2WUBA

Crystal structure of hgfa in complex with the allosteric non- inhibitory antibody fab40.deltatrp
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
239
structure length
231
Chain Sequence
IIGGSSSLPGSHPWLAAIYIGDSFCAGSLVHTCWVVSAAHCFSHSPPRDSVSVVLGQHFFNRTTDVTQTFGIEKYIPYTLYSVFNPSDHDLVLIRLKKKGDRCATRSQFVQPICLPEPGSTFPAGHKCQIAGWGHLDENVSGYSSSLREALVPLVADHKCSSPEVYGADISPNMLCAGYFDCACQGDSGGPLACEKNGVAYLYGIISWGCGKPGVYTRVANYVDWINDRIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/immune system
molecule keywords HEPATOCYTE GROWTH FACTOR ACTIVATOR LONG CHAIN
publication title Unraveling the Allosteric Mechanism of Serine Protease Inhibition by an Antibody
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 231
sequence length 239
chains with identical sequence C
ec nomenclature ec 3.4.21.-:
pdb deposition date 2009-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2wubA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2wubA01
1L1GA 2V0BA 2D8WA 1Y5UT 4TWYA 2ANMH 2ZFFH 3ZZ7A 1EOLA 4FUGA 4IGDA 3RC6A 2AERH 4SGBE 4CRCA 1Y8TA 1TNLA 2B7DH 3EGKH 1PPFE 2QN5T 3PYHA 4K8YA 3QGNB 3GISB 1ARBA 1P05A 2P3UB 1CGIE 1TNIA 1Y5BT 1TMBH 2XTTB 2ZU5A 1IQKA 1SC8U 1S6HA 3GY3A 1MZDA 4DG4A 1FY5A 3K2UA 2CF8H 5C1YA 2ULLA 4AX9H 3GCTF 4CH8B 6LPRA 3SUDA 1C1RA 2IN2A 1T8NA 2GCHF 2ZEBA 4ISNA 2GX4A 1UVOA 1V2NT 3O8BA 2WV4A 4LXBH 1TB6H 2C8YB 1VJ9U 3E90B 2C8ZB 3PMAB 4A7IB 5GPIB 2PKAB 3HK3B 5CHAC 1MAXA 2P8OC 4JYTA 1VITG 1LDTT 5IYTA 2EI8A 1LHDH 2VWLA 2A32A 1EQ9A 5LPEA 1LVMA 1IHSH 6CHAB 4PROA 5BPEA 4NSYA 5FPYA 2Z94A 3A8BA 1O2MA 3QZRA 4RKOB 3QO6A 2PKSC 5EGMA 4ABEA 2FS9A 1Z1JA 2WYJA 4JZIA 2OBQA 3CENA 1SHHB 3URCA 1XKAC 4AYYB 2OXSA 1UJ1A 1GBAA 1ZOMA 1F0UA 3H7OA 4JMYA 3QWCH 3SGQE 3QX5H 1LTOA 2PSYA 1ESAA 3KEEA 4BXSA 1JRSA 4K8BA 1N8OC 4ABBA 3B23B 1BT7A 1OWEA 4F4OC 3RXPA 2BVRH 1K1IA 1O2GH 1GMDG 4IBLH 3PO1C 1UK4A 1O2YA 3SNDA 5B6OA 2FI4E 5FPSA 2XBWA 2THFB 2TGTA 1LKAA 2WPMS 2PGQB 4KKDA 4IMZA 1SGFA 1MKWH 4HGCA 1T4VH 1C5RA 1B0EA 1HJ9A 1THSH 5C5OA 1HAOH 3SV8A 2ILNA 1GHWH 3Q3XA 2ZA5A 2P95A 1SLXB 2SNWA 8KME2 1PPEE 1LHFH 1PYTD 1C2MA 2BM2A 2UUFB 2GDDA 3CP7A 1D3TB 1JMOH 1SG8B 4WMFA 5JBTA 1GJ5H 4ABJA 2TGAA 3T26A 4X6OA 1TWXB 2IJOB 4E7RG 3RP2A 2BXUH 1F5LA 1SBWA 2BY5X 3BTHE 1IHTH 1NRQH 4LK4A 2OP9A 1O2OA 3UTUH 1AWFH 1GBEA 4X0WU 2SGDE 3MO9A 2RA3A 2PFEA 6ESTA 2C93B 3BTME 2YNAA 1O2IA 4BAKB 4A1TA 1W2KH 3HATH 2Z9LA 1GJ6A 2PSXA 2FO9A 1NU9A 3SZNA 3FANA 2ZFRH 4YOJA 1AVGH 5DO4H 1GBTA 3PLBA 3TNSA 2FOAA 5J4QA 3UWIA 1O3AA 1QFKH 2QC2A 2NU1E 2M5TA 4X2WA 2J4IA 1P10A 1F2SE 4A1XA 3K65B 1VZQH 1J16A 2P59A 3MH6A 3ZVCA 1BTXA 3GCOA 1AFQB 1SGYE 1O38A 2J2UA 4NG9H 4WJG2 2AYWA 1NM6A 4BAOB 3S7KB 1QB1A 4MLFB 3F9EA 4MTBA 1YPGH 1FZZA 4H6TA 1Z8JB 2FOEA 1TMUH 3VFEA 1QURH 1P2QA 1LHCH 2Y5GA 4DIHH 2VJ1A 5L2YH 2NU0E 1GJ9B 2ZPSA 2ZPRA 4YT7H 2Z9JA 2J94A 5EODA 1BB0B 1V2OT 3SW2B 1O3JA 2G4TA 3KHVA 4IC6A 4MNWA 2AS9A 5E2PA 1K28D 1G3DA 1TPSA 4DVAU 1V2KT 3LGUA 4X8SH 1JBUH 1ZZZA 1F7ZA 1O2SA 4ABAA 2QA9E 1S6FA 2BMGB 4TY6A 3OYPA 4HTCH 4KP0A 2V3OH 3IITA 5EXLA 2ZHQH 3ATLA 5GIBA 5TJXA 1ZRKA 2R3UA 4Y7AA 4A6LA 1T32A 5J4SA 4BTTB 4NWLA 1EASA 3E91A 3GCHC 1W13U 2ZPQA 3MWIU 1TGBA 1TGNA 1TIOA 1MKXH 2G52A 3SOSA 3S7HB 5F03A 2W7SA 1GMHF 2V35A 5HM9A 5EQSA 2ODQA 1GBCA 1GI3A 1RIWC 3M7TA 2EI7A 3LONA 3TIUA 1P57B 3DT0H 1KLTA 2P16A 2W5EA 2FZZA 2WUCA 1EKBB 1PPZA 4HI3A 1GMCG 1O3NA 4JK6A 3PMBB 5C67A 1YPHC 3SJIA 4WY3A 4FU7A 5DP6A 2VH6A 3EYDA 3SJKA 2Y5FA 1PPGE 1EZXC 3VB6A 1K1MA 1O2LA 2VIOA 4IN1A 1C5ZB 1QL7A 3SU1A 1QY6A 5C3NA 2ZCLP 3TK9A 1SGEE 2ZNKH 3E0NB 3JZ2B 4IN2A 3M37A 4NA7A 4WXVA 5T3HA 4FU8A 1LVBA 2ZG0H 1PFXC 1DM4B 4FUBA 4X6PA 1LPKB 2ZHDA 1Z71A 3SNEA 4AORA 1T7CA 4CHAC 2BVXH 1Q3XA 1NESE 3RM0H 3HKIB 3SV2H 5A0BA 1OWKA 5HXFA 3K9XB 1ABIH 2OC0A 4MVNA 1BOQA 1HAGE 3TITA 3CS0A 2QCYA 1P09A 2Q6FA 5T6GA 1GBKA 2ZWLH 2ZKSA 1FY8E 3SNBA 1M9UA 3T5FH 3S9BA 3ZVEA 1CT0E 1RJXB 3SUEA 4K2YA 1MBQA 3LKWA 4JYVH 2G4UA 3M61U 5JB9S 1SQOA 1V2LT 5GJ4B 1NRSH 1HYLA 3ITIA 1FN8A 1S81A 2TBSA 1GBFA 2Q6DA 5A2MH 2QGRA 2XWBI 1PPBH 2FESH 4B2CA 1IQLA 1U6QA 1WBGB 2BOKA 3I29A 3GY5A 1UVUH 3KF2A 1VGCC 1SSXA 4UEHH 1O5BB 5DP5A 1VCWA 4DJZB 3V7TA 4MNYA 3RXBA 4D7FA 1C2FA 2XW9A 2SFAA 4I33A 1SGDE 1ELVA 2IPHA 1ANBA 6GCHF 2FLRH 1O2KA 2B9LA 2FYRA 4XE4A 1HGTH 1P3EA 4AGJA 2XC0A 3ZVAA 1XUFA 4Q80A 1AE5A 1ABJH 4DW2U 1FIZA 1G2MA 1BRAA 4FXGH 3KQEA 1XUKA 3F9HA 5JYIA 4AOQA 3SORA 2GMTB 5DP4A 1E37B 3EA9A 1DE7H 1KDQB 4M7GA 1TFXA 1DS2E 2STAE 3LGIA 3PO1B 2OQ5A 1EB2A 1CGHA 3P8GA 2NWNA 1V6DA 2P94A 1EB1H 1JWTA 4E06H 3RXDA 2Z7FE 3LGYA 1V2PT 1HAHH 2HGTH 2Y82A 1TNKA 5DG6A 3PWCA 3BTQE 2Y7ZA 1V2JT 3LGTA 1Q31A 1C4V2 1SGTA 3U8TH 1AVXA 1YYY1 1XMNB 3A7XA 3C1KA 1YKTA 1YBWA 4GLYA 1QL9A 1UTPA 3MO6A 4DCDA 3ZVFA 3BTWE 3GDVA 1YCPM 1DPOA 2NU4E 1EZQA 1P9UA 4YM9A 1Z1IA 3DUXH 1AD8H 1MD8A 1NRNH 2HALA 1FY3A 5JDUB 4GSOA 1OSSA 1P12E 1EP6A 4Y0ZE 1O3MA 1YF4A 3A7ZA 1F0RA 4X6NA 3SV9A 1TLDA 4D8NA 2C8XB 5DP9A 1UVTH 3BEIB 4ZKNU 2D1JA 1BRCE 5IDKA 1GDUA 1LQEA 5T6FA 4AG1A 3H5CB 2P3FH 4I32A 2GKVE 1EAUA 1OWIA 3PWBA 3UNSA 2A5KA 2IOTA 4LZ4B 1QIXB 2J34A 1P3CA 3A89A 3L33A 4Y71A 4ZKRU 1O5AB 1FV9A 4ABFA 1EAWA 1FI8A 1O5CB 3ZVDA 5L2ZH 1GHZA 1NRRH 1G36A 4Y7BA 1FDPA 2GD4B 2FYQA 2XWAA 1L2EA 4NFEA 3FP6E 2CHAB 4FUFA 1GBIA 3BV9B 1OXGA 4B75A 3UUZA 1UTLM 2FODA 1GPZA 3BTGE 1QJ1B 2J92A 3PMHB 1HAXB 1QL8A 1AFQC 3FVFB 2KAIB 2OC1A 2VGCC 4RKJB 1TGSZ 3MNBA 3MH5A 4ZROA 2J9NA 2XXLA 3HK6B 1ETTH 1NT1A 1MMJN 2G5VA 2G8TA 4U32A 4A92A 1S82A 2FMJA 1XVOA 2BDIA 3NKKA 3LPRA 1SLVB 1EJNA 1DFPA 1MTVA 1P11E 2A7HA 2ZDKA 1TGTA 1P2KA 1C1QA 1V2TT 3GCNA 1J17T 3P8OA 5C5NA 1ZHMA 1ARCA 4AG2A 1LHGH 1C4U2 1BBRK 1EAIA 5EOKA 5L30H 1IAUA 1ANEA 2TPIZ 1C5SA 3O8DA 4XBCA 4GVUA 3M5NA 2BQ7B 1A4WH 1CBWB 2Z9GA 3PLPA 2YOLA 1EPTB 2ZDMA 1V2WT 2W7UA 3SHCH 1XVMA 1AZZA 1ZPZA 2UWPA 3ZVBA 2XCNA 1LPGB 1O2ZA 4J2YB 4YZUA 2A5IA 1VCQA 4DGJA 1HAPH 1A7SA 2Y81A 1NY22 1FAXA 3A7YA 2G81E 3LC5A 1EUFA 3GY6A 4WH6A 3D49H 1TQ7B 9LPRA 4UFDH 1KY9A 1O2WA 2GZ8A 1ETRH 1LQDB 3HKJB 4AFUA 3ZZ8A 1FMGA 1SL3A 2PLXA 5GCHF 1GHVH 4OGXA 2SNVA 4Y8XA 5AFZH 4MNXA 1DICA 1YLCA 2ZTYA 3SU6A 1G3CA 1UCYH 3ZVGA 4CHAB 1A2CH 5TCAA 1AU8A 1IQEA 2UUJB 2ALVA 2PTNA 5FPTA 2B5TB 3SU2A 3U8OH 2HOBA 3Q3KA 1FNIA 3A7WA 2OQUA 1ZTJA 2BD4A 1DT2A 1KXAA 1W8BH 3MU1A 3BTDE 1BBRE 2A4RA 3RU4D 1TMTH 1QRWA 1Z6JH 4KELA 3LH3A 3T2NA 3QZQA 1O32A 2ZC9H 1SQTA 2OUAA 4FVDA 2QXGA 1BQYA 1YPMH 4X2VA 3SI3H 5T6DA 2PGBB 2A4QA 1LMWB 4Y0YE 1MTSA 3TNTA 1AKSB 3STJA 2EI6A 4B2AA 2ZCHP 2ZGBH 1C5OH 1O5DH 4F49A 1VGCB 5EPNA 2F9UA 3RC5A 5FX6A 2R9PA 3A87A 4VGCB 1QQ4A 1S85A 1ZMLA 2A1DB 1NZQH 2QXHA 3T27A 1H1BA 2QAAA 3LJJA 2HNTC 2ZFPH 1F0TA 4FUCA 3EAJA 1BTWA 1GJCB 4UD9H 3QTVH 4JYUH 1D3QB 2K1QA 1KLIH 2F9PA 2QF0A 3TH4H 1HIAB 1EJMA 1O2VA 1KXBA 2ZTZA 1GHAF 3RU4E 2BHGA 1YPJH 2SGEE 3MHWU 4HFPB 3FAOA 1CQQA 5FXLA 2ZU2A 2YNBA 2AFQB 4U01A 1GDQA 3PMJA 2FI5E 2B8OH 4BTIB 3D65E 2ZZUH 3ATKA 1HAVB 1UMAH 1KXFA 3NCLA 1ZSJA 1O2QA 5HGGA 3RXCA 1GMHG 1XUJA 2O8LA 3RXRA 1O35A 4ABGA 1W11U 2GMTC 3QUMP 4LZ1H 3KQDA 2CMYA 4DIIH 3SV7A 2B0FA 2C8WB 3HPTB 3KQCA 1GBJA 3V12A 2H9EH 1Y3YA 4DOQA 1O3LA 5E0GA 1ELFA 3A86A 3D62A 1H9LB 8GCHF 1EOJA 3M5OA 2ZO3H 4ABIA 4CR9A 4DY7B 1TOMH 3NK8A 1C9TA 2FTLE 1QTFA 1C2EA 3ODDA 5FCRA 1W14U 1F92A 4GUXA 1XXFA 1TA6A 3N7OA 1ORFA 1GJBB 2JH6D 3RXTA 3GYLB 3PTNA 1A5HA 1FXYA 1FPHH 1O3EA 1AUTC 2BDGA 3A84A 2Z6BD 2VVCA 2D2DA 2UWLA 1ZRBA 1TX6A 3LH1A 3QGJA 2P3TB 3BTEE 4IMQA 1IQGA 4UFEH 4Y76A 1QCPA 2BDHA 4JZEH 5EU8A 5EXMA 4O3TA 1C5XB 1JIRA 1K1PA 1IQFA 2A7CA 1DUEA 1ELTA 1GBHA 3LGWA 4NA9H 2XC4A 4GCHF 3VGCB 1ZLRA 3M3SA 1C1TA 3PLKA 1O33A 5PTPA 1AWHB 4TPIZ 3E8LA 3RU4T 1AN1E 2GV7A 1WYKA 1O5EH 5CMXH 1BTZA 3KCGH 4NZQA 3RXQA 2H2ZA 5FAHA 4CRAA 4MNVA 2UWOA 2CHAC 3W95A 1IQJA 3SGBE 1AE8H 1IOEA 4I8JA 1O3GA 3RUOA 1UTMA 2VGCB 4JK5A 4Y11E 1EZSC 3SBKA 1CO7E 5HM2A 2F9VA 1DSUA 2ZFSA 3SUFA 1V3XA 4XOJA 1GI8B 2BDAA 3ODFA 5JB8S 2BX3A 1TQ0B 6GCHG 1BMMH 1J9CH 1JRTA 1FLEE 4I7YH 2FM2A 1ZMJA 1SOTA 1ACBE 2WPJS 2FWWA 1C5YB 1V2VT 1ZHPA 3BG4C 2RDLA 3ATWA 3W94A 1ZSKA 4IS5A 9ESTA 4WMDA 2BOHB 1ZSLA 2G00A 3HGPA 4CH2B 2HNTF 1ELCA 2AH4X 3ZZAA 2ANWA 2OINA 2J38A 1HJAB 3P92A 3QK1A 4O9VA 1CA8B 2ESTE 2NU2E 3BEUA 1PJPA 1GL0E 1C1NA 1SGPE 1L1NA 3JZ1B 4TY7A 1RXPA 4Y8YA 3RXJA 1T8LA 1DWCH 4UDWH 2Y5HA 2ZGXH 1MQ6A 1CBWC 1JOUB 1PQAA 2G5NA 4X6MA 1EPTC 1K9OE 4IC5A 3MO3A 1IQIA 1P2MA 1Y3WA 1VITH 1IQMA 2V3HH 1BJVA 1UK2A 3RMNH 1YPEH 3SQEE 2G55A 1DX5M 4OS2A 1QJ7B 3D23A 1HAYB 3E6PH 3K6YA 5C20A 1HRTH 1ZPBA 2FTMA 2O8UA 1QB9A 1YPHE 3MYWA 1JIMA 1G2LA 1EZUC 4Y10E 1Y5AT 3F9FA 2ZTXA 3V0XA 1D4PB 1DWDH 1ID5H 1PQ5A 3SJ9A 3QN7A 1QA0A 1MH0A 3VXFH 5JPMH 1YCPH 1SHYA 7LPRA 3SN8A 4ESTE 5A8ZA 3RLWH 1L1JA 3GY4A 1IQHA 3LDXH 1ZTLA 3K6ZA 2CV3A 1XKBC 1W12U 2FDAA 1F5KU 5DJ7A 1GI0A 3GDSA 3F6UH 3TJUA 1FPCH 3U69H 1HUTH 1C1MA 2H6MA 1KIGH 2CGAA 2BLQA 3BIVH 4XBDA 2AGEX 3RLYH 1CT4E 2RG3A 5A0CA 2ZGJA 3O8RA 3GY7A 2OD3B 1NRPH 3M5MA 4WH8A 1TA2A 2AEIH 1P0SH 1UTOA 1XUHA 1BA8B 1S5SA 1BCUH 1NFWA 2BYAX 3SI4H 1WSSH 4NIXA 1QRZA 1BTHH 3EDXB 2NU3E 5JBCS 1WTGH 1BRBE 2EA3A 3WY8A 1S84A 1SLWB 1GVLA 5F8TA 1GBLA 2WPIS 1UHBA 3URDA 3STIA 4VGCC 2XBYA 2PHBA 2JH5D 2A7JA 1GHXH 1B0FA 3DFJA 1A0HB 1G3BA 1P2NA 2BZAA 1GJAB 3KL6A 2GVFA 1QR3E 1N6XA 4A5TS 2SGAA 1CA0B 3OU0A 2O9QA 2R2MB 3NZIA 1NTPA 5DGJA 4FUIA 1C5NH 3P95A 1SB1H 1WV7H 2H5CA 1BTUA 1A0JA 1ANDA 2VVUA 3RXMA 2R3YA 2ZCKP 2ZDVH 1GJ4H 3MI4A 2F91A 7KMEH 1SGRE 1HLTH 3BN9A 3RXUA 3M36A 1HXFH 2BZ6H 3AVZA 1OP8A 1XUGA 1QA7A 2ZP0H 4Z6AH 1W10U 1AB9B 1DSTA 1JXPA 1O2UA 5FCKA 2AGGX 4NSVA 3SU0A 3TK5A 1S83A 5TCCA 1NFYA 1G3EA 3NWUA 2Z9IA 3EQ0H 1AMHA 5LH8A 4I31A 4NFFA 4ZUHA 1IQNA 4CRGA 1E38B 1VR1H 4BANB 2A5AA 4KTCA 1ELGA 1C5UA 1LHEH 3T28A 1SMFE 5FBEA 1H8DH 4ZH8A 2F3CE 1AY6H 1VCPA 1TRNA 2O8MA 1P8VC 1ZHRA 3V13A 2FOBA 2GZ9A 2HPPH 1P2IA 5GCHG 1T4UH 3UR9A 3SJ8A 1AFEH 2PUXB 3ENSB 3MU5A 4B2BA 2BX4A 1V2UT 2HVXA 1GJ8B 2Z3DA 1RD3B 1RTKA 5HMAA 2TGPZ 1O30A 1BUIA 5ABWA 3MNSA 5ETXA 1SI5H 1YC0A 1MKWK 2STBE 1C2KA 4CRDA 2BY8X 3EA7A 4NIVA 3EE0B 3Q00A 1O3IA 4UONA 1KSNA 2F83A 2UUKB 1RFNA 3MTYA 2FOCA 1O5FH 1QBOA 1ZYOA 1FN6A 3IG6B 2BD7A 4I8HA 2FX4A 3RXOA 4JZ1A 3P8NA 3UNRA 5DK1A 3AW1A 1E35B 2V6NA 1SGIB 1BDAA 1QGFA 4ZHLU 3VGCC 1T8MA 4AZ2B 2VINA 1BIOA 3ZZCA 3SU4A 4E05H 2WINI 1DITH 4O97A 4U2WA 5LGOA 1WAYB 3UFAA 1Z6EA 3S0NA 1GBDA 2VIQA 4ISHH 3RC4A 1XX9A 4BAQB 2BQWB 3TH3H 3KQBA 2C90B 2PKAA 1MU8B 1D6WA 2F9BH 1SQAA 4YOIA 2H9HA 3KN2A 4GAWA 3TLOA 3L6PA 3MNXA 4B71A 2ZDNA 1CE5A 3PM3A 1RTLA 1V2RT 1QRXA 2BXTH 1QHRB 1GHAG 3SJOA 3BG4B 1ELDE 4FU9A 1O3KA 3P6ZB 5DP3A 4ABDA 4ZKSU 3OTJE 5L6NH 4X1PU 1T8OA 4SGAE 1KTTB 3OY5U 3TVJB 1Y3XA 3RXHA 1TPOA 2RA0A 1UVPA 3E1XB 4WWYA 3AAUA 3A88A 1O2PA 3A7TA 4Y6DA 2FOHA 2QXIA 3S9AA 2VVVA 5GDSH 4I8GA 1C5WB 1UTKA 5E0HA 3ZV9A 1OP0A 4WMEA 3FP8E 3VB5A 1HJAC 3OSYA 5F8XA 2VNTA 1FY1A 1B5GH 1L0ZA 1TBRH 3TH2H 2FP7B 2XNIA 1GI9B 1HDTH 3MFJA 4YLQH 4Q7ZA 3A7VA 4ZKOU 1O2NA 3RDZA 1Y3UA 1O3HA 1C1PA 3M3VA 4ISLA 1O3FA 1SPJA 8GCHG 4A1VA 4OS7A 2AMDA 1GCTB 4MPWA 1W3CA 2ZIQH 1GI2A 2RCEA 3SV6A 1TNGA 2VIWA 2H9TH 1UTQA 1K2I1 3A81A 4ZHMU 2AMPA 2Y80A 2WPLS 7GCHG 1MKXK 1YGCH 1QJ6B 3NUMA 3T62A 4YO9A 2ZGHA 4E7NA 1NC6A 4WF8A 4OS6A 4DURA 1S0RA 4Q7YA 1RS0A 1HPGA 2GCTB 3L3TA 1A61H 3UY9A 1WCZA 2G51A 1OS8A 1KXCA 1O3OA 4GCHG 1TX8A 2SGPE 1BZXE 1SGNE 4XBBA 7ESTE 1KYNA 1YM0A 2PR3A 2FEQH 2CJIA 3KIDU 2CF9H 2WPHS 4CR5A 1SGFG 5HYOA 4K1EA 1NROH 2CXVA 3QDZB 2JETC 1TPAE 4MG3A 3P70B 2PW8H 2BD3A 1ZGIA 1GG6B 3ZZ4A 2TIOA 1HNEE 4YOGA 4GPGA 5K7RA 3A83A 1QQUA 5DP7A 1P01A 1MTNB 1FAKH 2ANKH 4ZXXH 4ABHA 5EPYA 1AO5A 1HFDA 3BTKE 4CRBA 1GI6A 3LJOA 1NS3A 1SGQE 2BQ6B 5H4IB 5C2ZA 1MBMA 4WXIA 4TPYA 3NXPA 3LT3A 2A0QB 2XYAA 1VJAU 4MQAA 1C1OA 4MPVA 1MUEB 1N1LA 4NA8A 1O37A 1CHGA 1OYQA 3S69A 3SU5A 4HZHA 3M7UA 1OX1A 1DWEH 2HNTE 2JKHA 1SLUB 1GHBG 1ELAA 3RMOH 1AUJA 4D9RA 1WOFA 3U98H 2BY6X 2GTBA 2FS8A 1GI5A 3LC3A 1ZMNA 2DUCA 3M7QA 5ESTE 1CA0C 2F9NA 2BDYA 2VIPA 1UK3A 4ZXYH 4OS5A 5E8EH 2A2XH 5GXPA 4CBOA 3ZV8A 1QBNA 1WTHD 3RXVA 3DD2H 1NN6A 3SGAE 2FPZA 2BY7X 1J14A 3T29A 3SUGA 3U8RH 4B73A 3PB1E 1AB9C 1XM1A 1CSOE 2XRCA 4AFZA 2HPQH 3TJOA 3RXIA 2TGDA 2AMQA 2ZGCA 8ESTE 1W7XH 2GGVB 2GT8A 2GV6A 5DKMA 4FUEA 3B9FH 1J8AA 1OKXA 5AVDA 2OC8A 3TGJE 2XBVA 2OC7A 1O3BA 3RMLH 4D76A 3S9CA 3DHKH 2GDEH 3TJVA 1QNJA 1BRUP 3A8AA 3TK6A 3QTOH 1BHXF 2FI3E 1ANCA 2PUQH 1DVAH 5G4BA 5A8YA 4J1YA 2QYIA 3DFLA 1E34B 1ESTA 3G01A 7GCHF 1C9PA 1P06A 4Q7XA 3MU4A 1SGCA 1UVSH 1MTUA 1W0ZU 1W0YH 1ELEE 1P2OA 3A80A 4AFQA 1HJ8A 2BDBA 3Q76A 3QLPH 1LPZB 3RXFA 4MPUA 1OWHA 5EW1H 4CBNA 1YPKH 1TAWA 2ZU4A 1O2HA 4YTAA 4D7GA 1RRKA 3ZYEA 1B7XB 1C5MD 1Y3VA 2VIDA 4ISOA 5EQRA 2GP9B 1P2JA 2Y7XA 2ANYA 3UPEA 2BD2A 2A4GA 5K0HA 1LKBA 1LVYA 3AAVA 2VWNA 4ISIH 1D9IA 1AGJA 1GWAA 4OS4A 3RXSA 4R8TB 2AIPA 3ESTA 2I6SA 3R3GB 2AIQA 4X1QU 3H7TA 5A0AE 4UFGH 1TBQH 1E36B 4MPXA 4AN7A 3A8DA 4UFFH 1A0LA 1O34A 1CU1A 4INKA 3A8CA 3LU9B 3VEQB 3I77A 1O3CA 1TNJA 2A4OA 4ZMAH 3ATMA 1NFUA 1O2JA 3C27B 1PQ8A 2ZDLA 3ZZBA 3Q3YA 4IW4E 1LVOA 1PYTC 2BLOA 4K1TA 3UNQA 1BMAA 1J15A 1KXDA 1WQSA 1L4ZA 2O8TA 4FUHA 1GGDB 2O8WA 4R0IA 4X1RU 1D3PB 5F8ZA 1C5TA 4Z0KA 5C1UA 1AQ7A 2ODPA 4INLA 4K3JA 1AI8H 1G30B 4KGAA 1C2HA 1DY9A 1DXWA 3ZYDA 5F6MA 1O2RA 4AYVB 4NZLA 3KGPA 3UR6A 2SGFE 1GHBF 2Z3CA 1O2XA 4FUDA 4X1NU 1X7AC 3GY8A 1OYTH 2JH0D 2XBXA 2H5DA 1SR5C 1BBRH 1FONA 2XC5A 1ELBA 5FBIA 1UTJA 1DY8A 1TABE 1VITF 4K60A 1F5RA 1KDQA 4THNH 1HAIH 2VWMA 4GHTA 5E2OA 1EXFA 1C5LH 4H6SB 1K21H 1BHXB 3AASA 2OBOA 4B1TA 2FLBH 2WUBA 3TJNA 1WU1A 4CRFA 1DWBH 3VPKA 1NO9H 1K1NA 1INCA 1FY4A 1G37A 1O0DH 2ZFQH 1ZGVA 1TPPA 4NCYA 1GCTC 2GZ7A 3BEFB 4FUJA 3BSQA 5GWZA 1RGQA 1QBVH 1HV7A 1AIXH 1BJUA 1EAXA 1ZJKA 3BG8A 4QT8C 1AHTH 1ZPCA 3FP7E 3MH4A 4INHA 1Z8GA 2ZQ1A 2VIVA 4YT6H 3DA9B 4JCNA 2DE8A 2WV5A 3B8JA 5SGAE 1O3DA 1GMDF 2LNCA 5EQQA 1C4Y2 1V2MT 4I8KA 3ATIA 4YLUA 2SGQE 3M35A 4H4FA 1NU7B 3MH7A 1AVWA 1GI7B 2FOGA 1HAZB 5ESBA 3ZZ9A 1Q2WA 2GCTC 2BLVA 1TALA 1PPHE 2VU8E 1BITA 3EA8A 3P8FA 5A09A 3E0PB 5BRRE 3BF6H 4XSKU 2UUYA 1YPLH 2Q6GA 3SHAH 2QIQA 3BIUH 5AHGH 2JETB 3IWMA 3RXKA 1L4DA 2AGIX 4K1SA 4AGKA 1C2LA 4JZDH 1OP2A 1K1JA 4BAHB 4RN6A 2ZQ2A 3VB4A 2BVSH 3P17H 1UCYK 1TNHA 1GL1A 2BDCA 1CHOG 2BD5A 1GG6C 1Z8IB 3E16B 1GBBA 1W7GH 2FXRA 1P9SA 1MTNC 1EATA 4OGYA 2KAIA 4NWKA 4XFQA 2TRMA 3MNCA 3GYMA 4X2YA 1O2TA 2Q1JA 3MU0A 1HCGA 3RMMH 1UO6A 2ZU1A 1GVZA 5A8XA 2H1UA 1HBTH 3Q77A 1EX3A 3O8CA 5LPFA 1H9IE 4X2XA 1DLEA 4X1SU 1MZAA 4BTUB 3MMGA 3UIRA 1N6YA 2EC9H 4KTUA 4FVBA 1SFQB 3A82A 1C5VA 1EJAA 3CS7A 1MD7A 1FUJA 5CE1A 5CHAB 1GDNA 2P8OB 1GI1A 1GJDB 2P93A 1UTNA 2ZI2H 3PTBA 2C4FH 5LPRA 1TRMA 1ZTKA 3VXEH 4AB8A 1FJSA 1DLKB 1H9HE 1P02A 3SNCA 3OX7U 3KNXA 4I8LA 3F9GA 1XXDA 1Z8RA 2ZFTA 1ZJDA 2PKSB 3T25A 3UREA 4BOHA 2FOFA 2ODYB 5AFYH 6CHAC 1NFXA 3HGNA 1ZR0A 5FHTA 1SOZA 3E3TA 1BTYA 1F0SA 3ZZDA 2HWLB 1EPTA 1GCDA 1QB6A 4WVPE 3RXGA 4YESB 1EP5A 1O5GH 1C2GA 3V3MA 1Y59T 2D26C 1C1VH 1V2QT 3BTFE 2GT7A 3TPIZ 1UCYE 3GY2A 5I46H 1A3EH 1N8OB 1Z7KA 2DE9A 1PPCE 4U30A 5AF9H 1TE0A 1GI4A 2BY9X 5C1XA 2ASUB 1C2JA 2ZHEH 1H8IH 2W3IA 4TYDA 1BTPA 1NPMA 5EG4A 2J95A 2QY0B 1KXEA 4O03A 3UQVA 3SQHE 3SU3A 5JBAS 1DUAA 4X8VH 1TX7A 1TBZH 2PTCE 3M3TA 2BD8A 3VB3A 3R0FA 2EEKA 3GDUA 1AZ8A 1THRH 3RM2H 1CT2E 2Y6TA 1G9IE 2QV1A 4TWWA 1C1UH 1MCTA 2A45B 2ZF0H 3F1SB 1T31A 2BLWA 4UE7H 3M5LA 5FX5A 1GMCF 3ZZ6A 1O39A 2LPRA 4ZAEA 1KTSB 2OTVA 1O3PB 1ESBA 1OOKB 2HRVA 4Y79A 5E0JA 4RSPA 1TRYA 1DDJA 1LO6A 3LIWA 2ZU3A 2C3SA 2FX6A 1HXEH 4Q2KA 3ZZ3A 1P03A 3FZZA 3RXAA 1AKSA 2HLCA 2Z9KA 4ZHAA 1DOJA 3MU8A 2VH0A 1CHOF 8LPRA 2QXJA 1XUIA 2ZHFH 3FFGA 3U1JB 1O31A 1K1LA 2FOMB 4XDEA 3GCTG 3TGIE 5EXNA 2GCHG 2PWXA 4H42U 3MOCA 4BNRA 2WPKS 1GHYH 1PQ7A 1D6RA 1E0FD 1GBMA 1ETSH 1WUNH 3A85A 2VWOA 4CREA 1OWJA 4DT7B 3VB7A 1HIAA 3BTTE 1LCYA 1A1RA 1GGDC 1A5GH 1TOCB 1A3BH 3ZZ5A 2FIRH 1MTWA 4NGAH 3I78A 4B76A 1D3DB 1HAVA 1SFIA 5DPAA 1UHBB 1MU6B 1O36A 2I6QA 2VB0A 3RXLA 1C5QA 2R2WU 5JBBS 2A31A 1H4WA 3UWJH 3SNAA 1C5PA 2BB4A 4BXWA 3FZDA 2PV9B 1YP9A 3PV4A 4AFSA 1A46H 1K22H 1MAYA 4K5ZA 1OPHB 1C1WH 3F68H 3SO3A 3AW0A 1P04A 3GOVB 3TGKE 1A5IA 4JZFH 2ZECA 3GCHB 1MQ5A 1C2IA 3U9AH 1V2ST 1CGJE 1HB0B 2ALPA 4KTSA 4BAMB 2XCFA 1TONA 2R0LA 4O3UA 1RTFB 3PROA 4ASHA 4X8UH 1BMNH 5EW2H 1DXPA 1RIWB 2ZDAH 1GVKB 2BD9A 2CN0H 1MCVA 3LGVA 1BMLA 4K69A 1SVPA 3U1IB 1FQ3A 2A2QH 1C1SA 2OCVB 1S0QA 1TYNA 2W26A 5I25A 1C2DA 4GHQA 4AB9A 2OLGA 4Y8ZA 4X8TH 1GJ7B 3LOXA 2WYGA 4LOYH 3UOPA 4B74A 1WQVH 1FIWA 1YLDA 4NIWA 1KLJH 3OY6U 2BTCE 2Z3EA 3RXEA 1G32B 1DANH 2W3KA 3ELAH 4NIYA 1TGCA 3TU7H 3NPSA 4D9QA 2ZHWH 1K1OA 1YCPK 3GICB 3UQOA 1CVWH 2F9OA 2QF3A 1THPB 2R0KA 3UOUA 4OS1A 5DP8A 1OWDA 4MDSA
chains in the Genus database with same CATH superfamily
1L1GA 2V0BA 2D8WA 1Y5UT 4TWYA 2ANMH 2ZFFH 3ZZ7A 1EOLA 4FUGA 4IGDA 3RC6A 2AERH 4SGBE 4CRCA 1Y8TA 1TNLA 2B7DH 3EGKH 1PPFE 2QN5T 3PYHA 4K8YA 1COWD 3QGNB 3GISB 1ARBA 1P05A 2P3UB 1CGIE 1TNIA 5EJLA 1Y5BT 1SQRA 1TMBH 2XTTB 2ZU5A 1IQKA 1SC8U 1S6HA 3GY3A 1MZDA 4DG4A 1FY5A 3K2UA 2CF8H 2WSSD 2W6JD 5C1YA 2ULLA 4AX9H 3GCTF 4CH8B 6LPRA 3SUDA 1C1RA 2IN2A 1T8NA 2GCHF 2ZEBA 4ISNA 3DCLA 2GX4A 1UVOA 1V2NT 3O8BA 2WV4A 4LXBH 1TB6H 2C8YB 1VJ9U 3E90B 2C8ZB 3PMAB 4A7IB 5GPIB 2PKAB 3HK3B 5CHAC 1MAXA 2P8OC 4JYTA 1VITG 1LDTT 5IYTA 2EI8A 1LHDH 2VWLA 2A32A 1EQ9A 5LPEA 1LVMA 1IHSH 2YMSB 6CHAB 2W6ID 4PROA 5BPEA 4NSYA 5FPYA 2Z94A 3A8BA 1O2MA 3QZRA 4RKOB 3QO6A 2PKSC 5EGMA 4ABEA 2FS9A 3PV5A 1Z1JA 2WYJA 4JZIA 2OBQA 3CENA 1SHHB 3URCA 1XKAC 4AYYB 2OXSA 1UJ1A 1GBAA 1ZOMA 1F0UA 3H7OA 4JMYA 3QWCH 3SGQE 3QX5H 1LTOA 2PSYA 1ESAA 3KEEA 4BXSA 1JRSA 4K8BA 1N8OC 4ABBA 3B23B 1BT7A 1OWEA 4F4OC 3RXPA 2BVRH 1K1IA 1O2GH 1GMDG 4IBLH 3PO1C 1UK4A 1O2YA 3SNDA 5B6OA 2FI4E 5FPSA 2XBWA 2THFB 2TGTA 1LKAA 2WPMS 2PGQB 4KKDA 4IMZA 1SGFA 1MKWH 4HGCA 1T4VH 1C5RA 1B0EA 1HJ9A 1THSH 5C5OA 1HAOH 3SV8A 2ILNA 1GHWH 3Q3XA 2ZA5A 2P95A 1SLXB 2SNWA 8KME2 1PPEE 1LHFH 1PYTD 1C2MA 2BM2A 2UUFB 2GDDA 2KZ4A 3CP7A 1D3TB 1JMOH 1SG8B 4WMFA 5JBTA 1GJ5H 4ABJA 2TGAA 3T26A 4X6OA 1TWXB 2IJOB 4E7RG 3RP2A 2BXUH 1F5LA 1SBWA 2BY5X 3KYGA 3BTHE 1IHTH 1NRQH 4LK4A 2OP9A 1O2OA 3UTUH 1AWFH 1GBEA 4X0WU 2SGDE 3MO9A 2RA3A 2PFEA 6ESTA 2C93B 3BTME 2YNAA 1O2IA 4BAKB 4A1TA 1W2KH 3HATH 2Z9LA 1GJ6A 2PSXA 2FO9A 1NU9A 3SZNA 3FANA 2ZFRH 4YOJA 1AVGH 5DO4H 1GBTA 3PLBA 3TNSA 2FOAA 5J4QA 3UWIA 1O3AA 1QFKH 2QC2A 2NU1E 2M5TA 4X2WA 2J4IA 1P10A 1F2SE 2QE7D 4A1XA 3K65B 1VZQH 1J16A 2P59A 3MH6A 3ZVCA 1BTXA 3GCOA 1AFQB 1SGYE 1O38A 2J2UA 4NG9H 4WJG2 2AYWA 1NM6A 4BAOB 3S7KB 1QB1A 4MLFB 3F9EA 4MTBA 1YPGH 1FZZA 4H6TA 4YXWD 1Z8JB 2FOEA 1TMUH 3VFEA 1QURH 1P2QA 1LHCH 2Y5GA 4RT1A 4DIHH 2VJ1A 5L2YH 2NU0E 1GJ9B 2ZPSA 2ZPRA 4YT7H 2Z9JA 4Q63A 2J94A 5EODA 1BB0B 1V2OT 3SW2B 1O3JA 2G4TA 3KHVA 1WDIA 4IC6A 4MNWA 2AS9A 5E2PA 1K28D 1G3DA 1TPSA 4DVAU 1V2KT 3LGUA 4X8SH 1JBUH 1ZZZA 1F7ZA 1O2SA 4ABAA 2KCPA 2QA9E 1S6FA 2BMGB 4TY6A 3OYPA 4HTCH 4KP0A 2V3OH 3IITA 5EXLA 5KEDA 2ZHQH 3ATLA 5GIBA 5TJXA 1ZRKA 2R3UA 4Y7AA 4A6LA 1T32A 5J4SA 4BTTB 4NWLA 1EASA 3E91A 5C0TA 3GCHC 1W13U 2ZPQA 3MWIU 3FN8A 1TGBA 1TGNA 1TIOA 1MKXH 2G52A 3SOSA 3S7HB 2RFKC 5F03A 2W7SA 1GMHF 3PRBA 2V35A 5HM9A 1YWUA 5EQSA 2ODQA 1GBCA 1GI3A 4Z0KA 1RIWC 3M7TA 2KCYA 2EI7A 3LONA 3TIUA 1P57B 3DT0H 1KLTA 2P16A 2W5EA 2FZZA 2WUCA 1EKBB 1PPZA 4HI3A 1GMCG 1O3NA 4JK6A 3PMBB 5C67A 1YPHC 3SJIA 4WY3A 4FU7A 5DP6A 2VH6A 3EYDA 3SJKA 2Y5FA 1PPGE 1EZXC 3VB6A 1K1MA 1O2LA 2VIOA 4IN1A 1C5ZB 1QL7A 3SU1A 1QY6A 5C3NA 2ZCLP 3TK9A 4ACAA 1SGEE 2ZNKH 3E0NB 3JZ2B 4IN2A 3M37A 4NA7A 4WXVA 5T3HA 4FU8A 1LVBA 2ZG0H 1PFXC 1DM4B 4FUBA 4X6PA 1LPKB 2ZHDA 1Z71A 3SNEA 4AORA 1T7CA 4CHAC 2BVXH 1Q3XA 1NESE 3RM0H 3HKIB 3SV2H 5A0BA 1OWKA 4TT3D 3K9XB 1ABIH 5HXFA 2OC0A 4MVNA 1BOQA 1HAGE 2YMSD 3TITA 3CS0A 2QCYA 1P09A 2Q6FA 5T6GA 1GBKA 2ZWLH 2ZKSA 1FY8E 3DSOA 3SNBA 2XNDD 1M9UA 3T5FH 3S9BA 3ZVEA 1CT0E 2K0QA 1RJXB 3SUEA 4K2YA 3KYFA 1MBQA 3LKWA 4JYVH 2G4UA 3M61U 5JB9S 1SQOA 1V2LT 5GJ4B 1NRSH 1HYLA 3ITIA 1FN8A 1S81A 2TBSA 1GBFA 2Q6DA 2XOKD 5A2MH 2QGRA 2XWBI 1PPBH 2FESH 4B2CA 1IQLA 1U6QA 1WBGB 2BOKA 3I29A 3GY5A 1UVUH 3KF2A 1VGCC 1SSXA 4UEHH 1O5BB 5DP5A 1VCWA 3SYJA 4DJZB 3V7TA 4MNYA 3RXBA 5CHBA 1MABB 4D7FA 1C2FA 2XW9A 2SFAA 4I33A 2YMSC 1SGDE 1ELVA 2IPHA 1ANBA 6GCHF 2FLRH 1O2KA 2B9LA 2FYRA 4XE4A 1HGTH 1P3EA 3OEED 4AGJA 2XC0A 3ZVAA 1XUFA 4Q80A 1AE5A 1ABJH 4DW2U 1FIZA 1G2MA 1BRAA 3OAAD 4ASUD 4FXGH 3KQEA 1XUKA 3F9HA 5JYIA 1H8HD 4AOQA 3SORA 2GMTB 5DP4A 1E37B 3EA9A 1DE7H 1KDQB 4M7GA 1TFXA 1DS2E 2STAE 3LGIA 3PO1B 2OQ5A 1EB2A 1CGHA 3P8GA 2NWNA 1V6DA 2P94A 1EB1H 1JWTA 1NBMD 4E06H 3RXDA 2Z7FE 3LGYA 1V2PT 1HAHH 2HGTH 2Y82A 1TNKA 5DG6A 3PWCA 3BTQE 2Y7ZA 3OE7D 1V2JT 3LGTA 1Q31A 1C4V2 1SGTA 3U8TH 1AVXA 1YYY1 1XMNB 3A7XA 3C1KA 1YKTA 1YBWA 4GLYA 1QL9A 1UTPA 3MO6A 3H09A 3ZVFA 4DCDA 3BTWE 3GDVA 1YCPM 1DPOA 2NU4E 1EZQA 1P9UA 4YM9A 1Z1IA 3DUXH 1AD8H 1MD8A 1NRNH 3FKSD 2HALA 5B6LA 1FY3A 5JDUB 4GSOA 1OSSA 1P12E 1EP6A 4Y0ZE 1O3MA 1YF4A 3A7ZA 1F0RA 4X6NA 3SV9A 1TLDA 4D8NA 2C8XB 5DP9A 1UVTH 3BEIB 2F4LA 4ZKNU 4B6EA 2D1JA 1BRCE 5IDKA 1GDUA 1LQEA 5T6FA 4AG1A 3H5CB 2P3FH 4I32A 2GKVE 1EAUA 1OWIA 3PWBA 3UNSA 2A5KA 2IOTA 4LZ4B 1QIXB 2J34A 1P3CA 3A89A 3L33A 4Y71A 4ZKRU 1O5AB 1FV9A 4ABFA 1EAWA 1FI8A 1O5CB 3ZVDA 5L2ZH 1GHZA 1NRRH 1G36A 4Y7BA 1FDPA 2GD4B 2FYQA 5C17A 2XWAA 1L2EA 4NFEA 5KGOA 3FP6E 2CHAB 4FUFA 1GBIA 3BV9B 4RI0A 1OXGA 4B75A 3UUZA 1UTLM 2FODA 1GPZA 3BTGE 1QJ1B 2J92A 3PMHB 1HAXB 1QL8A 1AFQC 2KCAA 3FVFB 2KAIB 2OC1A 2VGCC 4RKJB 1TGSZ 3MNBA 3MH5A 3F2GA 4ZROA 2J9NA 2XXLA 3HK6B 1ETTH 1NT1A 1MMJN 2G5VA 2G8TA 2IJD1 4U32A 2HLDD 4A92A 4ACBA 1S82A 2FMJA 1XVOA 2BDIA 3NKKA 3LPRA 1SLVB 1EJNA 1DFPA 1MTVA 1P11E 2A7HA 2ZDKA 1TGTA 1P2KA 1C1QA 1V2TT 3GCNA 1J17T 3P8OA 5C5NA 1ZHMA 1ARCA 4AG2A 1LHGH 1C4U2 1BBRK 1EAIA 5EOKA 5L30H 1IAUA 1ANEA 2TPIZ 1C5SA 3O8DA 4XBCA 4GVUA 3M5NA 2BQ7B 1A4WH 1CBWB 2Z9GA 3PLPA 2YOLA 1EPTB 2ZDMA 1V2WT 2W7UA 2IPQX 3SHCH 1XVMA 3F0PA 1AZZA 1ZPZA 2UWPA 3AK5A 3ZVBA 2XCNA 1LPGB 1O2ZA 4J2YB 4YZUA 2A5IA 1VCQA 4DGJA 1HAPH 1A7SA 2Y81A 1NY22 1FAXA 3A7YA 2G81E 3LC5A 1EUFA 3GY6A 4WH6A 3D49H 1TQ7B 9LPRA 4UFDH 3OEHD 1KY9A 1O2WA 2GZ8A 1ETRH 1LQDB 3F2FA 3HKJB 4AFUA 3ZZ8A 1FMGA 1SL3A 4DT4A 2PLXA 5GCHF 1GHVH 4OGXA 2SNVA 4Y8XA 5AFZH 4MNXA 1DICA 1YLCA 4FOUC 2ZTYA 3SU6A 1G3CA 1UCYH 3ZVGA 4CHAB 1A2CH 5TCAA 1AU8A 1IQEA 2UUJB 2ALVA 2PTNA 5FPTA 2B5TB 3SU2A 3U8OH 2HOBA 3Q3KA 1FNIA 3A7WA 2OQUA 1ZTJA 2BD4A 1DT2A 1KXAA 3UAIC 1W8BH 3MU1A 3BTDE 1BBRE 2A4RA 3RU4D 1TMTH 1QRWA 1Z6JH 4KELA 3LH3A 4P00A 3T2NA 3QZQA 1O32A 3F2HA 5HIYA 2ZC9H 1SQTA 2OUAA 4FVDA 2QXGA 1BQYA 2M2AA 1YPMH 4X2VA 3SI3H 5T6DA 2PGBB 2A4QA 1LMWB 4Y0YE 1MTSA 3TNTA 1AKSB 1BMFD 3STJA 2EI6A 4B2AA 2ZCHP 2ZGBH 1C5OH 1O5DH 4F49A 1VGCB 5EPNA 2F9UA 3RC5A 5FX6A 2R9PA 3A87A 4VGCB 1QQ4A 1S85A 1ZMLA 2A1DB 1NZQH 2QXHA 3T27A 1H1BA 2QAAA 3LJJA 2HNTC 2ZFPH 1F0TA 4FUCA 3EAJA 1BTWA 1GJCB 4UD9H 3QTVH 2V7QD 4JYUH 1D3QB 2K1QA 1KLIH 2F9PA 2QF0A 3TH4H 1HIAB 1EJMA 1O2VA 1KXBA 2ZTZA 1GHAF 3RU4E 2BHGA 1YPJH 2SGEE 3MHWU 4HFPB 3FAOA 1CQQA 5FXLA 2ZU2A 2YNBA 2AFQB 4U01A 1GDQA 1W0JD 2FI5E 3PMJA 2B8OH 4BTIB 3D65E 2ZZUH 3ATKA 1HAVB 1UMAH 1KXFA 3NCLA 1ZSJA 1O2QA 5HGGA 3RXCA 1GMHG 1XUJA 2O8LA 3RXRA 1O35A 4ABGA 1W11U 2GMTC 3QUMP 4LZ1H 3KQDA 2CMYA 4DIIH 3SV7A 3KQ5A 2B0FA 2C8WB 3HPTB 3KQCA 1GBJA 3UB0A 3V12A 2QF5A 2H9EH 5DN6D 1Y3YA 4DOQA 1O3LA 5E0GA 1ELFA 3A86A 3D62A 1H9LB 5HKKD 8GCHF 1EOJA 1KMHB 3M5OA 2ZO3H 4ABIA 4CR9A 4DY7B 1K0HA 1TOMH 3NK8A 1C9TA 2FTLE 1QTFA 1C2EA 3ODDA 5FCRA 1W14U 1F92A 4GUXA 1XXFA 1TA6A 3N7OA 1ORFA 1GJBB 2JH6D 3RXTA 3GYLB 3PTNA 1A5HA 1FXYA 1FPHH 1O3EA 1AUTC 4F48B 2BDGA 3A84A 2Z6BD 2VVCA 2D2DA 2UWLA 1ZRBA 1TX6A 3LH1A 3QGJA 2P3TB 5HIZA 3BTEE 4IMQA 1IQGA 4UFEH 4Y76A 2KM0A 2PP6A 1QCPA 2BDHA 4JZEH 5EU8A 5EXMA 4O3TA 1C5XB 1JIRA 1K1PA 1IQFA 2A7CA 1DUEA 2VBCA 1ELTA 1GBHA 3LGWA 4NA9H 5EIYA 2XC4A 4GCHF 3VGCB 1ZLRA 3M3SA 1C1TA 3PLKA 1O33A 5PTPA 1AWHB 4TPIZ 5DSFA 3E8LA 3RU4T 1AN1E 2J98B 2V3MA 2GV7A 1WYKA 1O5EH 5CMXH 1BTZA 3KCGH 4NZQA 3RXQA 2H2ZA 5FAHA 4CRAA 4MNVA 2UWOA 1SKYE 2CHAC 2F43B 3W95A 1IQJA 3SGBE 1AE8H 1IOEA 4I8JA 1O3GA 3RUOA 1UTMA 2VGCB 2WZQA 4JK5A 4Y11E 1EZSC 3SBKA 1CO7E 5HM2A 2F9VA 1DSUA 2ZFSA 3SUFA 1V3XA 4XOJA 1GI8B 2BDAA 3ODFA 5JB8S 2BX3A 1TQ0B 6GCHG 1BMMH 1J9CH 1JRTA 1FLEE 4I7YH 2FM2A 1ZMJA 4HG6A 1SOTA 1ACBE 2WPJS 2FWWA 1C5YB 1V2VT 1ZHPA 3BG4C 2RDLA 3ATWA 3W94A 1ZSKA 2J97A 4IS5A 9ESTA 4WMDA 2BOHB 1ZSLA 2G00A 3HGPA 4CH2B 2HNTF 1ELCA 2AH4X 3ZZAA 2ANWA 2OINA 2J38A 1HJAB 3P92A 3QK1A 4O9VA 1CA8B 2ESTE 2NU2E 3BEUA 1PJPA 1GL0E 1C1NA 1SGPE 1L1NA 3JZ1B 4TY7A 1RXPA 4Y8YA 3RXJA 1T8LA 1DWCH 4UDWH 2Y5HA 2ZGXH 1MQ6A 1CBWC 1JOUB 1PQAA 2G5NA 4X6MA 1EPTC 1K9OE 4IC5A 3MO3A 1IQIA 1P2MA 1Y3WA 1VITH 1IQMA 2V3HH 1BJVA 1UK2A 3RMNH 1YPEH 3SQEE 2G55A 1DX5M 4OS2A 1QJ7B 3D23A 1HAYB 3E6PH 3K6YA 4M9FA 5C20A 1HRTH 1ZPBA 2FTMA 2O8UA 1QB9A 1YPHE 3MYWA 1JIMA 1G2LA 1EZUC 4Y10E 1Y5AT 3F9FA 2ZTXA 3V0XA 2WV9A 1D4PB 1DWDH 1ID5H 1PQ5A 3SZEA 3SJ9A 3QN7A 1QA0A 1MH0A 3VXFH 5JPMH 1YCPH 1SHYA 4F55A 7LPRA 3SN8A 4ESTE 5A8ZA 3RLWH 1L1JA 3GY4A 1IQHA 3LDXH 1ZTLA 3K6ZA 2CV3A 1XKBC 1W12U 2FDAA 1F5KU 5DJ7A 1GI0A 3GDSA 3F6UH 3TJUA 1FPCH 3U69H 1HUTH 1C1MA 2H6MA 1KIGH 2CGAA 2BLQA 3BIVH 4XBDA 2AGEX 3RLYH 1CT4E 2RG3A 5A0CA 2ZGJA 3O8RA 3GY7A 2OD3B 1NRPH 3M5MA 4WH8A 1TA2A 2AEIH 1P0SH 1UTOA 1XUHA 1BA8B 1S5SA 1BCUH 1NFWA 2BYAX 3SI4H 1WSSH 4NIXA 1QRZA 1BTHH 1WXRA 1OHHD 3EDXB 2NU3E 5JBCS 1WTGH 2OK5A 1BRBE 2EA3A 3WY8A 1S84A 1SLWB 1GVLA 5F8TA 1GBLA 2WPIS 1UHBA 3URDA 4AC9A 3STIA 4VGCC 2XBYA 2PHBA 2JH5D 2A7JA 1GHXH 1B0FA 3DFJA 1A0HB 1G3BA 1P2NA 2BZAA 1GJAB 3KL6A 2GVFA 1QR3E 1N6XA 4A5TS 2SGAA 1CA0B 3OU0A 2O9QA 2R2MB 3NZIA 1NTPA 5DGJA 4FUIA 1C5NH 3P95A 1SB1H 1WV7H 2H5CA 1BTUA 1A0JA 1ANDA 2VVUA 3RXMA 2R3YA 2JJ1D 2ZCKP 2ZDVH 1GJ4H 3MI4A 2F91A 7KMEH 1SGRE 1HLTH 3BN9A 3RXUA 3M36A 1HXFH 2BZ6H 3AVZA 1OP8A 1XUGA 1QA7A 2ZP0H 4Z6AH 1W10U 1AB9B 1DSTA 1JXPA 1O2UA 5FCKA 2AGGX 4NSVA 3SU0A 3TK5A 1S83A 5TCCA 1NFYA 1G3EA 3NWUA 2Z9IA 3EQ0H 1AMHA 5LH8A 4I31A 4NFFA 4ZUHA 1IQNA 4CRGA 1E38B 1VR1H 4BANB 2A5AA 3WWBA 4KTCA 1ELGA 1C5UA 2CK3D 1LHEH 3W1EA 3DSGA 3T28A 1SMFE 5FBEA 1H8DH 4ZH8A 2F3CE 1AY6H 1VCPA 1TRNA 2O8MA 1P8VC 1H8ED 1ZHRA 3V13A 2FOBA 2GZ9A 2HPPH 1P2IA 5GCHG 1T4UH 3UR9A 3SJ8A 1AFEH 2PUXB 3ENSB 3MU5A 4B2BA 2BX4A 1V2UT 2HVXA 1GJ8B 2Z3DA 1RD3B 1RTKA 5HMAA 2TGPZ 1O30A 1BUIA 5ABWA 3MNSA 5ETXA 1SI5H 1YC0A 1MKWK 4Z1MD 2STBE 5T1VA 1C2KA 3OTPA 4CRDA 2BY8X 2KCOA 3EA7A 4NIVA 3EE0B 3Q00A 1O3IA 4UONA 1KSNA 2F83A 2UUKB 1RFNA 3MTYA 2FOCA 1O5FH 1QBOA 1ZYOA 1FN6A 3IG6B 2BD7A 4I8HA 2FX4A 3RXOA 4JZ1A 3P8NA 3UNRA 5DK1A 3AW1A 1EFRD 1E35B 2V6NA 1SGIB 1BDAA 1QGFA 4ZHLU 3VGCC 3VG8A 1T8MA 4AZ2B 2VINA 1BIOA 2JDID 3ZZCA 3SU4A 4E05H 2WINI 1DITH 4O97A 4U2WA 5LGOA 1WAYB 3UFAA 1Z6EA 3S0NA 1GBDA 2VIQA 4ISHH 3RC4A 1XX9A 3N99A 4BAQB 2BQWB 3TH3H 3KQBA 2C90B 3NRLA 2PKAA 1MU8B 1D6WA 2F9BH 1SQAA 4YOIA 2H9HA 3KN2A 4GAWA 3TLOA 2LELA 3L6PA 3MNXA 4B71A 2ZDNA 1CE5A 3PM3A 1RTLA 1V2RT 5C94A 1QRXA 2BXTH 1QHRB 1GHAG 3SJOA 3BG4B 1ELDE 4FU9A 1O3KA 3P6ZB 5DP3A 4ABDA 4ZKSU 3OTJE 5L6NH 4X1PU 1T8OA 4SGAE 1KTTB 3OY5U 3TVJB 1Y3XA 3RXHA 1TPOA 2RA0A 1UVPA 3E1XB 4WWYA 3AAUA 3A88A 1O2PA 3A7TA 4Y6DA 2FOHA 2QXIA 3N7EA 3S9AA 2VVVA 5GDSH 4I8GA 1C5WB 1UTKA 5E0HA 3ZV9A 1OP0A 4WMEA 3FP8E 3VB5A 1HJAC 3OSYA 5F8XA 2VNTA 1FY1A 1B5GH 1L0ZA 1TBRH 3TH2H 2FP7B 2XNIA 1GI9B 1HDTH 3MFJA 4YLQH 4Q7ZA 3A7VA 1YY3A 4ZKOU 1O2NA 1UW7A 3RDZA 1Y3UA 1O3HA 1C1PA 3M3VA 4ISLA 1O3FA 1SPJA 8GCHG 4A1VA 4OS7A 1E79D 2AMDA 1GCTB 4MPWA 1W3CA 2ZIQH 1GI2A 2RCEA 3SV6A 1TNGA 2VIWA 2H9TH 1UTQA 1K2I1 3A81A 4ZHMU 2KX4A 2AMPA 2JJ2D 2Y80A 2WPLS 7GCHG 1MKXK 1YGCH 1QJ6B 3NUMA 3T62A 4YO9A 2ZGHA 4E7NA 1NC6A 5KECA 4WF8A 4OS6A 4DURA 1S0RA 3PRDA 2JIZD 4Q7YA 1RS0A 1HPGA 2GCTB 3L3TA 1A61H 3UY9A 1WCZA 2G51A 1OS8A 1KXCA 1O3OA 4GCHG 1TX8A 2SGPE 1BZXE 1SGNE 4XBBA 7ESTE 1KYNA 1YM0A 2PR3A 2FEQH 2CJIA 3KIDU 2CF9H 2WPHS 4CR5A 1SGFG 5HYOA 4K1EA 1NROH 2CXVA 3QDZB 2JETC 1TPAE 4MG3A 3P70B 2PW8H 2BD3A 1ZGIA 1GG6B 3ZZ4A 2TIOA 1HNEE 4YOGA 4GPGA 5K7RA 3A83A 1QQUA 5DP7A 1P01A 1MTNB 1FAKH 3WW7A 2ANKH 4ZXXH 4ABHA 5EPYA 1AO5A 5EJ1A 1HFDA 3BTKE 4CRBA 2K8IA 1GI6A 3LJOA 1NS3A 1SGQE 2BQ6B 5H4IB 5C2ZA 1MBMA 4WXIA 4TPYA 3NXPA 3LT3A 2A0QB 2XYAA 1VJAU 4MQAA 1C1OA 4MPVA 1W0KD 1MUEB 1N1LA 4NA8A 1O37A 1CHGA 1OYQA 3S69A 3SU5A 4HZHA 3M7UA 1OX1A 1DWEH 2HNTE 2JKHA 1SLUB 1GHBG 1ELAA 3RMOH 1AUJA 4D9RA 1WOFA 3U98H 2RDEA 2HVYB 2BY6X 2GTBA 2FS8A 1GI5A 3LC3A 1ZMNA 2DUCA 3M7QA 5ESTE 1CA0C 2F9NA 2BDYA 2VIPA 1UK3A 4ZXYH 4OS5A 5E8EH 2A2XH 5GXPA 4CBOA 3ZV8A 1QBNA 1WTHD 5C1UA 3RXVA 3DD2H 1NN6A 3SGAE 2FPZA 2BY7X 1J14A 3T29A 3SUGA 3U8RH 4B73A 3PB1E 1AB9C 1XM1A 1CSOE 2XRCA 4AFZA 2HPQH 3F3BA 3TJOA 3RXIA 2TGDA 2AMQA 2ZGCA 2KFWA 8ESTE 1W7XH 2GGVB 2GT8A 2GV6A 5DKMA 4FUEA 3B9FH 1J8AA 1OKXA 5AVDA 2OC8A 3TGJE 2XBVA 2EY4C 2OC7A 1O3BA 3RMLH 4D76A 3S9CA 3DHKH 2GDEH 3TJVA 1QNJA 1BRUP 3A8AA 3TK6A 3QTOH 5CDFE 1BHXF 2FI3E 1ANCA 2PUQH 1DVAH 5G4BA 5A8YA 4J1YA 2QYIA 3DFLA 1E34B 1ESTA 4I86A 3G01A 7GCHF 1C9PA 1P06A 4Q7XA 3MU4A 1SGCA 1UVSH 1MTUA 1W0ZU 1W0YH 1ELEE 1P2OA 3A80A 4AFQA 1HJ8A 2BDBA 2EQNA 4RT0A 1YLNA 3Q76A 3QLPH 1LPZB 3RXFA 4MPUA 1OWHA 5EW1H 4CBNA 1YPKH 1TAWA 2ZU4A 1O2HA 4YTAA 4D7GA 1RRKA 3ZYEA 1B7XB 1C5MD 1Y3VA 2VIDA 4ISOA 5EQRA 2GP9B 1P2JA 2Y7XA 2ANYA 3UPEA 2BD2A 2A4GA 5K0HA 1LKBA 1LVYA 2L74A 3AAVA 2VWNA 4ISIH 1D9IA 1AGJA 1GWAA 4OS4A 3RXSA 4R8TB 2AIPA 3ESTA 2I6SA 3R3GB 2AIQA 4X1QU 3H7TA 5A0AE 4UFGH 1TBQH 1E36B 4MPXA 4AN7A 3A8DA 4UFFH 1A0LA 1O34A 1CU1A 4INKA 3A8CA 3LU9B 3VEQB 3I77A 1O3CA 1TNJA 2A4OA 4ZMAH 3ATMA 1NFUA 1O2JA 3C27B 1PQ8A 2ZDLA 3ZZBA 3Q3YA 4IW4E 1LVOA 1PYTC 2BLOA 4TSFD 4K1TA 3UNQA 1BMAA 1J15A 1KXDA 1WQSA 3FO8D 1L4ZA 2O8TA 4FUHA 1GGDB 2O8WA 3FOAA 2L6OA 1D3PB 4R0IA 1C5TA 4X1RU 5F8ZA 1AQ7A 2ODPA 4INLA 4K3JA 1AI8H 1G30B 4KGAA 1C2HA 1DY9A 1DXWA 3ZYDA 5F6MA 1O2RA 4AYVB 4NZLA 3KGPA 3UR6A 2SGFE 1GHBF 2Z3CA 1O2XA 4FUDA 4X1NU 1X7AC 3GY8A 1OYTH 2JH0D 2XBXA 2H5DA 1SR5C 1BBRH 1FONA 2XC5A 1ELBA 5FBIA 1UTJA 1DY8A 1TABE 1VITF 4K60A 1F5RA 1KDQA 1VKYA 4THNH 1HAIH 2VWMA 4GHTA 4B6FA 5E2OA 1EXFA 1C5LH 4H6SB 1K21H 1BHXB 3AASA 2OBOA 4B1TA 2FLBH 2WUBA 3TJNA 1WU1A 4CRFA 1DWBH 3VPKA 1NO9H 1K1NA 1INCA 1FY4A 3PV2A 1G37A 1O0DH 2ZFQH 1ZGVA 1TPPA 4NCYA 4Q4LA 1GCTC 2GZ7A 3BEFB 4FUJA 3BSQA 5GWZA 1RGQA 1QBVH 1HV7A 1AIXH 1BJUA 1EAXA 1ZJKA 3BG8A 4QT8C 1AHTH 1ZPCA 3FP7E 3MH4A 2WHXA 1Z8GA 2ZQ1A 4INHA 2VIVA 4YT6H 3DA9B 4JCNA 2DE8A 2WV5A 3B8JA 5SGAE 1O3DA 1GMDF 2LNCA 5EQQA 1C4Y2 1V2MT 4I8KA 3ATIA 4YLUA 2SGQE 3M35A 4H4FA 1NU7B 3MH7A 1AVWA 1GI7B 2FOGA 1HAZB 5ESBA 3ZZ9A 1Q2WA 2GCTC 2BLVA 1TALA 1PPHE 2VU8E 1BITA 3EA8A 3P8FA 5A09A 3E0PB 5BRRE 3BF6H 4XSKU 2UUYA 1YPLH 2Q6GA 3SHAH 2QIQA 3BIUH 5AHGH 2JETB 3IWMA 3RXKA 1L4DA 2AGIX 4K1SA 4AGKA 1C2LA 4JZDH 1OP2A 1K1JA 4BAHB 4RN6A 2ZQ2A 3VB4A 3N7DA 2BVSH 3P17H 1UCYK 1TNHA 1GL1A 5IK2D 2BDCA 1CHOG 2BD5A 1GG6C 1Z8IB 3E16B 1GBBA 1W7GH 2FXRA 1P9SA 1MTNC 1EATA 4OGYA 2KAIA 4NWKA 4XFQA 2TRMA 3MNCA 3GYMA 4X2YA 1O2TA 2Q1JA 3MU0A 1HCGA 3RMMH 1UO6A 2ZU1A 1FX0B 1GVZA 5A8XA 2H1UA 1HBTH 3Q77A 1EX3A 3O8CA 5LPFA 1H9IE 1QZ8A 4X2XA 1DLEA 4X1SU 1MZAA 4BTUB 3MMGA 4P02A 3UIRA 1N6YA 2EC9H 4KTUA 4FVBA 1SFQB 3A82A 1C5VA 1EJAA 3CS7A 3CNRA 3GS9A 1MD7A 1FUJA 5CE1A 2J5UA 1GDNA 2P8OB 5CHAB 1GI1A 1GJDB 2P93A 1UTNA 2ZI2H 3F0OA 3PTBA 1E1RD 2C4FH 5LPRA 1TRMA 1ZTKA 3VXEH 4AB8A 1FJSA 1DLKB 1H9HE 1P02A 3SNCA 3OX7U 3KNXA 4I8LA 3F9GA 1XXDA 1Z8RA 3OFND 2ZFTA 1ZJDA 2PKSB 3T25A 3UREA 4BOHA 2FOFA 2ODYB 5AFYH 6CHAC 1NFXA 3HGNA 1ZR0A 5FHTA 1SOZA 3E3TA 1BTYA 1F0SA 3ZZDA 2HWLB 1EPTA 1GCDA 1QB6A 4WVPE 3RXGA 4YESB 1EP5A 1O5GH 1C2GA 3V3MA 1S6LA 1Y59T 2D26C 1C1VH 1V2QT 3BTFE 2GT7A 3TPIZ 1UCYE 3GY2A 5I46H 2KR7A 1A3EH 1N8OB 1Z7KA 2DE9A 1PPCE 4U30A 5AF9H 1TE0A 1GI4A 2BY9X 5C1XA 2ASUB 1C2JA 2ZHEH 1H8IH 2W3IA 4TYDA 1BTPA 1NPMA 5EG4A 3WWFA 2J95A 2QY0B 1KXEA 4O03A 3UQVA 3MQKC 3SQHE 3SU3A 5JBAS 1DUAA 4X8VH 4ZCNA 1TX7A 1TBZH 2PTCE 3M3TA 2BD8A 3VB3A 3R0FA 2EEKA 3GDUA 1AZ8A 1THRH 3RM2H 1CT2E 2Y6TA 1G9IE 2QV1A 4TWWA 1C1UH 1MCTA 2A45B 2ZF0H 3F1SB 1T31A 2BLWA 4UE7H 3M5LA 5FX5A 1GMCF 5C0UA 3ZZ6A 2LP6A 1O39A 2LPRA 4ZAEA 1KTSB 2AHME 2OTVA 1O3PB 1ESBA 1OOKB 2HRVA 4Y79A 5E0JA 4RSPA 1TRYA 1DDJA 1LO6A 4OM9A 3LIWA 2ZU3A 2C3SA 2QF4A 5FL7D 2FX6A 1HXEH 4Q2KA 3ZZ3A 1P03A 3FZZA 4XRNA 3RXAA 1AKSA 2HLCA 2Z9KA 4ZHAA 1DOJA 1E1QD 3MU8A 5F53A 2VH0A 1NBME 1CHOF 8LPRA 2QXJA 1XUIA 2ZHFH 3FFGA 3U1JB 1O31A 1K1LA 2FOMB 4XDEA 3GCTG 3TGIE 5EXNA 2GCHG 2PWXA 4H42U 3MOCA 4BNRA 3U28C 2WPKS 1GHYH 1PQ7A 1D6RA 1E0FD 1GBMA 1ETSH 1WUNH 3A85A 2VWOA 4CREA 1OWJA 4DT7B 3VB7A 1HIAA 3BTTE 1LCYA 1A1RA 1GGDC 1A5GH 1TOCB 1A3BH 3ZZ5A 2FIRH 1MTWA 2WPDD 4NGAH 3I78A 4B76A 1D3DB 1HAVA 1SFIA 5DPAA 1UHBB 1MU6B 1O36A 2I6QA 2VB0A 3RXLA 1C5QA 2R2WU 5JBBS 2A31A 1H4WA 3UWJH 3SNAA 5EJZA 1C5PA 2BB4A 4BXWA 3FZDA 2PV9B 1YP9A 3PV4A 4AFSA 1A46H 1K22H 3ZIAD 1MAYA 3EE7A 4K5ZA 1OPHB 1C1WH 3F68H 3SO3A 3AW0A 1P04A 3GOVB 5GNDA 3TGKE 1A5IA 4JZFH 2ZECA 3GCHB 1MQ5A 1C2IA 3U9AH 1V2ST 1CGJE 1HB0B 2ALPA 4KTSA 4BAMB 2XCFA 1TONA 2R0LA 4O3UA 1RTFB 3PROA 4ASHA 4X8UH 1BMNH 5EW2H 1DXPA 4XD7D 1RIWB 2ZDAH 1GVKB 2BD9A 3DSPA 2CN0H 1MCVA 3LGVA 1BMLA 4K69A 1SVPA 3U1IB 1FQ3A 2A2QH 1C1SA 2OCVB 1S0QA 1TYNA 2W26A 5I25A 1C2DA 4GHQA 4AB9A 2OLGA 2GJGA 4Y8ZA 4X8TH 1GJ7B 3LOXA 2WYGA 4LOYH 3UOPA 4B74A 1WQVH 1FIWA 1YLDA 4NIWA 1KLJH 3OY6U 2BTCE 2Z3EA 3RXEA 1G32B 1DANH 2W3KA 3ELAH 4NIYA 1TGCA 3TU7H 3NPSA 4D9QA 2ZHWH 4FETA 1K1OA 1YCPK 3GICB 3UQOA 1CVWH 2F9OA 2QF3A 1THPB 2R0KA 3UOUA 4OS1A 5DP8A 2J98A 1OWDA 4MDSA
chains in the Genus database with same CATH topology
1L1GA 2V0BA 2D8WA 1Y5UT 4TWYA 2ANMH 2ZFFH 3ZZ7A 1EOLA 4FUGA 4IGDA 3RC6A 2AERH 4SGBE 4CRCA 1Y8TA 1TNLA 2B7DH 3EGKH 1PPFE 2QN5T 3PYHA 4K8YA 3QGNB 3GISB 1ARBA 1P05A 2P3UB 1CGIE 1TNIA 1Y5BT 1TMBH 2XTTB 2ZU5A 1IQKA 1SC8U 1S6HA 3GY3A 1MZDA 4DG4A 1FY5A 3K2UA 2CF8H 5C1YA 2ULLA 4AX9H 3GCTF 4CH8B 6LPRA 3SUDA 1C1RA 2IN2A 1T8NA 2GCHF 2ZEBA 4ISNA 2GX4A 1UVOA 1V2NT 3O8BA 2WV4A 4LXBH 1TB6H 2C8YB 1VJ9U 3E90B 2C8ZB 3PMAB 4A7IB 5GPIB 2PKAB 3HK3B 5CHAC 1MAXA 2P8OC 4JYTA 1VITG 1LDTT 5IYTA 2EI8A 1LHDH 2VWLA 2A32A 1EQ9A 5LPEA 1LVMA 1IHSH 6CHAB 4PROA 5BPEA 4NSYA 5FPYA 2Z94A 3A8BA 1O2MA 3QZRA 4RKOB 3QO6A 2PKSC 5EGMA 4ABEA 2FS9A 1Z1JA 2WYJA 4JZIA 2OBQA 3CENA 1SHHB 3URCA 1XKAC 4AYYB 2OXSA 1UJ1A 1GBAA 1ZOMA 1F0UA 3H7OA 4JMYA 3QWCH 3SGQE 3QX5H 1LTOA 2PSYA 1ESAA 3KEEA 4BXSA 1JRSA 4K8BA 1N8OC 4ABBA 3B23B 1BT7A 1OWEA 4F4OC 3RXPA 2BVRH 1K1IA 1O2GH 1GMDG 4IBLH 3PO1C 1UK4A 1O2YA 3SNDA 5B6OA 2FI4E 5FPSA 2XBWA 2THFB 2TGTA 1LKAA 2WPMS 2PGQB 4KKDA 4IMZA 1SGFA 1MKWH 4HGCA 1T4VH 1C5RA 1B0EA 1HJ9A 1THSH 5C5OA 1HAOH 3SV8A 2ILNA 1GHWH 3Q3XA 2ZA5A 2P95A 1SLXB 2SNWA 8KME2 1PPEE 1LHFH 1PYTD 1C2MA 2BM2A 2UUFB 2GDDA 3CP7A 1D3TB 1JMOH 1SG8B 4WMFA 5JBTA 1GJ5H 4ABJA 2TGAA 3T26A 4X6OA 1TWXB 2IJOB 4E7RG 3RP2A 2BXUH 1F5LA 1SBWA 2BY5X 3BTHE 1IHTH 1NRQH 4LK4A 2OP9A 1O2OA 3UTUH 1AWFH 1GBEA 4X0WU 2SGDE 3MO9A 2RA3A 2PFEA 6ESTA 2C93B 3BTME 2YNAA 1O2IA 4BAKB 4A1TA 1W2KH 3HATH 2Z9LA 1GJ6A 2PSXA 2FO9A 1NU9A 3SZNA 3FANA 2ZFRH 4YOJA 1AVGH 5DO4H 1GBTA 3PLBA 3TNSA 2FOAA 5J4QA 3UWIA 1O3AA 1QFKH 2QC2A 2NU1E 2M5TA 4X2WA 2J4IA 1P10A 1F2SE 4A1XA 3K65B 1VZQH 1J16A 2P59A 3MH6A 3ZVCA 1BTXA 3GCOA 1AFQB 1SGYE 1O38A 2J2UA 4NG9H 4WJG2 2AYWA 1NM6A 4BAOB 3S7KB 1QB1A 4MLFB 3F9EA 4MTBA 1YPGH 1FZZA 4H6TA 1Z8JB 2FOEA 1TMUH 3VFEA 1QURH 1P2QA 1LHCH 2Y5GA 4DIHH 2VJ1A 5L2YH 2NU0E 1GJ9B 2ZPSA 2ZPRA 4YT7H 2Z9JA 2J94A 5EODA 1BB0B 1V2OT 3SW2B 1O3JA 2G4TA 3KHVA 4IC6A 4MNWA 2AS9A 5E2PA 1K28D 1G3DA 1TPSA 4DVAU 1V2KT 3LGUA 4X8SH 1JBUH 1ZZZA 1F7ZA 1O2SA 4ABAA 2QA9E 1S6FA 2BMGB 4TY6A 3OYPA 4HTCH 4KP0A 2V3OH 3IITA 5EXLA 2ZHQH 3ATLA 5GIBA 5TJXA 1ZRKA 2R3UA 4Y7AA 4A6LA 1T32A 5J4SA 4BTTB 4NWLA 1EASA 3E91A 3GCHC 1W13U 2ZPQA 3MWIU 1TGBA 1TGNA 1TIOA 1MKXH 2G52A 3SOSA 3S7HB 5F03A 2W7SA 1GMHF 2V35A 5HM9A 5EQSA 2ODQA 1GBCA 1GI3A 1RIWC 3M7TA 2EI7A 3LONA 3TIUA 1P57B 3DT0H 1KLTA 2P16A 2W5EA 2FZZA 2WUCA 1EKBB 1PPZA 4HI3A 1GMCG 1O3NA 4JK6A 3PMBB 5C67A 1YPHC 3SJIA 4WY3A 4FU7A 5DP6A 2VH6A 3EYDA 3SJKA 2Y5FA 1PPGE 1EZXC 3VB6A 1K1MA 1O2LA 2VIOA 4IN1A 1C5ZB 1QL7A 3SU1A 1QY6A 5C3NA 2ZCLP 3TK9A 1SGEE 2ZNKH 3E0NB 3JZ2B 4IN2A 3M37A 4NA7A 4WXVA 5T3HA 4FU8A 1LVBA 2ZG0H 1PFXC 1DM4B 4FUBA 4X6PA 1LPKB 2ZHDA 1Z71A 3SNEA 4AORA 1T7CA 4CHAC 2BVXH 1Q3XA 1NESE 3RM0H 3HKIB 3SV2H 5A0BA 1OWKA 5HXFA 3K9XB 1ABIH 2OC0A 4MVNA 1BOQA 1HAGE 3TITA 3CS0A 2QCYA 1P09A 2Q6FA 5T6GA 1GBKA 2ZWLH 2ZKSA 1FY8E 3SNBA 1M9UA 3T5FH 3S9BA 3ZVEA 1CT0E 1RJXB 3SUEA 4K2YA 1MBQA 3LKWA 4JYVH 2G4UA 3M61U 5JB9S 1SQOA 1V2LT 5GJ4B 1NRSH 1HYLA 3ITIA 1FN8A 1S81A 2TBSA 1GBFA 2Q6DA 5A2MH 2QGRA 2XWBI 1PPBH 2FESH 4B2CA 1IQLA 1U6QA 1WBGB 2BOKA 3I29A 3GY5A 1UVUH 3KF2A 1VGCC 1SSXA 4UEHH 1O5BB 5DP5A 1VCWA 4DJZB 3V7TA 4MNYA 3RXBA 4D7FA 1C2FA 2XW9A 2SFAA 4I33A 1SGDE 1ELVA 2IPHA 1ANBA 6GCHF 2FLRH 1O2KA 2B9LA 2FYRA 4XE4A 1HGTH 1P3EA 4AGJA 2XC0A 3ZVAA 1XUFA 4Q80A 1AE5A 1ABJH 4DW2U 1FIZA 1G2MA 1BRAA 4FXGH 3KQEA 1XUKA 3F9HA 5JYIA 4AOQA 3SORA 2GMTB 5DP4A 1E37B 3EA9A 1DE7H 1KDQB 4M7GA 1TFXA 1DS2E 2STAE 3LGIA 3PO1B 2OQ5A 1EB2A 1CGHA 3P8GA 2NWNA 1V6DA 2P94A 1EB1H 1JWTA 4E06H 3RXDA 2Z7FE 3LGYA 1V2PT 1HAHH 2HGTH 2Y82A 1TNKA 5DG6A 3PWCA 3BTQE 2Y7ZA 1V2JT 3LGTA 1Q31A 1C4V2 1SGTA 3U8TH 1AVXA 1YYY1 1XMNB 3A7XA 3C1KA 1YKTA 1YBWA 4GLYA 1QL9A 1UTPA 3MO6A 4DCDA 3ZVFA 3BTWE 3GDVA 1YCPM 1DPOA 2NU4E 1EZQA 1P9UA 4YM9A 1Z1IA 3DUXH 1AD8H 1MD8A 1NRNH 2HALA 1FY3A 5JDUB 4GSOA 1OSSA 1P12E 1EP6A 4Y0ZE 1O3MA 1YF4A 3A7ZA 1F0RA 4X6NA 3SV9A 1TLDA 4D8NA 2C8XB 5DP9A 1UVTH 3BEIB 4ZKNU 2D1JA 1BRCE 5IDKA 1GDUA 1LQEA 5T6FA 4AG1A 3H5CB 2P3FH 4I32A 2GKVE 1EAUA 1OWIA 3PWBA 3UNSA 2A5KA 2IOTA 4LZ4B 1QIXB 2J34A 1P3CA 3A89A 3L33A 4Y71A 4ZKRU 1O5AB 1FV9A 4ABFA 1EAWA 1FI8A 1O5CB 3ZVDA 5L2ZH 1GHZA 1NRRH 1G36A 4Y7BA 1FDPA 2GD4B 2FYQA 2XWAA 1L2EA 4NFEA 3FP6E 2CHAB 4FUFA 1GBIA 3BV9B 1OXGA 4B75A 3UUZA 1UTLM 2FODA 1GPZA 3BTGE 1QJ1B 2J92A 3PMHB 1HAXB 1QL8A 1AFQC 3FVFB 2KAIB 2OC1A 2VGCC 4RKJB 1TGSZ 3MNBA 3MH5A 4ZROA 2J9NA 2XXLA 3HK6B 1ETTH 1NT1A 1MMJN 2G5VA 2G8TA 4U32A 4A92A 1S82A 2FMJA 1XVOA 2BDIA 3NKKA 3LPRA 1SLVB 1EJNA 1DFPA 1MTVA 1P11E 2A7HA 2ZDKA 1TGTA 1P2KA 1C1QA 1V2TT 3GCNA 1J17T 3P8OA 5C5NA 1ZHMA 1ARCA 4AG2A 1LHGH 1C4U2 1BBRK 1EAIA 5EOKA 5L30H 1IAUA 1ANEA 2TPIZ 1C5SA 3O8DA 4XBCA 4GVUA 3M5NA 2BQ7B 1A4WH 1CBWB 2Z9GA 3PLPA 2YOLA 1EPTB 2ZDMA 1V2WT 2W7UA 3SHCH 1XVMA 1AZZA 1ZPZA 2UWPA 3ZVBA 2XCNA 1LPGB 1O2ZA 4J2YB 4YZUA 2A5IA 1VCQA 4DGJA 1HAPH 1A7SA 2Y81A 1NY22 1FAXA 3A7YA 2G81E 3LC5A 1EUFA 3GY6A 4WH6A 3D49H 1TQ7B 9LPRA 4UFDH 1KY9A 1O2WA 2GZ8A 1ETRH 1LQDB 3HKJB 4AFUA 3ZZ8A 1FMGA 1SL3A 2PLXA 5GCHF 1GHVH 4OGXA 2SNVA 4Y8XA 5AFZH 4MNXA 1DICA 1YLCA 2ZTYA 3SU6A 1G3CA 1UCYH 3ZVGA 4CHAB 1A2CH 5TCAA 1AU8A 1IQEA 2UUJB 2ALVA 2PTNA 5FPTA 2B5TB 3SU2A 3U8OH 2HOBA 3Q3KA 1FNIA 3A7WA 2OQUA 1ZTJA 2BD4A 1DT2A 1KXAA 1W8BH 3MU1A 3BTDE 1BBRE 2A4RA 3RU4D 1TMTH 1QRWA 1Z6JH 4KELA 3LH3A 3T2NA 3QZQA 1O32A 2ZC9H 1SQTA 2OUAA 4FVDA 2QXGA 1BQYA 1YPMH 4X2VA 3SI3H 5T6DA 2PGBB 2A4QA 1LMWB 4Y0YE 1MTSA 3TNTA 1AKSB 3STJA 2EI6A 4B2AA 2ZCHP 2ZGBH 1C5OH 1O5DH 4F49A 1VGCB 5EPNA 2F9UA 3RC5A 5FX6A 2R9PA 3A87A 4VGCB 1QQ4A 1S85A 1ZMLA 2A1DB 1NZQH 2QXHA 3T27A 1H1BA 2QAAA 3LJJA 2HNTC 2ZFPH 1F0TA 4FUCA 3EAJA 1BTWA 1GJCB 4UD9H 3QTVH 4JYUH 1D3QB 2K1QA 1KLIH 2F9PA 2QF0A 3TH4H 1HIAB 1EJMA 1O2VA 1KXBA 2ZTZA 1GHAF 3RU4E 2BHGA 1YPJH 2SGEE 3MHWU 4HFPB 3FAOA 1CQQA 5FXLA 2ZU2A 2YNBA 2AFQB 4U01A 1GDQA 3PMJA 2FI5E 2B8OH 4BTIB 3D65E 2ZZUH 3ATKA 1HAVB 1UMAH 1KXFA 3NCLA 1ZSJA 1O2QA 5HGGA 3RXCA 1GMHG 1XUJA 2O8LA 3RXRA 1O35A 4ABGA 1W11U 2GMTC 3QUMP 4LZ1H 3KQDA 2CMYA 4DIIH 3SV7A 2B0FA 2C8WB 3HPTB 3KQCA 1GBJA 3V12A 2H9EH 1Y3YA 4DOQA 1O3LA 5E0GA 1ELFA 3A86A 3D62A 1H9LB 8GCHF 1EOJA 3M5OA 2ZO3H 4ABIA 4CR9A 4DY7B 1TOMH 3NK8A 1C9TA 2FTLE 1QTFA 1C2EA 3ODDA 5FCRA 1W14U 1F92A 4GUXA 1XXFA 1TA6A 3N7OA 1ORFA 1GJBB 2JH6D 3RXTA 3GYLB 3PTNA 1A5HA 1FXYA 1FPHH 1O3EA 1AUTC 2BDGA 3A84A 2Z6BD 2VVCA 2D2DA 2UWLA 1ZRBA 1TX6A 3LH1A 3QGJA 2P3TB 3BTEE 4IMQA 1IQGA 4UFEH 4Y76A 1QCPA 2BDHA 4JZEH 5EU8A 5EXMA 4O3TA 1C5XB 1JIRA 1K1PA 1IQFA 2A7CA 1DUEA 1ELTA 1GBHA 3LGWA 4NA9H 2XC4A 4GCHF 3VGCB 1ZLRA 3M3SA 1C1TA 3PLKA 1O33A 5PTPA 1AWHB 4TPIZ 3E8LA 3RU4T 1AN1E 2GV7A 1WYKA 1O5EH 5CMXH 1BTZA 3KCGH 4NZQA 3RXQA 2H2ZA 5FAHA 4CRAA 4MNVA 2UWOA 2CHAC 3W95A 1IQJA 3SGBE 1AE8H 1IOEA 4I8JA 1O3GA 3RUOA 1UTMA 2VGCB 4JK5A 4Y11E 1EZSC 3SBKA 1CO7E 5HM2A 2F9VA 1DSUA 2ZFSA 3SUFA 1V3XA 4XOJA 1GI8B 2BDAA 3ODFA 5JB8S 2BX3A 1TQ0B 6GCHG 1BMMH 1J9CH 1JRTA 1FLEE 4I7YH 2FM2A 1ZMJA 1SOTA 1ACBE 2WPJS 2FWWA 1C5YB 1V2VT 1ZHPA 3BG4C 2RDLA 3ATWA 3W94A 1ZSKA 4IS5A 9ESTA 4WMDA 2BOHB 1ZSLA 2G00A 3HGPA 4CH2B 2HNTF 1ELCA 2AH4X 3ZZAA 2ANWA 2OINA 2J38A 1HJAB 3P92A 3QK1A 4O9VA 1CA8B 2ESTE 2NU2E 3BEUA 1PJPA 1GL0E 1C1NA 1SGPE 1L1NA 3JZ1B 4TY7A 1RXPA 4Y8YA 3RXJA 1T8LA 1DWCH 4UDWH 2Y5HA 2ZGXH 1MQ6A 1CBWC 1JOUB 1PQAA 2G5NA 4X6MA 1EPTC 1K9OE 4IC5A 3MO3A 1IQIA 1P2MA 1Y3WA 1VITH 1IQMA 2V3HH 1BJVA 1UK2A 3RMNH 1YPEH 3SQEE 2G55A 1DX5M 4OS2A 1QJ7B 3D23A 1HAYB 3E6PH 3K6YA 5C20A 1HRTH 1ZPBA 2FTMA 2O8UA 1QB9A 1YPHE 3MYWA 1JIMA 1G2LA 1EZUC 4Y10E 1Y5AT 3F9FA 2ZTXA 3V0XA 1D4PB 1DWDH 1ID5H 1PQ5A 3SJ9A 3QN7A 1QA0A 1MH0A 3VXFH 5JPMH 1YCPH 1SHYA 7LPRA 3SN8A 4ESTE 5A8ZA 3RLWH 1L1JA 3GY4A 1IQHA 3LDXH 1ZTLA 3K6ZA 2CV3A 1XKBC 1W12U 2FDAA 1F5KU 5DJ7A 1GI0A 3GDSA 3F6UH 3TJUA 1FPCH 3U69H 1HUTH 1C1MA 2H6MA 1KIGH 2CGAA 2BLQA 3BIVH 4XBDA 2AGEX 3RLYH 1CT4E 2RG3A 5A0CA 2ZGJA 3O8RA 3GY7A 2OD3B 1NRPH 3M5MA 4WH8A 1TA2A 2AEIH 1P0SH 1UTOA