2WUBA

Crystal structure of hgfa in complex with the allosteric non- inhibitory antibody fab40.deltatrp
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
239
structure length
231
Chain Sequence
IIGGSSSLPGSHPWLAAIYIGDSFCAGSLVHTCWVVSAAHCFSHSPPRDSVSVVLGQHFFNRTTDVTQTFGIEKYIPYTLYSVFNPSDHDLVLIRLKKKGDRCATRSQFVQPICLPEPGSTFPAGHKCQIAGWGHLDENVSGYSSSLREALVPLVADHKCSSPEVYGADISPNMLCAGYFDCACQGDSGGPLACEKNGVAYLYGIISWGCGKPGVYTRVANYVDWINDRIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unraveling the Allosteric Mechanism of Serine Protease Inhibition by an Antibody
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/immune system
molecule keywords HEPATOCYTE GROWTH FACTOR ACTIVATOR LONG CHAIN
total genus 45
structure length 231
sequence length 239
chains with identical sequence C
ec nomenclature ec 3.4.21.-:
pdb deposition date 2009-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2wubA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2wubA01
1D3PB 1GBHA 4A1XA 2ZKSA 5A0BA 4HZHA 6GCHF 1B0EA 1BB0B 2JH6D 3STJA 1SQAA 3U98H 1GDUA 5FCKA 1V2JT 3TJUA 2EI6A 3CS0A 2R2MB 1P05A 4MQAA 2GP9B 3S0NA 1N8OB 3BIVH 3K6YA 3SNEA 1A0LA 2BM2A 2BDBA 1BA8B 1HDTH 1UK3A 3VXEH 3M37A 2DE8A 3BF6H 2VU8E 1EAXA 1GI9B 2Z9GA 2PKAA 1GCTB 2VWNA 1C4V2 1RTFB 1BBRE 3URCA 2R0LA 2W3IA 3M5OA 2ZG0H 3FZZA 1P2QA 3ZV8A 3IWMA 1QJ1B 3ZZ8A 1IQFA 1P03A 3RMMH 1VJAU 2R3YA 5FCRA 4R0IA 1V2VT 3SJ9A 2GMTB 3SUEA 2PFEA 3PTBA 1BDAA 3TK6A 1V2KT 2DE9A 2FOFA 1HAOH 1SSXA 4ZAEA 4BXSA 1Y5UT 2ODPA 1UJ1A 1GI7B 2BQWB 1O2JA 2ZFRH 4ESTE 3A83A 4ZUHA 1C1UH 3A80A 1AVWA 2ZDLA 1S5SA 1O2YA 2V3HH 2ZHFH 3M36A 2R2WU 4B2BA 1QNJA 1NU9A 4X6MA 1YPHE 1RFNA 1O3MA 1EZQA 1B5GH 3TNSA 3SOSA 1C5XB 3M7TA 1UTMA 2BTCE 1V2LT 4XOJA 3SUDA 1DLEA 1GCTC 1RD3B 1ZPCA 3GY8A 3B8JA 2WPMS 1GVLA 1O3NA 4UEHH 4DJZB 5FPSA 1UHBB 2C8ZB 3U8TH 1ZMNA 5DP4A 4HI3A 3RXJA 2QAAA 1C2MA 2WPHS 3KCGH 2UUFB 3VB3A 1GI5A 3L3TA 1JWTA 1O5FH 2QC2A 4ZKOU 4DT7B 1C4U2 2D26C 3PO1C 3RXPA 1INCA 3F68H 2H5CA 5GWZA 1W10U 2VGCB 1ZTKA 2ZDMA 4PROA 4KTCA 4X2WA 3RXRA 3T27A 1GHYH 2ODQA 1ZGVA 1GJ5H 1SLUB 1Z71A 2BY9X 5EU8A 3RXAA 4D9QA 4I7YH 1C2GA 5TCAA 1TMUH 1EPTA 3FZDA 1ELTA 4ISLA 5L6NH 1ZJKA 1D9IA 1OP8A 1T32A 2HWLB 1KDQB 1L4DA 1RIWC 2VH6A 1OPHB 2VWOA 3MOCA 2FLRH 2RCEA 2VINA 2O8MA 2ZPQA 2FLBH 1WV7H 4Y79A 1GL0E 1O5CB 1XM1A 4BAOB 2F83A 4B74A 3AAUA 1WU1A 2EI7A 1JIMA 3UNRA 1EP5A 1E37B 2VWMA 2XBVA 1CGIE 1BHXF 1ZHPA 2ZEBA 5EQSA 4D76A 1UTLM 3C27B 4XFQA 1O2TA 2ZC9H 5JPMH 1TX7A 8GCHF 3TJNA 1G3CA 2XC0A 2ZU5A 7ESTE 2A5KA 1TIOA 1C1PA 2FOAA 4DW2U 1RTLA 2BD2A 5DP6A 4IMZA 3SORA 1NM6A 3ZYDA 1WYKA 3LDXH 4A1VA 5DGJA 1MTSA 4X1NU 1UTPA 1BIOA 2WPJS 1HAPH 1XUGA 4IBLH 2BZAA 4ISNA 3ESTA 3RXOA 3ZVGA 1A3EH 1NROH 1S85A 5HM2A 1C5SA 2BY6X 1XKAC 3MH4A 1RJXB 1ZPBA 1CA0C 1D6WA 3K9XB 1CGHA 1GBMA 2ZPRA 2SNVA 2ZQ2A 2ILNA 3P8NA 1GHAF 5ESTE 1TPPA 2BVXH 3ELAH 4CHAC 3BTQE 3UPEA 3LC3A 5HGGA 2ZHQH 1EKBB 4KP0A 1MTVA 2UWOA 1ZGIA 2AGIX 3HK3B 1XXDA 1YPLH 1GBAA 3SU4A 1L1JA 3ODDA 2R9PA 3GICB 1HAYB 3BG8A 1DY8A 2FMJA 1VCWA 3A84A 3EDXB 1KLJH 6CHAB 3UTUH 2GV6A 1CT4E 1S83A 1SG8B 2VIWA 1LPZB 2ZFPH 2G5NA 1EZSC 1T8MA 5ESBA 3RXTA 2PGBB 4IN1A 5F6MA 1NPMA 4FUJA 1B0FA 4TYDA 2G55A 2HVXA 4NA8A 3TVJB 3TK9A 2A31A 3MU0A 3SGBE 1AFQB 3RXMA 3TLOA 2H1UA 1FIZA 3BG4C 3EYDA 2ZO3H 3F1SB 1O3JA 4ZKNU 3SW2B 1ZSKA 2ZECA 2C90B 1ZRBA 1O2UA 4X2XA 2J38A 3QDZB 3UIRA 1TNIA 2OXSA 3M7QA 2Z94A 1DUAA 1EUFA 1Z6EA 2VVCA 4YOIA 3P8FA 5BRRE 3JZ2B 5FX6A 3T26A 4JMYA 4GCHF 1UMAH 4A92A 3SV7A 2FI3E 1OKXA 2PTCE 5IYTA 3F9FA 3S7KB 1G2MA 1TB6H 2UUYA 3M5NA 4ISOA 4GAWA 1CVWH 1YCPK 2J34A 2TBSA 3E3TA 5SGAE 1YLCA 3MNXA 4MNVA 1BTWA 1KXDA 5EW2H 1LKAA 2XWAA 1Z8JB 1ELAA 1QBVH 4NGAH 1BTUA 3SHCH 3T29A 2VGCC 3ZVCA 4DY7B 5LPFA 1UVPA 1ZMLA 1JBUH 2VIPA 1SOTA 1QJ7B 1AUJA 2SGFE 3ZZ5A 4E06H 5CE1A 1VITH 5LPEA 1WBGB 2G52A 2PHBA 3A89A 3EQ0H 1G2LA 3SGQE 2QN5T 3RMOH 1MMJN 1NZQH 5JBBS 2ZDKA 3S9AA 1QJ6B 1BTHH 4TPIZ 3UNSA 1A0JA 1OP2A 1AWHB 3EA8A 1J8AA 2G5VA 3RDZA 4DGJA 4MPXA 4RN6A 2F91A 2IN2A 3RXEA 4I33A 2FODA 4CRGA 3UREA 4AYVB 2Z6BD 2GD4B 3GYLB 4Y76A 4UONA 1RTKA 1NT1A 4K1SA 3SNCA 4FUGA 1DICA 3RXUA 5ETXA 1OWIA 3TITA 1JMOH 1OWDA 3V12A 1GDQA 2Y82A 1X7AC 4WH6A 1AFQC 2UWPA 3MH7A 2A0QB 3SBKA 3RXBA 1H4WA 1WTHD 2CHAC 2ANKH 4AN7A 1TQ0B 2BLQA 1H1BA 1KLIH 2P94A 3PTNA 1G37A 1TNKA 2J94A 1H8IH 1E35B 1WQSA 1CHOG 2SGPE 4JZEH 3SJOA 5EPYA 2A5IA 3E6PH 3M7UA 3VB7A 1BRAA 1A61H 1OSSA 3MU8A 1QA7A 1N8OC 1G3DA 2TGDA 1FUJA 3A85A 3MNBA 5AF9H 4WMFA 2OC7A 1EP6A 3QLPH 1DUEA 2V0BA 4AORA 1BMMH 2TPIZ 1EAIA 2ZGCA 1LHDH 4Y10E 2AGEX 4JK6A 1HAIH 1LTOA 1ELBA 1SGFG 2ZI2H 3A8CA 2BDIA 3ZZ6A 2XRCA 4BTIB 1C1WH 4BTUB 2FX6A 1AD8H 1LVYA 1VITG 1GI0A 2HALA 1V2TT 4KGAA 2QXIA 4YTAA 1BT7A 1E34B 1A5GH 2ZDAH 4CRCA 3F9GA 5JBCS 4H4FA 3RXLA 2PLXA 3LGUA 1P2JA 3MU5A 1AQ7A 1ZJDA 1O2KA 3BTWE 1MTUA 2AMPA 3KHVA 3PLBA 3RC5A 2BOKA 4A7IB 2FX4A 1P06A 4KTSA 1TBQH 5E8EH 1A2CH 1EJNA 1EZXC 1ZHRA 4IMQA 4ABAA 1Z8GA 1SBWA 3LONA 3I77A 3NZIA 3IG6B 1NFWA 2FOEA 1HAVB 1BOQA 3A8DA 1S82A 3NCLA 5DKMA 4OS7A 1O3DA 2WYGA 2H6MA 3FP6E 1G3BA 3ZZAA 2WV4A 2FI5E 3MWIU 1OOKB 2OUAA 3QK1A 2BQ7B 1TX6A 3GCNA 1SGPE 4AGJA 5A2MH 3U8OH 2F9NA 1Y5BT 4K3JA 2D1JA 5GIBA 3RXIA 2Z9IA 3R3GB 4NIVA 5CHAB 1HBTH 2Z3CA 1H9HE 4NIYA 4YOGA 5HYOA 2ZHDA 1A0HB 4O03A 1GJ8B 1TFXA 3BTFE 1O37A 3MNSA 7GCHG 1CA0B 1QFKH 3E0PB 1RGQA 1TNLA 1WUNH 2A1DB 2FOBA 1DXPA 1FONA 4JK5A 1P8VC 1LQEA 1ANDA 1RXPA 4XBCA 1GMHG 1C2JA 4KTUA 5A8ZA 1EQ9A 4Y0YE 3ZZBA 2BHGA 1P02A 1QL9A 3DT0H 5T6GA 3VGCC 1FAXA 4ABDA 2HOBA 3QWCH 3SU0A 4B1TA 1AVGH 1FQ3A 1ANCA 3NUMA 2Q6DA 1GHXH 4H42U 1GGDB 1MUEB 3QUMP 1W3CA 2W7SA 4CBNA 3SUGA 1Q31A 1YP9A 3GY4A 5DP7A 1SGFA 5E0JA 5L2ZH 1XVOA 3P8GA 4Y6DA 3RLWH 4HFPB 1FN8A 2SNWA 2GCHG 4OS1A 1BITA 1L0ZA 2BQ6B 1MZDA 1MQ5A 1P9SA 1H8DH 2CF9H 1SQOA 3M35A 1VCPA 8ESTE 1YPKH 1UK2A 2FESH 4IC5A 1O35A 1PQ8A 3GY3A 3V0XA 3MYWA 1P0SH 1SR5C 2FYQA 1XX9A 5JDUB 2ODYB 1P10A 1HAVA 1AE8H 2YOLA 4ISHH 1TGTA 3SUFA 2OP9A 3OX7U 1GJCB 5C3NA 1IHSH 1K9OE 1BUIA 2GX4A 1CE5A 4F49A 1BTYA 1Y3YA 1O3KA 1ZMJA 3IITA 4ZHLU 1K21H 2CF8H 1QL7A 1C9PA 1FNIA 5TJXA 3FVFB 1T8LA 4U2WA 4BANB 2C8WB 1VJ9U 2VNTA 2CHAB 1UCYH 3LH3A 1C2HA 1CSOE 1TPSA 1V3XA 3SNDA 1O39A 1K2I1 4WMEA 3SV9A 3LJJA 1LVOA 4ABBA 3S7HB 3PB1E 1SGRE 3GY5A 5HMAA 1UO6A 1UTKA 2YNAA 2QF3A 1NTPA 1SGCA 2XCNA 1TA2A 3EE0B 3BEIB 3P6ZB 4XDEA 4AB8A 2XYAA 1C5NH 1G30B 4DURA 2CGAA 4CR9A 2PGQB 3PMHB 3S69A 3DHKH 4JCNA 2ZCKP 2QV1A 4KELA 1GHZA 1AN1E 1TRNA 1P9UA 1V2PT 1C1NA 5FPTA 3PWCA 2FM2A 3Q3XA 2Z9LA 1RS0A 3VGCB 2CV3A 1CT0E 4FUCA 1QIXB 4ZXYH 3I78A 1LQDB 2XBXA 2PKAB 2PSYA 3LT3A 2OBQA 1WCZA 1GGDC 3N7OA 1C2IA 5FAHA 5F8XA 3NWUA 2FEQH 2XC4A 5GJ4B 1AMHA 2SGEE 3D49H 3SU1A 1CGJE 5ABWA 4B76A 3LJOA 5A0AE 4ASHA 4TWWA 3SNAA 4Y8ZA 3GYMA 4X8TH 1HAHH 1T7CA 1SLWB 1S81A 1UCYK 4BOHA 1KXBA 3TH4H 1CBWC 1FY8E 3KNXA 4ZH8A 1Z1JA 3FP7E 2XC5A 4MTBA 2O9QA 1HFDA 1GHVH 2QF0A 5F03A 3SU3A 3E1XB 1EX3A 5DP9A 1TAWA 4INKA 5HM9A 1KYNA 1C1OA 2XBWA 1TOMH 2ZZUH 1FY3A 3UQVA 4F4OC 3D23A 1G9IE 4CRBA 2D2DA 1BRUP 3BTGE 1KXFA 3KIDU 4H6SB 1SMFE 2NWNA 1AUTC 4CH8B 3D62A 3UQOA 2GCTC 1DSTA 2ANYA 1FZZA 4WXIA 3TJOA 4UFFH 1ABJH 2ZTXA 3U9AH 1GHWH 2WUCA 1NU7B 1HYLA 1F92A 5FXLA 2ZDNA 1K22H 4FUEA 2Q6FA 2F9BH 1CU1A 1Z8RA 2P3UB 1QBNA 3KQDA 3BEUA 2P93A 1P2NA 5C67A 3RXFA 1FLEE 2PTNA 4X8SH 1EB1H 1P57B 2BDAA 1C5OH 1A4WH 2KAIA 3A7ZA 3U1JB 4E05H 3MHWU 4FUDA 2HPQH 2ZGHA 3BIUH 4IS5A 1IQGA 4NA9H 1E36B 7LPRA 3KQBA 2V3OH 4FVBA 2I6QA 2RA0A 1DXWA 3NXPA 2PKSC 2ZHEH 1S0QA 2GKVE 1UVTH 2GCTB 1C2EA 1KTSB 2C8XB 1HGTH 3CS7A 1ANBA 1IQIA 1BJVA 1A1RA 5JB9S 5FPYA 3C1KA 3GY6A 1Y59T 2ZQ1A 2FP7B 2UUKB 3KF2A 6GCHG 4GVUA 3SU6A 3MNCA 1O31A 1THRH 4U01A 1C5WB 4HGCA 3E0NB 4JYVH 4RKOB 1ELGA 4DIHH 2WPKS 1P12E 1QRXA 4QT8C 2B0FA 1HLTH 1VCQA 1F0SA 1GBIA 4YZUA 9LPRA 1MD8A 1QHRB 2TGPZ 1XUHA 1A46H 1F0UA 1W2KH 2A32A 4I32A 1ZYOA 5EGMA 1KXAA 2B8OH 1MQ6A 1MTNC 3RXHA 4BXWA 1THPB 4ABJA 4GPGA 1Y3WA 4X6OA 1GWAA 2ZWLH 1XVMA 3EGKH 1LMWB 1O2GH 4NWLA 4Y8YA 2PV9B 3LU9B 1AHTH 2QY0B 1HB0B 1GBEA 1GBBA 3ATWA 2GDEH 1F7ZA 4AFSA 2OQUA 3AAVA 4LXBH 1OWJA 1J16A 1DWCH 4IN2A 1O2PA 4ZHMU 1Y3UA 2FXRA 2ZU2A 5PTPA 2A2XH 2ESTE 1MU6B 4MLFB 2BXUH 1ZTJA 1SGQE 1IQMA 1OYTH 1CO7E 2GV7A 1GMDF 2V35A 2ZFTA 2PR3A 3E8LA 3OY5U 1SPJA 2BX3A 1JRTA 5G4BA 1GI8B 2QCYA 2GMTC 4MDSA 3LKWA 1SGTA 4ABHA 1QURH 1N6YA 1GVZA 1SLXB 2BLVA 3MI4A 3ZZCA 2VIQA 1UVUH 3RC4A 5DP8A 4ZKRU 2ZPSA 3TPIZ 2NU4E 5GDSH 1D6RA 1HXEH 2VIDA 2SGQE 5JBTA 2WPIS 4I8LA 1BRBE 3SV8A 3STIA 1TABE 1TA6A 4AFUA 2OD3B 4AFQA 1PQ5A 4IW4E 4K69A 1G36A 4M7GA 3RXSA 2Q1JA 1FMGA 1IOEA 4NA7A 3TU7H 1OS8A 2VVUA 4YOJA 2C93B 1GJ4H 1QBOA 4Y0ZE 1HUTH 1AO5A 2ZDVH 1SFQB 4WXVA 3KQCA 4FU8A 4LZ4B 2Y80A 2CMYA 3P8OA 2VB0A 1J17T 3PLPA 4YT7H 1HNEE 2WYJA 1BMNH 2W3KA 1MTWA 1GCDA 3O8CA 4NCYA 2PUQH 3TH3H 1MCTA 4MNXA 4Q80A 3NK8A 4RSPA 5AFZH 2BZ6H 1LO6A 1HIAB 2TGAA 1V2MT 4MPVA 1PPGE 3HKJB 2P3FH 2PUXB 2XW9A 1QTFA 3HGNA 2THFB 2ANWA 4TPYA 1UTOA 5T3HA 1O2IA 4FXGH 1FY1A 2AFQB 3OU0A 1T8OA 3P92A 5F8ZA 5LGOA 1PPEE 1IQLA 3T25A 3VB5A 1GBTA 3A7YA 1ETSH 2SGDE 5C5NA 2Y5HA 3GCTG 1RIWB 2XCFA 1J9CH 3GCTF 1MCVA 2SFAA 1EXFA 3HKIB 1KDQA 4Y71A 3LGVA 2FS8A 1LHEH 3LC5A 2UUJB 3GCHB 1EPTB 2EC9H 1AY6H 4BAKB 2O8WA 3SV6A 3O8RA 3PROA 3KEEA 1AZZA 2BX4A 4A6LA 2QXJA 2XTTB 1UTNA 2IPHA 3RLYH 3SJ8A 5FX5A 3RXVA 4K8YA 5BPEA 4ZKSU 1UTJA 2BD8A 4TY6A 5TCCA 2FZZA 1JXPA 4NIXA 2OLGA 1TRMA 3DA9B 1DANH 1ELFA 1KSNA 1SQTA 1VGCC 2ULLA 4SGAE 1F5LA 1W14U 3QGNB 2A5AA 2Y81A 2BDCA 4JYTA 1GJDB 5LH8A 2ZCLP 1GHAG 2FWWA 1SB1H 2AMQA 1MKXK 3T62A 2FYRA 1AB9B 1YPJH 7GCHF 2C8YB 4BAMB 1EB2A 4OS4A 1BMLA 1VR1H 1FDPA 2FOGA 2AIPA 5GXPA 1PYTD 2H9HA 1CQQA 3BTME 4Y8XA 1DX5M 3DUXH 5DP5A 4O97A 3Q00A 4SGBE 1XUIA 3RC6A 1NFXA 2ZF0H 4FVDA 1S6HA 4GHTA 2QA9E 3A82A 3RP2A 1O3IA 1V2ST 1AKSB 4LZ1H 1DS2E 4NZQA 3RXCA 1ID5H 5GCHF 1M9UA 5FBEA 1C1QA 1O36A 3SJKA 1JIRA 1ZSJA 1LCYA 2TGTA 1SGNE 3HK6B 4E7NA 2P95A 3O8BA 2QYIA 4X6NA 3W94A 1O3LA 1PPCE 1ZZZA 3QTVH 1UHBA 2BY5X 3GOVB 4DOQA 4J2YB 1KXEA 2GVFA 1LKBA 4XE4A 2R3UA 4X6PA 1T4UH 1NRPH 3URDA 2G4TA 1BRCE 3GY7A 3MMGA 3VB4A 3SI4H 1HJ9A 1GI6A 4X8VH 1FXYA 2AGGX 1UTQA 3PLKA 4X1QU 2AS9A 5C20A 1IQNA 1UCYE 1S6FA 1O34A 1K1JA 1QRZA 2TRMA 3BTHE 4IGDA 1O3CA 4FU9A 3BTKE 2PWXA 1P01A 1HAXB 2B7DH 1ZR0A 5B6OA 2GZ9A 2AMDA 1AZ8A 5EW1H 2NU1E 2YNBA 5DPAA 5C5OA 2ZFQH 1SVPA 1C2FA 2VIOA 3M3SA 1GMHF 2Z9KA 3MU1A 4B75A 1O5GH 5E2PA 1HJAB 3A86A 3RU4D 2ASUB 1TPAE 3A88A 4RKJB 4B71A 5DK1A 1V2QT 1EAWA 1NFYA 3RM2H 3SN8A 1GHBF 1HRTH 1SGYE 2J9NA 4UE7H 4Z6AH 1UK4A 5EQQA 8KME2 2FOHA 4UFDH 3KGPA 3M5MA 3UUZA 1NO9H 1GG6B 2BDYA 5EXLA 1XXFA 1TGBA 2CJIA 2FOMB 2Z9JA 1H9IE 1TRYA 3M3VA 3ZVBA 2JETB 2LPRA 5AFYH 1QQ4A 5JBAS 2Z3DA 1DFPA 3Q3YA 1DM4B 4GUXA 4UD9H 3PMJA 1P2KA 4ABGA 1AB9C 1TPOA 2BVSH 5EXMA 4BNRA 1DY9A 5L2YH 1LHCH 5C1UA 2PKSB 1SL3A 1HPGA 4NFEA 2GZ7A 5CHAC 4GCHG 2BD4A 2Z3EA 1V2OT 1O5EH 3A7TA 1GPZA 1Y8TA 1J15A 1ESAA 4THNH 5T6FA 1ORFA 2BDHA 2STBE 2STAE 1BJUA 1CHGA 1P2OA 4OS6A 1MU8B 2A2QH 1BHXB 2BD7A 2BLOA 5DO4H 2HPPH 3SNBA 3VPKA 1OWEA 5I25A 3RMLH 2IOTA 3L6PA 1N1LA 1N6XA 2J2UA 4MNWA 4CRDA 1BBRH 1ZSLA 2BD5A 2Y7XA 3GISB 1GI1A 3RUOA 2JH0D 4NSVA 4D8NA 2A7CA 1OWHA 2FTLE 4OGXA 3RXKA 4Q7XA 1DWEH 2Y6TA 1D4PB 1DWBH 1EOLA 3BV9B 1TYNA 4TWYA 1NESE 2WPLS 2VJ1A 1YM0A 3VEQB 4D9RA 4Y7AA 3FFGA 4B2AA 1C5RA 5A09A 2WUBA 2F9VA 5C1YA 1C2KA 2O8LA 1DITH 1ESBA 4ZHAA 3SO3A 2QIQA 2ZNKH 1GMCG 2ZGBH 1O3AA 1AWFH 2OC1A 3ZZ3A 2OQ5A 3UNQA 5EODA 3RM0H 1WQVH 3CENA 2O8UA 3AASA 3H7TA 4Q7YA 3RXQA 1TE0A 5A0CA 1MAYA 5EOKA 3VFEA 5E0HA 1JRSA 3GY2A 1ETRH 3MO9A 2A7HA 1F5RA 1KLTA 5EG4A 3GCOA 3V3MA 1GHBG 1HJAC 3MO6A 4K60A 1SHHB 5AHGH 3SQHE 2WV5A 1MD7A 1SOZA 1TGSZ 3ZVFA 1W8BH 1EJAA 6CHAC 1PPHE 1SGDE 4D7GA 4YO9A 4D7FA 1JOUB 2ALVA 4CR5A 3K65B 6ESTA 4UFGH 1FAKH 1TONA 2Y5FA 1D3TB 4DCDA 1S84A 1NRSH 2AEIH 4DVAU 2BOHB 3T2NA 3OTJE 3U69H 4YM9A 1O2OA 2XXLA 1DE7H 2QXHA 3D65E 3P95A 4K1TA 1C5UA 3SU5A 1PPFE 2VVVA 1TX8A 1T8NA 3F9EA 1A5IA 1HCGA 1O3GA 1PQAA 3F9HA 2ZHWH 2XNIA 2D8WA 1O30A 3LGIA 3QZRA 1TQ7B 3A7XA 3SGAE 1DLKB 1PPZA 2W7UA 3EA9A 4R8TB 1AKSA 4O3UA 5A8YA 2GT7A 5H4IB 3UR9A 1YPEH 4NFFA 1Z8IB 2VWLA 2B9LA 3DFLA 1AI8H 3UY9A 2GGVB 2CN0H 1IQHA 2FS9A 1E38B 3L33A 1F0RA 1ETTH 3OY6U 1TMBH 3KN2A 4Y11E 1C9TA 5L30H 1GDNA 2GZ8A 2P3TB 1MKWK 1NRNH 4B2CA 1C5VA 1IAUA 1IQKA 2A4OA 4X8UH 1O2XA 7KMEH 5C2ZA 1ESTA 5F8TA 4XSKU 4MVNA 1BTXA 3UWJH 1YF4A 2C3SA 2Q6GA 3QO6A 5GPIB 3TGJE 2GTBA 3K6ZA 1E0FD 1C5TA 2EI8A 1C5MD 1OX1A 2ZGXH 3LPRA 5A8XA 3U1IB 1AVXA 1P3CA 4CBOA 1ACBE 1LPGB 3EAJA 1LHFH 1GBKA 3OYPA 4WY3A 1DPOA 2ZIQH 1DWDH 1DDJA 4Q7ZA 2HLCA 1FY5A 4X1SU 1O2QA 1YCPH 2EA3A 3B9FH 1Y3VA 2FO9A 3A81A 5DJ7A 1ZPZA 1YC0A 2ZU4A 5LPRA 4YT6H 1BCUH 1UVSH 3A8BA 4ABIA 1O2WA 3ZV9A 4Z0KA 1TNGA 2BD3A 1O3BA 1EAUA 2XBYA 1GBDA 1G32B 1A7SA 2GT8A 1HIAA 2SGAA 4K1EA 3JZ1B 1GI2A 1AIXH 1YPGH 2CXVA 1OXGA 2AYWA 1WAYB 3QZQA 3ITIA 1QY6A 2A7JA 3NPSA 5I46H 1EASA 1GMCF 1C1SA 2OCVB 1Q3XA 1EJMA 2NU3E 2BD9A 2BY8X 5J4QA 2BXTH 1AU8A 1YPMH 1ZTLA 1GBJA 3V13A 4FUHA 1ABIH 3PV4A 1KTTB 2ZTZA 1O38A 4MG3A 5J4SA 4H6TA 4CRAA 2LNCA 2RDLA 3SHAH 1C1MA 4MPWA 3SI3H 3BTTE 3H7OA 4YLUA 2ZA5A 1PPBH 3TGKE 2I6SA 4Y7BA 2HGTH 1KY9A 1L1NA 3ZZ4A 1O2HA 2G81E 4K5ZA 4A5TS 2AH4X 1W7GH 4AGKA 1BTZA 3EA7A 3A87A 1FPCH 3WY8A 3T28A 1MTNB 3P70B 4X2YA 2H2ZA 4B73A 3TJVA 1WOFA 2OINA 4DIIH 2BVRH 4WMDA 2F9PA 1O2NA 2NU0E 3GDSA 1C5YB 4UFEH 3UR6A 1L4ZA 1MZAA 2H9TH 3LOXA 1J14A 1CHOF 1FIWA 1FJSA 1MBMA 3VXFH 1OP0A 2FOCA 1O33A 3RXGA 3Q76A 1OWKA 4I8HA 9ESTA 2EEKA 2J4IA 4I8KA 1K1NA 2XWBI 3PWBA 5K0HA 3MO3A 1PQ7A 2A4GA 3BG4B 1FV9A 5FBIA 4UDWH 4FU7A 1O5BB 2A45B 2G8TA 3HGPA 4GLYA 1TMTH 1THSH 3ZVDA 1VZQH 3BTEE 1P2IA 2PSXA 2ZU1A 4NZLA 3ODFA 1LVBA 2A4RA 4X1PU 3TIUA 4X1RU 3O8DA 3Q77A 1MKWH 1XKBC 1EATA 2BB4A 2F9UA 3ATLA 1VGCB 1L1GA 2K1QA 3A7WA 2G4UA 1P3EA 3KQEA 1SFIA 1O3HA 1P09A 4O3TA 3LGYA 4BTTB 1XUJA 5AVDA 4BAQB 1BZXE 3GDUA 4ISIH 4U30A 1PYTC 1H9LB 1NRQH 3T5FH 2TIOA 2RG3A 1TNHA 1A3BH 1DOJA 4FUBA 2J95A 3MH5A 3LH1A 4HTCH 4ZMAH 3LIWA 4WH8A 2P8OC 1NS3A 1O2RA 1XUKA 4VGCC 4WF8A 2OC0A 1KIGH 1O3EA 2W5EA 1QCPA 1K1MA 1B7XB 1Z6JH 3G01A 3M61U 4I31A 1MAXA 4NG9H 1XUFA 3AW0A 1YYY1 3A7VA 4NWKA 1QB1A 4MNYA 4XBDA 1P2MA 1K1IA 5EPNA 1TNJA 1A5HA 1GVKB 3TK5A 1RRKA 1QRWA 5T6DA 3AW1A 3MH6A 5E0GA 2JETC 4ZXXH 3RU4E 4GSOA 4ABEA 1F5KU 4JZDH 1ZRKA 2HRVA 2ZGJA 2P16A 3AVZA 1K1OA 1GJ9B 4JZFH 3UOPA 1C4Y2 2Y7ZA 3QTOH 4K8BA 2JKHA 3TGIE 2Z7FE 3MTYA 5IDKA 1O5AB 2OBOA 3FP8E 4NIWA 3ZZDA 1C5ZB 1ARBA 3SQEE 4AG2A 2NU2E 1AE5A 1LPKB 2BY7X 4X2VA 4VGCB 1NC6A 4I8JA 2C4FH 3QX5H 5K7RA 2HNTC 3UWIA 1PFXC 3CP7A 1TBRH 3SZNA 1K1PA 3E16B 1W7XH 3B23B 1TBZH 1O2VA 4TY7A 1DVAH 3ZVEA 1P04A 1BTPA 4IC6A 2W26A 1PJPA 1IQJA 3M5LA 4NSYA 4JZIA 5HXFA 4AX9H 2QGRA 1VITF 1AGJA 1C2LA 3FAOA 1K1LA 2GCHF 2GDDA 1TGNA 2HNTF 6LPRA 8GCHG 1MBQA 1C1RA 2ZFFH 3TNTA 1CBWB 1LVMA 3FANA 4WWYA 5C1XA 3A8AA 4JYUH 1O2SA 1LHGH 3H5CB 1QR3E 3ZZ9A 1AFEH 1O3FA 2H5DA 1BBRK 2ZFSA 2AERH 4Q2KA 3TH2H 1Y5AT 1NFUA 1W13U 1YCPM 3R0FA 1GJBB 3K2UA 1C5LH 1C1TA 1Q2WA 2BYAX 3E91A 2P8OB 1U6QA 1CA8B 3ATKA 4E7RG 3S9BA 1G3EA 4KKDA 1F0TA 3PMBB 1O32A 2BMGB 2ZCHP 1GJ7B 1EPTC 3ZYEA 1V6DA 3PO1B 1TGCA 1QB9A 1EOJA 2F9OA 4J1YA 3VB6A 4A1TA 4K2YA 1MKXH 1TLDA 4AG1A 5JB8S 1P11E 1ARCA 3OSYA 3KL6A 4WJG2 1T31A 3I29A 3ENSB 2ZU3A 1D3DB 1WSSH 3U8RH 1ELEE 1O2ZA 1QB6A 4OGYA 1GI3A 1D3QB 4AFZA 3M3TA 1TWXB 3BEFB 5EXNA 2G00A 3S9CA 1O5DH 1O0DH 4AB9A 3V7TA 2OC8A 2ZTYA 4INLA 2B5TB 1EZUC 1HAZB 1SC8U 3ATIA 5EQRA 2JH5D 1O2LA 1K28D 1ZHMA 1DSUA 2IJOB 1V2WT 1W0YH 1SGIB 1UVOA 1ZOMA 5E2OA 1YLDA 1FY4A 2FDAA 1BQYA 1DT2A 2FTMA 3BSQA 2UWLA 1XMNB 3RU4T 4INHA 1V2NT 3DFJA 1SI5H 2OTVA 1BMAA 1O3PB 2FPZA 4GHQA 1W12U 1SGEE 3SJIA 1HJ8A 2VH0A 1C2DA 4MPUA 2P59A 1GI4A 1KXCA 3UFAA 4U32A 1SHYA 4ZROA 2J92A 4AZ2B 1S0RA 2Y5GA 1GG6C 4LOYH 1QGFA 2QXGA 2HNTE 1Z1IA 3HATH 1V2UT 3MFJA 4CH2B 4WVPE 1Y3XA 4XBBA 2O8TA 1TALA 1W11U 1W0ZU 1YGCH 3GCHC 3LGWA 3QN7A 3UOUA 4YESB 3HPTB 4OS5A 3E90B 3Q3KA 4O9VA 1GBCA 2A4QA 1O3OA 1CT2E 4I8GA 1HAGE 5FHTA 1SLVB 3SV2H 2VIVA 4CHAB 4JZ1A 1GBFA 3GDVA 2KAIB 1ANEA 1MH0A 4AOQA 1ELVA 1HXFH 1ELCA 4FUFA 1ZLRA 4FUIA 1GL1A 2ALPA 3PYHA 1C1VH 2F3CE 4BAHB 3MU4A 4CREA 1C5PA 2FIRH 8LPRA 3ATMA 5JYIA 1F2SE 1FPHH 1ELDE 3BN9A 3LGTA 1YKTA 4YLQH 1GBLA 4OS2A 3QGJA 2RA3A 2H9EH 3RXDA 1C5QA 1GMDG 3NKKA 1L2EA 4X0WU 1QQUA 2PW8H 1NRRH 1TOCB 3F6UH 2ZP0H 4CRFA 4LK4A 1GJAB 3DD2H 1YBWA 3BTDE 1QA0A 3RMNH 4AYYB 1QL8A 3PMAB 1Z7KA 1FI8A 1NY22 3PM3A 2G51A 5GCHG 2BLWA 5CMXH 2V6NA 2WINI 1LDTT 5DG6A 2R0KA 3W95A 2ANMH 1GJ6A 2AIQA 2DUCA 5DP3A 1IQEA 2BDGA 1HV7A 4ABFA 1OYQA 3P17H 1O2MA 1WTGH 2FI4E 3SU2A 4DG4A 1YPHC 1FN6A 3ZVAA 3ZZ7A 1IHTH 1V2RT 2M5TA 1T4VH 1NN6A
chains in the Genus database with same CATH superfamily
1D3PB 1GBHA 4A1XA 2ZKSA 5A0BA 4HZHA 6GCHF 1B0EA 1BB0B 2JH6D 2OK5A 3STJA 1SQAA 3U98H 1GDUA 5FCKA 1V2JT 3TJUA 2EI6A 3CS0A 2J98A 2R2MB 3OAAD 1P05A 4MQAA 2GP9B 3S0NA 1N8OB 3BIVH 3K6YA 2F4LA 3SNEA 1A0LA 2BM2A 2BDBA 1BA8B 1HDTH 1UK3A 4F55A 3VXEH 3M37A 2DE8A 3BF6H 2VU8E 1EAXA 1GI9B 2Z9GA 2PKAA 1GCTB 2VWNA 1C4V2 1RTFB 1BBRE 3URCA 2R0LA 2W3IA 3M5OA 2ZG0H 3FZZA 1P2QA 3ZV8A 3IWMA 1QJ1B 3N7EA 3ZZ8A 1IQFA 2QF4A 1P03A 3RMMH 1VJAU 2R3YA 5FCRA 4R0IA 1V2VT 3PV2A 2GMTB 3SJ9A 3SUEA 2PFEA 3PTBA 1BDAA 3TK6A 1V2KT 2DE9A 2FOFA 1HAOH 4HG6A 1SSXA 4ZAEA 4BXSA 1Y5UT 2ODPA 1UJ1A 1GI7B 2BQWB 1O2JA 2ZFRH 4ESTE 3A83A 4ZUHA 1C1UH 3A80A 1AVWA 2JIZD 2ZDLA 1S5SA 1O2YA 2V3HH 2ZHFH 3M36A 2R2WU 4B2BA 1QNJA 1NU9A 3PRBA 4X6MA 1YPHE 1RFNA 1O3MA 1EZQA 1B5GH 3TNSA 3SOSA 1C5XB 3M7TA 1UTMA 3CNRA 2BTCE 1V2LT 4XOJA 3SUDA 5C94A 1DLEA 1GCTC 1RD3B 2WSSD 1ZPCA 3GY8A 3B8JA 2WPMS 1EFRD 1GVLA 1O3NA 4UEHH 4DJZB 5FPSA 1UHBB 2C8ZB 3U8TH 4ASUD 1ZMNA 5DP4A 4HI3A 3RXJA 2QAAA 2WV9A 2KX4A 1C2MA 2WPHS 3KCGH 2UUFB 3VB3A 1GI5A 3L3TA 1JWTA 3DSOA 1O5FH 1H8HD 2QC2A 4ZKOU 4DT7B 1C4U2 2D26C 3PO1C 3RXPA 1INCA 3F68H 2H5CA 5GWZA 1W10U 2VGCB 1ZTKA 2ZDMA 4PROA 4KTCA 4X2WA 3RXRA 3T27A 1GHYH 2ODQA 1ZGVA 1GJ5H 1SLUB 1Z71A 2BY9X 5EU8A 3RXAA 4D9QA 4I7YH 1C2GA 5TCAA 1TMUH 1EPTA 3FZDA 1ELTA 4ISLA 5L6NH 1ZJKA 1D9IA 1OP8A 1T32A 2HWLB 1KDQB 1L4DA 1RIWC 2VH6A 1OPHB 2VWOA 3MOCA 2FLRH 2RCEA 2VINA 2O8MA 2ZPQA 2FLBH 1WV7H 4Y79A 1GL0E 1O5CB 1XM1A 4BAOB 2F83A 4B74A 3AAUA 1WU1A 2EI7A 1JIMA 3UNRA 1EP5A 1E37B 2VWMA 2XBVA 1CGIE 1BHXF 1ZHPA 2ZEBA 5EQSA 4D76A 1UTLM 3C27B 4XFQA 1O2TA 2ZC9H 5JPMH 1TX7A 8GCHF 3TJNA 1G3CA 2XC0A 2ZU5A 7ESTE 2A5KA 1TIOA 2YMSB 1WDIA 1C1PA 2FOAA 4DW2U 1RTLA 2BD2A 5DP6A 4IMZA 3SORA 1NM6A 3ZYDA 1WYKA 3LDXH 3DSGA 4A1VA 5DGJA 1MTSA 4X1NU 1UTPA 1BIOA 2WPJS 1HAPH 1XUGA 4IBLH 2BZAA 4ISNA 3ESTA 3RXOA 3ZVGA 1A3EH 1NROH 1S85A 3NRLA 5HM2A 1C5SA 2BY6X 2KZ4A 1XKAC 2KCAA 3MH4A 1RJXB 1ZPBA 1CA0C 1D6WA 3K9XB 1CGHA 1GBMA 2ZPRA 2SNVA 2ZQ2A 2ILNA 3P8NA 1GHAF 5ESTE 1TPPA 2BVXH 3ELAH 4CHAC 3BTQE 3UPEA 3LC3A 5HGGA 2ZHQH 1EKBB 4KP0A 1MTVA 2UWOA 1ZGIA 2AGIX 3HK3B 1XXDA 1YPLH 3KQ5A 1GBAA 3SU4A 1L1JA 3ODDA 2R9PA 3GICB 1HAYB 3BG8A 1DY8A 2FMJA 1VCWA 3A84A 3EDXB 1KLJH 6CHAB 3UTUH 2GV6A 1CT4E 1S83A 1SG8B 2VIWA 1LPZB 2ZFPH 2G5NA 1EZSC 1T8MA 5ESBA 3RXTA 2PGBB 4IN1A 5F6MA 1NPMA 4FUJA 1B0FA 4TYDA 2G55A 2HVXA 4NA8A 3TVJB 3TK9A 2A31A 3MU0A 3SGBE 1AFQB 3RXMA 3TLOA 2H1UA 1FIZA 3BG4C 3EYDA 2ZO3H 3F1SB 2VBCA 1O3JA 4ZKNU 3SW2B 1ZSKA 5F53A 2ZECA 2C90B 2JDID 1ZRBA 1O2UA 4X2XA 2J38A 3QDZB 3UIRA 1TNIA 3SZEA 3MQKC 2OXSA 3M7QA 1SQRA 2Z94A 1DUAA 1EUFA 1Z6EA 2VVCA 4YOIA 3P8FA 5BRRE 3JZ2B 5FX6A 3T26A 4JMYA 4GCHF 1UMAH 4A92A 3SV7A 2FI3E 1OKXA 3UB0A 2KFWA 2PTCE 5IYTA 3F9FA 3S7KB 1G2MA 1TB6H 2UUYA 3M5NA 4ISOA 4GAWA 1CVWH 1YCPK 5FL7D 2J34A 2TBSA 3E3TA 5SGAE 1YLCA 3MNXA 4MNVA 1BTWA 1KXDA 5EW2H 1LKAA 2XWAA 1Z8JB 1ELAA 1QBVH 4NGAH 1BTUA 3SHCH 3T29A 2VGCC 3ZVCA 4DY7B 5LPFA 1UVPA 1ZMLA 1JBUH 2VIPA 1SOTA 1QJ7B 1AUJA 2SGFE 3ZZ5A 4E06H 5CE1A 1VITH 4FOUC 5LPEA 1WBGB 2G52A 2PHBA 3A89A 3EQ0H 1G2LA 3SGQE 2QN5T 3RMOH 1MMJN 1NZQH 2HLDD 2ZDKA 5JBBS 3S9AA 1QJ6B 1BTHH 4TPIZ 3UNSA 1A0JA 1OP2A 1AWHB 3EA8A 1J8AA 2G5VA 3RDZA 4DGJA 4MPXA 4RN6A 2F91A 2IN2A 3RXEA 4I33A 2FODA 4CRGA 3UREA 4B6FA 4AYVB 2Z6BD 2GD4B 3GYLB 4Y76A 4UONA 1RTKA 1NT1A 4K1SA 3SNCA 4FUGA 1DICA 3RXUA 5ETXA 1OWIA 3TITA 3VG8A 1JMOH 1OWDA 3V12A 1GDQA 2LELA 2Y82A 1X7AC 4WH6A 1AFQC 2UWPA 5B6LA 3MH7A 2A0QB 3SBKA 3RXBA 1H4WA 1WTHD 2CHAC 2ANKH 4AN7A 1TQ0B 2BLQA 1H1BA 1KLIH 2P94A 3PTNA 1G37A 1TNKA 2J94A 1H8IH 1E35B 1WQSA 1CHOG 2SGPE 4JZEH 3DCLA 3SJOA 5EPYA 2A5IA 3E6PH 3M7UA 3VB7A 1BRAA 1A61H 1OSSA 3MU8A 1QA7A 1N8OC 1G3DA 2TGDA 1FUJA 3A85A 3MNBA 5AF9H 4WMFA 2OC7A 1EP6A 2WHXA 3QLPH 1DUEA 2V0BA 4AORA 1BMMH 2TPIZ 1EAIA 2ZGCA 1LHDH 4Y10E 1K0HA 2AGEX 4JK6A 2EQNA 3F2GA 1HAIH 1LTOA 1ELBA 1SGFG 1W0KD 2ZI2H 3A8CA 3N99A 2BDIA 3ZZ6A 2XRCA 4BTIB 1C1WH 4BTUB 2FX6A 1AD8H 1LVYA 2IJD1 1VITG 1GI0A 2HALA 1V2TT 4KGAA 2QXIA 4YTAA 1BT7A 1E34B 1A5GH 1NBMD 2ZDAH 4CRCA 3F9GA 5JBCS 4H4FA 3RXLA 2PLXA 3LGUA 1P2JA 3MU5A 1AQ7A 1KMHB 1ZJDA 1O2KA 3BTWE 1MTUA 2AMPA 3KHVA 3PLBA 3RC5A 2BOKA 4A7IB 2FX4A 1P06A 4KTSA 1TBQH 5E8EH 1A2CH 1EJNA 1EZXC 1ZHRA 4IMQA 4ABAA 1Z8GA 1SBWA 3LONA 3I77A 3NZIA 3IG6B 1NFWA 2FOEA 1HAVB 1BOQA 3A8DA 1S82A 3NCLA 5DKMA 4OS7A 1O3DA 2WYGA 2H6MA 1YY3A 2JJ1D 3FP6E 1G3BA 3ZZAA 2WV4A 2FI5E 3MWIU 1OOKB 2OUAA 3QK1A 5EJ1A 2BQ7B 1TX6A 3GCNA 1SGPE 4AGJA 5A2MH 3U8OH 2F9NA 1Y5BT 4K3JA 2D1JA 5GIBA 3RXIA 2Z9IA 3R3GB 4NIVA 5CHAB 1HBTH 2JJ2D 4F48B 4Z1MD 2Z3CA 1H9HE 4NIYA 4YOGA 5HYOA 2ZHDA 1A0HB 4O03A 1GJ8B 1TFXA 3BTFE 1O37A 3MNSA 7GCHG 1CA0B 4Q63A 1QFKH 3E0PB 1RGQA 1TNLA 1WUNH 2A1DB 2FOBA 1DXPA 1FONA 4JK5A 1P8VC 1LQEA 1ANDA 1RXPA 4XBCA 1GMHG 1C2JA 4KTUA 5A8ZA 1EQ9A 4Y0YE 3ZZBA 2BHGA 1P02A 1QL9A 3DT0H 5T6GA 3VGCC 1FAXA 4ABDA 2HOBA 3QWCH 3SU0A 1COWD 1AVGH 1FQ3A 1ANCA 3NUMA 4B1TA 2Q6DA 2KR7A 1GHXH 4H42U 1GGDB 1MUEB 5HIYA 3QUMP 1W3CA 3GS9A 2W7SA 4CBNA 3SUGA 1Q31A 1YP9A 2L6OA 3GY4A 5DP7A 1SGFA 5E0JA 5L2ZH 1XVOA 3P8GA 4Y6DA 3RLWH 4HFPB 1FN8A 2SNWA 2GCHG 4OS1A 1BITA 1L0ZA 5HKKD 2BQ6B 1MZDA 1MQ5A 1P9SA 1H8DH 2CF9H 1SQOA 3M35A 1VCPA 8ESTE 1YPKH 1UK2A 2FESH 4IC5A 1O35A 3OEHD 1PQ8A 3GY3A 3V0XA 3MYWA 1P0SH 1SR5C 2FYQA 1XX9A 5JDUB 2ODYB 1P10A 1HAVA 1AE8H 2YOLA 4ISHH 1TGTA 3SUFA 1W0JD 2OP9A 3OX7U 1GJCB 5C3NA 1IHSH 1K9OE 1BUIA 2GX4A 1CE5A 4F49A 1BTYA 1Y3YA 1O3KA 1ZMJA 3IITA 4ZHLU 1K21H 2CF8H 1QL7A 2KCPA 1C9PA 1FNIA 5TJXA 3FVFB 1T8LA 4U2WA 4BANB 2C8WB 1VJ9U 2VNTA 2CHAB 1UCYH 3LH3A 1C2HA 1CSOE 1TPSA 1V3XA 3SNDA 1O39A 1K2I1 4WMEA 3SV9A 3LJJA 1LVOA 4ABBA 3S7HB 3PB1E 1SGRE 3GY5A 5HMAA 1UO6A 1UTKA 2YNAA 2QF3A 1NTPA 1SGCA 2XCNA 1TA2A 3EE0B 3BEIB 3P6ZB 4XDEA 3FN8A 4AB8A 2XYAA 1C5NH 1G30B 4DURA 1QZ8A 2CGAA 4CR9A 2PGQB 3PMHB 3S69A 3DHKH 4JCNA 2ZCKP 2QV1A 4KELA 1GHZA 1AN1E 1TRNA 1P9UA 1V2PT 1C1NA 5FPTA 3PWCA 2FM2A 3Q3XA 2Z9LA 1RS0A 3VGCB 2CV3A 1CT0E 4FUCA 3U28C 1QIXB 2XNDD 4ZXYH 3I78A 1LQDB 2XBXA 2PKAB 3FKSD 2PSYA 3LT3A 5KGOA 2OBQA 1WCZA 1GGDC 3N7OA 1C2IA 5FAHA 2M2AA 5F8XA 3NWUA 2FEQH 2XC4A 5GJ4B 1AMHA 2SGEE 3D49H 3SU1A 1CGJE 5ABWA 2RFKC 4B76A 3LJOA 5A0AE 4ASHA 4TWWA 3SNAA 4Y8ZA 3GYMA 2IPQX 4X8TH 1HAHH 1T7CA 1SLWB 1S81A 1UCYK 4BOHA 1KXBA 3TH4H 1CBWC 1FY8E 3KNXA 4ZH8A 1Z1JA 3FP7E 2XC5A 4MTBA 2O9QA 1HFDA 1GHVH 2QF0A 5F03A 3SU3A 3E1XB 1EX3A 5DP9A 1TAWA 4INKA 3KYGA 5HM9A 1KYNA 1C1OA 2XBWA 1TOMH 1NBME 2ZZUH 1FY3A 3UQVA 4F4OC 3D23A 1G9IE 4CRBA 2D2DA 1BRUP 3BTGE 1KXFA 3KIDU 4H6SB 1SMFE 2NWNA 1AUTC 4CH8B 3D62A 3UQOA 2GCTC 1DSTA 2ANYA 1FZZA 4WXIA 3TJOA 4UFFH 1ABJH 2ZTXA 3U9AH 1GHWH 2WUCA 1NU7B 1HYLA 1F92A 5FXLA 2ZDNA 1K22H 4FUEA 2Q6FA 2F9BH 1CU1A 1Z8RA 2P3UB 1QBNA 3KQDA 3BEUA 2P93A 1P2NA 2KCYA 5C67A 3RXFA 1FLEE 2PTNA 1E1RD 4X8SH 1EB1H 1P57B 2BDAA 1C5OH 1A4WH 2KAIA 3A7ZA 3U1JB 4E05H 3MHWU 4FUDA 2HPQH 2ZGHA 3BIUH 4IS5A 1IQGA 4NA9H 1E36B 7LPRA 3KQBA 2V3OH 4FVBA 2I6QA 2RA0A 1DXWA 3NXPA 2PKSC 2ZHEH 1S0QA 2GKVE 1UVTH 2AHME 2GCTB 1C2EA 1KTSB 2C8XB 1HGTH 3CS7A 1ANBA 1IQIA 1BJVA 1A1RA 5JB9S 5FPYA 3PRDA 3C1KA 3GY6A 1Y59T 2ZQ1A 2FP7B 2UUKB 3KF2A 6GCHG 4GVUA 3SU6A 3MNCA 1O31A 1THRH 4U01A 1C5WB 4HGCA 3E0NB 4JYVH 4RKOB 1ELGA 4DIHH 2WPKS 1P12E 1QRXA 4QT8C 2B0FA 1HLTH 1VCQA 1F0SA 3F0PA 1GBIA 4YZUA 9LPRA 1MD8A 1QHRB 2TGPZ 1XUHA 1A46H 1F0UA 1W2KH 2A32A 4I32A 1ZYOA 5EGMA 1KXAA 2B8OH 1MQ6A 1MTNC 3RXHA 4BXWA 1THPB 4ABJA 4GPGA 1Y3WA 4X6OA 1GWAA 2ZWLH 1XVMA 3EGKH 1LMWB 1O2GH 4NWLA 4Y8YA 3UAIC 2PV9B 3LU9B 1AHTH 2QY0B 1HB0B 1GBEA 3OE7D 1GBBA 3ATWA 2GDEH 1F7ZA 4AFSA 2OQUA 3AAVA 4LXBH 1OWJA 1J16A 1DWCH 4IN2A 1O2PA 4ACAA 4ZHMU 1Y3UA 2FXRA 2ZU2A 5PTPA 2A2XH 2ESTE 1MU6B 4MLFB 2BXUH 1ZTJA 1SGQE 1IQMA 1OYTH 1CO7E 2GV7A 1GMDF 2V35A 2ZFTA 3SYJA 2PR3A 3E8LA 3OY5U 1SPJA 2BX3A 1JRTA 5G4BA 1GI8B 3EE7A 2QCYA 2GMTC 4MDSA 3LKWA 1SGTA 4ABHA 1QURH 1N6YA 1GVZA 1SLXB 2BLVA 3F0OA 3MI4A 3ZZCA 2VIQA 1UVUH 3RC4A 5DP8A 4ZKRU 2ZPSA 3TPIZ 2NU4E 5GDSH 1D6RA 1HXEH 2VIDA 2SGQE 5JBTA 2WPIS 4I8LA 1BRBE 4AC9A 3SV8A 3STIA 1TABE 1TA6A 4AFUA 2OD3B 4AFQA 1PQ5A 4IW4E 4K69A 1G36A 4M7GA 3RXSA 2Q1JA 3PV5A 5IK2D 1FMGA 1IOEA 4NA7A 3TU7H 1OS8A 2VVUA 4YOJA 2C93B 1GJ4H 1QBOA 4Y0ZE 1HUTH 1AO5A 2PP6A 2ZDVH 1SFQB 4WXVA 5C0UA 3KQCA 4FU8A 4LZ4B 2Y80A 2CMYA 3P8OA 2VB0A 1J17T 3PLPA 4YT7H 1HNEE 2WYJA 1BMNH 2W3KA 1MTWA 1GCDA 3WWBA 3O8CA 4NCYA 2PUQH 4ZCNA 3TH3H 1MCTA 4MNXA 4Q80A 3NK8A 4RSPA 5AFZH 2BZ6H 1LO6A 1HIAB 2TGAA 1V2MT 4MPVA 1PPGE 3HKJB 2P3FH 2QE7D 2PUXB 2XW9A 1QTFA 3HGNA 1FX0B 2THFB 2ANWA 4TPYA 1UTOA 5T3HA 1O2IA 4FXGH 1FY1A 2AFQB 1YWUA 3OU0A 1T8OA 3P92A 5F8ZA 5LGOA 1PPEE 1IQLA 3T25A 3VB5A 1GBTA 3A7YA 1ETSH 2SGDE 5C5NA 2Y5HA 3GCTG 1RIWB 2XCFA 1J9CH 3GCTF 1MCVA 2SFAA 1EXFA 3HKIB 1KDQA 4Y71A 3LGVA 5EJZA 2FS8A 1LHEH 3LC5A 2UUJB 3GCHB 1EPTB 2EC9H 1AY6H 4BAKB 2O8WA 3SV6A 3O8RA 3PROA 5DN6D 5CDFE 3KEEA 1AZZA 2BX4A 4A6LA 2QXJA 2XTTB 1UTNA 2IPHA 3RLYH 3SJ8A 2KCOA 5FX5A 3RXVA 4K8YA 5BPEA 4ZKSU 1UTJA 2BD8A 4TY6A 5TCCA 2FZZA 1JXPA 4NIXA 2OLGA 1TRMA 3DA9B 1DANH 1YLNA 1ELFA 1KSNA 1SQTA 1VGCC 2ULLA 4SGAE 1F5LA 1W14U 3QGNB 2A5AA 2Y81A 2BDCA 5EIYA 4JYTA 1GJDB 5LH8A 2ZCLP 1GHAG 2FWWA 1SB1H 2AMQA 1MKXK 3T62A 2FYRA 1AB9B 1YPJH 7GCHF 2C8YB 4BAMB 1EB2A 4OS4A 2FOGA 1BMLA 1FDPA 1VR1H 2AIPA 5GXPA 2L74A 1PYTD 2H9HA 1CQQA 3BTME 4Y8XA 1DX5M 3DUXH 5DP5A 4O97A 3Q00A 4SGBE 1XUIA 3RC6A 1NFXA 2ZF0H 4FVDA 1S6HA 4GHTA 2QA9E 3A82A 3RP2A 1O3IA 1V2ST 1AKSB 4LZ1H 1DS2E 5EJLA 4NZQA 3RXCA 1ID5H 5GCHF 1M9UA 5FBEA 1C1QA 1O36A 3SJKA 1JIRA 1ZSJA 1LCYA 2TGTA 1SGNE 3HK6B 4E7NA 4TSFD 2P95A 3O8BA 2QYIA 4X6NA 3W94A 5CHBA 1O3LA 1PPCE 1ZZZA 3QTVH 1UHBA 2BY5X 2WPDD 3GOVB 4DOQA 4J2YB 1KXEA 2GVFA 2J97A 1LKBA 4XE4A 2R3UA 4X6PA 1T4UH 1NRPH 3URDA 2G4TA 1BRCE 2YMSC 3GY7A 3MMGA 3VB4A 3SI4H 1HJ9A 1GI6A 4X8VH 1FXYA 2AGGX 1UTQA 3PLKA 4X1QU 2AS9A 5C20A 1IQNA 1UCYE 1S6FA 1O34A 1K1JA 1QRZA 2TRMA 3BTHE 4IGDA 1O3CA 4FU9A 3BTKE 2PWXA 1P01A 1HAXB 2B7DH 1ZR0A 5B6OA 2GZ9A 2AMDA 1AZ8A 5EW1H 2NU1E 2YNBA 5DPAA 5C5OA 2ZFQH 1SVPA 1C2FA 2VIOA 3M3SA 1GMHF 2J5UA 2Z9KA 3MU1A 4B75A 1O5GH 5E2PA 1HJAB 3A86A 3RU4D 2ASUB 1TPAE 3A88A 4RKJB 4B71A 5DK1A 1V2QT 1EAWA 1NFYA 3RM2H 3SN8A 1GHBF 1HRTH 1SGYE 2J9NA 4UE7H 4Z6AH 1UK4A 5EQQA 8KME2 2FOHA 4UFDH 3KGPA 3M5MA 3UUZA 1NO9H 1GG6B 2BDYA 5EXLA 1XXFA 1TGBA 2CJIA 2FOMB 2Z9JA 1H9IE 1TRYA 3M3VA 3ZVBA 2JETB 2LPRA 5AFYH 3N7DA 1QQ4A 5JBAS 2Z3DA 1DFPA 3Q3YA 1DM4B 4GUXA 4UD9H 3PMJA 1P2KA 4ABGA 1AB9C 1TPOA 2BVSH 5EXMA 4BNRA 1DY9A 5L2YH 1LHCH 5C1UA 2PKSB 1SL3A 1HPGA 4NFEA 2GZ7A 5CHAC 4GCHG 2BD4A 2Z3EA 1V2OT 1O5EH 3A7TA 1GPZA 1Y8TA 4P02A 1J15A 1ESAA 4THNH 5T6FA 1ORFA 2BDHA 2STBE 2STAE 1BJUA 4OM9A 1CHGA 1P2OA 3WWFA 4OS6A 1MU8B 2A2QH 1BHXB 2BD7A 2BLOA 5DO4H 2HPPH 3SNBA 3VPKA 1OWEA 5I25A 3RMLH 2IOTA 3L6PA 1N1LA 1N6XA 2J2UA 4MNWA 4CRDA 1BBRH 1ZSLA 2BD5A 2Y7XA 3F3BA 3GISB 1GI1A 3W1EA 3RUOA 2JH0D 4NSVA 4D8NA 2A7CA 1OWHA 2FTLE 4OGXA 3RXKA 4Q7XA 1DWEH 2Y6TA 1D4PB 1DWBH 1EOLA 3BV9B 1TYNA 4TWYA 1NESE 2WPLS 2VJ1A 1YM0A 3VEQB 4D9RA 4Y7AA 3FFGA 4B2AA 1C5RA 5A09A 2WUBA 2F9VA 5C1YA 1C2KA 5KECA 2O8LA 1DITH 1ESBA 4ZHAA 3SO3A 2QIQA 2ZNKH 1GMCG 2ZGBH 1O3AA 3KYFA 1AWFH 2OC1A 3ZZ3A 2OQ5A 5DSFA 3UNQA 5EODA 3RM0H 1WQVH 3CENA 3WW7A 2O8UA 3AASA 3H7TA 4Q7YA 3RXQA 1TE0A 5A0CA 1MAYA 5EOKA 3VFEA 5E0HA 1JRSA 3GY2A 1ETRH 3MO9A 2A7HA 1F5RA 1KLTA 5EG4A 3GCOA 3V3MA 1GHBG 1HJAC 3MO6A 4K60A 1SHHB 5AHGH 3SQHE 2WV5A 4YXWD 1UW7A 1MD7A 1SOZA 1TGSZ 3ZVFA 1W8BH 1EJAA 6CHAC 1PPHE 1SGDE 4D7GA 4YO9A 4D7FA 1JOUB 2ALVA 4CR5A 3K65B 6ESTA 4UFGH 3F2FA 1FAKH 1TONA 2Y5FA 1D3TB 4ACBA 4DCDA 1S84A 1NRSH 2AEIH 4DVAU 2BOHB 2HVYB 3T2NA 3OTJE 3U69H 4YM9A 1O2OA 2XXLA 1DE7H 2QXHA 3D65E 3P95A 1VKYA 4K1TA 1C5UA 3SU5A 1PPFE 2VVVA 5C0TA 4Q4LA 1TX8A 1T8NA 3F9EA 1A5IA 1HCGA 1O3GA 1PQAA 3AK5A 3F9HA 2ZHWH 2XNIA 2D8WA 1O30A 3LGIA 3QZRA 1TQ7B 3A7XA 3SGAE 1DLKB 1PPZA 2W7UA 3FOAA 3EA9A 4R8TB 1AKSA 4O3UA 5A8YA 2GT7A 5H4IB 3UR9A 3F2HA 1YPEH 4NFFA 1Z8IB 2B9LA 2VWLA 3DFLA 1AI8H 5C17A 3UY9A 2GGVB 2CN0H 1IQHA 2FS9A 1E38B 3L33A 1F0RA 1ETTH 3OY6U 1TMBH 3KN2A 4Y11E 1C9TA 5L30H 1GDNA 4M9FA 2GZ8A 2P3TB 1MKWK 1NRNH 4B2CA 1C5VA 1IAUA 1IQKA 2A4OA 4X8UH 4RT1A 2XOKD 1O2XA 7KMEH 5C2ZA 1ESTA 5F8TA 4XSKU 4MVNA 1BTXA 3UWJH 1YF4A 2C3SA 2Q6GA 3QO6A 5GPIB 3TGJE 2GTBA 3K6ZA 1E0FD 1C5TA 2EI8A 1C5MD 1OX1A 2ZGXH 3LPRA 5A8XA 3U1IB 1AVXA 1P3CA 4CBOA 1ACBE 1LPGB 3EAJA 1LHFH 1GBKA 3OYPA 4WY3A 1DPOA 2ZIQH 1DWDH 1DDJA 3OTPA 2HLCA 1FY5A 4Q7ZA 4X1SU 1O2QA 1YCPH 2EA3A 3B9FH 1Y3VA 2FO9A 3A81A 5DJ7A 1ZPZA 1YC0A 2ZU4A 5LPRA 4YT6H 1BCUH 1UVSH 3A8BA 4ABIA 3OEED 1O2WA 3ZV9A 4Z0KA 1TNGA 2BD3A 1O3BA 1EAUA 2YMSD 4TT3D 1GBDA 1G32B 2XBYA 1A7SA 2GT8A 1HIAA 2SGAA 4K1EA 3JZ1B 1GI2A 4RI0A 1AIXH 1YPGH 2CXVA 1OXGA 2AYWA 1WAYB 3QZQA 3ITIA 1QY6A 2A7JA 3NPSA 5I46H 1EASA 1GMCF 1C1SA 2OCVB 1Q3XA 1EJMA 2NU3E 2BD9A 2BY8X 5J4QA 2BXTH 2KM0A 1AU8A 1YPMH 1ZTLA 1GBJA 3V13A 4FUHA 1ABIH 3PV4A 1KTTB 2ZTZA 1O38A 4MG3A 2LP6A 5J4SA 4H6TA 4CRAA 2LNCA 2EY4C 2RDLA 3SHAH 1C1MA 4MPWA 3SI3H 3BTTE 3H7OA 4YLUA 2ZA5A 1PPBH 3TGKE 2I6SA 4Y7BA 2HGTH 1KY9A 1L1NA 3ZZ4A 1O2HA 2G81E 4K5ZA 4A5TS 2AH4X 1W7GH 4AGKA 1BTZA 3EA7A 3A87A 1FPCH 3WY8A 3T28A 1MTNB 3P70B 4X2YA 2H2ZA 1E79D 4B73A 3TJVA 1WOFA 2OINA 4DIIH 2BVRH 4WMDA 2F9PA 1O2NA 2NU0E 3GDSA 1C5YB 4UFEH 3UR6A 1L4ZA 1MZAA 2H9TH 3LOXA 1J14A 1CHOF 1FIWA 1FJSA 1MBMA 3VXFH 1OP0A 2FOCA 1O33A 3RXGA 3Q76A 1OWKA 4I8HA 9ESTA 2EEKA 2J4IA 4I8KA 1K1NA 2XWBI 3H09A 3PWBA 5K0HA 3MO3A 1PQ7A 2A4GA 3BG4B 1FV9A 5FBIA 4UDWH 4FU7A 1O5BB 2A45B 2G8TA 3HGPA 4GLYA 1TMTH 1THSH 3ZVDA 1VZQH 3BTEE 1P2IA 2PSXA 2ZU1A 4NZLA 4XD7D 3ODFA 1LVBA 2A4RA 4X1PU 3TIUA 4X1RU 3O8DA 3Q77A 1MKWH 1XKBC 1EATA 2BB4A 2F9UA 3ATLA 1VGCB 1L1GA 2K1QA 3A7WA 3ZIAD 2G4UA 1P3EA 3KQEA 1SFIA 1O3HA 1P09A 4O3TA 3LGYA 4BTTB 1XUJA 5AVDA 4BAQB 1BZXE 3GDUA 4ISIH 4U30A 1PYTC 1BMFD 1H9LB 1NRQH 3T5FH 2TIOA 2RG3A 1TNHA 1A3BH 1DOJA 4FUBA 1SKYE 2J95A 3MH5A 3LH1A 4HTCH 2V7QD 4ZMAH 3LIWA 4WH8A 2P8OC 1NS3A 1O2RA 1XUKA 4VGCC 4WF8A 2OC0A 1KIGH 4DT4A 1O3EA 2W5EA 1QCPA 1K1MA 1B7XB 1Z6JH 3G01A 3M61U 4I31A 1MAXA 4NG9H 1XUFA 3AW0A 1YYY1 3A7VA 4NWKA 1QB1A 4MNYA 4XBDA 1P2MA 1K1IA 5EPNA 1TNJA 1A5HA 5GNDA 1GVKB 3TK5A 1RRKA 1QRWA 5T6DA 3AW1A 3MH6A 5E0GA 2JETC 4ZXXH 3RU4E 4GSOA 4ABEA 1F5KU 4JZDH 1ZRKA 2HRVA 2RDEA 2ZGJA 4XRNA 2P16A 3AVZA 1K1OA 1GJ9B 4JZFH 3UOPA 1C4Y2 2Y7ZA 3QTOH 4K8BA 2JKHA 4P00A 3TGIE 2Z7FE 3MTYA 5IDKA 4B6EA 1O5AB 2OBOA 3FP8E 4NIWA 3ZZDA 1C5ZB 1ARBA 3SQEE 4AG2A 2NU2E 1AE5A 1LPKB 2BY7X 4X2VA 4VGCB 1NC6A 4I8JA 2C4FH 2WZQA 1E1QD 3QX5H 2W6JD 5K7RA 2HNTC 3UWIA 1PFXC 3CP7A 1TBRH 3SZNA 1K1PA 3E16B 1W7XH 3B23B 1TBZH 1O2VA 4TY7A 1DVAH 3ZVEA 1P04A 1BTPA 4IC6A 2W26A 1PJPA 1IQJA 3M5LA 4NSYA 4JZIA 5HXFA 4AX9H 2QGRA 1VITF 1AGJA 1C2LA 3FAOA 5T1VA 1K1LA 2GCHF 2GDDA 1TGNA 2HNTF 6LPRA 8GCHG 1MBQA 1C1RA 2ZFFH 3TNTA 1CBWB 1LVMA 1S6LA 3FANA 4WWYA 5C1XA 3A8AA 4JYUH 2W6ID 1O2SA 1LHGH 3H5CB 1QR3E 4I86A 3ZZ9A 1AFEH 1O3FA 2H5DA 1BBRK 2ZFSA 2AERH 4Q2KA 3TH2H 1Y5AT 1NFUA 1W13U 1YCPM 3R0FA 1GJBB 3K2UA 1C5LH 1C1TA 1Q2WA 2BYAX 3E91A 2P8OB 1U6QA 1CA8B 3ATKA 4E7RG 5KEDA 3S9BA 1G3EA 4KKDA 1F0TA 3PMBB 1O32A 2BMGB 2ZCHP 1GJ7B 1EPTC 3ZYEA 1V6DA 3PO1B 1TGCA 1QB9A 1EOJA 2F9OA 2F43B 4J1YA 3FO8D 1OHHD 3VB6A 4K2YA 1MKXH 1TLDA 4A1TA 4AG1A 1P11E 1ARCA 5JB8S 2K8IA 3OSYA 3KL6A 4WJG2 1T31A 3I29A 3ENSB 5HIZA 2ZU3A 1D3DB 1WSSH 3U8RH 1ELEE 1O2ZA 1QB6A 4OGYA 1GI3A 1D3QB 4AFZA 3M3TA 1TWXB 3BEFB 5EXNA 2G00A 3S9CA 1O5DH 1O0DH 4AB9A 3V7TA 2OC8A 2ZTYA 4INLA 2B5TB 1EZUC 1HAZB 1SC8U 2K0QA 3ATIA 5EQRA 2JH5D 1O2LA 1K28D 1ZHMA 1DSUA 2IJOB 1V2WT 1W0YH 1SGIB 1UVOA 1ZOMA 5E2OA 1YLDA 1FY4A 2FDAA 1BQYA 1DT2A 2FTMA 4RT0A 3BSQA 2UWLA 1XMNB 3RU4T 4INHA 1V2NT 3DFJA 1SI5H 2OTVA 1BMAA 1O3PB 2FPZA 4GHQA 1W12U 1SGEE 3SJIA 1HJ8A 2VH0A 1C2DA 4MPUA 2P59A 1GI4A 1KXCA 3UFAA 4U32A 1SHYA 3DSPA 2J98B 4ZROA 2J92A 4AZ2B 1S0RA 2Y5GA 1GG6C 4LOYH 1QGFA 2QXGA 2HNTE 1Z1IA 3HATH 1V2UT 3MFJA 4CH2B 4WVPE 1Y3XA 4XBBA 2O8TA 1TALA 1W11U 1W0ZU 1YGCH 3GCHC 3LGWA 3QN7A 3UOUA 4YESB 3HPTB 4OS5A 3E90B 3Q3KA 4O9VA 1GBCA 2A4QA 1O3OA 1CT2E 4I8GA 1HAGE 5FHTA 1SLVB 3SV2H 2QF5A 2VIVA 4CHAB 4JZ1A 1GBFA 3GDVA 2KAIB 1ANEA 1MH0A 4AOQA 1ELVA 1HXFH 1ELCA 4FUFA 1ZLRA 4FUIA 1GL1A 2ALPA 3PYHA 1C1VH 2F3CE 4BAHB 3MU4A 4FETA 4CREA 1C5PA 2FIRH 8LPRA 3ATMA 5JYIA 1F2SE 1FPHH 1ELDE 3BN9A 3LGTA 1YKTA 4YLQH 1GBLA 4OS2A 3QGJA 2RA3A 2H9EH 3RXDA 1C5QA 1GMDG 3NKKA 1L2EA 3OFND 1QQUA 2V3MA 2PW8H 4X0WU 1NRRH 1TOCB 1WXRA 3F6UH 2ZP0H 4CRFA 4LK4A 1GJAB 1MABB 3DD2H 1YBWA 3BTDE 1QA0A 3RMNH 4AYYB 1QL8A 3PMAB 1H8ED 1Z7KA 1FI8A 1NY22 3PM3A 2G51A 5GCHG 2BLWA 5CMXH 2V6NA 2WINI 1LDTT 5DG6A 2R0KA 3W95A 2CK3D 2ANMH 1GJ6A 2AIQA 2DUCA 5DP3A 1IQEA 2BDGA 1HV7A 4ABFA 1OYQA 3P17H 1O2MA 1WTGH 2FI4E 3SU2A 4DG4A 1YPHC 1FN6A 3ZVAA 3ZZ7A 1IHTH 1V2RT 2GJGA 2M5TA 1T4VH 1NN6A
chains in the Genus database with same CATH topology
1D3PB 1GBHA 4A1XA 2ZKSA 5A0BA 4HZHA 6GCHF 1B0EA 1BB0B 2JH6D 3STJA 1SQAA 3U98H 1GDUA 5FCKA 1V2JT 3TJUA 2EI6A 3CS0A 2R2MB 1P05A 4MQAA 2GP9B 3S0NA 1N8OB 3BIVH 3K6YA 3SNEA 1A0LA 2BM2A 2BDBA 1BA8B 1HDTH 1UK3A 3VXEH 3M37A 2DE8A 3BF6H 2VU8E 1EAXA 1GI9B 2Z9GA 2PKAA 1GCTB 2VWNA 1C4V2 1RTFB 1BBRE 3URCA 2R0LA 2W3IA 3M5OA 2ZG0H 3FZZA 1P2QA 3ZV8A 3IWMA 1QJ1B 3ZZ8A 1IQFA 1P03A 3RMMH 1VJAU 2R3YA 5FCRA 4R0IA 1V2VT 3SJ9A 2GMTB 3SUEA 2PFEA 3PTBA 1BDAA 3TK6A 1V2KT 2DE9A 2FOFA 1HAOH 1SSXA 4ZAEA 4BXSA 1Y5UT 2ODPA 1UJ1A 1GI7B 2BQWB 1O2JA 2ZFRH 4ESTE 3A83A 4ZUHA 1C1UH 3A80A 1AVWA 2ZDLA 1S5SA 1O2YA 2V3HH 2ZHFH 3M36A 2R2WU 4B2BA 1QNJA 1NU9A 4X6MA 1YPHE 1RFNA 1O3MA 1EZQA 1B5GH 3TNSA 3SOSA 1C5XB 3M7TA 1UTMA 2BTCE 1V2LT 4XOJA 3SUDA 1DLEA 1GCTC 1RD3B 1ZPCA 3GY8A 3B8JA 2WPMS 1GVLA 1O3NA 4UEHH 4DJZB 5FPSA 1UHBB 2C8ZB 3U8TH 1ZMNA 5DP4A 4HI3A 3RXJA 2QAAA 1C2MA 2WPHS 3KCGH 2UUFB 3VB3A 1GI5A 3L3TA 1JWTA 1O5FH 2QC2A 4ZKOU 4DT7B 1C4U2 2D26C 3PO1C 3RXPA 1INCA 3F68H 2H5CA 5GWZA 1W10U 2VGCB 1ZTKA 2ZDMA 4PROA 4KTCA 4X2WA 3RXRA 3T27A 1GHYH 2ODQA 1ZGVA 1GJ5H 1SLUB 1Z71A 2BY9X 5EU8A 3RXAA 4D9QA 4I7YH 1C2GA 5TCAA 1TMUH 1EPTA 3FZDA 1ELTA 4ISLA 5L6NH 1ZJKA 1D9IA 1OP8A 1T32A 2HWLB 1KDQB 1L4DA 1RIWC 2VH6A 1OPHB 2VWOA 3MOCA 2FLRH 2RCEA 2VINA 2O8MA 2ZPQA 2FLBH 1WV7H 4Y79A 1GL0E 1O5CB 1XM1A 4BAOB 2F83A 4B74A 3AAUA 1WU1A 2EI7A 1JIMA 3UNRA 1EP5A 1E37B 2VWMA 2XBVA 1CGIE 1BHXF 1ZHPA 2ZEBA 5EQSA 4D76A 1UTLM 3C27B 4XFQA 1O2TA 2ZC9H 5JPMH 1TX7A 8GCHF 3TJNA 1G3CA 2XC0A 2ZU5A 7ESTE 2A5KA 1TIOA 1C1PA 2FOAA 4DW2U 1RTLA 2BD2A 5DP6A 4IMZA 3SORA 1NM6A 3ZYDA 1WYKA 3LDXH 4A1VA 5DGJA 1MTSA 4X1NU 1UTPA 1BIOA 2WPJS 1HAPH 1XUGA 4IBLH 2BZAA 4ISNA 3ESTA 3RXOA 3ZVGA 1A3EH 1NROH 1S85A 5HM2A 1C5SA 2BY6X 1XKAC 3MH4A 1RJXB 1ZPBA 1CA0C 1D6WA 3K9XB 1CGHA 1GBMA 2ZPRA 2SNVA 2ZQ2A 2ILNA 3P8NA 1GHAF 5ESTE 1TPPA 2BVXH 3ELAH 4CHAC 3BTQE 3UPEA 3LC3A 5HGGA 2ZHQH 1EKBB 4KP0A 1MTVA 2UWOA 1ZGIA 2AGIX 3HK3B 1XXDA 1YPLH 1GBAA 3SU4A 1L1JA 3ODDA 2R9PA 3GICB 1HAYB 3BG8A 1DY8A 2FMJA 1VCWA 3A84A 3EDXB 1KLJH 6CHAB 3UTUH 2GV6A 1CT4E 1S83A 1SG8B 2VIWA 1LPZB 2ZFPH 2G5NA 1EZSC 1T8MA 5ESBA 3RXTA 2PGBB 4IN1A 5F6MA 1NPMA 4FUJA 1B0FA 4TYDA 2G55A 2HVXA 4NA8A 3TVJB 3TK9A 2A31A 3MU0A 3SGBE 1AFQB 3RXMA 3TLOA 2H1UA 1FIZA 3BG4C 3EYDA 2ZO3H 3F1SB 1O3JA 4ZKNU 3SW2B 1ZSKA 2ZECA 2C90B 1ZRBA 1O2UA 4X2XA 2J38A 3QDZB 3UIRA 1TNIA 2OXSA 3M7QA 2Z94A 1DUAA 1EUFA 1Z6EA 2VVCA 4YOIA 3P8FA 5BRRE 3JZ2B 5FX6A 3T26A 4JMYA 4GCHF 1UMAH 4A92A 3SV7A 2FI3E 1OKXA 2PTCE 5IYTA 3F9FA 3S7KB 1G2MA 1TB6H 2UUYA 3M5NA 4ISOA 4GAWA 1CVWH 1YCPK 2J34A 2TBSA 3E3TA 5SGAE 1YLCA 3MNXA 4MNVA 1BTWA 1KXDA 5EW2H 1LKAA 2XWAA 1Z8JB 1ELAA 1QBVH 4NGAH 1BTUA 3SHCH 3T29A 2VGCC 3ZVCA 4DY7B 5LPFA 1UVPA 1ZMLA 1JBUH 2VIPA 1SOTA 1QJ7B 1AUJA 2SGFE 3ZZ5A 4E06H 5CE1A 1VITH 5LPEA 1WBGB 2G52A 2PHBA 3A89A 3EQ0H 1G2LA 3SGQE 2QN5T 3RMOH 1MMJN 1NZQH 5JBBS 2ZDKA 3S9AA 1QJ6B 1BTHH 4TPIZ 3UNSA 1A0JA 1OP2A 1AWHB 3EA8A 1J8AA 2G5VA 3RDZA 4DGJA 4MPXA 4RN6A 2F91A 2IN2A 3RXEA 4I33A 2FODA 4CRGA 3UREA 4AYVB 2Z6BD 2GD4B 3GYLB 4Y76A 4UONA 1RTKA 1NT1A 4K1SA 3SNCA 4FUGA 1DICA 3RXUA 5ETXA 1OWIA 3TITA 1JMOH 1OWDA 3V12A 1GDQA 2Y82A 1X7AC 4WH6A 1AFQC 2UWPA 3MH7A 2A0QB 3SBKA 3RXBA 1H4WA 1WTHD 2CHAC 2ANKH 4AN7A 1TQ0B 2BLQA 1H1BA 1KLIH 2P94A 3PTNA 1G37A 1TNKA 2J94A 1H8IH 1E35B 1WQSA 1CHOG 2SGPE 4JZEH 3SJOA 5EPYA 2A5IA 3E6PH 3M7UA 3VB7A 1BRAA 1A61H 1OSSA 3MU8A 1QA7A 1N8OC 1G3DA 2TGDA 1FUJA 3A85A 3MNBA 5AF9H 4WMFA 2OC7A 1EP6A 3QLPH 1DUEA 2V0BA 4AORA 1BMMH 2TPIZ 1EAIA 2ZGCA 1LHDH 4Y10E 2AGEX 4JK6A 1HAIH 1LTOA 1ELBA 1SGFG 2ZI2H 3A8CA 2BDIA 3ZZ6A 2XRCA 4BTIB 1C1WH 4BTUB 2FX6A 1AD8H 1LVYA 1VITG 1GI0A 2HALA 1V2TT 4KGAA 2QXIA 4YTAA 1BT7A 1E34B 1A5GH 2ZDAH 4CRCA 3F9GA 5JBCS 4H4FA 3RXLA 2PLXA 3LGUA 1P2JA 3MU5A 1AQ7A 1ZJDA 1O2KA 3BTWE 1MTUA 2AMPA 3KHVA 3PLBA 3RC5A 2BOKA 4A7IB 2FX4A 1P06A 4KTSA 1TBQH 5E8EH 1A2CH 1EJNA 1EZXC 1ZHRA 4IMQA 4ABAA 1Z8GA 1SBWA 3LONA 3I77A 3NZIA 3IG6B 1NFWA 2FOEA 1HAVB 1BOQA 3A8DA 1S82A 3NCLA 5DKMA 4OS7A 1O3DA 2WYGA 2H6MA 3FP6E 1G3BA 3ZZAA 2WV4A 2FI5E 3MWIU 1OOKB 2OUAA 3QK1A 2BQ7B 1TX6A 3GCNA 1SGPE 4AGJA 5A2MH 3U8OH 2F9NA 1Y5BT 4K3JA 2D1JA 5GIBA 3RXIA 2Z9IA 3R3GB 4NIVA 5CHAB 1HBTH 2Z3CA 1H9HE 4NIYA 4YOGA 5HYOA 2ZHDA 1A0HB 4O03A 1GJ8B 1TFXA 3BTFE 1O37A 3MNSA 7GCHG 1CA0B 1QFKH 3E0PB 1RGQA 1TNLA 1WUNH 2A1DB 2FOBA 1DXPA 1FONA 4JK5A 1P8VC 1LQEA 1ANDA 1RXPA 4XBCA 1GMHG 1C2JA 4KTUA 5A8ZA 1EQ9A 4Y0YE 3ZZBA 2BHGA 1P02A 1QL9A 3DT0H 5T6GA 3VGCC 1FAXA 4ABDA 2HOBA 3QWCH 3SU0A 4B1TA 1AVGH 1FQ3A 1ANCA 3NUMA 2Q6DA 1GHXH 4H42U 1GGDB 1MUEB 3QUMP 1W3CA 2W7SA 4CBNA 3SUGA 1Q31A 1YP9A 3GY4A 5DP7A 1SGFA 5E0JA 5L2ZH 1XVOA 3P8GA 4Y6DA 3RLWH 4HFPB 1FN8A 2SNWA 2GCHG 4OS1A 1BITA 1L0ZA 2BQ6B 1MZDA 1MQ5A 1P9SA 1H8DH 2CF9H 1SQOA 3M35A 1VCPA 8ESTE 1YPKH 1UK2A 2FESH 4IC5A 1O35A 1PQ8A 3GY3A 3V0XA 3MYWA 1P0SH 1SR5C 2FYQA 1XX9A 5JDUB 2ODYB 1P10A 1HAVA 1AE8H 2YOLA 4ISHH 1TGTA 3SUFA 2OP9A 3OX7U 1GJCB 5C3NA 1IHSH 1K9OE 1BUIA 2GX4A 1CE5A 4F49A 1BTYA 1Y3YA 1O3KA 1ZMJA 3IITA 4ZHLU 1K21H 2CF8H 1QL7A 1C9PA 1FNIA 5TJXA 3FVFB 1T8LA 4U2WA 4BANB 2C8WB 1VJ9U 2VNTA 2CHAB 1UCYH 3LH3A 1C2HA 1CSOE 1TPSA 1V3XA 3SNDA 1O39A 1K2I1 4WMEA 3SV9A 3LJJA 1LVOA 4ABBA 3S7HB 3PB1E 1SGRE 3GY5A 5HMAA 1UO6A 1UTKA 2YNAA 2QF3A 1NTPA 1SGCA 2XCNA 1TA2A 3EE0B 3BEIB 3P6ZB 4XDEA 4AB8A 2XYAA 1C5NH 1G30B 4DURA 2CGAA 4CR9A 2PGQB 3PMHB 3S69A 3DHKH 4JCNA 2ZCKP 2QV1A 4KELA 1GHZA 1AN1E 1TRNA 1P9UA 1V2PT 1C1NA 5FPTA 3PWCA 2FM2A 3Q3XA 2Z9LA 1RS0A 3VGCB 2CV3A 1CT0E 4FUCA 1QIXB 4ZXYH 3I78A 1LQDB 2XBXA 2PKAB 2PSYA 3LT3A 2OBQA 1WCZA 1GGDC 3N7OA 1C2IA 5FAHA 5F8XA 3NWUA 2FEQH 2XC4A 5GJ4B 1AMHA 2SGEE 3D49H 3SU1A 1CGJE 5ABWA 4B76A 3LJOA 5A0AE 4ASHA 4TWWA 3SNAA 4Y8ZA 3GYMA 4X8TH 1HAHH 1T7CA 1SLWB 1S81A 1UCYK 4BOHA 1KXBA 3TH4H 1CBWC 1FY8E 3KNXA 4ZH8A 1Z1JA 3FP7E 2XC5A 4MTBA 2O9QA 1HFDA 1GHVH 2QF0A 5F03A 3SU3A 3E1XB 1EX3A 5DP9A 1TAWA 4INKA 5HM9A 1KYNA 1C1OA 2XBWA 1TOMH 2ZZUH 1FY3A 3UQVA 4F4OC 3D23A 1G9IE 4CRBA 2D2DA 1BRUP 3BTGE 1KXFA 3KIDU 4H6SB 1SMFE 2NWNA 1AUTC 4CH8B 3D62A 3UQOA 2GCTC 1DSTA 2ANYA 1FZZA 4WXIA 3TJOA 4UFFH 1ABJH 2ZTXA 3U9AH 1GHWH 2WUCA 1NU7B 1HYLA 1F92A 5FXLA 2ZDNA 1K22H 4FUEA 2Q6FA 2F9BH 1CU1A 1Z8RA 2P3UB 1QBNA 3KQDA 3BEUA 2P93A 1P2NA 5C67A 3RXFA 1FLEE 2PTNA 4X8SH 1EB1H 1P57B 2BDAA 1C5OH 1A4WH 2KAIA 3A7ZA 3U1JB 4E05H 3MHWU 4FUDA 2HPQH 2ZGHA 3BIUH 4IS5A 1IQGA 4NA9H 1E36B 7LPRA 3KQBA 2V3OH 4FVBA 2I6QA 2RA0A 1DXWA 3NXPA 2PKSC 2ZHEH 1S0QA 2GKVE 1UVTH 2GCTB 1C2EA 1KTSB 2C8XB 1HGTH 3CS7A 1ANBA 1IQIA 1BJVA 1A1RA 5JB9S 5FPYA 3C1KA 3GY6A 1Y59T 2ZQ1A 2FP7B 2UUKB 3KF2A 6GCHG 4GVUA 3SU6A 3MNCA 1O31A 1THRH 4U01A 1C5WB 4HGCA 3E0NB 4JYVH 4RKOB 1ELGA 4DIHH 2WPKS 1P12E 1QRXA 4QT8C 2B0FA 1HLTH 1VCQA 1F0SA 1GBIA 4YZUA 9LPRA 1MD8A 1QHRB 2TGPZ 1XUHA 1A46H 1F0UA 1W2KH 2A32A 4I32A 1ZYOA 5EGMA 1KXAA 2B8OH 1MQ6A 1MTNC 3RXHA 4BXWA 1THPB 4ABJA 4GPGA 1Y3WA 4X6OA 1GWAA 2ZWLH 1XVMA 3EGKH 1LMWB 1O2GH 4NWLA 4Y8YA 2PV9B 3LU9B 1AHTH 2QY0B 1HB0B 1GBEA 1GBBA 3ATWA 2GDEH 1F7ZA 4AFSA 2OQUA 3AAVA 4LXBH 1OWJA 1J16A 1DWCH 4IN2A 1O2PA 4ZHMU 1Y3UA 2FXRA 2ZU2A 5PTPA 2A2XH 2ESTE 1MU6B 4MLFB 2BXUH 1ZTJA 1SGQE 1IQMA 1OYTH 1CO7E 2GV7A 1GMDF 2V35A 2ZFTA 2PR3A 3E8LA 3OY5U 1SPJA 2BX3A 1JRTA 5G4BA 1GI8B 2QCYA 2GMTC 4MDSA 3LKWA 1SGTA 4ABHA 1QURH 1N6YA 1GVZA 1SLXB 2BLVA 3MI4A 3ZZCA 2VIQA 1UVUH 3RC4A 5DP8A 4ZKRU 2ZPSA 3TPIZ 2NU4E 5GDSH 1D6RA 1HXEH 2VIDA 2SGQE 5JBTA 2WPIS 4I8LA 1BRBE 3SV8A 3STIA 1TABE 1TA6A 4AFUA 2OD3B 4AFQA 1PQ5A 4IW4E 4K69A 1G36A 4M7GA 3RXSA 2Q1JA 1FMGA 1IOEA 4NA7A 3TU7H 1OS8A 2VVUA 4YOJA 2C93B 1GJ4H 1QBOA 4Y0ZE 1HUTH 1AO5A 2ZDVH 1SFQB 4WXVA 3KQCA 4FU8A 4LZ4B 2Y80A 2CMYA 3P8OA 2VB0A 1J17T 3PLPA 4YT7H 1HNEE 2WYJA 1BMNH 2W3KA 1MTWA 1GCDA 3O8CA 4NCYA 2PUQH 3TH3H 1MCTA 4MNXA 4Q80A 3NK8A 4RSPA 5AFZH 2BZ6H 1LO6A 1HIAB 2TGAA 1V2MT 4MPVA 1PPGE 3HKJB 2P3FH 2PUXB 2XW9A 1QTFA 3HGNA 2THFB 2ANWA 4TPYA 1UTOA 5T3HA 1O2IA 4FXGH 1FY1A 2AFQB 3OU0<