2J9NA

Robotically harvested trypsin complexed with benzamidine containing polypeptide mediated crystal contacts
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CATIONIC TRYPSIN
publication title Operator Assisted Harvesting of Protein Crystals Using a Universal Micromanipulation Robot.
pubmed doi rcsb
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2j9nA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2j9nA02
1B5GH 2O8MA 1O2UA 2A2XH 1V2JT 1FI8A 3TNTA 3RMMH 2FP7B 1VJAU 3SO3A 1P06A 4ABIA 1O2NA 1ANDA 2FDAA 1SHYA 4UE7H 5F6MA 3LGIA 1ZMLA 1QR3E 1WTHD 1LQDB 1C2GA 4ABGA 1YGCH 3PMJA 5EW2H 1HLTH 4BNRA 5DK1A 2ZHFH 1GJ4H 1TRMA 1EJAA 1HGTH 1GDUA 2FOGA 4A6LA 1A0LA 1P12E 2THFB 4YOGA 1LVMA 1C5SA 3RMNH 1HV7A 1GI9B 3M7TA 1TPPA 4RKJB 3MU0A 3MO6A 3RUOA 2WV4A 5DP3A 2Q1JA 3M7UA 2WPLS 5HM2A 1SGEE 2SNVA 3PO1C 4DY7B 5CHAC 5EXNA 3QWCH 3PROA 2FO9A 1YPMH 2GV7A 3P95A 3ATMA 3L33A 1VITG 2ZI2H 1NC6A 1SGRE 7ESTE 1K2I1 1V2QT 1W0YH 4INLA 3SU4A 1O33A 1MMJN 1GDQA 1N6YA 4ZKNU 1IQHA 3P8OA 2ZO3H 1QL9A 2ZU3A 1C2MA 4X2WA 1OS8A 2XCNA 2H5DA 4XBCA 5A0BA 1DY8A 7GCHG 1S84A 1O32A 1ZMNA 2R3YA 1C5OH 1BOQA 2PGBB 2ZDNA 1UVPA 3PLKA 1LVOA 4IMQA 1C4V2 1YCPK 2QGRA 1HXFH 3E90B 1GI3A 4OS6A 1ELCA 7LPRA 4A92A 3M3TA 2ZU2A 2O8LA 2AMDA 1ZHRA 1MUEB 5CMXH 1YPEH 3MH5A 1WV7H 4AFUA 2XC5A 2ZF0H 1SL3A 3NK8A 1SGQE 2ZKSA 4DIHH 2WUCA 3KQDA 2TGTA 3OY6U 1MH0A 3LGVA 3DFLA 3I77A 4E7RG 1E38B 3LGTA 2J9NA 4IN1A 3MNXA 1AVGH 4UD9H 3SUEA 2QXJA 1O2KA 2CJIA 2TIOA 4GSOA 1EZSC 2AMPA 1ELVA 1UMAH 2OTVA 1J15A 1PQ5A 3FZDA 3BN9A 1HDTH 1FIZA 1J8AA 2CXVA 1UTQA 3VB6A 1K1OA 2J92A 5ETXA 1GDNA 2FWWA 2GT7A 3GCHC 5ESBA 1FNIA 1GBBA 1P04A 3TH4H 1O2WA 2BXTH 3GYMA 4K8YA 1G32B 3RXJA 4AN7A 4X8TH 1O2LA 1SVPA 5E0HA 2H9HA 3N7OA 4I7YH 1ZJKA 5HM9A 1S0RA 2AGEX 1DSUA 3SV6A 1BBRE 6CHAB 1QBNA 5DP8A 5T6GA 1TMUH 2G81E 1W14U 1NESE 2OC8A 4WJG2 4NFFA 3UNSA 3DD2H 1SFQB 1P0SH 1IQKA 1KLTA 5DPAA 2IN2A 4CRDA 3DUXH 3SUFA 2FTLE 1O3KA 1OX1A 2F9VA 1RIWB 5JDUB 2PTNA 1DSTA 4H6TA 4WMEA 1ID5H 1LDTT 2CMYA 1ELTA 1GG6C 2VGCC 4OS1A 1MQ5A 3G01A 4R0IA 5EU8A 5DP7A 1LQEA 2BOHB 1MD8A 4MPVA 3S0NA 3P8FA 4FVBA 3A89A 2Y5FA 3MTYA 1H9LB 1PPBH 1HXEH 4CRGA 1C9PA 1UO6A 3OX7U 1S82A 5EQSA 3LC3A 1G9IE 4X2VA 1SLUB 1KYNA 1GHYH 2FS9A 1F2SE 1ABJH 1O38A 3F9HA 1TGNA 2NU2E 1BTXA 1O2TA 1RGQA 2D2DA 4JZ1A 4Q7ZA 3U8RH 4AFZA 1F7ZA 2M5TA 2FIRH 2SGQE 3M5MA 4MDSA 4DT7B 3MU1A 2BD9A 3BV9B 4Y8YA 1L1NA 1LPGB 4Y71A 1HAOH 2W5EA 1G3CA 1DXWA 3UIRA 4ZHLU 1O39A 1F0RA 2G8TA 3KHVA 4BAHB 2Y6TA 3AASA 4QT8C 4YT7H 2HGTH 3SBKA 2P8OB 3A85A 4H6SB 2NU3E 1GI4A 2BQ6B 4UEHH 1C2HA 4Y76A 4CR5A 4CREA 3UR9A 3UNRA 3C27B 3SUDA 3M61U 2ZIQH 5HGGA 1C2EA 1ZRBA 2BD4A 3E0NB 2GDEH 1GMCG 1ESBA 4ZXYH 2VINA 3RXVA 3RXCA 1D6WA 1QY6A 1YPKH 1IQJA 1Y5UT 1A0HB 1BCUH 1K22H 2BD7A 5E0JA 5LGOA 1AWFH 3JZ1B 1FJSA 4IC6A 3M37A 1C1OA 3CP7A 5FHTA 1KXFA 1TNLA 2PKSC 1JXPA 2AERH 2VWNA 4CHAC 1O3DA 1O3FA 2FODA 4A1XA 3RXMA 2BLQA 1GVZA 4MNYA 1W12U 1K28D 3SJ9A 1YCPM 1GBIA 1KTSB 1HAXB 1YLDA 2RG3A 2FYQA 1O0DH 2Y80A 1OP8A 3A87A 1CVWH 3RXKA 3MO3A 2ANKH 1HAVB 3ZVDA 3A83A 5IYTA 1G2MA 1C2LA 5A8ZA 3ATKA 1GBHA 1A5HA 3TGIE 5GIBA 4ESTE 5H4IB 3M5OA 1GBMA 3GCNA 4A5TS 5JBAS 2DE9A 1SFIA 2UWLA 3HKJB 4PROA 2EC9H 1V2UT 1AKSB 2AEIH 1MZAA 4I33A 3FFGA 2ZPRA 1AFQC 4JCNA 1T8NA 1GI6A 1XUHA 4X6NA 1P03A 1OXGA 1HAIH 1YPLH 4BOHA 1GI5A 1BHXF 4O97A 1W7GH 3QDZB 4FUJA 2IPHA 1RFNA 2TGAA 3A86A 5L6NH 4FUBA 1PPEE 3BEFB 4HFPB 2A5KA 1BA8B 4Y8ZA 1MKXK 1L4ZA 3E8LA 1S6HA 4B74A 4GCHG 1GBKA 2BX3A 4YTAA 4I8LA 2UUKB 1RTKA 2A4GA 1D3DB 3DT0H 2BDBA 3SU1A 1JRTA 2BQWB 2SGPE 1O2HA 1SG8B 2BY5X 3GY3A 3PMBB 4DIIH 2XBYA 1DXPA 1SR5C 1ANCA 2FM2A 3V13A 1ZHMA 1UCYH 1Y3WA 2PHBA 4JZIA 3GOVB 1J16A 1RS0A 4Q80A 3VFEA 4ISHH 1BITA 1QRXA 2Z9IA 3OSYA 3TIUA 2VU8E 4ZUHA 1GBFA 1BBRK 5EODA 1GI1A 2C90B 5I25A 1P8VC 1X7AC 4JZFH 1P2QA 4UFFH 4IW4E 2ZDVH 2BVXH 4HTCH 3RM2H 4DW2U 3IITA 2FI5E 4ABBA 4BAMB 2VIDA 1BTWA 1AFEH 1W10U 2OBQA 1CU1A 1GBEA 1WQVH 1F0SA 3ZV8A 4F4OC 2GT8A 1Y5AT 3T25A 3P8NA 4CRFA 2BDCA 2QXGA 2YNAA 1ZTKA 3T27A 3KQEA 3SU6A 2ZECA 5EW1H 2XBVA 5F8TA 2WINI 1WAYB 2R2MB 4SGAE 4Z6AH 4ZKSU 2OQUA 1MTUA 4ISIH 2ANMH 2Z9LA 4AFQA 2ZHEH 3GDVA 1RD3B 3SU3A 1KXAA 1K1IA 3SV7A 1O3CA 3GY2A 2STAE 1WOFA 3EA7A 1P2MA 4KKDA 1FIWA 1PJPA 2BXUH 2OCVB 3ODDA 1GBCA 3PV4A 2C4FH 1VITH 1QRZA 2BY9X 1P05A 1GBAA 1E36B 1BT7A 2Z9KA 1P2KA 2QF3A 1TIOA 2F83A 3F6UH 1SGIB 1O3PB 1O3IA 3BIVH 1EZQA 3ZZBA 1KDQB 1P9SA 5E2OA 1SOZA 3NKKA 1DANH 2C93B 4X1QU 1SI5H 3KGPA 2HALA 1V2TT 2NWNA 4WWYA 2B0FA 3A81A 2P93A 3IG6B 1O5CB 4JYTA 2WPIS 3LDXH 3HGNA 2B7DH 1UVOA 4Y0YE 1NRNH 3A82A 1GBJA 1DITH 1E0FD 1Y3XA 1SC8U 2A4OA 1VITF 3SU2A 2B9LA 1YM0A 1GG6B 1UK3A 1TBRH 2VGCB 3EAJA 3SV8A 2VH0A 1NM6A 1A61H 2J34A 1K1JA 4Y7BA 1Z6EA 1TQ7B 2ZTXA 2GDDA 3RU4E 3SJOA 5GDSH 3SZNA 3NPSA 4ASHA 1CHOG 1TONA 2PTCE 1C1WH 4A7IB 4RKOB 1EOJA 4X1NU 3BTDE 1Y8TA 3V7TA 7GCHF 4ZMAH 2FS8A 4FU9A 1BJVA 3UR6A 2BM2A 3H7TA 5FAHA 2EEKA 4Q7XA 1AZ8A 4GLYA 1ELEE 4UFGH 1UTPA 2ZC9H 3ZZ9A 2A2QH 3RXBA 2W7UA 2ZFRH 2ZCLP 1E37B 1ZPZA 4NG9H 3VEQB 2FOFA 2ZU5A 3MMGA 2BB4A 3LU9B 2FEQH 4RN6A 1T4VH 4IC5A 2AH4X 3UOUA 2OUAA 1GJ9B 4BAOB 1C5UA 2BLOA 3SNDA 3HK3B 5C20A 1HAYB 1FDPA 1HJ8A 1GBLA 4CRCA 1TE0A 1NRRH 1GCDA 3F1SB 2A7JA 3W95A 3LC5A 1FPCH 4KTUA 2WYJA 3E0PB 2VIPA 3SHAH 1W7XH 3PM3A 1GHWH 1P09A 1A3EH 5FPSA 4ZHMU 5FXLA 1V2WT 4MPUA 4M7GA 1O2VA 1CSOE 1P11E 3NUMA 2ZA5A 1H4WA 4IN2A 1O30A 3SGBE 1TWXB 3BTGE 1HUTH 4NA7A 1RJXB 1P2IA 2QF0A 1V2PT 3VXFH 2GVFA 2EI7A 2PKSB 1OSSA 1FY4A 2ASUB 4MPWA 1DX5M 3SHCH 1O2GH 4H42U 4CHAB 4NZQA 5BRRE 1OOKB 2BD8A 1CT2E 1NRQH 2FZZA 4BANB 3PWCA 1F92A 1LPKB 4MPXA 1Y3YA 1BRAA 1B7XB 1ARCA 1GVLA 3FP7E 3VPKA 1A7SA 4OS4A 1DUAA 1ELAA 1PYTC 1GJ8B 2ZPQA 3ATIA 3OTJE 1HAGE 3ZZ5A 4UONA 4ZKRU 1YBWA 2RDLA 5G4BA 1GJAB 3F9FA 4D76A 1PFXC 6ESTA 5DP4A 9ESTA 1IQNA 4YOIA 1TFXA 2HOBA 4BTUB 1CT0E 1NY22 1PPFE 5F8XA 3Q3KA 2VNTA 2BZAA 1AFQB 3SOSA 3LT3A 1EXFA 1CO7E 3Q76A 1MKWK 3QO6A 2RA0A 8GCHF 5JYIA 1OWKA 4TWWA 3A8AA 2BTCE 1C5ZB 4XE4A 1WUNH 3FVFB 3SGQE 1D4PB 1YCPH 2SGDE 2H6MA 1DWDH 3TJOA 1D6RA 2GMTC 2VIWA 1NFUA 3MNBA 1CE5A 5DG6A 1ZR0A 1ZSKA 1FN6A 3ZZ4A 3GY7A 3RXLA 1HAVA 3R0FA 2BY7X 1MTVA 1FY8E 2QXIA 2SGEE 1FXYA 1UTOA 1H1BA 1C5XB 2JH0D 2Y81A 4AG1A 1GJ6A 5F8ZA 4ABFA 4ABAA 1AQ7A 1O34A 1EZUC 3M7QA 1P2OA 1G36A 4R8TB 1MU8B 2BOKA 3A7WA 1AKSA 4BXWA 3DFJA 1TX7A 1TALA 3OY5U 1QJ7B 1F0UA 2O8WA 2DE8A 3UUZA 3RXIA 1ACBE 5HMAA 1EPTC 4ZH8A 1TMBH 1T4UH 5EG4A 1VGCC 4ZHAA 3A7ZA 1AVWA 1FUJA 1GMCF 1P9UA 2HRVA 4NIXA 2OD3B 4YO9A 1KLJH 3RXFA 4E05H 1FAKH 3S7HB 4UDWH 2ANYA 3QGNB 1O5BB 1EQ9A 1UK4A 3I29A 5JB8S 5GCHF 4OGXA 3B23B 4ISLA 1PQ8A 3HATH 3MH7A 2ZCHP 1QGFA 4KELA 2BDHA 3OU0A 5A0CA 5LPEA 4BXSA 5I46H 1LHEH 1UTMA 3T26A 3MU4A 1IHTH 2GZ9A 4I31A 1TBZH 1EJNA 2VVCA 4NA9H 3UQOA 1HFDA 2ZP0H 5TCAA 3SJ8A 5C1YA 1VCPA 1KY9A 2VB0A 2VVVA 1JRSA 5A0AE 2F9NA 4X2XA 4X1PU 2XBXA 2ESTE 1BJUA 4NSYA 1TNKA 3O8BA 1K1PA 3KN2A 1CGHA 2Z94A 4D9RA 2GCHF 1ELGA 2HNTC 2ZWLH 1JBUH 4AG2A 1ZOMA 2VWLA 2R0LA 1QB6A 3CENA 4X8SH 1IQFA 2B5TB 4XDEA 1MQ6A 1GI8B 1DWEH 2GKVE 3LGWA 3A88A 4DOQA 1ZTLA 3GY6A 1ESTA 2CV3A 1O2YA 3BG4B 3BF6H 2V35A 4O3UA 1QA7A 2ZGCA 1O2OA 1Z1JA 1QFKH 3ITIA 3MOCA 1L4DA 1HJ9A 1XXFA 2STBE 1AB9B 1H8DH 1KTTB 1XVMA 2TRMA 2G5VA 3SV9A 8GCHG 2PUXB 1Z8RA 2ZDKA 4ZKOU 1ZSJA 1GJ5H 1GPZA 3A7VA 2FESH 2QC2A 4GCHF 5PTPA 3QK1A 4ABDA 2BVRH 2ZGXH 4E06H 1T8OA 4MVNA 1SGFA 1TLDA 1UTKA 3P70B 4F49A 1G37A 2LPRA 1XUIA 2FMJA 4NCYA 5GPIB 3S9AA 2FLRH 3A8CA 2P3UB 1THSH 1KXBA 5DP5A 3UOPA 2F3CE 2ZG0H 3RXUA 2O8UA 4TPYA 1YKTA 5FCKA 3L6PA 2PUQH 4NSVA 3UY9A 2BD5A 4JK6A 1QBOA 1CHGA 1MBMA 1F5KU 2VIQA 4WF8A 2AMQA 2JETC 2PW8H 1EZXC 3RXPA 1XKAC 1AWHB 4ABEA 1GHAG 1FPHH 1E34B 4I8KA 3EE0B 2P16A 4B73A 1KDQA 2ODYB 3O8DA 3SORA 3S69A 3A8BA 5EQRA 5JBCS 5EXMA 1C5NH 1D9IA 2QCYA 3TJVA 2QY0B 1AZZA 1ANEA 3B9FH 3TNSA 1P3CA 3ZZ3A 1HBTH 4X6PA 1DWBH 2ZFPH 2W7SA 5TJXA 2BHGA 1O3EA 2QV1A 4CRAA 5GCHG 3KF2A 4FUFA 1VJ9U 1LCYA 1K9OE 1BTUA 3ZYEA 1QL8A 3ZYDA 9LPRA 3GCOA 2RA3A 1AUJA 1C1SA 1O31A 2OP9A 3V3MA 2Q6DA 1BHXB 3SN8A 3EDXB 2WV5A 1TYNA 2ZDMA 1NT1A 3H7OA 4E7NA 3RU4T 2H5CA 1WCZA 1IQEA 4K69A 4UFDH 4LXBH 2W3IA 2ODQA 2XTTB 5E8EH 1ZYOA 1RTFB 1LHCH 3A80A 4LZ1H 1BZXE 3TJUA 5AFYH 3S9CA 1T8MA 5LH8A 4LZ4B 1S85A 2GCHG 3ATWA 3RXTA 4MLFB 1UHBB 3QGJA 1GJ7B 4XBBA 3A84A 4IS5A 1MKXH 2UUJB 4H4FA 3RM0H 1XKBC 1GVKB 3TLOA 2BDYA 1Z7KA 2ZHDA 3LKWA 4VGCC 3T28A 3D23A 1P2NA 4X2YA 1W0ZU 2UUYA 1IAUA 1QIXB 1YLCA 3U9AH 5GWZA 1AGJA 1IQMA 1BRBE 2GZ8A 2WPHS 1IOEA 3QTOH 1F0TA 2XW9A 4MNWA 2A0QB 1ELDE 2A5AA 3EGKH 1VZQH 1PQ7A 2FLBH 4NWLA 3TITA 1EUFA 2OLGA 3MNCA 3WY8A 1C5PA 3QLPH 3SU0A 3W94A 1B0FA 3PB1E 3LH1A 3TH2H 4JZEH 2CF9H 1Z8JB 5IDKA 1H9IE 1NPMA 1BMNH 1Q3XA 4NIYA 1SOTA 4A1VA 3AW1A 2J2UA 4O3TA 1O3MA 1FY3A 1CHOF 4NFEA 4IBLH 2P3TB 3VB5A 1BBRH 4XFQA 1NU9A 2ODPA 3BTWE 1TPOA 5AFZH 2GMTB 2CF8H 2A7CA 4DCDA 1C1TA 2A5IA 2BX4A 3Q3YA 3BTHE 4AOQA 1B0EA 5C2ZA 4K8BA 4TY7A 1EB1H 4GPGA 3M5NA 1T7CA 4WMFA 2P94A 4BAQB 3SJKA 1T32A 5E0GA 3ZZ8A 1MTNC 1FONA 1G3BA 3HGPA 1IQLA 1OWJA 1UTNA 3BTME 1BTYA 1W13U 1THRH 1WSSH 1EKBB 1GHVH 4ISOA 1TNIA 3ZZDA 1G2LA 4B76A 3ZZ7A 1ESAA 4FUIA 4D9QA 2AIQA 1FZZA 4XOJA 2G52A 4Y79A 1O2QA 1LKAA 5C5OA 2WYGA 4KTCA 1GGDB 4AFSA 1A5GH 1AY6H 2GP9B 1MD7A 1LHDH 1T8LA 3RDZA 1C5LH 1EPTB 5FPTA 3Q00A 2GGVB 4ZAEA 1V2MT 1VGCB 2GD4B 1JIMA 3EA8A 1DOJA 1GBTA 1HAZB 2OC7A 4GAWA 3QZQA 2XWBI 5C1XA 1DE7H 2F9OA 3MWIU 2R9PA 3O8CA 1CQQA 5K0HA 1KLIH 4THNH 1HIAB 2C8YB 3LGUA 1OKXA 1C5MD 5LPFA 4CBOA 3FP6E 1TOMH 2H9EH 5JBBS 4AGKA 1ORFA 1OP2A 4B1TA 2GV6A 1NZQH 1UVSH 1C2JA 4DGJA 1C1MA 1A0JA 2SGFE 2HVXA 1MTSA 3MFJA 5AF9H 5LPRA 3TU7H 4NIWA 4FUHA 1LMWB 3BG4C 1SLWB 4MNVA 3F68H 2FOEA 4D8NA 4OS7A 2QAAA 4LOYH 1C4Y2 1P57B 4WMDA 3SUGA 2FOMB 3BTEE 4GUXA 3AAUA 1V2LT 3BTFE 4CH8B 4X8UH 1EAXA 1AB9C 1TABE 5L2YH 2BDGA 1C2FA 1S0QA 1TGBA 2XWAA 1LKBA 3VB7A 3PWBA 2R3UA 4K60A 1GHBF 2PKAB 1HPGA 1EAWA 2ZU4A 1EAUA 4D7GA 4OS5A 2J38A 1HAPH 5HYOA 5DKMA 1O3BA 1CA0B 6GCHG 2VWMA 1A5IA 1A3BH 2QA9E 1GJDB 4JYVH 1TRYA 1SGNE 1O2RA 2ZPSA 1C2IA 2FX4A 3S7KB 5FX5A 3RC5A 1ANBA 2GZ7A 1ZHPA 2CGAA 1QBVH 1SLVB 2ALPA 2Y5HA 3PYHA 2ZHWH 1P02A 2I6SA 1GWAA 3KQCA 1QNJA 1O2JA 2R2WU 1O3GA 1ZSLA 1Q2WA 3U1JB 3TK9A 5CE1A 2C8ZB 1DPOA 4AYYB 3LJOA 2ZU1A 3A7TA 3MYWA 1V2OT 2A45B 3ZVCA 5T3HA 4Z0KA 5EOKA 1OYQA 5JBTA 1WYKA 1CBWC 1WBGB 1C9TA 3U69H 2JETB 1OWEA 5EQQA 3S9BA 1TPSA 1UTLM 5EPNA 1CGIE 5L2ZH 1S6FA 1M9UA 1FV9A 2PV9B 4GVUA 1UK2A 1Z71A 1GMHF 1F5RA 1LHGH 3RXRA 2OBOA 3KCGH 3ZVEA 1KIGH 1TBQH 4ZXXH 2NU4E 1ETSH 5FX6A 4KTSA 2Z9GA 1VR1H 5F03A 3E91A 3UQVA 2CHAB 1TOCB 2C8XB 2D8WA 5A8YA 1MU6B 1TB6H 3SJIA 2ZGHA 2A31A 3MH6A 3SW2B 2A4RA 1SGPE 4I8JA 1TNJA 1LVBA 1TA6A 3D49H 3UNQA 2WPMS 1INCA 3UTUH 3MI4A 2G5NA 4YT6H 4NZLA 3D65E 1ELFA 3A8DA 3M3VA 1EP6A 2NU0E 2J95A 2V0BA 1PPHE 4FU7A 1DICA 2Z3EA 1UVUH 1MKWH 3P17H 3QTVH 4GHTA 1S5SA 2RCEA 1QQ4A 4K3JA 4OS2A 4FUEA 1H8IH 3MNSA 3P92A 2FYRA 3UWIA 2Q6GA 2PGQB 2Z3CA 3M35A 1H9HE 4U32A 2AYWA 1O5DH 1SBWA 2WPKS 1YP9A 2GCTC 2BLWA 1BMMH 1TGTA 3AVZA 4MQAA 4VGCB 2VJ1A 5C67A 1CA8B 4ISNA 1DDJA 4INKA 1GHBG 3NWUA 5DGJA 4TYDA 2PLXA 3SI3H 1DM4B 3SNCA 1NS3A 1ELBA 1BRUP 1LHFH 1J14A 3ESTA 2TBSA 2BQ7B 5C5NA 4OGYA 1YF4A 1BTZA 1SGFG 4DJZB 4AB9A 1JOUB 2K1QA 1WTGH 2BD3A 1C4U2 4MNXA 2XCFA 4CRBA 1BTHH 1QA0A 2SFAA 4FUGA 3ZVGA 4Y11E 5FBIA 1U6QA 4CR9A 3R3GB 4YZUA 3ZV9A 4YLUA 3PTNA 1BDAA 4D7FA 2C3SA 1JMOH 1ARBA 1FAXA 1G3DA 2ZNKH 4YM9A 1XMNB 3RXQA 2F9UA 2D26C 2Y7XA 3UREA 1EATA 2OXSA 1TA2A 3LGYA 1UHBA 1K1NA 1C5TA 4K1TA 1GHAF 3V0XA 1FLEE 3U8OH 1GGDC 2C8WB 2A1DB 3AAVA 2HPPH 1C2KA 1MTNB 1QB9A 1SB1H 2Y82A 3U1IB 3T29A 3ELAH 3KL6A 2BDAA 4FXGH 2V6NA 2ZFTA 2P3FH 1BIOA 2XNIA 4WXVA 1W8BH 1QCPA 3GICB 3RMOH 1Y3UA 3RXOA 1GI7B 3L3TA 1GMHG 4NA8A 2ZGBH 1SQTA 3LOXA 1D3QB 1C5QA 3QX5H 3PLPA 4WXIA 3RP2A 2ZGJA 1F5LA 1BRCE 1DS2E 1HAHH 3ZVFA 1N8OC 2ZZUH 4AB8A 1ZGVA 1YPJH 1A1RA 1SLXB 4J2YB 2GTBA 1RXPA 3SNEA 2FOCA 3CS0A 1K21H 2FX6A 1HJAB 1D3PB 3NXPA 3O8RA 1PPCE 1HNEE 4GHQA 3RXHA 1O5GH 4BTIB 5E2PA 2EI6A 5B6OA 3PTBA 1ZRKA 2UUFB 1IQGA 3NCLA 5J4QA 2P95A 2UWOA 1OPHB 1L1GA 1DT2A 4YESB 1C1UH 4Y8XA 3M36A 1FQ3A 1TMTH 1CGJE 1LPZB 3TK5A 1GMDG 4DG4A 4JYUH 3ATLA 2AIPA 2TGDA 3HK6B 5T6DA 1SMFE 2F9BH 5C3NA 1TX6A 2BY6X 2FI4E 1QURH 1AD8H 5DO4H 2HWLB 1OWDA 3STIA 1EAIA 1BMLA 3GCTF 4NIVA 3ODFA 2VWOA 2ZDLA 1AI8H 4B2CA 2ZQ2A 2AFQB 4CBNA 1GCTC 1ETRH 5EPYA 1QTFA 1V2NT 2QIQA 1CA0C 3FZZA 2Y7ZA 3LIWA 2Z9JA 1V2VT 2YOLA 2A4QA 4ZROA 1UCYE 3K6ZA 1EPTA 3F9EA 1DY9A 1O3JA 1QJ1B 5GXPA 1RRKA 2XYAA 3RXSA 2P59A 3QZRA 2ZTZA 3VGCC 4IMZA 3TGJE 3BIUH 2Q6FA 4JK5A 1TGSZ 1QRWA 1A4WH 1LTOA 1GI0A 1HIAA 3B8JA 2KAIB 3Q3XA 2FPZA 1YPHC 3D62A 1IQIA 1MBQA 5A8XA 3CS7A 1EJMA 3IWMA 5ABWA 2ANWA 4Q7YA 2EA3A 1TAWA 3M5LA 1BTPA 1GL1A 1MZDA 4YLQH 4FVDA 4AX9H 3NZIA 2PR3A 3RLYH 2IJOB 1NRSH 1WU1A 1MCVA 3SNBA 1XXDA 3UWJH 4RSPA 3KIDU 2A7HA 2FOAA 3KEEA 4X6OA 3GDSA 2G51A 5FPYA 2QN5T 3BG8A 2BLVA 1O37A 3PMAB 2BDIA 2NU1E 4I8HA 1J9CH 1V2RT 3HPTB 3LONA 3SU5A 3BTKE 4DURA 4I32A 3GY4A 4CH2B 2CHAC 4TY6A 2PKAA 3T5FH 2JH6D 1CBWB 2Z6BD 1AHTH 3SNAA 1C1VH 3TGKE 3RXGA 4AGJA 1QQUA 1S83A 1QB1A 1BMAA 1TGCA 4UFEH 1GI2A 1RTLA 1O2PA 4Q2KA 5J4SA 1YPGH 5DJ7A 4YOJA 1SPJA 3DHKH 3VXEH 2OQ5A 3QN7A 2VIOA 4B2AA 3URCA 2HNTE 2BYAX 3U8TH 2TGPZ 4K1EA 1FY1A 1TNGA 3GY8A 3A7XA 2G4TA 5EXLA 1AN1E 2XC4A 4K5ZA 1LO6A 3K65B 2G00A 3F9GA 1P10A 3T62A 3V12A 1AIXH 2FXRA 1C5WB 1QL7A 4HZHA 4WVPE 2H9TH 1O36A 1FMGA 1UTJA 1S81A 1W11U 3A7YA 1GHZA 4B71A 2A32A 1E35B 4K1SA 1GL0E 4HGCA 5SGAE 1O5FH 3BTQE 4AYVB 3RC6A 1XUJA 3GCTG 1DVAH 3SI4H 1NRPH 1T31A 1JIRA 2ALVA 5ESTE 4X1SU 2BD2A 4SGBE 3RLWH 3ZZAA 1ZPCA 3P8GA 1SSXA 1L0ZA 1GBDA 1O3HA 4Y0ZE 3UFAA 1O3AA 1J17T 2ZTYA 5K7RA 1KXDA 1KXCA 2GCTB 3LPRA 5AHGH 6GCHF 1SHHB 1VCWA 1XUKA 5C1UA 3ZVBA 3BSQA 1N6XA 1YPHE 3MU8A 3C1KA 1OWHA 3ZVAA 1ETTH 4X6MA 3VB3A 2FTMA 3ENSB 2FOBA 2D1JA 2ZDAH 3KNXA 1XVOA 1TX8A 1CT4E 2HLCA 4TWYA 4I8GA 3RXEA 3VB4A 2IOTA 1AO5A 1P01A 5FBEA 4Y6DA 1NROH 2VH6A 1EP5A 5T6FA 2VIVA 2HPQH 4A1TA 1O3OA 3TK6A 4ABHA 1V6DA 3RU4D 1NFWA 1C5YB 4NWKA 4BAKB 3PO1B 3BEUA 2XRCA 5CHAB 1DLEA 1AMHA 3E16B 3MHWU 1DUEA 4Y10E 1DLKB 1C1PA 3TJNA 4X8VH 4FUDA 2PSXA 1EX3A 2J94A 1EASA 1K1LA 2XXLA 3GYLB 1NFXA 7KMEH 3STJA 2OINA 5HXFA 3EQ0H 2OC0A 4IGDA 5BPEA 1TQ0B 5DP6A 4BTTB 2BVSH 1V3XA 1NO9H 2SGAA 2GX4A 2ZCKP 1KSNA 4WH6A 1FN8A 3M3SA 3T2NA 2AGGX 2Z7FE 1C1NA 5GJ4B 4WH8A 1L1JA 1QJ6B 1HJAC 2AGIX 3AW0A 2FOHA 4HI3A 1ZMJA 1V2ST 2G55A 3DA9B 4U30A 4KP0A 3URDA 4B75A 2YNBA 3RMLH 2R0KA 4O03A 1THPB 3OYPA 2BZ6H 1BB0B 1C5RA 2UWPA 1A46H 3P6ZB 1SQAA 4MG3A 1UCYK 2W3KA 4J1YA 3LJJA 5A2MH 1N8OB 3K6YA 3UPEA 2B8OH 3ZZCA 4KGAA 2ZFQH 4XSKU 5L30H 2JKHA 1TNHA 1O3NA 1O2IA 1L2EA 1TPAE 2ZHQH 4O9VA 4AORA 1SGYE 2H1UA 2PFEA 1AVXA 3EYDA 1ABIH 4INHA 1P3EA 6CHAC 4U01A 4DVAU 2J4IA 3E1XB 1MAXA 1Y5BT 4LK4A 1SGDE 2W26A 3FAOA 3EA9A 3HKIB 2ULLA 2I6QA 3GCHB 3BEIB 1HYLA 1AE8H 2PSYA 3H5CB 2O8TA 1WQSA 3U98H 1HRTH 2SNWA 2ZFSA 3GY5A 1AUTC 1RIWC 1DWCH 2XBWA 4FU8A 4ABJA 1XX9A 4X0WU 1XUFA 1VCQA 3GISB 1BUIA 1FY5A 3LH3A 2ZQ1A 1GCTB 1N1LA 5DP9A 1XM1A 1PPGE 2JH5D 3SQEE 3ZZ6A 2Y5GA 4AZ2B 1W2KH 1O2SA 1Y3VA 4TPIZ 1SGCA 1LVYA 3K9XB 1C1QA 1BQYA 1NN6A 1OP0A 1ZJDA 3MH4A 3I78A 1A2CH 1SGTA 3VGCB 1O2XA 1EB2A 4XBDA 1NFYA 3E3TA 4FUCA 2QXHA 2WUBA 1MAYA 1Y59T 1OWIA 4B2BA 1NU7B 1D3TB 2AS9A 5TCCA 1IHSH 3PMHB 1YC0A 1YYY1 1O5EH 1PQAA 1TRNA 3SV2H 2H2ZA 1JWTA 4JZDH 2BY8X 2V3HH 3FP8E 2O9QA 1Z8IB 1HCGA 1GJCB 1Z6JH 2Z3DA 1KXEA 3KQBA 1GJBB 3MU5A 3JZ2B 2HNTF 2DUCA 2V3OH 3GDUA 1O2MA 2F9PA 5EGMA 3SQHE 1ZGIA 1SQOA 1C1RA 2EI8A 2P8OC 2ZFFH 3RXDA 5JPMH 1OYTH 4WY3A 2ILNA 1UVTH 1K1MA 3RXAA 1Z8GA 4JMYA 3SGAE 1G3EA 1PPZA 2TPIZ 1UJ1A 3MO9A 1P2JA 1ZLRA 2G4UA 2WPJS 1HB0B 1G30B 2PWXA 2CN0H 3TH3H 1Z1IA 3QUMP 1GHXH 2XC0A 5FCRA 2QYIA 3RC4A 2BMGB 1AU8A 5A09A 1C5VA 1C2DA 1EOLA 4K2YA 1O2ZA 3Q77A 3K2UA 1ZTJA 1MTWA 1XUGA 1V2KT 5AVDA 8KME2 2ZEBA 1ZPBA 4Y7AA 2KAIA 3TVJB 2FI3E 1QHRB 3BTTE 3FANA 1W3CA 3E6PH 4MTBA 2OC1A 8LPRA 1AE5A 1O3LA 4X1RU 4NGAH 1MCTA 1O35A 8ESTE 1DFPA 5JB9S 1GMDF 4U2WA 3TPIZ 2LNCA 1NTPA 2VVUA 1PYTD 3PLBA 1ZZZA 1O5AB 1Q31A 2F91A 6LPRA
chains in the Genus database with same CATH superfamily
1B5GH 2O8MA 1O2UA 2A2XH 1V2JT 1FI8A 3TNTA 3RMMH 2FP7B 1VJAU 3SO3A 1P06A 4ABIA 1O2NA 1ANDA 2FDAA 1SHYA 1WDIA 4UE7H 5F6MA 3LGIA 1ZMLA 1QR3E 1WTHD 1LQDB 1C2GA 4ABGA 1YGCH 3PMJA 5EW2H 1HLTH 4BNRA 5DK1A 1MABB 2ZHFH 1GJ4H 1TRMA 1EJAA 1HGTH 1GDUA 2CK3D 2FOGA 4A6LA 1A0LA 1P12E 2THFB 4YOGA 1LVMA 1C5SA 3RMNH 1HV7A 3F2GA 1GI9B 3M7TA 1TPPA 4RKJB 3MU0A 3MO6A 3RUOA 2WV4A 5DP3A 2Q1JA 3M7UA 2WPLS 5HM2A 1SGEE 2SNVA 3PO1C 4DY7B 5CHAC 5EXNA 3QWCH 3PROA 2FO9A 1YPMH 2GV7A 3P95A 3ATMA 3L33A 1VITG 2ZI2H 1NC6A 1SGRE 2KCOA 7ESTE 1K2I1 1V2QT 1W0YH 4INLA 3SU4A 1O33A 1MMJN 1GDQA 1N6YA 3NRLA 4ZKNU 1IQHA 3P8OA 2ZO3H 1QL9A 2ZU3A 1C2MA 4X2WA 2YMSD 1OS8A 3OEED 2XCNA 2H5DA 4XBCA 5A0BA 1DY8A 3WWFA 7GCHG 1S84A 1O32A 1ZMNA 2R3YA 1C5OH 1BOQA 2PP6A 2PGBB 2ZDNA 1UVPA 3PLKA 1LVOA 4IMQA 1C4V2 1YCPK 2QGRA 1HXFH 2KM0A 3E90B 2YMSC 1GI3A 4OS6A 1ELCA 7LPRA 4A92A 3M3TA 2ZU2A 2O8LA 2AMDA 2HVYB 1ZHRA 1MUEB 5CMXH 1YPEH 3MH5A 1WV7H 2LP6A 4AFUA 2XC5A 2ZF0H 1K0HA 1SL3A 3NK8A 1SGQE 2ZKSA 4DIHH 2WUCA 3KQDA 2TGTA 3OY6U 1MH0A 3LGVA 3DFLA 3I77A 4E7RG 1E38B 3LGTA 2J9NA 4IN1A 3MNXA 1AVGH 4UD9H 3SUEA 2QXJA 1O2KA 2CJIA 2TIOA 2JIZD 4GSOA 4ZCNA 1EZSC 2AMPA 1ELVA 1UMAH 2OTVA 1J15A 1PQ5A 3FZDA 3BN9A 1HDTH 1FIZA 1J8AA 4TSFD 2CXVA 1UTQA 3VB6A 1K1OA 2J92A 5ETXA 1GDNA 2FWWA 2GT7A 3GCHC 5ESBA 1FNIA 1GBBA 1P04A 3TH4H 1O2WA 2BXTH 3GYMA 4K8YA 1G32B 3RXJA 4AN7A 4X8TH 1O2LA 1SVPA 5E0HA 2H9HA 3N7OA 4I7YH 1ZJKA 5HM9A 1S0RA 2AGEX 1DSUA 3SV6A 1BBRE 6CHAB 3F3BA 1QBNA 5DP8A 5T6GA 1TMUH 2G81E 1W14U 1NESE 2OC8A 4WJG2 4NFFA 3UNSA 3PRDA 3DD2H 1SFQB 4FETA 1P0SH 1IQKA 1KLTA 5DPAA 2IN2A 4CRDA 3DUXH 3SUFA 4B6EA 2FTLE 1O3KA 1OX1A 2F9VA 1RIWB 5JDUB 2PTNA 1DSTA 4H6TA 4WMEA 1ID5H 1LDTT 4ASUD 2CMYA 1ELTA 1GG6C 2VGCC 4OS1A 5C94A 1MQ5A 3G01A 4R0IA 5EU8A 5DP7A 1LQEA 2BOHB 1MD8A 4MPVA 3S0NA 3P8FA 4FVBA 3A89A 3FKSD 2Y5FA 3MTYA 1H9LB 1PPBH 1HXEH 4CRGA 1C9PA 1UO6A 3OX7U 1S82A 1NBME 5EQSA 3LC3A 5EJ1A 1G9IE 4X2VA 1SLUB 1KYNA 1GHYH 2FS9A 1F2SE 1ABJH 1O38A 3F9HA 1TGNA 2NU2E 1BTXA 1O2TA 1RGQA 2D2DA 4JZ1A 4Q7ZA 3U8RH 4AFZA 1F7ZA 2M5TA 2FIRH 2SGQE 3M5MA 4MDSA 4DT7B 3MU1A 3OE7D 2BD9A 3BV9B 4Y8YA 1L1NA 1LPGB 4Y71A 1HAOH 2W5EA 1G3CA 1DXWA 3UIRA 4ZHLU 1O39A 1F0RA 2G8TA 3KHVA 4BAHB 2Y6TA 3AASA 4QT8C 4YT7H 2HGTH 3SBKA 2P8OB 3A85A 4H6SB 2NU3E 1GI4A 2BQ6B 4UEHH 1C2HA 4Y76A 4CR5A 4CREA 3UR9A 3UNRA 2V3MA 3C27B 3SUDA 3M61U 2ZIQH 5HGGA 1C2EA 1ZRBA 2BD4A 3E0NB 2GDEH 1GMCG 1ESBA 4ZXYH 2VINA 3RXVA 4FOUC 3RXCA 1D6WA 1QY6A 1YPKH 1YWUA 1IQJA 1Y5UT 1A0HB 1BCUH 1K22H 2BD7A 5E0JA 5LGOA 1AWFH 3JZ1B 1FJSA 4IC6A 3M37A 1C1OA 3CP7A 5FHTA 1H8ED 1KXFA 1TNLA 1JXPA 2PKSC 2AERH 2VWNA 4CHAC 1O3DA 5GNDA 1O3FA 2FODA 4A1XA 3RXMA 2BLQA 1GVZA 4MNYA 1W12U 1K28D 3SJ9A 1YCPM 1GBIA 3W1EA 1KTSB 1HAXB 1YLDA 2RG3A 2FYQA 1O0DH 2Y80A 1OP8A 3A87A 1CVWH 4B6FA 3RXKA 3MO3A 2ANKH 1HAVB 3ZVDA 3A83A 5IYTA 1G2MA 1C2LA 5A8ZA 3ATKA 1H8HD 1GBHA 1A5HA 3TGIE 5GIBA 2J98B 4ESTE 5H4IB 3M5OA 5F53A 1GBMA 3GCNA 4A5TS 5JBAS 2DE9A 1SFIA 2UWLA 3HKJB 4PROA 2EC9H 1V2UT 1AKSB 2AEIH 1MZAA 4I33A 3FFGA 2ZPRA 3OTPA 1AFQC 4JCNA 3EE7A 3SZEA 1T8NA 1GI6A 1XUHA 4X6NA 1P03A 1OXGA 1HAIH 1YPLH 4BOHA 1GI5A 1BHXF 4O97A 1W7GH 3QDZB 4FUJA 2IPHA 1RFNA 2TGAA 3A86A 5L6NH 4FUBA 1PPEE 3BEFB 4HFPB 2WHXA 2A5KA 3DSOA 1BA8B 4Y8ZA 1MKXK 1L4ZA 3E8LA 1S6HA 4B74A 4GCHG 1GBKA 2BX3A 4YTAA 4I8LA 2UUKB 1RTKA 2VBCA 2A4GA 1D3DB 5C0TA 3DT0H 2BDBA 3SU1A 1JRTA 2BQWB 2SGPE 1O2HA 1SG8B 2BY5X 3GY3A 3PMBB 4DIIH 2XBYA 3WWBA 1DXPA 1SR5C 1ANCA 2FM2A 3KQ5A 3V13A 1ZHMA 1UCYH 1Y3WA 2PHBA 4JZIA 3GOVB 1J16A 1RS0A 4Q80A 3VFEA 5CDFE 4ISHH 1BITA 1QRXA 2Z9IA 3OSYA 3TIUA 2VU8E 4ZUHA 1GBFA 1BBRK 5EODA 1GI1A 2C90B 5I25A 1COWD 1P8VC 1X7AC 4JZFH 2YMSB 1P2QA 4UFFH 4IW4E 2ZDVH 2BVXH 4HTCH 3RM2H 4DW2U 5EIYA 3IITA 2FI5E 4ABBA 4BAMB 2VIDA 1BTWA 1AFEH 1W10U 2OBQA 1CU1A 3PRBA 1GBEA 1WQVH 1F0SA 3ZV8A 4F4OC 2GT8A 1Y5AT 3T25A 3P8NA 4CRFA 2BDCA 2QXGA 2YNAA 1ZTKA 3T27A 3KQEA 3SU6A 2ZECA 5EW1H 2XBVA 5F8TA 2WINI 1WAYB 2R2MB 4SGAE 4Z6AH 4ZKSU 2OQUA 1MTUA 4ISIH 2ANMH 2Z9LA 4AFQA 2ZHEH 3GDVA 1RD3B 3SU3A 1KXAA 1K1IA 4F55A 3SV7A 1O3CA 3GY2A 2STAE 1WOFA 3EA7A 1P2MA 4KKDA 1FIWA 1PJPA 2BXUH 2OCVB 3ODDA 1GBCA 3PV4A 3KYFA 2C4FH 1VITH 1QRZA 2BY9X 1P05A 1GBAA 1E36B 1BT7A 2Z9KA 1P2KA 2QF3A 1TIOA 2F83A 4M9FA 3F6UH 1SGIB 1O3PB 1O3IA 3BIVH 1EZQA 3ZZBA 1KDQB 1P9SA 5E2OA 1SOZA 3NKKA 1DANH 5C17A 2C93B 4X1QU 1SI5H 3KGPA 2HALA 1V2TT 2NWNA 4WWYA 4XD7D 2B0FA 3A81A 2P93A 3IG6B 2RDEA 1O5CB 1QZ8A 4JYTA 2WPIS 3LDXH 2K8IA 3HGNA 2B7DH 1UVOA 4Y0YE 1NRNH 3A82A 1GBJA 1DITH 1E0FD 1Y3XA 1SC8U 2A4OA 4HG6A 1VITF 3N99A 3SU2A 2B9LA 1YM0A 1GG6B 1UK3A 1TBRH 2VGCB 3EAJA 3SV8A 2VH0A 1NM6A 1A61H 2J34A 1K1JA 4Y7BA 1Z6EA 1TQ7B 2ZTXA 2GDDA 3RU4E 3SJOA 5GDSH 3SZNA 3NPSA 4ASHA 2J97A 4TT3D 1CHOG 1TONA 2PTCE 1C1WH 4A7IB 4RKOB 1EOJA 4X1NU 3BTDE 1Y8TA 3V7TA 7GCHF 4ZMAH 2FS8A 4FU9A 1BJVA 3UR6A 2BM2A 3H7TA 5FAHA 5KECA 2EEKA 4Q7XA 1AZ8A 4GLYA 1ELEE 4UFGH 1UTPA 2ZC9H 3ZZ9A 2A2QH 3RXBA 2W7UA 2ZFRH 2ZCLP 1E37B 1ZPZA 4NG9H 3VEQB 2FOFA 2ZU5A 3MMGA 2BB4A 3LU9B 2FEQH 4RN6A 1T4VH 4IC5A 2AH4X 3UOUA 2OUAA 1GJ9B 4BAOB 1C5UA 3DCLA 2BLOA 3SNDA 3HK3B 1VKYA 1HAYB 1FDPA 5C20A 1HJ8A 1GBLA 4CRCA 4RT0A 1TE0A 1NRRH 1GCDA 3F1SB 2A7JA 3W95A 3LC5A 1FPCH 4KTUA 2WYJA 3E0PB 2VIPA 3SHAH 1W7XH 3PM3A 1GHWH 1P09A 1A3EH 5FPSA 4ZHMU 5FXLA 1V2WT 4MPUA 4M7GA 1O2VA 1CSOE 1P11E 3NUMA 2ZA5A 1H4WA 4IN2A 1O30A 3SGBE 1TWXB 3BTGE 1HUTH 4NA7A 1RJXB 1P2IA 2QF0A 1V2PT 3VXFH 2GVFA 2EI7A 2PKSB 1OSSA 1FY4A 2ASUB 4MPWA 1DX5M 3SHCH 3N7EA 1O2GH 4H42U 2QE7D 4CHAB 4NZQA 5BRRE 1W0KD 1OOKB 2BD8A 1CT2E 1NRQH 2FZZA 4BANB 3PWCA 1F92A 1LPKB 2V7QD 4MPXA 1Y3YA 1BRAA 1B7XB 1ARCA 1GVLA 3FP7E 3VPKA 1A7SA 4OS4A 1DUAA 1ELAA 1PYTC 1GJ8B 2ZPQA 3ATIA 3OTJE 1HAGE 3ZZ5A 4UONA 4ZKRU 1YBWA 2RDLA 5G4BA 1GJAB 3F9FA 4D76A 1PFXC 6ESTA 5DP4A 9ESTA 1IQNA 4YOIA 1TFXA 2HOBA 4BTUB 1CT0E 1NY22 1PPFE 5F8XA 3Q3KA 2VNTA 3UAIC 2BZAA 1AFQB 3SOSA 3LT3A 1EXFA 1CO7E 3Q76A 1MKWK 3QO6A 2RA0A 8GCHF 2AHME 5JYIA 1OWKA 4TWWA 3A8AA 2BTCE 1C5ZB 4XE4A 1WUNH 3FVFB 3SGQE 1D4PB 1YCPH 2SGDE 2H6MA 1DWDH 3TJOA 1D6RA 2GMTC 2VIWA 1NFUA 3MNBA 1CE5A 5DG6A 1ZR0A 1ZSKA 1FN6A 3ZZ4A 3GY7A 2EY4C 3RXLA 1HAVA 3R0FA 2BY7X 1MTVA 1FY8E 2QXIA 2SGEE 1FXYA 1UTOA 1H1BA 1C5XB 2JH0D 2Y81A 4AG1A 1GJ6A 5F8ZA 2J98A 4ABFA 3H09A 4ABAA 1AQ7A 1O34A 1EZUC 3M7QA 1P2OA 1G36A 4R8TB 1MU8B 2BOKA 4Z1MD 3A7WA 1AKSA 4BXWA 3DFJA 1TX7A 1TALA 3OY5U 1QJ7B 1F0UA 2O8WA 2DE8A 3UUZA 3RXIA 1ACBE 5HMAA 1EPTC 4ZH8A 1TMBH 1T4UH 5EG4A 1VGCC 4ZHAA 5C0UA 3A7ZA 1AVWA 1FUJA 1GMCF 1P9UA 2HRVA 4NIXA 3WW7A 2OD3B 4YO9A 1KLJH 3RXFA 4E05H 1FAKH 3S7HB 4UDWH 2ANYA 3QGNB 1O5BB 1EQ9A 1UK4A 2KCYA 3I29A 5JB8S 5GCHF 4OGXA 3B23B 2EQNA 4ISLA 1PQ8A 3HATH 3MH7A 2ZCHP 1QGFA 4KELA 2BDHA 3OU0A 5A0CA 5LPEA 4BXSA 5I46H 1LHEH 1UTMA 3T26A 3MU4A 1IHTH 2GZ9A 4I31A 5B6LA 1TBZH 1EJNA 2VVCA 4NA9H 3UQOA 1HFDA 5DSFA 2ZP0H 5TCAA 3SJ8A 5C1YA 1VCPA 1KY9A 2VB0A 2VVVA 1JRSA 5A0AE 2F9NA 2JJ1D 4X1PU 4X2XA 2XBXA 2ESTE 1BJUA 4NSYA 1TNKA 3O8BA 1K1PA 3KN2A 1CGHA 2Z94A 4D9RA 2GCHF 1ELGA 2GJGA 2IPQX 2HNTC 2ZWLH 1JBUH 4AG2A 1ZOMA 2VWLA 2R0LA 1QB6A 3CENA 4X8SH 1IQFA 2B5TB 4XDEA 1MQ6A 1GI8B 2KCPA 1DWEH 2GKVE 3LGWA 3A88A 4DOQA 1ZTLA 3GY6A 1ESTA 2CV3A 1O2YA 3BG4B 3BF6H 2V35A 4O3UA 1QA7A 2F43B 2ZGCA 1O2OA 1Z1JA 1QFKH 3ITIA 3MOCA 1L4DA 1HJ9A 1XXFA 2STBE 3FO8D 1AB9B 1H8DH 1KTTB 1XVMA 2TRMA 2G5VA 3SV9A 8GCHG 2PUXB 1Z8RA 2ZDKA 4ZKOU 1ZSJA 1GJ5H 1GPZA 3A7VA 2FESH 2QC2A 4GCHF 5PTPA 3QK1A 4ABDA 2BVRH 2ZGXH 4E06H 1T8OA 4MVNA 1SGFA 1TLDA 1UTKA 1OHHD 2KX4A 3P70B 4F49A 3OFND 1G37A 3CNRA 2LPRA 1XUIA 2FMJA 4NCYA 5GPIB 3S9AA 2FLRH 3A8CA 2P3UB 1THSH 1KXBA 5DP5A 3UOPA 2F3CE 2ZG0H 3RXUA 2O8UA 4TPYA 1YKTA 5FCKA 3L6PA 2PUQH 4NSVA 3UY9A 2BD5A 4JK6A 1QBOA 1CHGA 4DT4A 1MBMA 1F5KU 2VIQA 1EFRD 2AMQA 4WF8A 2JETC 2PW8H 1EZXC 3RXPA 1XKAC 1AWHB 4ABEA 1GHAG 1FPHH 1E34B 4I8KA 3EE0B 2P16A 4B73A 1KDQA 2ODYB 3O8DA 3SORA 3S69A 3A8BA 5EQRA 5JBCS 5EXMA 1C5NH 1D9IA 2QCYA 1SKYE 2XNDD 2JJ2D 2QY0B 3TJVA 1AZZA 1ANEA 3B9FH 3TNSA 1P3CA 3ZZ3A 1HBTH 4X6PA 1DWBH 2ZFPH 2W7SA 3F0OA 5TJXA 2BHGA 1O3EA 2QV1A 4CRAA 5GCHG 3KF2A 4FUFA 1VJ9U 1LCYA 1K9OE 1BTUA 3ZYEA 1QL8A 3ZYDA 9LPRA 3GCOA 2RA3A 1AUJA 1C1SA 1O31A 2OP9A 3V3MA 2Q6DA 1BHXB 3SN8A 3EDXB 2WV5A 1TYNA 2ZDMA 1NT1A 3H7OA 4E7NA 4Q4LA 3RU4T 2H5CA 1WCZA 1IQEA 4K69A 4UFDH 4LXBH 2W3IA 2ODQA 2XTTB 5E8EH 1ZYOA 1RTFB 1KMHB 1LHCH 3A80A 4LZ1H 1BZXE 3TJUA 5AFYH 3S9CA 1T8MA 5LH8A 4LZ4B 1S85A 2GCHG 3ATWA 3RXTA 4MLFB 1UHBB 3QGJA 1GJ7B 4XBBA 3A84A 3F2HA 4IS5A 1MKXH 2UUJB 4H4FA 3RM0H 1XKBC 1GVKB 3TLOA 2BDYA 1Z7KA 2ZHDA 3LKWA 4VGCC 3T28A 3D23A 1P2NA 4X2YA 1W0ZU 2UUYA 1IAUA 1QIXB 1YLCA 3UB0A 3U9AH 5GWZA 1AGJA 1IQMA 1BRBE 2GZ8A 2WPHS 1IOEA 3QTOH 1F0TA 2XW9A 4MNWA 2A0QB 1ELDE 2A5AA 3EGKH 1VZQH 1PQ7A 2FLBH 4NWLA 3TITA 1EUFA 2OLGA 3MNCA 3WY8A 1C5PA 3QLPH 3SU0A 3W94A 1B0FA 2L74A 3LH1A 3PB1E 3TH2H 4JZEH 2CF9H 1Z8JB 5IDKA 1H9IE 1NPMA 1BMNH 1Q3XA 4NIYA 1SOTA 4A1VA 3AW1A 2J2UA 4O3TA 1O3MA 1FY3A 1CHOF 5CHBA 4NFEA 4IBLH 2P3TB 3VB5A 1BBRH 4XFQA 1NU9A 2L6OA 2ODPA 3BTWE 1TPOA 5AFZH 2GMTB 2CF8H 2A7CA 4DCDA 1C1TA 2A5IA 2BX4A 3Q3YA 3BTHE 4AOQA 1B0EA 5C2ZA 4K8BA 4TY7A 5IK2D 1EB1H 4GPGA 3M5NA 1T7CA 4WMFA 2P94A 4BAQB 3SJKA 1T32A 5E0GA 3ZZ8A 1MTNC 1E79D 1FONA 1G3BA 3HGPA 5T1VA 1IQLA 1OWJA 1UTNA 3BTME 1BTYA 1W13U 1THRH 1WSSH 1EKBB 1GHVH 4ISOA 1TNIA 3ZZDA 2HLDD 1G2LA 4B76A 3ZZ7A 1ESAA 4FUIA 4D9QA 2AIQA 1FZZA 4XOJA 2G52A 4Y79A 1O2QA 1LKAA 5C5OA 2WYGA 4KTCA 1GGDB 4AFSA 1A5GH 1AY6H 2GP9B 1MD7A 1LHDH 1T8LA 3RDZA 1C5LH 1EPTB 5FPTA 3Q00A 2GGVB 4ZAEA 1V2MT 1VGCB 2GD4B 1JIMA 3EA8A 1DOJA 1GBTA 4P02A 1HAZB 2OC7A 4GAWA 1YLNA 3QZQA 3AK5A 2XWBI 5C1XA 5KGOA 1DE7H 2F9OA 3MWIU 2R9PA 3O8CA 1CQQA 5K0HA 1KLIH 4THNH 1HIAB 2C8YB 3LGUA 1OKXA 1C5MD 5LPFA 4CBOA 3FP6E 1TOMH 2H9EH 5JBBS 4AGKA 1ORFA 1OP2A 4B1TA 2GV6A 1NZQH 1UVSH 1C2JA 4DGJA 1C1MA 1A0JA 2SGFE 2HVXA 1MTSA 3MFJA 5AF9H 5LPRA 2K0QA 3PV5A 3TU7H 4NIWA 4FUHA 1LMWB 3BG4C 1SLWB 4MNVA 3F68H 2FOEA 4D8NA 4OS7A 2QAAA 4LOYH 1C4Y2 1P57B 4WMDA 3SUGA 2FOMB 3BTEE 4GUXA 3AAUA 1V2LT 3BTFE 4CH8B 4X8UH 1EAXA 1AB9C 1TABE 4F48B 5L2YH 2BDGA 1C2FA 1S0QA 1TGBA 2XWAA 1LKBA 3VB7A 3PWBA 2R3UA 4K60A 1GHBF 2PKAB 1HPGA 1EAWA 2ZU4A 1EAUA 4D7GA 4OS5A 2J38A 1HAPH 5HYOA 5DKMA 1O3BA 1CA0B 6GCHG 2KFWA 2VWMA 4ACBA 1A5IA 1A3BH 2QA9E 1GJDB 4JYVH 3FN8A 1TRYA 1SGNE 1O2RA 1SQRA 2ZPSA 1C2IA 2FX4A 3S7KB 5FX5A 3RC5A 1ANBA 2GZ7A 1ZHPA 2CGAA 1QBVH 1SLVB 2ALPA 2Y5HA 3PYHA 2ZHWH 1P02A 2I6SA 1GWAA 3KQCA 1QNJA 1O2JA 2R2WU 1O3GA 1ZSLA 1Q2WA 3U1JB 3TK9A 5CE1A 2C8ZB 1DPOA 4AYYB 3LJOA 2ZU1A 3A7TA 3MYWA 1V2OT 2A45B 3ZVCA 5T3HA 4Z0KA 5EOKA 1OYQA 5JBTA 1WYKA 1CBWC 1WBGB 1C9TA 3U69H 2JETB 1OWEA 5EQQA 3S9BA 1TPSA 1UTLM 5EPNA 1CGIE 5L2ZH 1S6FA 1M9UA 1FV9A 2PV9B 4GVUA 1UK2A 1Z71A 1GMHF 1F5RA 3U28C 1LHGH 3RXRA 2OBOA 3KCGH 3ZVEA 1KIGH 1TBQH 4ZXXH 2NU4E 1ETSH 2WZQA 5FX6A 4KTSA 2Z9GA 1VR1H 5F03A 3E91A 3UQVA 2CHAB 1TOCB 2C8XB 2D8WA 3OEHD 5A8YA 5DN6D 1MU6B 1TB6H 3SJIA 2ZGHA 2A31A 3MH6A 3SW2B 2A4RA 1SGPE 4I8JA 1TNJA 1LVBA 1TA6A 3D49H 3UNQA 2WPMS 1INCA 3UTUH 3MI4A 2G5NA 4YT6H 4NZLA 3D65E 1ELFA 1W0JD 3A8DA 3M3VA 5HIYA 1EP6A 2NU0E 2J95A 3DSPA 2V0BA 1PPHE 4FU7A 4RT1A 1DICA 2Z3EA 1UVUH 1MKWH 3P17H 3F0PA 3QTVH 4GHTA 1S5SA 2RCEA 1QQ4A 4K3JA 4OS2A 4FUEA 1H8IH 3MNSA 3P92A 2FYRA 3UWIA 2Q6GA 2PGQB 2Z3CA 3M35A 1H9HE 4U32A 2AYWA 1O5DH 1SBWA 2WPKS 1YP9A 2GCTC 4AC9A 2BLWA 1BMMH 1TGTA 3AVZA 4RI0A 4MQAA 4VGCB 2VJ1A 5C67A 2W6JD 1CA8B 4ISNA 1DDJA 4INKA 1GHBG 3NWUA 5DGJA 4TYDA 2PLXA 3SI3H 1DM4B 3SNCA 1NS3A 1ELBA 1BRUP 1LHFH 1J14A 3ESTA 2TBSA 2BQ7B 5C5NA 4OGYA 1YF4A 1BTZA 1SGFG 4DJZB 4AB9A 1JOUB 2K1QA 1WTGH 2BD3A 1C4U2 4MNXA 2XCFA 4CRBA 1BTHH 1QA0A 2SFAA 2JDID 4FUGA 3ZVGA 4Y11E 5FBIA 1U6QA 4CR9A 3R3GB 4YZUA 3ZV9A 4YLUA 3PTNA 1BDAA 4D7FA 1NBMD 1JMOH 2C3SA 1ARBA 1FAXA 1G3DA 2ZNKH 4YM9A 1E1RD 1XMNB 3RXQA 2F9UA 2QF4A 2D26C 2Y7XA 3UREA 1EATA 2OK5A 2OXSA 1TA2A 3LGYA 1UHBA 1K1NA 1C5TA 4K1TA 1GHAF 3V0XA 1FLEE 3U8OH 1GGDC 2C8WB 2KCAA 2A1DB 3AAVA 2HPPH 1C2KA 1MTNB 1QB9A 1WXRA 1SB1H 2Y82A 3U1IB 3VG8A 3T29A 3ELAH 3KL6A 2BDAA 4FXGH 2V6NA 2ZFTA 2P3FH 1BIOA 2XNIA 4WXVA 1W8BH 1QCPA 3GICB 3RMOH 1Y3UA 3RXOA 1GI7B 3L3TA 1GMHG 4NA8A 2ZGBH 1SQTA 3LOXA 1D3QB 1C5QA 3QX5H 3PLPA 4WXIA 3RP2A 2ZGJA 1F5LA 1BRCE 1DS2E 1HAHH 3ZVFA 1N8OC 2ZZUH 4AB8A 1ZGVA 1YPJH 1A1RA 1SLXB 4J2YB 2GTBA 1RXPA 3SNEA 4OM9A 2FOCA 3CS0A 1K21H 2FX6A 3GS9A 1HJAB 1D3PB 3NXPA 3O8RA 1PPCE 1HNEE 4GHQA 3RXHA 1O5GH 4BTIB 5E2PA 2EI6A 5B6OA 3PTBA 1ZRKA 2UUFB 1IQGA 3NCLA 5J4QA 2P95A 2UWOA 1OPHB 1L1GA 1DT2A 4YESB 1C1UH 4Y8XA 3M36A 1FQ3A 5HIZA 1TMTH 1CGJE 1LPZB 3TK5A 1GMDG 5EJZA 4DG4A 4JYUH 3ATLA 2AIPA 2TGDA 3HK6B 5T6DA 1SMFE 2F9BH 5C3NA 1TX6A 2BY6X 2FI4E 1QURH 1AD8H 5DO4H 2HWLB 1OWDA 3STIA 1EAIA 1BMLA 3GCTF 4NIVA 3ODFA 2VWOA 2ZDLA 1AI8H 4B2CA 1FX0B 2ZQ2A 2AFQB 4CBNA 1GCTC 1ETRH 5EPYA 1QTFA 1V2NT 2QIQA 1CA0C 3FZZA 5KEDA 2Y7ZA 3LIWA 2Z9JA 1V2VT 2YOLA 2A4QA 4ZROA 1UCYE 3K6ZA 1EPTA 3F9EA 1DY9A 1O3JA 1QJ1B 5GXPA 1RRKA 2XYAA 3RXSA 2P59A 3QZRA 2ZTZA 3VGCC 5FL7D 4IMZA 3TGJE 3BIUH 2Q6FA 4JK5A 1TGSZ 1QRWA 1A4WH 1LTOA 1GI0A 1HIAA 3B8JA 2KAIB 3Q3XA 2FPZA 1UW7A 1YPHC 3D62A 1IQIA 1MBQA 5A8XA 3CS7A 1EJMA 3IWMA 5ABWA 2ANWA 4Q7YA 2EA3A 1TAWA 3M5LA 1BTPA 1GL1A 1MZDA 4YLQH 4FVDA 3N7DA 4AX9H 3NZIA 2PR3A 3RLYH 2IJOB 1NRSH 1WU1A 1MCVA 3SNBA 1XXDA 3UWJH 4RSPA 3KIDU 2A7HA 2FOAA 3KEEA 4X6OA 3GDSA 2G51A 5FPYA 2QN5T 3BG8A 2BLVA 1O37A 2XOKD 3PMAB 2BDIA 2NU1E 4I8HA 1J9CH 1V2RT 3HPTB 3LONA 3SU5A 3BTKE 3PV2A 4DURA 2LELA 3GY4A 4I32A 2CHAC 4CH2B 4TY6A 2PKAA 3T5FH 2JH6D 1CBWB 2Z6BD 1AHTH 3SNAA 1C1VH 3TGKE 3RXGA 4AGJA 2M2AA 1QQUA 1S83A 1QB1A 1BMAA 1TGCA 4UFEH 1GI2A 1RTLA 1O2PA 4Q2KA 5J4SA 1YPGH 5DJ7A 4YOJA 1SPJA 3DHKH 3VXEH 4XRNA 2OQ5A 3QN7A 2VIOA 4B2AA 3URCA 2HNTE 2BYAX 3U8TH 2TGPZ 4K1EA 1FY1A 1TNGA 3GY8A 3A7XA 2G4TA 5EXLA 1AN1E 2XC4A 4K5ZA 1LO6A 3K65B 2G00A 3F9GA 1P10A 3T62A 3V12A 1AIXH 2FXRA 1C5WB 1QL7A 4HZHA 4WVPE 2H9TH 1O36A 1FMGA 1UTJA 1S81A 1W11U 2KR7A 1GHZA 3A7YA 4B71A 2A32A 1E35B 4K1SA 1GL0E 4HGCA 5SGAE 1O5FH 3BTQE 4AYVB 3RC6A 1XUJA 3GCTG 1DVAH 3SI4H 3SYJA 1NRPH 1T31A 1JIRA 2ALVA 5ESTE 4X1SU 2BD2A 2W6ID 2J5UA 4SGBE 3RLWH 3ZZAA 3DSGA 1ZPCA 3P8GA 1SSXA 1L0ZA 1GBDA 3ZIAD 1O3HA 4Y0ZE 3UFAA 1YY3A 1O3AA 1J17T 2ZTYA 5K7RA 1KXDA 1KXCA 2GCTB 3LPRA 5AHGH 6GCHF 1SHHB 1VCWA 1XUKA 5C1UA 3ZVBA 2WV9A 3BSQA 1N6XA 1YPHE 3MU8A 3C1KA 1OWHA 3MQKC 3ZVAA 1ETTH 4X6MA 3VB3A 2FTMA 3ENSB 2FOBA 2D1JA 2ZDAH 3KNXA 1XVOA 1TX8A 1CT4E 2HLCA 4TWYA 4I8GA 3RXEA 3VB4A 2IOTA 1AO5A 1P01A 5FBEA 4Y6DA 1NROH 1S6LA 2VH6A 1EP5A 5T6FA 2VIVA 2HPQH 4A1TA 1O3OA 3TK6A 2IJD1 4I86A 3OAAD 1V6DA 3RU4D 4ABHA 1NFWA 1C5YB 4NWKA 4BAKB 3PO1B 3BEUA 2XRCA 5CHAB 1DLEA 1AMHA 4Q63A 3E16B 3MHWU 1DUEA 4Y10E 1DLKB 1C1PA 3TJNA 4X8VH 4FUDA 2PSXA 1EX3A 2J94A 1EASA 1K1LA 2XXLA 3GYLB 1NFXA 7KMEH 3STJA 2OINA 5HXFA 3EQ0H 2OC0A 4IGDA 5BPEA 1TQ0B 5DP6A 4BTTB 2BVSH 1V3XA 1NO9H 2SGAA 2GX4A 2ZCKP 1KSNA 4WH6A 1FN8A 3M3SA 3T2NA 2AGGX 2Z7FE 1C1NA 5GJ4B 4WH8A 1L1JA 1QJ6B 1HJAC 2AGIX 3AW0A 2FOHA 4HI3A 1ZMJA 1V2ST 2G55A 3DA9B 4U30A 2F4LA 4KP0A 3URDA 4B75A 2YNBA 3RMLH 2R0KA 4O03A 1THPB 2WSSD 3OYPA 2BZ6H 1BB0B 1C5RA 2UWPA 1A46H 3F2FA 3P6ZB 1SQAA 4MG3A 1UCYK 2W3KA 4J1YA 3LJJA 5A2MH 1N8OB 3K6YA 3UPEA 2B8OH 3ZZCA 4KGAA 2ZFQH 4XSKU 5L30H 2JKHA 1TNHA 1O3NA 1O2IA 1L2EA 1TPAE 2ZHQH 4O9VA 4AORA 1SGYE 2H1UA 2PFEA 1AVXA 3EYDA 1ABIH 4INHA 1P3EA 6CHAC 5HKKD 4U01A 4DVAU 2J4IA 3E1XB 1MAXA 1Y5BT 4LK4A 1SGDE 2W26A 3FAOA 3EA9A 3HKIB 2ULLA 2I6QA 3GCHB 3BEIB 1HYLA 1AE8H 3FOAA 2PSYA 3H5CB 2O8TA 1WQSA 3U98H 1HRTH 2SNWA 2ZFSA 3GY5A 1AUTC 1RIWC 1DWCH 2XBWA 4FU8A 4ABJA 1XX9A 4X0WU 1XUFA 1VCQA 3GISB 1BUIA 1FY5A 3LH3A 2ZQ1A 1GCTB 1N1LA 5DP9A 1XM1A 1PPGE 2JH5D 3SQEE 3ZZ6A 2Y5GA 4AZ2B 1W2KH 1O2SA 1Y3VA 4TPIZ 1SGCA 1LVYA 3K9XB 1C1QA 1BQYA 1NN6A 1OP0A 1ZJDA 3MH4A 3I78A 1A2CH 1SGTA 3VGCB 1O2XA 1EB2A 1BMFD 4XBDA 1NFYA 3E3TA 4FUCA 2QXHA 2WUBA 1MAYA 1Y59T 1OWIA 4B2BA 2RFKC 1NU7B 1D3TB 2AS9A 5TCCA 1IHSH 3PMHB 1YC0A 1YYY1 1O5EH 1PQAA 1TRNA 3SV2H 2H2ZA 1JWTA 4JZDH 2BY8X 2V3HH 3FP8E 2O9QA 1Z8IB 1HCGA 1GJCB 1Z6JH 2Z3DA 1KXEA 3KQBA 4P00A 1GJBB 3MU5A 3JZ2B 2HNTF 2DUCA 2V3OH 3GDUA 1O2MA 2F9PA 5EGMA 3SQHE 1ZGIA 1SQOA 1C1RA 2EI8A 2P8OC 2ZFFH 3RXDA 5JPMH 1OYTH 4WY3A 2ILNA 1UVTH 1K1MA 3RXAA 1Z8GA 4JMYA 3SGAE 1G3EA 1PPZA 2TPIZ 1UJ1A 3MO9A 1P2JA 1ZLRA 2G4UA 2WPJS 1HB0B 1G30B 2PWXA 2CN0H 4ACAA 5EJLA 3TH3H 1Z1IA 3QUMP 1GHXH 2XC0A 5FCRA 2QYIA 3RC4A 2BMGB 1AU8A 5A09A 1C5VA 1C2DA 1EOLA 4K2YA 1O2ZA 3Q77A 3K2UA 1ZTJA 1MTWA 1XUGA 1V2KT 5AVDA 8KME2 2ZEBA 1ZPBA 4Y7AA 3KYGA 2KAIA 3TVJB 2FI3E 1QHRB 3BTTE 3FANA 1E1QD 1W3CA 3E6PH 4MTBA 2OC1A 8LPRA 1AE5A 1O3LA 4X1RU 4NGAH 1MCTA 1O35A 8ESTE 1DFPA 5JB9S 1GMDF 2QF5A 4U2WA 3TPIZ 2LNCA 4YXWD 1NTPA 2VVUA 1PYTD 3PLBA 2KZ4A 1ZZZA 1O5AB 1Q31A 2F91A 2WPDD 6LPRA
chains in the Genus database with same CATH topology
1B5GH 2O8MA 1O2UA 2A2XH 1V2JT 1FI8A 3TNTA 3RMMH 2FP7B 1VJAU 3SO3A 1P06A 4ABIA 1O2NA 1ANDA 2FDAA 1SHYA 4UE7H 5F6MA 3LGIA 1ZMLA 1QR3E 1WTHD 1LQDB 1C2GA 4ABGA 1YGCH 3PMJA 5EW2H 1HLTH 4BNRA 5DK1A 2ZHFH 1GJ4H 1TRMA 1EJAA 1HGTH 1GDUA 2FOGA 4A6LA 1A0LA 1P12E 2THFB 4YOGA 1LVMA 1C5SA 3RMNH 1HV7A 1GI9B 3M7TA 1TPPA 4RKJB 3MU0A 3MO6A 3RUOA 2WV4A 5DP3A 2Q1JA 3M7UA 2WPLS 5HM2A 1SGEE 2SNVA 3PO1C 4DY7B 5CHAC 5EXNA 3QWCH 3PROA 2FO9A 1YPMH 2GV7A 3P95A 3ATMA 3L33A 1VITG 2ZI2H 1NC6A 1SGRE 7ESTE 1K2I1 1V2QT 1W0YH 4INLA 3SU4A 1O33A 1MMJN 1GDQA 1N6YA 4ZKNU 1IQHA 3P8OA 2ZO3H 1QL9A 2ZU3A 1C2MA 4X2WA 1OS8A 2XCNA 2H5DA 4XBCA 5A0BA 1DY8A 7GCHG 1S84A 1O32A 1ZMNA 2R3YA 1C5OH 1BOQA 2PGBB 2ZDNA 1UVPA 3PLKA 1LVOA 4IMQA 1C4V2 1YCPK 2QGRA 1HXFH 3E90B 1GI3A 4OS6A 1ELCA 7LPRA 4A92A 3M3TA 2ZU2A 2O8LA 2AMDA 1ZHRA 1MUEB 5CMXH 1YPEH 3MH5A 1WV7H 4AFUA 2XC5A 2ZF0H 1SL3A 3NK8A 1SGQE 2ZKSA 4DIHH 2WUCA 3KQDA 2TGTA 3OY6U 1MH0A 3LGVA 3DFLA 3I77A 4E7RG 1E38B 3LGTA 2J9NA 4IN1A 3MNXA 1AVGH 4UD9H 3SUEA 2QXJA 1O2KA 2CJIA 2TIOA 4GSOA 1EZSC 2AMPA 1ELVA 1UMAH 2OTVA 1J15A 1PQ5A 3FZDA 3BN9A 1HDTH 1FIZA 1J8AA 2CXVA 1UTQA 3VB6A 1K1OA 2J92A 5ETXA 1GDNA 2FWWA 2GT7A 3GCHC 5ESBA 1FNIA 1GBBA 1P04A 3TH4H 1O2WA 2BXTH 3GYMA 4K8YA 1G32B 3RXJA 4AN7A 4X8TH 1O2LA 1SVPA 5E0HA 2H9HA 3N7OA 4I7YH 1ZJKA 5HM9A 1S0RA 2AGEX 1DSUA 3SV6A 1BBRE 6CHAB 1QBNA 5DP8A 5T6GA 1TMUH 2G81E 1W14U 1NESE 2OC8A 4WJG2 4NFFA 3UNSA 3DD2H 1SFQB 1P0SH 1IQKA 1KLTA 5DPAA 2IN2A 4CRDA 3DUXH 3SUFA 2FTLE 1O3KA 1OX1A 2F9VA 1RIWB 5JDUB 2PTNA 1DSTA 4H6TA 4WMEA 1ID5H 1LDTT 2CMYA 1ELTA 1GG6C 2VGCC 4OS1A 1MQ5A 3G01A 4R0IA 5EU8A 5DP7A 1LQEA 2BOHB 1MD8A 4MPVA 3S0NA 3P8FA 4FVBA 3A89A 2Y5FA 3MTYA 1H9LB 1PPBH 1HXEH 4CRGA 1C9PA 1UO6A 3OX7U 1S82A 5EQSA 3LC3A 1G9IE 4X2VA 1SLUB 1KYNA 1GHYH 2FS9A 1F2SE 1ABJH 1O38A 3F9HA 1TGNA 2NU2E 1BTXA 1O2TA 1RGQA 2D2DA 4JZ1A 4Q7ZA 3U8RH 4AFZA 1F7ZA 2M5TA 2FIRH 2SGQE 3M5MA 4MDSA 4DT7B 3MU1A 2BD9A 3BV9B 4Y8YA 1L1NA 1LPGB 4Y71A 1HAOH 2W5EA 1G3CA 1DXWA 3UIRA 4ZHLU 1O39A 1F0RA 2G8TA 3KHVA 4BAHB 2Y6TA 3AASA 4QT8C 4YT7H 2HGTH 3SBKA 2P8OB 3A85A 4H6SB 2NU3E 1GI4A 2BQ6B 4UEHH 1C2HA 4Y76A 4CR5A 4CREA 3UR9A 3UNRA 3C27B 3SUDA 3M61U 2ZIQH 5HGGA 1C2EA 1ZRBA 2BD4A 3E0NB 2GDEH 1GMCG 1ESBA 4ZXYH 2VINA 3RXVA 3RXCA 1D6WA 1QY6A 1YPKH 1IQJA 1Y5UT 1A0HB 1BCUH 1K22H 2BD7A 5E0JA 5LGOA 1AWFH 3JZ1B 1FJSA 4IC6A 3M37A 1C1OA 3CP7A 5FHTA 1KXFA 1TNLA 2PKSC 1JXPA 2AERH 2VWNA 4CHAC 1O3DA 1O3FA 2FODA 4A1XA 3RXMA 2BLQA 1GVZA 4MNYA 1W12U 1K28D 3SJ9A 1YCPM 1GBIA 1KTSB 1HAXB 1YLDA 2RG3A 2FYQA 1O0DH 2Y80A 1OP8A 3A87A 1CVWH 3RXKA 3MO3A 2ANKH 1HAVB 3ZVDA 3A83A 5IYTA 1G2MA 1C2LA 5A8ZA 3ATKA 1GBHA 1A5HA 3TGIE 5GIBA 4ESTE 5H4IB 3M5OA 1GBMA 3GCNA 4A5TS 5JBAS 2DE9A 1SFIA 2UWLA 3HKJB 4PROA 2EC9H 1V2UT 1AKSB 2AEIH 1MZAA 4I33A 3FFGA 2ZPRA 1AFQC 4JCNA 1T8NA 1GI6A 1XUHA 4X6NA 1P03A 1OXGA 1HAIH 1YPLH 4BOHA 1GI5A 1BHXF 4O97A 1W7GH 3QDZB 4FUJA 2IPHA 1RFNA 2TGAA 3A86A 5L6NH 4FUBA 1PPEE 3BEFB 4HFPB 2A5KA 1BA8B 4Y8ZA 1MKXK 1L4ZA 3E8LA 1S6HA 4B74A 4GCHG 1GBKA 2BX3A 4YTAA 4I8LA 2UUKB 1RTKA 2A4GA 1D3DB 3DT0H 2BDBA 3SU1A 1JRTA 2BQWB 2SGPE 1O2HA 1SG8B 2BY5X 3GY3A 3PMBB 4DIIH 2XBYA 1DXPA 1SR5C 1ANCA 2FM2A 3V13A 1ZHMA 1UCYH 1Y3WA 2PHBA 4JZIA 3GOVB 1J16A 1RS0A 4Q80A 3VFEA 4ISHH 1BITA 1QRXA 2Z9IA 3OSYA 3TIUA 2VU8E 4ZUHA 1GBFA 1BBRK 5EODA 1GI1A 2C90B 5I25A 1P8VC 1X7AC 4JZFH 1P2QA 4UFFH 4IW4E 2ZDVH 2BVXH 4HTCH 3RM2H 4DW2U 3IITA 2FI5E 4ABBA 4BAMB 2VIDA 1BTWA 1AFEH 1W10U 2OBQA 1CU1A 1GBEA 1WQVH 1F0SA 3ZV8A 4F4OC 2GT8A 1Y5AT 3T25A 3P8NA 4CRFA 2BDCA 2QXGA 2YNAA 1ZTKA 3T27A 3KQEA 3SU6A 2ZECA 5EW1H 2XBVA 5F8TA 2WINI 1WAYB 2R2MB 4SGAE 4Z6AH 4ZKSU 2OQUA 1MTUA 4ISIH 2ANMH 2Z9LA 4AFQA 2ZHEH 3GDVA 1RD3B 3SU3A 1KXAA 1K1IA 3SV7A 1O3CA 3GY2A 2STAE 1WOFA 3EA7A 1P2MA 4KKDA 1FIWA 1PJPA 2BXUH 2OCVB 3ODDA 1GBCA 3PV4A 2C4FH 1VITH 1QRZA 2BY9X 1P05A 1GBAA 1E36B 1BT7A 2Z9KA 1P2KA 2QF3A 1TIOA 2F83A 3F6UH 1SGIB 1O3PB 1O3IA 3BIVH 1EZQA 3ZZBA 1KDQB 1P9SA 5E2OA 1SOZA 3NKKA 1DANH 2C93B 4X1QU 1SI5H 3KGPA 2HALA 1V2TT 2NWNA 4WWYA 2B0FA 3A81A 2P93A 3IG6B 1O5CB 4JYTA 2WPIS 3LDXH 3HGNA 2B7DH 1UVOA 4Y0YE 1NRNH 3A82A 1GBJA 1DITH 1E0FD 1Y3XA 1SC8U 2A4OA 1VITF 3SU2A 2B9LA 1YM0A 1GG6B 1UK3A 1TBRH 2VGCB 3EAJA 3SV8A 2VH0A 1NM6A 1A61H 2J34A 1K1JA 4Y7BA 1Z6EA 1TQ7B 2ZTXA 2GDDA 3RU4E 3SJOA 5GDSH 3SZNA 3NPSA 4ASHA 1CHOG 1TONA 2PTCE 1C1WH 4A7IB 4RKOB 1EOJA 4X1NU 3BTDE 1Y8TA 3V7TA 7GCHF 4ZMAH 2FS8A 4FU9A 1BJVA 3UR6A 2BM2A 3H7TA 5FAHA 2EEKA 4Q7XA 1AZ8A 4GLYA 1ELEE 4UFGH 1UTPA 2ZC9H 3ZZ9A 2A2QH 3RXBA 2W7UA 2ZFRH 2ZCLP 1E37B 1ZPZA 4NG9H 3VEQB 2FOFA 2ZU5A 3MMGA 2BB4A 3LU9B 2FEQH 4RN6A 1T4VH 4IC5A 2AH4X 3UOUA 2OUAA 1GJ9B 4BAOB 1C5UA 2BLOA 3SNDA 3HK3B 5C20A 1HAYB 1FDPA 1HJ8A 1GBLA 4CRCA 1TE0A 1NRRH 1GCDA 3F1SB 2A7JA 3W95A 3LC5A 1FPCH 4KTUA 2WYJA 3E0PB 2VIPA 3SHAH 1W7XH 3PM3A 1GHWH 1P09A 1A3EH 5FPSA 4ZHMU 5FXLA 1V2WT 4MPUA 4M7GA 1O2VA 1CSOE 1P11E 3NUMA 2ZA5A 1H4WA 4IN2A 1O30A 3SGBE 1TWXB 3BTGE 1HUTH 4NA7A 1RJXB 1P2IA 2QF0A 1V2PT 3VXFH 2GVFA 2EI7A 2PKSB 1OSSA 1FY4A 2ASUB 4MPWA 1DX5M 3SHCH 1O2GH 4H42U 4CHAB 4NZQA 5BRRE 1OOKB 2BD8A 1CT2E 1NRQH 2FZZA 4BANB 3PWCA 1F92A 1LPKB 4MPXA 1Y3YA 1BRAA 1B7XB 1ARCA 1GVLA 3FP7E 3VPKA 1A7SA 4OS4A 1DUAA 1ELAA 1PYTC 1GJ8B 2ZPQA 3ATIA 3OTJE 1HAGE 3ZZ5A 4UONA 4ZKRU 1YBWA 2RDLA 5G4BA 1GJAB 3F9FA 4D76A 1PFXC 6ESTA 5DP4A 9ESTA 1IQNA 4YOIA 1TFXA 2HOBA 4BTUB 1CT0E 1NY22 1PPFE 5F8XA 3Q3KA 2VNTA 2BZAA 1AFQB 3SOSA 3LT3A 1EXFA 1CO7E 3Q76A 1MKWK 3QO6A 2RA0A 8GCHF 5JYIA 1OWKA 4TWWA 3A8AA 2BTCE 1C5ZB 4XE4A 1WUNH 3FVFB 3SGQE 1D4PB 1YCPH 2SGDE 2H6MA 1DWDH 3TJOA 1D6RA 2GMTC 2VIWA 1NFUA 3MNBA 1CE5A 5DG6A 1ZR0A 1ZSKA 1FN6A 3ZZ4A 3GY7A 3RXLA 1HAVA 3R0FA 2BY7X 1MTVA 1FY8E 2QXIA 2SGEE 1FXYA 1UTOA 1H1BA 1C5XB 2JH0D 2Y81A 4AG1A 1GJ6A 5F8ZA 4ABFA 4ABAA 1AQ7A 1O34A 1EZUC 3M7QA 1P2OA 1G36A 4R8TB 1MU8B 2BOKA 3A7WA 1AKSA 4BXWA 3DFJA 1TX7A 1TALA 3OY5U 1QJ7B 1F0UA 2O8WA 2DE8A 3UUZA 3RXIA 1ACBE 5HMAA 1EPTC 4ZH8A 1TMBH 1T4UH 5EG4A 1VGCC 4ZHAA 3A7ZA 1AVWA 1FUJA 1GMCF 1P9UA 2HRVA 4NIXA 2OD3B 4YO9A 1KLJH 3RXFA 4E05H 1FAKH 3S7HB 4UDWH 2ANYA 3QGNB 1O5BB 1EQ9A 1UK4A 3I29A 5JB8S 5GCHF 4OGXA 3B23B 4ISLA 1PQ8A 3HATH 3MH7A 2ZCHP 1QGFA 4KELA 2BDHA 3OU0A 5A0CA 5LPEA 4BXSA 5I46H 1LHEH 1UTMA 3T26A 3MU4A 1IHTH 2GZ9A 4I31A 1TBZH 1EJNA 2VVCA 4NA9H 3UQOA 1HFDA 2ZP0H 5TCAA 3SJ8A 5C1YA 1VCPA 1KY9A 2VB0A 2VVVA 1JRSA 5A0AE 2F9NA 4X2XA 4X1PU 2XBXA 2ESTE 1BJUA 4NSYA 1TNKA 3O8BA 1K1PA 3KN2A 1CGHA 2Z94A 4D9RA 2GCHF 1ELGA 2HNTC 2ZWLH 1JBUH 4AG2A 1ZOMA 2VWLA 2R0LA 1QB6A 3CENA 4X8SH 1IQFA 2B5TB 4XDEA 1MQ6A 1GI8B 1DWEH 2GKVE 3LGWA 3A88A 4DOQA 1ZTLA 3GY6A 1ESTA 2CV3A 1O2YA 3BG4B 3BF6H 2V35A 4O3UA 1QA7A 2ZGCA 1O2OA 1Z1JA 1QFKH 3ITIA 3MOCA 1L4DA 1HJ9A 1XXFA 2STBE 1AB9B 1H8DH 1KTTB 1XVMA 2TRMA 2G5VA 3SV9A 8GCHG 2PUXB 1Z8RA 2ZDKA 4ZKOU 1ZSJA 1GJ5H 1GPZA 3A7VA 2FESH 2QC2A 4GCHF 5PTPA 3QK1A 4ABDA 2BVRH 2ZGXH 4E06H 1T8OA 4MVNA 1SGFA 1TLDA 1UTKA 3P70B 4F49A 1G37A 2LPRA 1XUIA 2FMJA 4NCYA 5GPIB 3S9AA 2FLRH 3A8CA 2P3UB 1THSH 1KXBA 5DP5A 3UOPA 2F3CE 2ZG0H 3RXUA 2O8UA 4TPYA 1YKTA 5FCKA 3L6PA 2PUQH 4NSVA 3UY9A 2BD5A 4JK6A 1QBOA 1CHGA 1MBMA 1F5KU 2VIQA 4WF8A 2AMQA 2JETC 2PW8H 1EZXC 3RXPA 1XKAC 1AWHB 4ABEA 1GHAG 1FPHH 1E34B 4I8KA 3EE0B 2P16A 4B73A 1KDQA 2ODYB 3O8DA 3SORA 3S69A 3A8BA 5EQRA 5JBCS 5EXMA 1C5NH 1D9IA 2QCYA 3TJVA 2QY0B 1AZZA 1ANEA 3B9FH 3TNSA 1P3CA 3ZZ3A 1HBTH 4X6PA 1DWBH 2ZFPH 2W7SA 5TJXA 2BHGA 1O3EA 2QV1A 4CRAA 5GCHG 3KF2A 4FUFA 1VJ9U 1LCYA 1K9OE 1BTUA 3ZYEA 1QL8A 3ZYDA 9LPRA 3GCOA 2RA3A 1AUJA 1C1SA 1O31A 2OP9A 3V3MA 2Q6DA 1BHXB 3SN8A 3EDXB 2WV5A 1TYNA 2ZDMA 1NT1A 3H7OA 4E7NA 3RU4T 2H5CA 1WCZA 1IQEA 4K69A 4UFDH 4LXBH 2W3IA 2ODQA 2XTTB 5E8EH 1ZYOA 1RTFB 1LHCH 3A80A 4LZ1H 1BZXE 3TJUA 5AFYH 3S9CA 1T8MA 5LH8A 4LZ4B 1S85A 2GCHG 3ATWA 3RXTA 4MLFB 1UHBB 3QGJA 1GJ7B 4XBBA 3A84A 4IS5A 1MKXH 2UUJB 4H4FA 3RM0H 1XKBC 1GVKB 3TLOA 2BDYA 1Z7KA 2ZHDA 3LKWA 4VGCC 3T28A 3D23A 1P2NA 4X2YA 1W0ZU 2UUYA 1IAUA 1QIXB 1YLCA 3U9AH