2J9NA

Robotically harvested trypsin complexed with benzamidine containing polypeptide mediated crystal contacts
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Operator Assisted Harvesting of Protein Crystals Using a Universal Micromanipulation Robot.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords CATIONIC TRYPSIN
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2j9nA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2j9nA02
3LJOA 1LVYA 3ZZAA 1Z6EA 1T31A 1DICA 2QA9E 1F0UA 5CHAC 3SI3H 2FESH 1IAUA 1V2ST 4BTIB 1HUTH 1YPGH 2FEQH 4THNH 1HAVA 4RN6A 1SGPE 2W5EA 5EPNA 3VFEA 1MKXH 4I33A 2TIOA 2PKAA 2GZ9A 1MAYA 1P2IA 1TMUH 1ZZZA 1EXFA 3E0NB 1DWCH 1A1RA 2EEKA 1MQ6A 2W7SA 4AG1A 2WYJA 1LHDH 3S69A 1EOJA 1OWJA 3F68H 2FYQA 2FDAA 3SV9A 2A31A 2ODYB 1DOJA 2ZA5A 4AG2A 3QUMP 4X2YA 1O2XA 2AS9A 1G30B 1O2PA 1O3PB 2OC7A 1CU1A 4X6OA 1IQNA 4TYDA 2DE8A 3ZZ3A 1S5SA 1SGEE 4A1VA 2ZGXH 1O5AB 2BX3A 1L1NA 3VB4A 2BM2A 3GY4A 3KNXA 3SUGA 2H9HA 3RXEA 1EZXC 3F9FA 4JYUH 3M3VA 5DP3A 2ZU3A 1DDJA 3LGYA 4E06H 1VJ9U 4JZEH 1F7ZA 1AY6H 2SGDE 1UTLM 2WPHS 1GHXH 5F8ZA 2HALA 1C4Y2 1AWHB 2TGTA 4FUFA 3VB3A 1EZSC 4IMQA 4YT6H 1K1LA 1QA7A 3PLBA 3MO6A 1D9IA 1F0TA 4FUBA 5K7RA 3VPKA 1Y3VA 2R0LA 5J4QA 1SLVB 1WUNH 2VVVA 2BB4A 1C1QA 5H4IB 1WTGH 3O8DA 5C1YA 1MU8B 1MCVA 4DG4A 2ZPSA 2RA0A 2SGAA 4MNXA 1C5XB 1QL8A 1O2LA 1A4WH 4MPUA 3HGPA 3HK3B 1PQ8A 3B23B 3ZVGA 5FBEA 1O5DH 4AYVB 4JK5A 2AERH 3LJJA 3URCA 3GY3A 3W95A 3PB1E 3CS7A 2AFQB 1SQTA 1C2EA 1QJ6B 1AVWA 2ASUB 3E90B 1P3CA 1FI8A 4A92A 4SGAE 5EXMA 4SGBE 1GJ6A 3SBKA 3LPRA 1AO5A 2VIWA 4X8UH 1SG8B 3U1JB 1MUEB 3A84A 2ZKSA 2XBYA 3NXPA 3SU5A 1SGQE 3QZQA 3TK5A 1P04A 2H5DA 3UNQA 3G01A 5DJ7A 3MMGA 3SHCH 3VXEH 1UK3A 1NC6A 1MKWK 5T3HA 2G81E 4Y79A 1TIOA 4OS1A 3BTDE 2WV4A 1TMTH 2OUAA 1QL7A 4X1RU 2BD9A 1O2SA 2VH6A 4DW2U 1TPAE 1F92A 3MH4A 2Q6FA 1TYNA 1GWAA 2FOEA 1P10A 2J95A 1D3TB 5DK1A 2XWAA 1W8BH 1OSSA 2FIRH 1ZJDA 3UQOA 4AFUA 3T26A 1T8OA 3LGVA 1T4VH 1TNIA 2QV1A 4WY3A 1A3BH 5CMXH 7KMEH 3MTYA 1YPMH 1V2VT 2UWPA 1QQUA 1QCPA 4BTUB 1SLWB 3MH6A 4ZUHA 1CSOE 2SNVA 1C9TA 2F9PA 4KGAA 3ZVBA 4AN7A 4IGDA 2UWLA 1C2HA 2GT8A 1BBRH 1L0ZA 2F9VA 2G8TA 2YOLA 1VGCC 1GMHF 3PTNA 5EQSA 5LPRA 1MU6B 1UHBA 2D8WA 1EAUA 1Q2WA 2ZFRH 2FO9A 1DX5M 1GGDC 1ZGIA 5DP6A 1WQSA 1J17T 5GWZA 1L1GA 2ZU2A 2NU3E 3RXQA 4DY7B 4E7NA 2VIOA 2XBWA 4XBCA 1DANH 1MBMA 1W13U 3EE0B 1XUIA 3AAUA 1VITF 3K65B 1ELTA 1K2I1 2IOTA 4Y7BA 1ELVA 1DS2E 1QNJA 2GVFA 1ELGA 2AMQA 3DT0H 3GCTF 5BRRE 1YC0A 1FIZA 1CT2E 3SQHE 1SSXA 4F4OC 4IC5A 4XOJA 5EG4A 4FUHA 2FM2A 2BVSH 2AH4X 1A0HB 2BY6X 1O5EH 4MPXA 2G51A 2ZFFH 4BNRA 4TWWA 4BAOB 4XBDA 3M35A 2FI3E 4R0IA 1XUFA 1MTWA 1VZQH 1UJ1A 1H9HE 4HI3A 2XW9A 2BQ7B 4K8BA 3Q3KA 4CR5A 6ESTA 1W0YH 3U1IB 1W14U 2H5CA 3L3TA 1GMCF 1ZMJA 3ZZ8A 4H42U 3A82A 3UR6A 5F6MA 1X7AC 1J9CH 1HAGE 1C5LH 4CBNA 1XUKA 3UUZA 1N6XA 1O3IA 1SL3A 5GCHG 1DUAA 1U6QA 1SGIB 3LH3A 4TWYA 1Q31A 3K6ZA 2A4GA 3A89A 1P09A 1RXPA 3PO1B 2NU2E 3MFJA 1KSNA 1QB9A 1L4DA 2TBSA 2ILNA 3OX7U 4YLQH 2BLVA 5PTPA 2CHAB 3UWIA 4I8LA 1P01A 1QRXA 2Q6DA 1JRTA 2JETB 2BD7A 3SGBE 4AFSA 5FHTA 4GVUA 3GCNA 4D7FA 3RXCA 4NWLA 1EOLA 4HFPB 2BZAA 2P94A 1G3EA 1SGYE 2XCFA 5A8XA 1ANEA 3RXAA 2XC0A 1O2YA 5A0CA 5AVDA 3TNSA 4UFEH 1K9OE 1KYNA 1QBOA 3LU9B 4I8JA 4K3JA 5DG6A 1MZAA 1YBWA 1DSTA 3LGTA 5EW1H 1JMOH 1LCYA 2FTLE 3STIA 3A81A 1EP5A 1LQEA 3ZZ6A 2OTVA 1GI1A 2PSXA 1O3AA 2ZZUH 1P03A 5GIBA 1B5GH 2A32A 5L6NH 1ZSJA 2A1DB 3ATLA 3A8BA 1TA2A 4D9QA 2BD3A 4WF8A 3PM3A 3UNRA 2A4RA 3R0FA 1MBQA 4A1TA 3E1XB 4OS2A 2CMYA 1O2GH 1O34A 1SGNE 2Z9JA 1NRPH 5T6FA 2BOKA 2TRMA 2PFEA 1UTMA 1EASA 3FVFB 2B9LA 4RSPA 1DXWA 2OP9A 2CXVA 1ELFA 4LOYH 4X1QU 4E7RG 2JH5D 1ETTH 2G55A 3P8FA 1OXGA 1C1SA 5HGGA 7LPRA 1GBAA 4ZROA 1AE5A 2FOBA 1F2SE 1GBLA 1KXCA 5LGOA 1O3GA 1AVGH 3UR9A 1TBRH 1UVSH 1JWTA 1C1TA 1NY22 4LZ4B 3GISB 1DSUA 1WV7H 4WXIA 2PKSC 1RS0A 1BTPA 1BTYA 4Y6DA 5HYOA 2ZQ2A 3RXJA 1GHBG 3RXOA 1C2GA 2JH0D 2FLBH 1BQYA 5DP5A 5EU8A 1ELEE 3KQBA 1ANBA 1AMHA 3RXSA 2HWLB 1HAHH 3RMOH 4I8HA 1ELDE 1A2CH 3OY6U 3PWBA 1C2FA 2HNTF 1H1BA 1SVPA 3A7XA 4KELA 4X2XA 2R0KA 1ARCA 1HRTH 2QCYA 3V13A 1QTFA 4D7GA 1C5MD 2GV7A 3UIRA 1GBJA 1FY5A 1WAYB 1AFQC 5ETXA 3SZNA 4AORA 5LPFA 3K6YA 2ODQA 2ZGHA 3F9HA 1C2MA 7GCHG 1GI2A 3NCLA 1T8LA 1C5ZB 2GMTB 3ITIA 4ABDA 3RXLA 1TB6H 1IQHA 1H4WA 1YPEH 1AD8H 1JRSA 2J38A 1W11U 2A2XH 1EB1H 4CH2B 1EAXA 4KTCA 2BLOA 1BMMH 1E35B 3SHAH 1CA0C 2BLWA 1GJ9B 3A87A 2A0QB 3SW2B 3ENSB 1RIWB 4XDEA 4CRBA 5L2ZH 2ZFTA 1CGJE 4ABGA 1GHAF 1VCQA 1JOUB 1Y3WA 4UD9H 1V2UT 4GUXA 2F9NA 1JIMA 4XSKU 4JZFH 3C1KA 3N7OA 1HAVB 1PJPA 1V2MT 3PMBB 1FY8E 1B7XB 4AYYB 1GI8B 1DT2A 2PWXA 2F9BH 3SN8A 4AOQA 5DPAA 1C5UA 1EPTA 1BBRE 2V6NA 1V2RT 1ACBE 1H9IE 3DUXH 1GVKB 1TQ0B 4KKDA 1D6RA 1ZHMA 5BPEA 1N8OB 3HGNA 2RG3A 3U9AH 4BXWA 2GGVB 4ABAA 2LNCA 1P3EA 4FU7A 1C5TA 2WINI 2OINA 3R3GB 3SJ9A 3QZRA 3RXHA 2XRCA 1TNGA 1AQ7A 2Y7ZA 1YCPM 5EPYA 3LGWA 1L1JA 4GSOA 2Z9GA 3AVZA 1K1OA 4MDSA 2LPRA 3RXRA 2BD5A 3RXGA 1GMHG 3OSYA 4ZH8A 3I77A 1OWDA 5EXLA 2FTMA 4ZHMU 3RU4E 1W0ZU 1TALA 2XWBI 3ZVFA 3BTQE 5TJXA 5HMAA 1HCGA 1QRZA 4LK4A 1O2TA 1ZTJA 2Q1JA 2PKAB 3S7HB 1LO6A 1T7CA 4NSVA 1OWEA 2Z9LA 3SGAE 2A4OA 1C5NH 1O5BB 3M36A 1PPCE 5JBCS 2FI5E 1K28D 3NUMA 3QK1A 3D49H 2HVXA 3Q76A 2Y81A 1FZZA 2AEIH 4A1XA 1NO9H 2BDIA 1ZHPA 2F3CE 1O3NA 1GI4A 2OC8A 3SORA 5AFZH 2ANMH 2GTBA 1LHFH 3QGJA 1JIRA 1S0QA 3KQDA 3EDXB 2AYWA 1BA8B 2AGIX 2BVRH 1KXEA 2CHAC 3P95A 4O03A 1A46H 3LIWA 1GVLA 3TGJE 4FUEA 2G52A 1OP8A 3M5NA 1NESE 2CN0H 5JBTA 3GOVB 5E2OA 5AHGH 4ZKRU 1O3BA 2ZPQA 1BRCE 1O5FH 1EPTB 2G5NA 2GCTC 2D26C 2R9PA 1NFYA 3A8DA 1BB0B 3SJ8A 1HAZB 1MTVA 2GDDA 4IBLH 5EXNA 1AU8A 1UVTH 3RU4D 1UO6A 1DPOA 2HRVA 1LVOA 1O5GH 2ZGBH 4AX9H 3HK6B 3F9GA 4E05H 2R3YA 2VU8E 5C5OA 1MQ5A 1ZHRA 2VIDA 1BUIA 2FOFA 3VEQB 1RGQA 1Z8IB 2FX6A 1F0SA 3EYDA 1GBKA 1KIGH 2WPLS 4I7YH 3L33A 1WQVH 2GCHF 8GCHF 3IITA 2ZCHP 2ZDVH 5K0HA 1YLCA 1BCUH 1O3FA 3SJKA 3C27B 3TK6A 2J34A 1HAXB 1W10U 3M3SA 1SOZA 2QY0B 4DIHH 1BMNH 4NG9H 3U8OH 1O3MA 3NPSA 2ZDAH 1SGCA 3MYWA 5HM2A 1FPCH 2BDGA 1JBUH 2VWOA 1K1NA 1FIWA 4ZKOU 1CHOF 1XUHA 1G3BA 3GY5A 4X1NU 1NTPA 3KCGH 1UTKA 3T27A 2ZTXA 1LMWB 1FN8A 2ZGJA 1TA6A 3IWMA 2GMTC 1A0JA 4FU8A 2R2MB 2J94A 1Y8TA 2OQUA 3E16B 2HOBA 4OS7A 1Y5UT 2ALVA 2AMPA 2IJOB 3QGNB 4GLYA 1TGBA 1WBGB 5JDUB 3MOCA 1C5PA 2FOMB 4FU9A 4NWKA 1QB1A 2BLQA 3E3TA 1F5LA 1EP6A 1C5OH 2H9TH 2GD4B 2O8WA 3RXMA 3ZV9A 2QF0A 1B0EA 4NA9H 1O30A 4K1EA 1P12E 1S0RA 3RC6A 1LHEH 1ZRKA 3GY2A 1FY3A 1VJAU 5E2PA 2VIPA 3MU1A 4X6PA 2UWOA 1T4UH 4Q80A 4TPYA 1FY1A 3Q77A 4ZXXH 4AGJA 8KME2 4FVBA 1HAPH 1GI6A 1BHXF 1LPGB 1LVBA 3SQEE 4Z0KA 2DE9A 1C1MA 1HV7A 4OGXA 1TPOA 5GPIB 2XTTB 4IC6A 3SV2H 4ABBA 2Z3DA 3ELAH 4KP0A 2BDYA 3E8LA 4AGKA 1MKXK 4RKOB 4XFQA 1C5VA 3RXDA 1UCYK 2BY9X 3PV4A 3SV6A 1C1WH 2ANWA 4JZ1A 1FXYA 1TNLA 2ZU5A 4OS5A 4FUJA 1AB9C 3RU4T 5FCKA 2P16A 1IQJA 4NZQA 1NFUA 1EB2A 5FPTA 1VCPA 4GCHG 4O3TA 1TFXA 3T5FH 5B6OA 1FDPA 1O2JA 3MNXA 4B73A 3SUFA 1TPSA 2ZDNA 4UFGH 1V2QT 4ISIH 1O2MA 5IDKA 1NT1A 2ZIQH 3E6PH 3BTTE 3D62A 2VJ1A 1TWXB 3CP7A 1V2OT 7GCHF 3BIVH 1ZR0A 4CRDA 1O2IA 3S0NA 4IN1A 1HBTH 4NA7A 1ORFA 1UVPA 4Q2KA 1P2NA 4ASHA 2RA3A 3TJUA 1E36B 1WCZA 4A5TS 2Y5GA 2C3SA 2WV5A 1YCPH 1ZTLA 3D65E 1QRWA 2HGTH 3RXFA 1O37A 4MPWA 4O9VA 3U8TH 2BX4A 1XXDA 1A5HA 2A7JA 1DLKB 2FXRA 3RXUA 3O8RA 4U01A 3GCHC 2A2QH 4CRGA 2FX4A 4RKJB 1N6YA 1YPKH 4ISNA 3BTME 1HGTH 3HKIB 2V0BA 2EI8A 2JETC 2PTNA 3P17H 2Z3CA 3KQEA 3O8CA 1C9PA 1N1LA 4DCDA 2ZHEH 1TBZH 5A2MH 5I46H 2O9QA 5EQQA 4D76A 1D3DB 5A8ZA 2ZI2H 2ODPA 4MLFB 1CBWB 1P11E 2ZP0H 4ISLA 4ISOA 3E0PB 6GCHG 1KLTA 1O39A 1XXFA 2D2DA 4FUGA 2ZHWH 3A8CA 4MNYA 2SGFE 1KDQB 1GDQA 1AIXH 4NSYA 2P95A 4WVPE 2JKHA 1FLEE 2UUFB 2VVCA 1A3EH 2XC4A 1A0LA 2RDLA 3A7YA 2C8WB 4YOIA 1YPLH 8LPRA 1YM0A 1CA8B 1VITG 1AB9B 5FAHA 6GCHF 4ISHH 2ZWLH 1F5KU 4WJG2 1EATA 3M7TA 3VGCB 1PQ7A 1HIAB 2OQ5A 1AZ8A 2VNTA 1FJSA 1W7GH 4Y8XA 4B1TA 1CT0E 2TGPZ 4WMFA 1GJCB 3P8NA 3EQ0H 2QGRA 3O8BA 4UEHH 2Z3EA 4Y71A 5ESBA 5A09A 1XM1A 1TNKA 1NZQH 4IN2A 4JYVH 3EGKH 1NS3A 1PPFE 1AE8H 3PMJA 3TNTA 2FI4E 2SGQE 2V3HH 1E34B 1Z1JA 3PO1C 1YYY1 3SNBA 3MNBA 3BG4B 3BF6H 2D1JA 1ESBA 1E38B 1BMLA 1TGCA 3SU6A 2G4UA 1O3LA 1C5RA 3SNDA 2O8UA 2ZQ1A 4M7GA 1C1NA 1G2LA 3QX5H 3BTEE 2P59A 1GBEA 1TOMH 1C5SA 1UTPA 1O3KA 5TCCA 5C1XA 2STAE 2HNTE 1FAXA 1C1VH 1LPZB 3FP7E 1BTXA 2RCEA 1EX3A 1F0RA 1Y59T 2A45B 1MMJN 1AHTH 2A5IA 3U8RH 4J2YB 1NRNH 3FZZA 4ABHA 3PMHB 1TRMA 4MQAA 3T29A 4BAHB 1DLEA 3A7ZA 1S81A 1ABIH 2P3TB 5GXPA 1AWFH 4MNVA 1A5GH 3BEIB 1E37B 3KF2A 4WMDA 3T62A 1P2OA 3BN9A 2NU0E 3M7QA 4GHQA 4ZKNU 4WH8A 1ZLRA 1UK2A 5JBAS 1UVOA 2H6MA 3OU0A 3SO3A 3SU0A 1P2MA 1YPHC 3RXPA 3GY8A 1MD8A 1O2ZA 2QXHA 3P6ZB 1TX8A 4B2AA 2I6QA 3FZDA 3I78A 2J9NA 3RUOA 3ZV8A 1V6DA 2GDEH 3TLOA 3KN2A 1SMFE 2CGAA 2F91A 3P8OA 3KHVA 1IQIA 3V0XA 1DXPA 2ZCKP 4X6NA 1HXEH 3QN7A 3RXBA 1DUEA 2BYAX 3HKJB 4NIYA 1PPHE 4UE7H 1G9IE 3SUEA 3QLPH 4ABIA 2GP9B 1RIWC 2ZC9H 4U30A 1GJ5H 1H9LB 3VGCC 4ESTE 1EAIA 3UTUH 3SU2A 1B0FA 1GJ8B 2Z7FE 1K21H 1LDTT 1F5RA 1BRAA 3ATMA 4NIWA 4YT7H 4B2CA 4YZUA 4B2BA 2O8MA 6CHAB 1VCWA 2ZDKA 1ABJH 1LHGH 3QDZB 4UFFH 1DY9A 3PLPA 2C8XB 4YOGA 1GMCG 1V2NT 1O5CB 2Y5HA 1CVWH 5JBBS 3UQVA 1NRSH 1MTNB 1GBFA 1OS8A 4B74A 1SOTA 1S6FA 4U32A 3GDUA 1K1MA 5C3NA 3RXKA 3LDXH 2BD4A 4OGYA 1RFNA 1THRH 1CBWC 3SV7A 2ZFQH 1IQKA 5EGMA 4B76A 4MTBA 3PROA 4TPIZ 1Y3XA 2GT7A 1LKAA 1YLDA 1K1JA 3HPTB 1TNJA 1Z71A 2FYRA 1SFIA 3RXTA 4YO9A 1IHSH 4JYTA 4X2WA 1TONA 2TGAA 1WTHD 1P2QA 1HYLA 1VGCB 1W3CA 2ZNKH 1ETRH 1AFEH 1G3DA 2O8TA 4CH8B 5HXFA 1Z8RA 1C4U2 3T2NA 1LTOA 3MU8A 2TPIZ 1G2MA 1OP2A 4AFZA 1AKSB 4K69A 4GHTA 1DWBH 4XE4A 1S83A 1IQGA 2J92A 4FVDA 1KXDA 4DOQA 2NU4E 1GJAB 3PLKA 4K8YA 3F9EA 2P93A 4NFEA 1FAKH 1S84A 2HPQH 1IQFA 3ATKA 5C20A 1GJ4H 2QIQA 4NA8A 1DFPA 5DP9A 1VR1H 1ELBA 3H5CB 2FODA 1T8NA 1EAWA 1HAIH 3STJA 3UOPA 4NZLA 2XCNA 1W7XH 1C2DA 3BTHE 4Q7XA 1FQ3A 3VB6A 1HXFH 3TIUA 2UUJB 2WPKS 2Z9KA 4H6TA 3F6UH 2W3KA 1D6WA 1QQ4A 1YF4A 4BAQB 3M37A 3A7WA 1NM6A 4Z6AH 1ZMLA 3TJNA 1ZSKA 1CA0B 2FP7B 4FXGH 2QC2A 2WYGA 2BD8A 1WSSH 3V7TA 1SB1H 4Y11E 1AN1E 1EJNA 3VB5A 5JPMH 2ZTZA 2PLXA 1UCYE 2H9EH 1O3DA 4ZAEA 1BTUA 6CHAC 1EZUC 3QO6A 2XC5A 1AGJA 2Y7XA 3CS0A 4I32A 1SQOA 3B9FH 2SGPE 1S85A 1MCTA 3MH7A 1LHCH 3MU4A 2Q6GA 2V3OH 2C90B 1NROH 1O3OA 3MNCA 3DFLA 2P8OB 3BEUA 1O2NA 2Z94A 1XKBC 4HGCA 5GJ4B 2QXJA 3SI4H 3GY6A 1PFXC 1TQ7B 3HATH 2GZ7A 2VINA 4B71A 4J1YA 2ZECA 3KL6A 4FUIA 3TITA 2H2ZA 2BY8X 1GI5A 5JB8S 1UMAH 3IG6B 5DGJA 3GCTG 3EA8A 1SC8U 1ZMNA 2FLRH 2VB0A 1AI8H 3SNCA 3AAVA 2AMDA 1TABE 3TH3H 2BDAA 2BTCE 1YKTA 1O3EA 3QWCH 1GBMA 3ZZDA 2EA3A 2VGCB 1RTFB 1YPJH 5E8EH 4Y10E 5FCRA 2BMGB 1HJAC 1QA0A 1SGRE 1K1PA 1J15A 3ZVCA 2C8ZB 1GHAG 2B8OH 3UNSA 4MNWA 2ESTE 1TMBH 4ZKSU 4Y8YA 4ZMAH 3U69H 1A61H 2EC9H 3V12A 1PPZA 3LH1A 2OBQA 1XVMA 4ZHLU 1SBWA 4LZ1H 4HZHA 5A8YA 1BJVA 2B7DH 1QJ1B 1A7SA 2QXIA 1EJMA 2XXLA 1C2LA 1N8OC 1RTLA 3URDA 3AASA 1EKBB 3VXFH 1Y3UA 1HPGA 1ESTA 4CR9A 1TNHA 3DD2H 2PTCE 1FONA 1AUTC 1O2HA 1OX1A 2GKVE 3RDZA 3Q3YA 3A86A 1HIAA 2OC0A 3GYMA 4DVAU 2W26A 2YNBA 2R2WU 2IPHA 2AIQA 3M5MA 1V2WT 1JXPA 4CHAB 2CJIA 4ABFA 3BTKE 3FFGA 1GVZA 2XYAA 1ZGVA 1C4V2 2BXTH 2FMJA 1YCPK 3A83A 4UFDH 2NU1E 4LXBH 3BTWE 2ANYA 2QN5T 1ANDA 1GI7B 1TPPA 2C8YB 1BTZA 4KTUA 4X0WU 5E0GA 5HM9A 1FPHH 2VIVA 3OY5U 1TAWA 1GCTB 1V2TT 2GV6A 3JZ2B 1HNEE 1ZPZA 2A7CA 4JZDH 2OBOA 1BRBE 3SU4A 4CRFA 4O3UA 3ZZCA 1KTSB 3BG4C 2ZDLA 5G4BA 4R8TB 1GPZA 1BRUP 1GG6B 3ATWA 1MKWH 4K1SA 4YTAA 4INKA 3PWCA 5DP8A 4X8VH 3OYPA 2ZEBA 1GCTC 2BQ6B 2O8LA 1PQ5A 1P2JA 9LPRA 4NIXA 3BIUH 3CENA 5C5NA 3BV9B 5I25A 3S9CA 4DGJA 1PYTC 1QY6A 3SU3A 1G37A 2STBE 1O2WA 1GCDA 1UHBB 1BITA 2P8OC 3RXIA 2GCTB 1O35A 4FUCA 4X1PU 1O3CA 3ESTA 2J2UA 1QIXB 3LOXA 1DE7H 2WUBA 3VB7A 3ZYDA 2FS8A 3P70B 3V3MA 4AB8A 1SPJA 2EI6A 3MU5A 1KDQA 1PPGE 1KXFA 2ZU4A 2EI7A 3BTGE 1KTTB 2PGBB 1S6HA 4MVNA 1IQLA 1P57B 1Y3YA 1TOCB 1XMNB 2W7UA 1Z8GA 4X8TH 3DHKH 5EQRA 2WPJS 2G5VA 2BHGA 2F9UA 1O2KA 4A7IB 3ODFA 3Q00A 4CREA 4X8SH 1PYTD 1TLDA 3UFAA 1MD7A 2BDCA 1AFQB 1SI5H 3GCHB 4OS6A 2ZPRA 2GCHG 8GCHG 1L2EA 1SGTA 3MH5A 1GHZA 5AFYH 2SNWA 5ABWA 4CBOA 1QHRB 5LPEA 4Y0ZE 1GBBA 4YM9A 4OS4A 3QTOH 3RP2A 3ZVEA 3QTVH 1OWKA 5DKMA 1SGFA 2SGEE 2G4TA 1C2KA 1AVXA 1BMAA 3EAJA 4NCYA 4XBBA 1BOQA 3K9XB 3P8GA 2XBXA 3A80A 1TBQH 2K1QA 1EQ9A 1SLUB 4QT8C 3S9BA 4U2WA 3D23A 3GICB 2HNTC 1UCYH 3TVJB 1KXBA 1GI9B 1H8DH 5FX6A 1NFWA 3UOUA 1FN6A 2BZ6H 3H7OA 3RMNH 2CF8H 1GI3A 1GBIA 1C5YB 3KQCA 3M3TA 2G00A 1NRRH 1O2OA 4CRAA 1PPEE 4FUDA 1CGHA 3GCOA 4NFFA 1BDAA 1OP0A 2SFAA 5GDSH 3BEFB 1CO7E 3SV8A 2Y82A 1UTJA 5FBIA 1QJ7B 4BAKB 1EJAA 1OWIA 3RM0H 1M9UA 2GX4A 1ZYOA 3BSQA 2XBVA 1GI0A 1QBNA 1GL1A 4NGAH 3LGIA 3MWIU 1RD3B 1GHVH 2Y5FA 2VWLA 2NWNA 3NZIA 2BY7X 2PGQB 3JZ1B 3ZVAA 1KXAA 1V2PT 1P05A 1YPHE 3M61U 1A5IA 2C93B 1GBDA 2BD2A 1O32A 3E91A 1QL9A 1KY9A 1O0DH 1TX7A 4K2YA 1GGDB 3DFJA 2BVXH 2VGCC 3KIDU 2ZG0H 3FAOA 4YESB 5F8TA 5FPSA 3A88A 5E0HA 4WWYA 3NKKA 4HTCH 1NN6A 4DURA 1LQDB 3FP8E 5C1UA 1KLIH 4CRCA 1QB6A 1GJ7B 3WY8A 1NRQH 1D4PB 5T6DA 1GHBF 2Y80A 1GHYH 3LKWA 2FPZA 3PMAB 5A0BA 4A6LA 4K5ZA 2BY5X 1C5WB 1QR3E 1THSH 3Q3XA 5L2YH 1P06A 3RMLH 5SGAE 1P9UA 3LGUA 2I6SA 2OXSA 4PROA 2Y6TA 2XNIA 2ZHQH 1ID5H 1OKXA 5DP4A 2FS9A 3H7TA 1QGFA 4UONA 3RM2H 1V2JT 2AGEX 4K60A 5EW2H 1P2KA 3SGQE 1OPHB 2OC1A 3I29A 3RC5A 4I31A 3W94A 2CF9H 1C1UH 4F49A 4UDWH 4GPGA 2PR3A 3SNAA 4BTTB 1UTOA 2H1UA 3UY9A 2PW8H 1CHGA 4H4FA 4WXVA 5LH8A 1THPB 2HLCA 2FOCA 2W3IA 1Q3XA 2Z9IA 3AW1A 4MPVA 5L30H 3RC4A 2OCVB 1DVAH 2QYIA 4NIVA 1INCA 1RTKA 2F83A 1GL0E 1SQAA 3S7KB 3SJIA 1C2IA 4TY6A 3KEEA 1GJBB 1P0SH 1CE5A 1Z7KA 2OLGA 4JZIA 5T6GA 2VH0A 5EODA 3BTFE 1TGNA 2ANKH 1NPMA 3LONA 3FP6E 2FOAA 3GY7A 3UPEA 3P92A 3MI4A 4INHA 1HAYB 1SFQB 1V3XA 5TCAA 1UVUH 2B0FA 2BDHA 1XUGA 2KAIB 1ELCA 1K22H 1G3CA 5CE1A 1RRKA 3K2UA 1FUJA 1TE0A 1KLJH 4JMYA 1BTWA 1ARBA 4B75A 2VWMA 1O3HA 1P8VC 2PV9B 2VIQA 3SUDA 1TRNA 1O33A 2DUCA 4K1TA 5JB9S 1AZZA 2A5KA 4GCHF 2WUCA 1OYQA 5DP7A 3ZYEA 2A4QA 3RLWH 1GDNA 1AKSA 1IQEA 1ZSLA 5AF9H 2HPPH 3GDSA 1CQQA 2FWWA 1BTHH 3LT3A 4Q7ZA 1S82A 1O31A 5F8XA 1O3JA 3SJOA 2UUYA 1ZOMA 1QURH 2A7HA 2AIPA 1HFDA 1ETSH 1OOKB 1GMDG 1C1RA 4D9RA 2PKSB 1SGFG 2VWNA 4YLUA 3ZZ4A 3KGPA 1DM4B 4Y8ZA 4ABJA 3NK8A 1XVOA 2FOHA 1DWDH 1SLXB 3EA7A 1E0FD 1BIOA 1VITH 1CT4E 3EA9A 1T8MA 3T28A 3GDVA 5C67A 1Y5AT 1TRYA 1D3PB 4AB9A 3ZZ5A 1T32A 3B8JA 4I8KA 3TH2H 6LPRA 2TGDA 3M7UA 1HJ9A 1WYKA 3AW0A 2BQWB 1YP9A 1Y5BT 1UTNA 3M5LA 1NU9A 1WU1A 2ZGCA 3PYHA 1HJ8A 2BDBA 1J14A 1DITH 3MU0A 4VGCC 1BJUA 1HDTH 3S9AA 1EPTC 2ZFSA 3SNEA 1IQMA 2YNAA 4INLA 1C2JA 1TX6A 2QAAA 1O36A 2WPIS 3UREA 5JYIA 1RJXB 1Z6JH 4AZ2B 3ODDA 1TGSZ 1QBVH 3ZZ7A 1XX9A 1MTNC 1ZPCA 2THFB 1IOEA 5GCHF 2A5AA 4JCNA 2ZDMA 3DA9B 4X2VA 3TJVA 1ZRBA 1V2KT 1GG6C 1MAXA 1EZQA 3A85A 3LC5A 2PUXB 1J16A 1P02A 1O2UA 2QF3A 3F1SB 4ZXYH 2P3FH 4IW4E 3TJOA 2JH6D 1GBHA 1LVMA 1MTUA 1J8AA 2Z6BD 1BHXB 2ZF0H 1P9SA 1MH0A 2B5TB 1L4ZA 3U98H 1UK4A 1UTQA 4D8NA 1DY8A 1FY4A 3MO9A 2FOGA 1O38A 1GBCA 1C1OA 4X6MA 1QFKH 1GMDF 1XUJA 1ZJKA 3TH4H 1O2QA 4I8GA 3LC3A 4Q7YA 3A7TA 4AFQA 2ZU1A 2V35A 4X1SU 3ZVDA 3TGIE 3M5OA 1NU7B 3RLYH 5F03A 3SOSA 1ANCA 1BBRK 1MTSA 4DIIH 3GYLB 4ZHAA 1LKBA 2R3UA 5A0AE 1D3QB 1EUFA 2BXUH 1K1IA 2CV3A 4Y76A 1MZDA 3UWJH 3ZZBA 2QXGA 1IHTH 1AUJA 1NFXA 1V2LT 2P3UB 4IMZA 2J4IA 2ZFPH 5IYTA 1HAOH 4O97A 4ABEA 3SU1A 7ESTE 4H6SB 2VVUA 1GBTA 1BT7A 3T25A 5ESTE 5FXLA 3PTBA 2PHBA 1WOFA 1O2RA 2ZCLP 2WPMS 4KTSA 1YGCH 3TU7H 1SHHB 1OWHA 1OYTH 5CHAB 1HB0B 4BOHA 1ESAA 1H8IH 4JK6A 1ELAA 3FANA 1SGDE 3TK9A 1GJDB 1LPKB 3RMMH 1FMGA 3MHWU 2PUQH 1GHWH 4BAMB 4GAWA 2GZ8A 1G36A 2UUKB 2KAIA 2F9OA 3ZZ9A 4VGCB 3MNSA 9ESTA 2ALPA 3ATIA 2ZO3H 5E0JA 2ZTYA 1PQAA 4YOJA 4TY7A 1O2VA 1CHOG 1Z8JB 2BOHB 8ESTE 1FNIA 2FZZA 2IN2A 5DO4H 1HJAB 1C5QA 1SHYA 4IS5A 5FPYA 4DT7B 5C2ZA 4DJZB 1C1PA 1G32B 2C4FH 3RXVA 4WH6A 5EOKA 5FX5A 1Z1IA 3NWUA 1SR5C 1ZPBA 1ZTKA 3BG8A 1W2KH 2ZHFH 1PPBH 4MG3A 1TGTA 1W12U 3L6PA 1BZXE 3OTJE 3MO3A 2OD3B 4Y0YE 1DWEH 1GDUA 2PSYA 2M5TA 3TGKE 2ZHDA 4Y7AA 2ULLA 1CGIE 4WMEA 5J4SA 3TPIZ 4BANB 3A7VA 1HLTH 4BXSA 2AGGX 4CHAC 3A8AA 1XKAC 1FV9A
chains in the Genus database with same CATH superfamily
3LJOA 1LVYA 3ZZAA 3OFND 1Z6EA 1T31A 1DICA 2QA9E 1F0UA 5CHAC 3SI3H 2FESH 1IAUA 1V2ST 4BTIB 1HUTH 1YPGH 2WV9A 2FEQH 4THNH 1HAVA 4RN6A 1SGPE 2W5EA 5EPNA 3VFEA 1MKXH 4I33A 2TIOA 2PKAA 2GZ9A 1VKYA 4M9FA 1MAYA 1P2IA 1TMUH 1ZZZA 1EXFA 1WDIA 3E0NB 1DWCH 1A1RA 2EEKA 1MQ6A 2W7SA 4AG1A 2WYJA 1LHDH 3WWFA 2WZQA 3S69A 1EOJA 1OWJA 2JJ1D 2FYQA 3F68H 2FDAA 3SV9A 2A31A 2ODYB 1DOJA 2ZA5A 4AG2A 3QUMP 4X2YA 1O2XA 2AS9A 1G30B 1O2PA 1O3PB 2OC7A 1CU1A 3FN8A 4X6OA 1IQNA 4TYDA 2DE8A 3ZZ3A 1S5SA 1SGEE 4A1VA 2ZGXH 1O5AB 1MABB 2BX3A 1L1NA 3VB4A 2BM2A 3GY4A 3KNXA 2QF4A 3SUGA 2H9HA 3RXEA 1EZXC 3F9FA 4JYUH 3M3VA 2CK3D 5DP3A 2ZU3A 1WXRA 1DDJA 3LGYA 4E06H 1VJ9U 4JZEH 1F7ZA 1AY6H 2SGDE 1UTLM 4YXWD 2WPHS 1GHXH 5F8ZA 3DSOA 2HALA 1C4Y2 1AWHB 2TGTA 4FUFA 3VB3A 1EZSC 4IMQA 4YT6H 1K1LA 1QA7A 1YLNA 3PLBA 3MO6A 1D9IA 1F0TA 4FUBA 5K7RA 3VPKA 1Y3VA 2R0LA 5J4QA 1SLVB 1WUNH 2VVVA 2BB4A 1C1QA 5H4IB 1WTGH 3O8DA 5C1YA 1MU8B 1MCVA 4DG4A 2KCAA 2ZPSA 2RA0A 2SGAA 4MNXA 1C5XB 1QL8A 1O2LA 1A4WH 3UAIC 4MPUA 3HGPA 3HK3B 1PQ8A 3B23B 3ZVGA 5FBEA 1O5DH 4AYVB 4JK5A 2AERH 3LJJA 3URCA 3GY3A 3W95A 3PB1E 3CS7A 2AFQB 1SQTA 1C2EA 2J5UA 1QJ6B 1AVWA 2ASUB 3E90B 1P3CA 1FI8A 4A92A 4SGAE 5EXMA 4SGBE 1GJ6A 3SBKA 3LPRA 1AO5A 2VIWA 4X8UH 1YY3A 1SG8B 3U1JB 1MUEB 2V3MA 3A84A 2ZKSA 2XBYA 3OE7D 3NXPA 3SU5A 1SGQE 3QZQA 3TK5A 1P04A 2H5DA 3UNQA 3G01A 5DJ7A 3MMGA 3SHCH 4TT3D 1UK3A 3VXEH 1NC6A 1MKWK 5T3HA 2G81E 4Y79A 2PP6A 1TIOA 4OS1A 3BTDE 2WV4A 1TMTH 2OUAA 1QL7A 4X1RU 2BD9A 1O2SA 2VH6A 4DW2U 1TPAE 1F92A 3MH4A 2Q6FA 1TYNA 1GWAA 2FOEA 1P10A 2J95A 1D3TB 5DK1A 2XWAA 3OEHD 1W8BH 1OSSA 2FIRH 1ZJDA 3UQOA 4AFUA 3T26A 1T8OA 3LGVA 1T4VH 1TNIA 2QV1A 4WY3A 1A3BH 5CMXH 7KMEH 3MTYA 1YPMH 1V2VT 2UWPA 1QQUA 1QCPA 4BTUB 1SLWB 3MH6A 4ZUHA 1CSOE 2SNVA 1C9TA 2F9PA 4KGAA 3ZVBA 4AN7A 4IGDA 2UWLA 1C2HA 2GT8A 1BBRH 1L0ZA 2F9VA 2G8TA 2YOLA 1VGCC 1GMHF 3PTNA 5EQSA 5LPRA 1MU6B 1UHBA 5EIYA 2D8WA 1EAUA 1Q2WA 2AHME 2ZFRH 2FO9A 1DX5M 1GGDC 1ZGIA 5DP6A 1WQSA 1J17T 5GWZA 1L1GA 3F2HA 2ZU2A 2NU3E 3RXQA 4DY7B 4E7NA 2VIOA 2XBWA 4XBCA 1DANH 1MBMA 1W13U 3EE0B 1XUIA 3AAUA 1VITF 3K65B 1ELTA 1K2I1 2IOTA 4Y7BA 1ELVA 1DS2E 1QNJA 2GVFA 1ELGA 2AMQA 3DT0H 3GCTF 5BRRE 1YC0A 1FIZA 1CT2E 3SQHE 1SSXA 4F4OC 4IC5A 4XOJA 5EG4A 4FUHA 2FM2A 2BVSH 2AH4X 1A0HB 2BY6X 1O5EH 4MPXA 2G51A 2ZFFH 4BNRA 4TWWA 4BAOB 4XBDA 2J98B 3M35A 2FI3E 4R0IA 1XUFA 1MTWA 1H8ED 1VZQH 1UJ1A 1H9HE 4HI3A 2XW9A 2BQ7B 4K8BA 3Q3KA 4CR5A 6ESTA 2KZ4A 5B6LA 1W0YH 3U1IB 1W14U 2H5CA 3L3TA 1GMCF 1ZMJA 3ZZ8A 1SQRA 4H42U 3A82A 3UR6A 5F6MA 1X7AC 1J9CH 1HAGE 4ACAA 1C5LH 4CBNA 1XUKA 3UUZA 1N6XA 1O3IA 1SL3A 5GCHG 1DUAA 1U6QA 1SGIB 3LH3A 4TWYA 1Q31A 3K6ZA 2A4GA 3A89A 1P09A 1RXPA 3PO1B 2NU2E 3MFJA 1KSNA 1QB9A 1L4DA 2TBSA 2ILNA 3OX7U 4YLQH 2BLVA 5PTPA 2CHAB 3UWIA 4I8LA 1P01A 1QRXA 2Q6DA 1JRTA 2JETB 2BD7A 3SGBE 4AFSA 5FHTA 4GVUA 3GCNA 4D7FA 3RXCA 4NWLA 4TSFD 1EOLA 4HFPB 2BZAA 2P94A 3FO8D 1G3EA 1SGYE 2XCFA 5A8XA 1ANEA 3RXAA 2XC0A 1O2YA 5A0CA 5AVDA 3TNSA 4UFEH 1K9OE 1KYNA 1QBOA 3LU9B 4I8JA 4K3JA 5DG6A 1MZAA 1YBWA 1DSTA 3LGTA 5EJ1A 5EW1H 1JMOH 1LCYA 2FTLE 3STIA 3A81A 1EP5A 1LQEA 3ZZ6A 2OTVA 1GI1A 2PSXA 1O3AA 2ZZUH 1P03A 1S6LA 2WPDD 5GIBA 1B5GH 2A32A 5L6NH 1ZSJA 2A1DB 3ATLA 3A8BA 1TA2A 4D9QA 2BD3A 4WF8A 3PM3A 3UNRA 2A4RA 3R0FA 1MBQA 4A1TA 4Z1MD 3E1XB 4OS2A 2CMYA 1O2GH 1O34A 1SGNE 2Z9JA 4B6FA 5C94A 1NRPH 5T6FA 2BOKA 2TRMA 2PFEA 1UTMA 1EASA 3FVFB 2B9LA 4RSPA 1DXWA 2OP9A 2CXVA 1ELFA 4LOYH 4X1QU 4E7RG 2JH5D 1ETTH 2G55A 3P8FA 1OXGA 1C1SA 5HGGA 7LPRA 1GBAA 4ZROA 1AE5A 2FOBA 1F2SE 1GBLA 1KXCA 5LGOA 1O3GA 1AVGH 5KGOA 3UR9A 1TBRH 1UVSH 1JWTA 1C1TA 1NY22 4LZ4B 3GISB 1DSUA 1WV7H 1E1QD 2F4LA 2JIZD 4WXIA 2WSSD 2PKSC 1RS0A 1BTPA 1BTYA 4Y6DA 5HYOA 2ZQ2A 3RXJA 1GHBG 3RXOA 1C2GA 2JH0D 2FLBH 1BQYA 5DP5A 5EU8A 1ELEE 3KQBA 1ANBA 1AMHA 3RXSA 2HWLB 1HAHH 3RMOH 4I8HA 1ELDE 1A2CH 3OY6U 3PWBA 4Q4LA 1C2FA 2HNTF 1H1BA 1SVPA 3A7XA 4KELA 4X2XA 2R0KA 1ARCA 1HRTH 4Q63A 2QCYA 3V13A 1QTFA 4D7GA 1C5MD 2GV7A 3UIRA 1GBJA 1FY5A 2L6OA 1WAYB 1AFQC 5ETXA 3SZNA 4AORA 5LPFA 3K6YA 2ODQA 2ZGHA 3F9HA 1C2MA 7GCHG 5HKKD 5DN6D 1GI2A 3NCLA 1T8LA 1C5ZB 2GMTB 3ITIA 4ABDA 3RXLA 1TB6H 1IQHA 1H4WA 1YPEH 1W0JD 1AD8H 1JRSA 2J38A 1W11U 2A2XH 1EB1H 4CH2B 1EAXA 4KTCA 2BLOA 1BMMH 1E35B 3SHAH 2XOKD 1CA0C 2BLWA 1GJ9B 3A87A 2A0QB 3SW2B 3ENSB 1RIWB 4XDEA 4CRBA 5L2ZH 2ZFTA 1CGJE 4ABGA 1GHAF 1VCQA 1JOUB 1Y3WA 4UD9H 1V2UT 1E79D 4GUXA 2F9NA 1JIMA 4XSKU 4JZFH 3C1KA 3N7OA 1HAVB 1PJPA 1V2MT 3PMBB 1FY8E 1COWD 1B7XB 4AYYB 1GI8B 1DT2A 2PWXA 2KCYA 2F9BH 3SN8A 2K8IA 4AOQA 5DPAA 1C5UA 1EPTA 1BBRE 2V6NA 1V2RT 4RT0A 1ACBE 1H9IE 3DUXH 1GVKB 1TQ0B 4KKDA 1D6RA 1ZHMA 5BPEA 1N8OB 3HGNA 2RG3A 3U9AH 1NBME 4BXWA 2GGVB 4ABAA 2LNCA 1P3EA 4FU7A 1C5TA 2WINI 2OINA 3R3GB 3SJ9A 1H8HD 3QZRA 3RXHA 2XRCA 1TNGA 2EY4C 1AQ7A 2Y7ZA 4B6EA 1YCPM 5EPYA 3LGWA 1L1JA 4GSOA 2Z9GA 3AVZA 1K1OA 4MDSA 2LPRA 3RXRA 2BD5A 3RXGA 1GMHG 3OSYA 4ZH8A 3I77A 1OWDA 5EXLA 2FTMA 4ZHMU 3RU4E 1W0ZU 1TALA 2XWBI 3ZVFA 3BTQE 5TJXA 5HMAA 1HCGA 1QRZA 4LK4A 1O2TA 1ZTJA 2LP6A 2Q1JA 2PKAB 3S7HB 1LO6A 1T7CA 4NSVA 1OWEA 2Z9LA 3SGAE 2A4OA 1C5NH 1O5BB 3M36A 1PPCE 5JBCS 2FI5E 1K28D 3NUMA 3QK1A 3D49H 2HVXA 3Q76A 4HG6A 2Y81A 1FZZA 2AEIH 4A1XA 1NO9H 2BDIA 1ZHPA 2F3CE 1O3NA 1GI4A 2OC8A 3SORA 5AFZH 2ANMH 2GTBA 1LHFH 3QGJA 1JIRA 1S0QA 3KQDA 3EDXB 5FL7D 2AYWA 1BA8B 2AGIX 2BVRH 2KM0A 1KXEA 2CHAC 3P95A 4O03A 1EFRD 1A46H 3LIWA 1GVLA 3TGJE 4FUEA 2G52A 1OP8A 3M5NA 1NESE 2CN0H 5JBTA 3GOVB 5E2OA 5AHGH 4ZKRU 1O3BA 2ZPQA 5HIZA 1BRCE 4I86A 1O5FH 1EPTB 2G5NA 3SYJA 2GCTC 2D26C 2R9PA 1NFYA 3A8DA 1BB0B 3SJ8A 1HAZB 1MTVA 2GDDA 4IBLH 5EXNA 4P02A 1AU8A 1UVTH 3RU4D 1UO6A 1DPOA 2HRVA 1LVOA 1O5GH 2KCOA 2ZGBH 4AX9H 3HK6B 3F9GA 4E05H 2R3YA 2VU8E 5C5OA 1MQ5A 1ZHRA 2VIDA 1BUIA 2FOFA 3VEQB 1RGQA 1Z8IB 2FX6A 1F0SA 3EYDA 1GBKA 1KIGH 2WPLS 4I7YH 3L33A 1WQVH 2GCHF 8GCHF 3IITA 4FOUC 2ZCHP 2ZDVH 5CHBA 5K0HA 1K0HA 1YLCA 4F48B 1BCUH 1O3FA 3SJKA 3C27B 3TK6A 2IJD1 1HAXB 2J34A 1W10U 3M3SA 1SOZA 2QY0B 4DIHH 1BMNH 4NG9H 3U8OH 1O3MA 3NPSA 1UW7A 4AC9A 2ZDAH 1SGCA 3MYWA 5HM2A 1FPCH 2BDGA 1JBUH 2VWOA 1K1NA 1FIWA 4ZKOU 1CHOF 1XUHA 1G3BA 3GY5A 4X1NU 1NTPA 3KCGH 1UTKA 3T27A 2ZTXA 1LMWB 1FN8A 2ZGJA 1TA6A 3IWMA 2GMTC 1A0JA 4FU8A 2R2MB 2J94A 1Y8TA 1YWUA 2OQUA 3E16B 2HOBA 4OS7A 1Y5UT 2ALVA 2AMPA 2IJOB 3QGNB 4GLYA 1TGBA 1WBGB 5JDUB 3MOCA 1C5PA 2FOMB 4FU9A 4NWKA 1QB1A 2BLQA 3E3TA 1F5LA 1EP6A 1C5OH 3DSPA 2H9TH 2GD4B 2O8WA 3RXMA 3ZV9A 2QF0A 5F53A 1B0EA 4NA9H 1O30A 4K1EA 1P12E 1S0RA 3RC6A 1LHEH 1ZRKA 3GY2A 1FY3A 1VJAU 5E2PA 2VIPA 3MU1A 4X6PA 5KEDA 2UWOA 1T4UH 4Q80A 4TPYA 1FY1A 3Q77A 4ZXXH 4AGJA 8KME2 4FVBA 1HAPH 1GI6A 1BHXF 2YMSB 1LPGB 1LVBA 3SQEE 4Z0KA 2DE9A 1C1MA 1HV7A 4OGXA 1TPOA 4XD7D 2XTTB 4IC6A 5GPIB 3SV2H 4ABBA 2F43B 2Z3DA 3ELAH 4KP0A 2BDYA 3E8LA 4AGKA 1MKXK 4RKOB 4XFQA 1C5VA 3RXDA 1UCYK 2BY9X 3PV4A 3SV6A 1C1WH 2ANWA 4JZ1A 1SKYE 1FXYA 1TNLA 2ZU5A 4OS5A 4FUJA 1AB9C 3RU4T 5FCKA 2P16A 1IQJA 4NZQA 1NFUA 1EB2A 5FPTA 1VCPA 2WHXA 4GCHG 4O3TA 1TFXA 3T5FH 5B6OA 1FDPA 1O2JA 3MNXA 4B73A 3SUFA 1TPSA 2ZDNA 4UFGH 1V2QT 4ISIH 1O2MA 5IDKA 1QZ8A 1NT1A 2ZIQH 3E6PH 3BTTE 3D62A 2VJ1A 1TWXB 3CP7A 1V2OT 7GCHF 3BIVH 1ZR0A 4CRDA 1O2IA 3S0NA 4IN1A 1HBTH 4NA7A 1ORFA 1UVPA 4Q2KA 1P2NA 4ASHA 2RA3A 3TJUA 1E36B 1WCZA 4A5TS 2Y5GA 2C3SA 2WV5A 1YCPH 1ZTLA 3D65E 1QRWA 2HGTH 3RXFA 1O37A 4MPWA 4O9VA 3U8TH 2BX4A 1XXDA 1A5HA 2A7JA 1DLKB 2FXRA 3RXUA 3O8RA 4U01A 3GCHC 2A2QH 4CRGA 2FX4A 4RKJB 1N6YA 1YPKH 4ISNA 3BTME 1HGTH 3HKIB 2V0BA 2EI8A 2JETC 2PTNA 3P17H 2Z3CA 3KQEA 3O8CA 1C9PA 1N1LA 4DCDA 2ZHEH 1TBZH 5A2MH 5I46H 2O9QA 5EQQA 4D76A 1D3DB 5A8ZA 2ZI2H 4RT1A 2ODPA 4MLFB 1CBWB 1P11E 2ZP0H 4ISLA 4ISOA 3E0PB 6GCHG 4RI0A 1KLTA 1O39A 1XXFA 2D2DA 4FUGA 2ZHWH 2K0QA 3A8CA 4MNYA 3KYGA 2SGFE 3WWBA 1KDQB 2QF5A 1GDQA 3VG8A 1AIXH 4NSYA 2P95A 4WVPE 2JKHA 1FLEE 2UUFB 2VVCA 1A3EH 2XC4A 1A0LA 2RDLA 2XNDD 3A7YA 2C8WB 4YOIA 1YPLH 8LPRA 1YM0A 2VBCA 1CA8B 1VITG 1AB9B 5FAHA 6GCHF 4ISHH 2ZWLH 1F5KU 4WJG2 1EATA 3M7TA 3VGCB 1PQ7A 1HIAB 2OQ5A 1AZ8A 2VNTA 1FJSA 1W7GH 4Y8XA 4B1TA 1CT0E 2TGPZ 4WMFA 1GJCB 3P8NA 3EQ0H 2QGRA 3O8BA 4UEHH 2Z3EA 4Y71A 5ESBA 5A09A 1XM1A 1TNKA 1NZQH 4IN2A 4JYVH 3EGKH 1NS3A 1PPFE 1AE8H 3PMJA 3TNTA 2FI4E 2SGQE 2V3HH 1E34B 1Z1JA 3PO1C 1YYY1 2KR7A 3SNBA 3MNBA 2EQNA 3BG4B 2M2AA 3BF6H 2D1JA 1ESBA 1E38B 1BMLA 1TGCA 3SU6A 2G4UA 1O3LA 1C5RA 3SNDA 2O8UA 2ZQ1A 2YMSD 4M7GA 1C1NA 1G2LA 3QX5H 3BTEE 2P59A 1GBEA 1TOMH 1C5SA 1UTPA 1O3KA 5TCCA 5C1XA 2STAE 2HNTE 1FAXA 3F3BA 1C1VH 1LPZB 3FP7E 1BTXA 2RCEA 1EX3A 1F0RA 1Y59T 2A45B 1MMJN 1AHTH 2A5IA 3U8RH 4J2YB 1NRNH 3FZZA 4ABHA 3PMHB 1TRMA 4MQAA 3T29A 4BAHB 1DLEA 3A7ZA 1S81A 1ABIH 2P3TB 5GXPA 1AWFH 4MNVA 1A5GH 3BEIB 1E37B 3KF2A 4WMDA 3T62A 1P2OA 5HIYA 3BN9A 2NU0E 3M7QA 4GHQA 4ZKNU 4WH8A 1ZLRA 1UK2A 5JBAS 1UVOA 2H6MA 3OU0A 3SO3A 3SU0A 1P2MA 1YPHC 3RXPA 3GY8A 1MD8A 1O2ZA 2QXHA 3P6ZB 1TX8A 4B2AA 2I6QA 2JJ2D 1OHHD 3FZDA 3I78A 5C0UA 2J9NA 3RUOA 3ZV8A 1V6DA 2GDEH 3TLOA 3H09A 3KN2A 1SMFE 2CGAA 2F91A 5DSFA 3P8OA 3KHVA 5KECA 1IQIA 3V0XA 1DXPA 2ZCKP 4X6NA 3KQ5A 1HXEH 3QN7A 3RXBA 1DUEA 2BYAX 3HKJB 4NIYA 1PPHE 4UE7H 1G9IE 2J98A 3SUEA 3QLPH 4ABIA 2GP9B 1RIWC 2ZC9H 4U30A 1GJ5H 1H9LB 3VGCC 4ESTE 1EAIA 3UTUH 3SU2A 1B0FA 1NBMD 1GJ8B 2Z7FE 1K21H 1LDTT 1F5RA 1BRAA 3ATMA 4NIWA 4YT7H 4B2CA 4YZUA 4B2BA 2O8MA 3DCLA 6CHAB 1VCWA 2ZDKA 1ABJH 1LHGH 3QDZB 4UFFH 3WW7A 1DY9A 3PLPA 2C8XB 4YOGA 1GMCG 1V2NT 1O5CB 2Y5HA 1CVWH 5JBBS 3UQVA 1NRSH 3ZIAD 1MTNB 1GBFA 1OS8A 3FKSD 4B74A 1SOTA 1S6FA 3W1EA 4U32A 3GDUA 1K1MA 5C3NA 3RXKA 3LDXH 2BD4A 4OGYA 1RFNA 1THRH 1CBWC 3SV7A 2YMSC 2ZFQH 1IQKA 5EGMA 4B76A 4MTBA 3PROA 4TPIZ 1Y3XA 2GT7A 1LKAA 1YLDA 1K1JA 3HPTB 1TNJA 3KYFA 3MQKC 1Z71A 2FYRA 1SFIA 3RXTA 4YO9A 1IHSH 4JYTA 4X2WA 1TONA 2TGAA 1WTHD 1P2QA 1HYLA 1VGCB 1W3CA 2ZNKH 1ETRH 3PRDA 1AFEH 1G3DA 2O8TA 4CH8B 5HXFA 1Z8RA 1C4U2 3T2NA 4ASUD 1LTOA 3MU8A 2TPIZ 1G2MA 1OP2A 4AFZA 1AKSB 4K69A 3DSGA 4GHTA 1DWBH 4XE4A 1S83A 1IQGA 2J92A 4FVDA 1KXDA 4DOQA 2NU4E 1GJAB 3PLKA 4K8YA 3F9EA 2HLDD 2P93A 4NFEA 1FAKH 1S84A 2HPQH 1IQFA 3ATKA 5C20A 1GJ4H 2QIQA 4NA8A 1DFPA 5DP9A 1VR1H 1ELBA 3H5CB 2FODA 1T8NA 1EAWA 1HAIH 2QE7D 3STJA 3UOPA 4NZLA 2XCNA 1W7XH 1C2DA 3BTHE 4Q7XA 1FQ3A 3VB6A 1HXFH 3TIUA 2UUJB 2WPKS 2Z9KA 4H6TA 3F6UH 2W3KA 1D6WA 1QQ4A 1YF4A 4BAQB 3M37A 3A7WA 1NM6A 4Z6AH 1ZMLA 3TJNA 1ZSKA 1CA0B 2FP7B 4FXGH 2QC2A 2WYGA 2BD8A 1WSSH 3V7TA 1SB1H 4Y11E 1AN1E 1EJNA 3VB5A 5JPMH 2ZTZA 2PLXA 1UCYE 2H9EH 1O3DA 4ZAEA 1BTUA 6CHAC 1EZUC 3QO6A 2XC5A 1AGJA 2Y7XA 3CS0A 4I32A 1SQOA 3B9FH 2SGPE 1S85A 1MCTA 3MH7A 1LHCH 3MU4A 2Q6GA 2V3OH 2C90B 1NROH 1O3OA 3MNCA 3DFLA 2P8OB 3BEUA 1O2NA 2Z94A 1XKBC 4HGCA 5GJ4B 2QXJA 3SZEA 3EE7A 3SI4H 3GY6A 1PFXC 1TQ7B 3HATH 2GZ7A 4ACBA 3F0PA 5IK2D 2VINA 4B71A 4J1YA 2ZECA 3KL6A 4FUIA 3TITA 2H2ZA 2BY8X 1GI5A 5JB8S 1UMAH 4F55A 3IG6B 5DGJA 3GCTG 3EA8A 1SC8U 1ZMNA 2FLRH 2VB0A 1AI8H 3SNCA 3AAVA 2AMDA 1TABE 3TH3H 2KCPA 2BDAA 2BTCE 1YKTA 1O3EA 3QWCH 1GBMA 3ZZDA 2EA3A 2VGCB 1RTFB 1YPJH 2W6JD 5E8EH 4Y10E 5FCRA 2BMGB 1HJAC 1QA0A 1SGRE 1K1PA 1J15A 3ZVCA 2C8ZB 1GHAG 2B8OH 3UNSA 4MNWA 2ESTE 1TMBH 4ZKSU 4Y8YA 4ZMAH 3U69H 1A61H 2EC9H 3V12A 1PPZA 3LH1A 2OBQA 1XVMA 4ZHLU 1SBWA 4LZ1H 4HZHA 5EJZA 5A8YA 1BJVA 2B7DH 1QJ1B 1A7SA 2QXIA 2IPQX 1EJMA 2XXLA 1C2LA 1N8OC 1RTLA 3URDA 3AASA 1EKBB 3VXFH 1Y3UA 1HPGA 1ESTA 4CR9A 1TNHA 3DD2H 2PTCE 1FONA 1AUTC 1O2HA 1OX1A 2GKVE 3RDZA 3Q3YA 3A86A 2V7QD 1HIAA 5C0TA 2OC0A 3GYMA 4DVAU 2W26A 2YNBA 2R2WU 3N7EA 2IPHA 2AIQA 3M5MA 1V2WT 1JXPA 4CHAB 2CJIA 4ABFA 3BTKE 3FFGA 1GVZA 2XYAA 1ZGVA 1C4V2 2BXTH 2FMJA 1YCPK 3A83A 4UFDH 2NU1E 4LXBH 3BTWE 2ANYA 2QN5T 1ANDA 1GI7B 1TPPA 2C8YB 1BTZA 4KTUA 4X0WU 5E0GA 5HM9A 1FPHH 2VIVA 3OY5U 1TAWA 1GCTB 1V2TT 2GV6A 3JZ2B 1HNEE 1ZPZA 2A7CA 4JZDH 2RFKC 2OBOA 1BRBE 3SU4A 4CRFA 4O3UA 3ZZCA 1KTSB 3GS9A 3BG4C 2ZDLA 5G4BA 4R8TB 1GPZA 1BRUP 1GG6B 3ATWA 1MKWH 4K1SA 4YTAA 4INKA 3PWCA 5DP8A 4X8VH 3OYPA 2ZEBA 1GCTC 2BQ6B 2O8LA 1PQ5A 1P2JA 9LPRA 4NIXA 3BIUH 3CENA 5C5NA 3BV9B 5I25A 3S9CA 4DGJA 1PYTC 1QY6A 3SU3A 1G37A 2STBE 1O2WA 1GCDA 1UHBB 1BITA 2P8OC 3RXIA 2GCTB 1O35A 4FUCA 4X1PU 1O3CA 3ESTA 2J2UA 1QIXB 3LOXA 1DE7H 2WUBA 3VB7A 3ZYDA 2FS8A 3P70B 3V3MA 5EJLA 4AB8A 2OK5A 1SPJA 2EI6A 3MU5A 1KDQA 1PPGE 1KXFA 2ZU4A 2EI7A 3BTGE 1KTTB 2PGBB 3F2FA 2KFWA 1S6HA 4MVNA 1IQLA 1P57B 1Y3YA 1TOCB 1XMNB 2W7UA 1Z8GA 4X8TH 3DHKH 5EQRA 2WPJS 2G5VA 2BHGA 2F9UA 1O2KA 4A7IB 3ODFA 3Q00A 4CREA 4X8SH 1PYTD 1TLDA 3UFAA 1MD7A 2BDCA 1AFQB 1SI5H 3GCHB 4OS6A 2J97A 2ZPRA 2GCHG 8GCHG 1L2EA 1SGTA 3MH5A 1GHZA 5AFYH 2SNWA 5ABWA 4CBOA 3F0OA 1QHRB 5LPEA 4Y0ZE 3F2GA 1GBBA 4YM9A 4DT4A 4OS4A 3QTOH 3RP2A 3ZVEA 3QTVH 1OWKA 5DKMA 1SGFA 2SGEE 1E1RD 2G4TA 1C2KA 1AVXA 1BMAA 3EAJA 4NCYA 4XBBA 1BOQA 3K9XB 3P8GA 2XBXA 3A80A 4OM9A 1TBQH 2K1QA 1EQ9A 1SLUB 4QT8C 3S9BA 4U2WA 3D23A 3GICB 2HNTC 1UCYH 3TVJB 1KXBA 1GI9B 1H8DH 5FX6A 1NFWA 3UOUA 1FN6A 2BZ6H 3H7OA 3RMNH 2CF8H 1GI3A 1GBIA 1C5YB 3KQCA 3M3TA 2G00A 1NRRH 1O2OA 4CRAA 1PPEE 4FUDA 1CGHA 3GCOA 4NFFA 1BDAA 1OP0A 2SFAA 5GDSH 3BEFB 1CO7E 3SV8A 2Y82A 1UTJA 5FBIA 1QJ7B 3NRLA 1EJAA 1OWIA 4BAKB 3RM0H 1M9UA 2GX4A 1ZYOA 3BSQA 2XBVA 1GI0A 1QBNA 1GL1A 4NGAH 3LGIA 3MWIU 1RD3B 4P00A 1GHVH 2Y5FA 2VWLA 2NWNA 3NZIA 2BY7X 2PGQB 2LELA 3JZ1B 3ZVAA 1KXAA 1V2PT 1P05A 1YPHE 3M61U 1A5IA 2C93B 1GBDA 2BD2A 3OAAD 1O32A 3E91A 1QL9A 1KY9A 1O0DH 1TX7A 4K2YA 1GGDB 3DFJA 2BVXH 2VGCC 3KIDU 2ZG0H 3FAOA 4YESB 5F8TA 5FPSA 3A88A 5E0HA 4WWYA 3NKKA 5T1VA 4HTCH 1NN6A 3FOAA 4DURA 1LQDB 3FP8E 5C1UA 1KLIH 4CRCA 1QB6A 1GJ7B 3WY8A 1NRQH 1D4PB 5T6DA 1GHBF 2Y80A 1GHYH 3LKWA 2FPZA 3PMAB 5A0BA 4A6LA 4K5ZA 2BY5X 1C5WB 1QR3E 1THSH 3Q3XA 5L2YH 1P06A 3RMLH 5SGAE 1P9UA 3LGUA 2I6SA 2OXSA 4PROA 2Y6TA 2XNIA 2ZHQH 1ID5H 1OKXA 5DP4A 2FS9A 3H7TA 1QGFA 4UONA 3RM2H 1V2JT 2AGEX 4K60A 5EW2H 1P2KA 3SGQE 1OPHB 2OC1A 3I29A 3RC5A 4I31A 3W94A 2CF9H 1C1UH 4F49A 4UDWH 4GPGA 2PR3A 3SNAA 4BTTB 1UTOA 2H1UA 3UY9A 2PW8H 1CHGA 4H4FA 4WXVA 5LH8A 1THPB 2HLCA 2FOCA 2W3IA 1Q3XA 2Z9IA 3AW1A 4MPVA 5L30H 3RC4A 2OCVB 1DVAH 2QYIA 3N7DA 4NIVA 1INCA 1RTKA 2F83A 1GL0E 2RDEA 1SQAA 3S7KB 3SJIA 1C2IA 4TY6A 3KEEA 1GJBB 1P0SH 1CE5A 1Z7KA 2OLGA 4JZIA 5T6GA 3UB0A 2VH0A 5EODA 3BTFE 1TGNA 2ANKH 1NPMA 3LONA 3FP6E 2FOAA 3GY7A 3UPEA 3P92A 3MI4A 4INHA 1HAYB 1SFQB 1V3XA 5TCAA 1UVUH 2B0FA 2BDHA 1XUGA 2KAIB 1ELCA 1K22H 1G3CA 5CE1A 1RRKA 3K2UA 1FUJA 1TE0A 1KLJH 4JMYA 1BTWA 1ARBA 4B75A 2W6ID 2VWMA 1O3HA 1P8VC 2PV9B 2VIQA 3SUDA 1TRNA 2KX4A 1O33A 2DUCA 4K1TA 5JB9S 1AZZA 2A5KA 4GCHF 2WUCA 1OYQA 5DP7A 3ZYEA 2A4QA 4XRNA 5CDFE 3RLWH 1GDNA 1AKSA 1IQEA 1ZSLA 5AF9H 2HPPH 3GDSA 1CQQA 2FWWA 1BTHH 3LT3A 4Q7ZA 1S82A 1O31A 5F8XA 1O3JA 5GNDA 3SJOA 2UUYA 1ZOMA 1QURH 2A7HA 2AIPA 1HFDA 1ETSH 1OOKB 1GMDG 1C1RA 4D9RA 1FX0B 2PKSB 1SGFG 2VWNA 3OEED 4YLUA 3ZZ4A 3KGPA 1DM4B 4Y8ZA 4ABJA 3NK8A 1XVOA 2FOHA 1DWDH 1SLXB 3EA7A 1E0FD 1BIOA 1VITH 1CT4E 3EA9A 1T8MA 3T28A 3GDVA 5C67A 3CNRA 1Y5AT 1TRYA 1D3PB 4AB9A 3ZZ5A 1T32A 3B8JA 4I8KA 3TH2H 6LPRA 2TGDA 3M7UA 1HJ9A 1WYKA 3AW0A 2BQWB 1YP9A 1Y5BT 1UTNA 3M5LA 1NU9A 1WU1A 2ZGCA 3PYHA 1HJ8A 2BDBA 1BMFD 1J14A 1DITH 3MU0A 4VGCC 1BJUA 1HDTH 3S9AA 1EPTC 2GJGA 2ZFSA 3SNEA 1IQMA 2YNAA 4INLA 1C2JA 1TX6A 2QAAA 1O36A 2WPIS 3UREA 5JYIA 1RJXB 1Z6JH 4AZ2B 3ODDA 1TGSZ 1QBVH 3ZZ7A 1XX9A 1MTNC 1ZPCA 2THFB 1IOEA 5GCHF 2A5AA 4JCNA 2ZDMA 3DA9B 4X2VA 3TJVA 3PV5A 1ZRBA 1V2KT 1GG6C 1MAXA 1EZQA 3A85A 3LC5A 2PUXB 1J16A 1P02A 1O2UA 2QF3A 3F1SB 4ZXYH 2P3FH 4IW4E 3TJOA 2JH6D 1GBHA 1LVMA 1MTUA 1J8AA 2Z6BD 1BHXB 2ZF0H 1P9SA 3PRBA 1MH0A 2B5TB 1L4ZA 3U98H 1UK4A 1UTQA 4D8NA 1DY8A 1FY4A 1KMHB 3MO9A 2FOGA 1O38A 1GBCA 1C1OA 4X6MA 1QFKH 1GMDF 1XUJA 1ZJKA 3TH4H 1O2QA 4I8GA 3LC3A 4Q7YA 3A7TA 4AFQA 2ZU1A 2V35A 4X1SU 3ZVDA 3TGIE 3M5OA 1NU7B 3RLYH 5F03A 3SOSA 2L74A 1ANCA 1BBRK 1MTSA 4DIIH 3GYLB 4ZHAA 1LKBA 2R3UA 5A0AE 1D3QB 1EUFA 3OTPA 2BXUH 1K1IA 2CV3A 4Y76A 1MZDA 3UWJH 3ZZBA 2QXGA 1IHTH 1AUJA 5C17A 1NFXA 1V2LT 2P3UB 4IMZA 2J4IA 2ZFPH 5IYTA 1HAOH 4O97A 4ABEA 3SU1A 7ESTE 4H6SB 2VVUA 1GBTA 1BT7A 3T25A 5ESTE 5FXLA 2JDID 2PHBA 1WOFA 1O2RA 2ZCLP 2WPMS 3PTBA 4KTSA 1YGCH 3TU7H 1SHHB 1OWHA 1OYTH 5CHAB 1HB0B 4BOHA 1ESAA 1H8IH 4JK6A 1ELAA 3FANA 1SGDE 3TK9A 3AK5A 1GJDB 1LPKB 3RMMH 1FMGA 3MHWU 2PUQH 1GHWH 4BAMB 4GAWA 2GZ8A 1G36A 2UUKB 2KAIA 2F9OA 3ZZ9A 4VGCB 3MNSA 3U28C 9ESTA 2ALPA 3ATIA 2ZO3H 5E0JA 3PV2A 2ZTYA 1PQAA 4YOJA 4TY7A 1O2VA 1CHOG 1Z8JB 2BOHB 3N99A 8ESTE 1FNIA 2FZZA 2IN2A 5DO4H 2HVYB 1HJAB 1C5QA 1SHYA 4IS5A 5FPYA 4DT7B 5C2ZA 4DJZB 1C1PA 1G32B 2C4FH 3RXVA 4ZCNA 4WH6A 5EOKA 5FX5A 1Z1IA 3NWUA 1SR5C 4FETA 1ZPBA 1W0KD 1ZTKA 3BG8A 1W2KH 2ZHFH 1PPBH 4MG3A 1TGTA 1W12U 3L6PA 1BZXE 3OTJE 3MO3A 2OD3B 4Y0YE 1DWEH 1GDUA 2PSYA 2M5TA 3TGKE 2ZHDA 4Y7AA 2ULLA 1CGIE 4WMEA 5J4SA 3TPIZ 4BANB 3A7VA 1HLTH 4BXSA 2AGGX 4CHAC 3A8AA 1XKAC 1FV9A
chains in the Genus database with same CATH topology
3LJOA 1LVYA 3ZZAA 1Z6EA 1T31A 1DICA 2QA9E 1F0UA 5CHAC 3SI3H 2FESH 1IAUA 1V2ST 4BTIB 1HUTH 1YPGH 2FEQH 4THNH 1HAVA 4RN6A 1SGPE 2W5EA 5EPNA 3VFEA 1MKXH 4I33A 2TIOA 2PKAA 2GZ9A 1MAYA 1P2IA 1TMUH 1ZZZA 1EXFA 3E0NB 1DWCH 1A1RA 2EEKA 1MQ6A 2W7SA 4AG1A 2WYJA 1LHDH 3S69A 1EOJA 1OWJA 3F68H 2FYQA 2FDAA 3SV9A 2A31A 2ODYB 1DOJA 2ZA5A 4AG2A 3QUMP 4X2YA 1O2XA 2AS9A 1G30B 1O2PA 1O3PB 2OC7A 1CU1A 4X6OA 1IQNA 4TYDA 2DE8A 3ZZ3A 1S5SA 1SGEE 4A1VA 2ZGXH 1O5AB 2BX3A 1L1NA 3VB4A 2BM2A 3GY4A 3KNXA 3SUGA 2H9HA 3RXEA 1EZXC 3F9FA 4JYUH 3M3VA 5DP3A 2ZU3A 1DDJA 3LGYA 4E06H 1VJ9U 4JZEH 1F7ZA 1AY6H 2SGDE 1UTLM 2WPHS 1GHXH 5F8ZA 2HALA 1C4Y2 1AWHB 2TGTA 4FUFA 3VB3A 1EZSC 4IMQA 4YT6H 1K1LA 1QA7A 3PLBA 3MO6A 1D9IA 1F0TA 4FUBA 5K7RA 3VPKA 1Y3VA 2R0LA 5J4QA 1SLVB 1WUNH 2VVVA 2BB4A 1C1QA 5H4IB 1WTGH 3O8DA 5C1YA 1MU8B 1MCVA 4DG4A 2ZPSA 2RA0A 2SGAA 4MNXA 1C5XB 1QL8A 1O2LA 1A4WH 4MPUA 3HGPA 3HK3B 1PQ8A 3B23B 3ZVGA 5FBEA 1O5DH 4AYVB 4JK5A 2AERH 3LJJA 3URCA 3GY3A 3W95A 3PB1E 3CS7A 2AFQB 1SQTA 1C2EA 1QJ6B 1AVWA 2ASUB 3E90B 1P3CA 1FI8A 4A92A 4SGAE 5EXMA 4SGBE 1GJ6A 3SBKA 3LPRA 1AO5A 2VIWA 4X8UH 1SG8B 3U1JB 1MUEB 3A84A 2ZKSA 2XBYA 3NXPA 3SU5A 1SGQE 3QZQA 3TK5A 1P04A 2H5DA 3UNQA 3G01A 5DJ7A 3MMGA 3SHCH 3VXEH 1UK3A 1NC6A 1MKWK 5T3HA 2G81E 4Y79A 1TIOA 4OS1A 3BTDE 2WV4A 1TMTH 2OUAA 1QL7A 4X1RU 2BD9A 1O2SA 2VH6A 4DW2U 1TPAE 1F92A 3MH4A 2Q6FA 1TYNA 1GWAA 2FOEA 1P10A 2J95A 1D3TB 5DK1A 2XWAA 1W8BH 1OSSA 2FIRH 1ZJDA 3UQOA 4AFUA 3T26A 1T8OA 3LGVA 1T4VH 1TNIA 2QV1A 4WY3A 1A3BH 5CMXH 7KMEH 3MTYA 1YPMH 1V2VT 2UWPA 1QQUA 1QCPA 4BTUB 1SLWB 3MH6A 4ZUHA 1CSOE 2SNVA 1C9TA 2F9PA 4KGAA 3ZVBA 4AN7A 4IGDA 2UWLA 1C2HA 2GT8A 1BBRH 1L0ZA 2F9VA 2G8TA 2YOLA 1VGCC 1GMHF 3PTNA 5EQSA 5LPRA 1MU6B 1UHBA 2D8WA 1EAUA 1Q2WA 2ZFRH 2FO9A 1DX5M 1GGDC 1ZGIA 5DP6A 1WQSA 1J17T 5GWZA 1L1GA 2ZU2A 2NU3E 3RXQA 4DY7B 4E7NA 2VIOA 2XBWA 4XBCA 1DANH 1MBMA 1W13U 3EE0B 1XUIA 3AAUA 1VITF 3K65B 1ELTA 1K2I1 2IOTA 4Y7BA 1ELVA 1DS2E 1QNJA 2GVFA 1ELGA 2AMQA 3DT0H 3GCTF 5BRRE 1YC0A 1FIZA 1CT2E 3SQHE 1SSXA 4F4OC 4IC5A 4XOJA 5EG4A 4FUHA 2FM2A 2BVSH 2AH4X 1A0HB 2BY6X 1O5EH 4MPXA 2G51A 2ZFFH 4BNRA 4TWWA 4BAOB 4XBDA 3M35A 2FI3E 4R0IA 1XUFA 1MTWA 1VZQH 1UJ1A 1H9HE 4HI3A 2XW9A 2BQ7B 4K8BA 3Q3KA 4CR5A 6ESTA 1W0YH 3U1IB 1W14U 2H5CA 3L3TA 1GMCF 1ZMJA 3ZZ8A 4H42U 3A82A 3UR6A 5F6MA 1X7AC 1J9CH 1HAGE 1C5LH 4CBNA 1XUKA 3UUZA 1N6XA 1O3IA 1SL3A 5GCHG 1DUAA 1U6QA 1SGIB 3LH3A 4TWYA 1Q31A 3K6ZA 2A4GA 3A89A 1P09A 1RXPA 3PO1B 2NU2E 3MFJA 1KSNA 1QB9A 1L4DA 2TBSA 2ILNA 3OX7U 4YLQH 2BLVA 5PTPA 2CHAB 3UWIA 4I8LA 1P01A 1QRXA 2Q6DA 1JRTA 2JETB 2BD7A 3SGBE 4AFSA 5FHTA 4GVUA 3GCNA 4D7FA 3RXCA 4NWLA 1EOLA 4HFPB 2BZAA 2P94A 1G3EA 1SGYE 2XCFA 5A8XA 1ANEA 3RXAA 2XC0A 1O2YA 5A0CA 5AVDA 3TNSA 4UFEH 1K9OE 1KYNA 1QBOA 3LU9B 4I8JA 4K3JA 5DG6A 1MZAA 1YBWA 1DSTA 3LGTA 5EW1H 1JMOH 1LCYA 2FTLE 3STIA 3A81A 1EP5A 1LQEA 3ZZ6A 2OTVA 1GI1A 2PSXA 1O3AA 2ZZUH 1P03A 5GIBA 1B5GH 2A32A 5L6NH 1ZSJA 2A1DB 3ATLA 3A8BA 1TA2A 4D9QA 2BD3A 4WF8A 3PM3A 3UNRA 2A4RA 3R0FA 1MBQA 4A1TA 3E1XB 4OS2A 2CMYA 1O2GH 1O34A 1SGNE 2Z9JA 1NRPH 5T6FA 2BOKA 2TRMA 2PFEA 1UTMA 1EASA 3FVFB 2B9LA 4RSPA 1DXWA 2OP9A 2CXVA 1ELFA 4LOYH 4X1QU 4E7RG 2JH5D 1ETTH 2G55A 3P8FA 1OXGA 1C1SA 5HGGA 7LPRA 1GBAA 4ZROA 1AE5A 2FOBA 1F2SE 1GBLA 1KXCA 5LGOA 1O3GA 1AVGH 3UR9A 1TBRH 1UVSH 1JWTA 1C1TA 1NY22 4LZ4B 3GISB 1DSUA 1WV7H 4WXIA 2PKSC 1RS0A 1BTPA 1BTYA 4Y6DA 5HYOA 2ZQ2A 3RXJA 1GHBG 3RXOA 1C2GA 2JH0D 2FLBH 1BQYA 5DP5A 5EU8A 1ELEE 3KQBA 1ANBA 1AMHA 3RXSA 2HWLB 1HAHH 3RMOH 4I8HA 1ELDE 1A2CH 3OY6U 3PWBA 1C2FA 2HNTF 1H1BA 1SVPA 3A7XA 4KELA 4X2XA 2R0KA 1ARCA 1HRTH 2QCYA 3V13A 1QTFA 4D7GA 1C5MD 2GV7A 3UIRA 1GBJA 1FY5A 1WAYB 1AFQC 5ETXA 3SZNA 4AORA 5LPFA 3K6YA 2ODQA 2ZGHA 3F9HA 1C2MA 7GCHG 1GI2A 3NCLA 1T8LA 1C5ZB 2GMTB 3ITIA 4ABDA 3RXLA 1TB6H 1IQHA 1H4WA 1YPEH 1AD8H 1JRSA 2J38A 1W11U 2A2XH 1EB1H 4CH2B 1EAXA 4KTCA 2BLOA 1BMMH 1E35B 3SHAH 1CA0C 2BLWA 1GJ9B 3A87A 2A0QB 3SW2B 3ENSB 1RIWB 4XDEA 4CRBA 5L2ZH 2ZFTA 1CGJE 4ABGA 1GHAF 1VCQA 1JOUB 1Y3WA 4UD9H 1V2UT 4GUXA 2F9NA 1JIMA 4XSKU 4JZFH 3C1KA 3N7OA 1HAVB 1PJPA 1V2MT 3PMBB 1FY8E 1B7XB 4AYYB 1GI8B 1DT2A 2PWXA 2F9BH 3SN8A 4AOQA 5DPAA 1C5UA 1EPTA 1BBRE 2V6NA 1V2RT 1ACBE 1H9IE 3DUXH 1GVKB 1TQ0B 4KKDA 1D6RA 1ZHMA 5BPEA 1N8OB 3HGNA 2RG3A 3U9AH 4BXWA 2GGVB 4ABAA 2LNCA 1P3EA 4FU7A 1C5TA 2WINI 2OINA 3R3GB 3SJ9A 3QZRA 3RXHA 2XRCA 1TNGA 1AQ7A 2Y7ZA 1YCPM 5EPYA 3LGWA 1L1JA 4GSOA 2Z9GA 3AVZA 1K1OA 4MDSA 2LPRA 3RXRA 2BD5A 3RXGA 1GMHG 3OSYA 4ZH8A 3I77A 1OWDA 5EXLA 2FTMA 4ZHMU 3RU4E 1W0ZU 1TALA 2XWBI 3ZVFA 3BTQE 5TJXA 5HMAA 1HCGA 1QRZA 4LK4A 1O2TA 1ZTJA 2Q1JA 2PKAB 3S7HB 1LO6A 1T7CA 4NSVA 1OWEA 2Z9LA 3SGAE 2A4OA 1C5NH 1O5BB 3M36A 1PPCE 5JBCS 2FI5E 1K28D 3NUMA 3QK1A 3D49H 2HVXA 3Q76A 2Y81A 1FZZA 2AEIH 4A1XA 1NO9H 2BDIA 1ZHPA 2F3CE 1O3NA 1GI4A 2OC8A 3SORA 5AFZH 2ANMH 2GTBA 1LHFH 3QGJA 1JIRA 1S0QA 3KQDA 3EDXB 2AYWA 1BA8B 2AGIX 2BVRH 1KXEA 2CHAC 3P95A 4O03A 1A46H 3LIWA 1GVLA 3TGJE 4FUEA 2G52A 1OP8A 3M5NA 1NESE 2CN0H 5JBTA 3GOVB 5E2OA 5AHGH 4ZKRU 1O3BA 2ZPQA 1BRCE 1O5FH 1EPTB 2G5NA 2GCTC 2D26C 2R9PA 1NFYA 3A8DA 1BB0B 3SJ8A 1HAZB 1MTVA 2GDDA 4IBLH 5EXNA 1AU8A 1UVTH 3RU4D 1UO6A 1DPOA 2HRVA 1LVOA 1O5GH 2ZGBH 4AX9H 3HK6B 3F9GA 4E05H 2R3YA 2VU8E 5C5OA 1MQ5A 1ZHRA 2VIDA 1BUIA 2FOFA 3VEQB 1RGQA 1Z8IB 2FX6A 1F0SA 3EYDA 1GBKA 1KIGH 2WPLS 4I7YH 3L33A 1WQVH 2GCHF 8GCHF 3IITA 2ZCHP 2ZDVH 5K0HA 1YLCA 1BCUH 1O3FA 3SJKA 3C27B 3TK6A 2J34A 1HAXB 1W10U 3M3SA 1SOZA 2QY0B 4DIHH 1BMNH 4NG9H 3U8OH 1O3MA 3NPSA 2ZDAH 1SGCA 3MYWA 5HM2A 1FPCH 2BDGA 1JBUH 2VWOA 1K1NA 1FIWA 4ZKOU 1CHOF 1XUHA 1G3BA 3GY5A 4X1NU 1NTPA 3KCGH 1UTKA 3T27A 2ZTXA 1LMWB 1FN8A 2ZGJA 1TA6A 3IWMA 2GMTC 1A0JA 4FU8A 2R2MB 2J94A 1Y8TA 2OQUA 3E16B 2HOBA 4OS7A 1Y5UT 2ALVA 2AMPA 2IJOB 3QGNB 4GLYA 1TGBA 1WBGB 5JDUB 3MOCA 1C5PA 2FOMB 4FU9A 4NWKA 1QB1A 2BLQA 3E3TA 1F5LA 1EP6A 1C5OH 2H9TH 2GD4B 2O8WA 3RXMA 3ZV9A 2QF0A 1B0EA 4NA9H 1O30A 4K1EA 1P12E 1S0RA 3RC6A 1LHEH 1ZRKA 3GY2A 1FY3A 1VJAU 5E2PA 2VIPA 3MU1A 4X6PA 2UWOA 1T4UH 4Q80A 4TPYA 1FY1A 3Q77A 4ZXXH 4AGJA 8KME2 4FVBA 1HAPH 1GI6A 1BHXF 1LPGB 1LVBA 3SQEE 4Z0KA 2DE9A 1C1MA 1HV7A 4OGXA 1TPOA 5GPIB 2XTTB 4IC6A 3SV2H 4ABBA 2Z3DA 3ELAH 4KP0A 2BDYA 3E8LA 4AGKA 1MKXK 4RKOB 4XFQA 1C5VA 3RXDA 1UCYK 2BY9X 3PV4A 3SV6A 1C1WH 2ANWA 4JZ1A 1FXYA 1TNLA 2ZU5A 4OS5A 4FUJA 1AB9C 3RU4T 5FCKA 2P16A 1IQJA 4NZQA 1NFUA 1EB2A 5FPTA 1VCPA 4GCHG 4O3TA 1TFXA 3T5FH 5B6OA 1FDPA 1O2JA 3MNXA 4B73A 3SUFA 1TPSA 2ZDNA 4UFGH 1V2QT 4ISIH 1O2MA 5IDKA 1NT1A 2ZIQH 3E6PH 3BTTE 3D62A 2VJ1A 1TWXB 3CP7A 1V2OT 7GCHF 3BIVH 1ZR0A 4CRDA 1O2IA 3S0NA 4IN1A 1HBTH 4NA7A 1ORFA 1UVPA 4Q2KA 1P2NA 4ASHA 2RA3A 3TJUA 1E36B 1WCZA 4A5TS 2Y5GA 2C3SA 2WV5A 1YCPH 1ZTLA 3D65E 1QRWA 2HGTH 3RXFA 1O37A 4MPWA 4O9VA 3U8TH 2BX4A 1XXDA 1A5HA 2A7JA 1DLKB 2FXRA 3RXUA 3O8RA 4U01A 3GCHC 2A2QH 4CRGA 2FX4A 4RKJB 1N6YA 1YPKH 4ISNA 3BTME 1HGTH 3HKIB 2V0BA 2EI8A 2JETC 2PTNA 3P17H 2Z3CA 3KQEA 3O8CA 1C9PA 1N1LA 4DCDA 2ZHEH 1TBZH 5A2MH 5I46H 2O9QA 5EQQA 4D76A 1D3DB 5A8ZA 2ZI2H 2ODPA 4MLFB 1CBWB 1P11E 2ZP0H 4ISLA 4ISOA 3E0PB 6GCHG 1KLTA 1O39A 1XXFA 2D2DA 4FUGA 2ZHWH 3A8CA 4MNYA 2SGFE 1KDQB 1GDQA 1AIXH 4NSYA 2P95A 4WVPE 2JKHA 1FLEE 2UUFB 2VVCA 1A3EH 2XC4A 1A0LA 2RDLA 3A7YA 2C8WB 4YOIA 1YPLH 8LPRA 1YM0A 1CA8B 1VITG 1AB9B 5FAHA 6GCHF 4ISHH 2ZWLH 1F5KU 4WJG2 1EATA 3M7TA 3VGCB 1PQ7A 1HIAB 2OQ5A 1AZ8A 2VNTA 1FJSA 1W7GH 4Y8XA 4B1TA 1CT0E 2TGPZ 4WMFA 1GJCB 3P8NA 3EQ0H 2QGRA 3O8BA 4UEHH 2Z3EA 4Y71A 5ESBA 5A09A 1XM1A 1TNKA 1NZQH 4IN2A 4JYVH 3EGKH 1NS3A 1PPFE 1AE8H 3PMJA 3TNTA 2FI4E 2SGQE 2V3HH 1E34B 1Z1JA 3PO1C 1YYY1 3SNBA 3MNBA 3BG4B 3BF6H 2D1JA 1ESBA 1E38B 1BMLA 1TGCA 3SU6A 2G4UA 1O3LA 1C5RA 3SNDA 2O8UA 2ZQ1A 4M7GA 1C1NA 1G2LA 3QX5H 3BTEE 2P59A 1GBEA 1TOMH 1C5SA 1UTPA 1O3KA 5TCCA 5C1XA 2STAE 2HNTE 1FAXA 1C1VH 1LPZB 3FP7E 1BTXA 2RCEA 1EX3A 1F0RA 1Y59T 2A45B 1MMJN 1AHTH 2A5IA 3U8RH 4J2YB 1NRNH 3FZZA 4ABHA 3PMHB 1TRMA 4MQAA 3T29A 4BAHB 1DLEA 3A7ZA