4JK5A

Human urokinase-type plasminogen activator (upa) in complex with a bicyclic peptide inhibitor (uk18-d-ser)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator
publication title Improving binding affinity and stability of Peptide ligands by substituting glycines with d-amino acids.
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2013-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4jk5A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4jk5A01
1GI6A 1EQ9A 1O35A 5A2MH 2GT7A 1NN6A 4MG3A 1HLTH 1DLKB 4KKDA 1DS2E 5A0BA 4MPXA 3CS0A 3SZNA 1O5BB 3GCNA 5JBTA 2ZECA 1FAKH 1OYQA 2J9NA 1DXWA 2GZ9A 2QV1A 1TPPA 1AZ8A 1CHGA 4OS6A 4A1TA 1MCTA 1UTKA 3T5FH 4AGKA 4B2AA 1QJ7B 1BIOA 2HWLB 2ZGXH 5E2PA 3NKKA 3OSYA 2ZGJA 1G3EA 3UOUA 2FYRA 1MH0A 1C1NA 5DP3A 4DG4A 1GI4A 1EXFA 3A8BA 2BQWB 1SVPA 2BLWA 3PWCA 2A2QH 3ATKA 1Q31A 4D76A 1XKAC 1SFIA 1IQLA 3DFJA 2J2UA 1FAXA 2ODYB 1EAUA 3PV4A 1BT7A 4A1XA 1C2DA 1K9OE 1B0EA 1FN6A 4U32A 2GDDA 1C5XB 2Y7XA 1GI1A 1PPCE 1ZJKA 2FLBH 1HV7A 3GY4A 5IYTA 2FWWA 2HGTH 4LOYH 2UWLA 3SUEA 3RXHA 1K28D 3PMAB 2HPPH 1AMHA 1T8LA 1ZPBA 3T28A 5SGAE 1GPZA 3MNSA 4YOIA 3VFEA 2H9TH 1ETTH 2PSYA 3DT0H 1C5ZB 1MU8B 1XUKA 4ZHMU 1MKXH 2TBSA 1P3CA 2UWPA 1K1OA 1TGBA 1U6QA 2G4TA 1KXAA 4LK4A 2BXTH 3RC5A 1ANCA 1XUFA 1UK2A 1ZHPA 2CN0H 2QXHA 3SV9A 1VGCC 2Q6FA 2ZIQH 2A4OA 1C2LA 1LHGH 1K1JA 3E91A 1FONA 1O3KA 1P9SA 3FP8E 3P92A 3QGNB 5HYOA 2OC1A 1GJDB 4FUEA 1Q3XA 1RTKA 4K1EA 1A46H 7GCHF 3BIUH 3GY7A 2LPRA 3KL6A 3TJOA 1NU7B 4INLA 3SUGA 4NFFA 1CBWC 8LPRA 4AN7A 1O3HA 3M3TA 1L1GA 2NU1E 1C1WH 1OSSA 2BLVA 3A83A 4UFDH 3CP7A 3QZRA 4BXWA 3OY5U 2CF8H 3KCGH 3SGBE 4IMQA 2XBWA 2QF0A 3ZZ8A 1TALA 2VU8E 3ZZ4A 1ZSLA 3GDUA 1TWXB 2QCYA 1SGEE 4H42U 4ABHA 1F5RA 1HJAB 5T6GA 1KXBA 5A8ZA 2YNBA 5EXMA 2VIDA 1O3IA 3TH3H 4X2WA 1FV9A 1N8OB 2BY7X 2M5TA 3M61U 3RC4A 5A09A 5C3NA 2GGVB 3EE0B 1BRBE 1CQQA 1BMNH 1QCPA 5H4IB 1V2WT 3SU0A 2F3CE 1P57B 3UFAA 5LPRA 1FPHH 1CGHA 1OPHB 4O9VA 4WJG2 3RXGA 3E8LA 4UFEH 4ABBA 1C5NH 2FOFA 1MKWH 2RCEA 2ZGBH 1EJMA 2XBYA 2WUBA 1C4Y2 2R3UA 4ABDA 1PPEE 1QL8A 1Y5AT 4JYUH 1BTUA 5GIBA 1MD8A 1ZYOA 2F83A 3P17H 1GBFA 1GJAB 1YBWA 5ABWA 2BVRH 1ELDE 1HCGA 4DT7B 3QDZB 2F9VA 1MCVA 1QJ6B 3RMOH 2CXVA 1EAIA 1LHEH 1H8IH 1W7XH 4FUBA 1GDUA 3SUFA 4B74A 1EB1H 1CGJE 1GCTB 4X8TH 3VGCB 1O5CB 2ZU3A 4Q2KA 3A82A 3BSQA 1S83A 2ODQA 3BTFE 3LGYA 1BRUP 1Y3VA 2ZTXA 3KNXA 1GVZA 2A32A 1TX6A 1ZTJA 1BJUA 1SGCA 3GY6A 3SW2B 3RXIA 3V0XA 1X7AC 3PROA 3VPKA 3PB1E 3S69A 1FIZA 5C5OA 1L1JA 4Y8XA 4ABIA 3P95A 1SOZA 3R0FA 4FUCA 1G3CA 1GJ6A 5GCHF 4ISIH 4NFEA 4BAQB 4UE7H 2AMPA 2CHAB 1TNIA 1JWTA 1TNHA 2V0BA 4CR9A 3TGJE 3F9FA 4UONA 4FU7A 2BX3A 3G01A 1UHBB 3K9XB 2PUQH 3ZZ6A 1O30A 4IS5A 1TMUH 4ISNA 2BVSH 4Y10E 2BDGA 5I46H 1DITH 2ZG0H 2PWXA 1PPGE 2G8TA 2D1JA 4U30A 1P9UA 5EGMA 2CV3A 3M5MA 4MNWA 5EQQA 4HI3A 2AEIH 5EQSA 1TA6A 2FI5E 4NA8A 3RXRA 3MU4A 1KTTB 1QB6A 1KXCA 1HUTH 1VJAU 3MH5A 1GJ9B 3MTYA 1XUIA 4NIXA 4RKJB 3LU9B 1KLJH 3HKIB 2QAAA 4MTBA 3RXTA 4TWWA 1SPJA 3U8OH 2OQ5A 1O38A 1GBBA 2SFAA 1Y3XA 3FANA 3SV2H 2C8XB 1UHBA 2PUXB 2VVCA 3PMBB 3MMGA 3PTBA 5C20A 1RXPA 2AIQA 1O2QA 4CR5A 2Y5GA 2BLOA 3RXEA 4XSKU 1W11U 2RA3A 5GPIB 1DSTA 4AOQA 1FIWA 1W0ZU 2ZDKA 4K3JA 3V13A 4Y6DA 1AFQB 1O2KA 2J34A 4WWYA 1GHVH 2A4QA 2BTCE 1QIXB 5EPNA 2VIOA 3FP6E 1MBMA 3TJUA 2TIOA 1GBJA 1QJ1B 1B0FA 2H5DA 1ETSH 3RXOA 2ANMH 1ARCA 1ZHMA 1UK4A 4BNRA 3SUDA 1THSH 4GVUA 3DFLA 2VIWA 4BAOB 4BTIB 2STAE 1Z6JH 3SQHE 1DANH 1OKXA 1OWHA 2OCVB 2G5VA 1LCYA 4ESTE 4IC5A 1A3EH 2H5CA 1ELTA 1FDPA 4KELA 1TRYA 1UO6A 3CENA 3KIDU 2BDYA 3A80A 2FOGA 3T27A 3SORA 1ABIH 5CMXH 1SGYE 1CHOG 2Z3EA 3A7ZA 1GVKB 2ZI2H 3SU6A 1AVWA 4YOGA 1O2WA 3PTNA 1O31A 4DGJA 1O2NA 2TGPZ 1TPSA 3A85A 3GCTF 1EPTB 3E6PH 3GYMA 1F0TA 2IJOB 1FZZA 4NCYA 2GZ8A 1DX5M 1GCTC 2WPLS 3GDVA 3VGCC 1GMDG 1KIGH 1BHXB 2FESH 4YT7H 2SGEE 3QK1A 4UFFH 3ATLA 2HALA 4XFQA 5HGGA 1RRKA 2PGBB 1L0ZA 1N1LA 1HXEH 1PFXC 2FPZA 4K60A 1K21H 1N6YA 2P3FH 5EQRA 1ANDA 3RM2H 2CHAC 1O5FH 9ESTA 4X1QU 2R0LA 3AW0A 4XDEA 1P02A 3H7OA 3M7UA 5C2ZA 2XNIA 4E05H 3T26A 5TJXA 2ILNA 2PGQB 3M36A 4XBCA 3FAOA 1CHOF 5EW2H 1YPGH 1T7CA 4ZHLU 1K1NA 1BB0B 1PQ5A 3A88A 1KXEA 1YKTA 2KAIB 1NRPH 3LJJA 1UVPA 2AIPA 1C2HA 1KXFA 3C27B 1DLEA 9LPRA 2ODPA 3GISB 1BQYA 1DXPA 4U2WA 1NESE 2D8WA 4X6PA 2Y81A 1BTPA 1XX9A 1TBQH 2WV4A 2BD9A 2H6MA 5F8TA 2J94A 1ELAA 1YPLH 1C4V2 1A0LA 3RU4E 1AU8A 1QTFA 1ZSJA 2ZO3H 2ZKSA 5AFZH 1JRSA 1ETRH 1SGIB 2R2WU 1W10U 1LQDB 2C4FH 4DW2U 2KAIA 1P11E 4NIVA 1O5AB 1OYTH 5JBAS 4ISHH 5JPMH 5FBIA 1TB6H 3M37A 3Q77A 1GHXH 1IAUA 1D3PB 3PM3A 4FU9A 1AFQC 3QX5H 4Y8YA 1QY6A 1QFKH 4CBOA 1C5SA 3ELAH 3S7KB 1FY5A 1HAOH 1ARBA 1UVTH 2ZDAH 4B75A 1WOFA 1YPMH 2G55A 2UUKB 2B9LA 2VGCB 3GCOA 3MNCA 3MU1A 2WPJS 3QGJA 2G00A 2PTNA 1AB9B 2BD4A 2AGEX 3P8NA 1GWAA 3ZVFA 2BQ7B 3ODDA 2AGGX 2A45B 1TX7A 3F68H 1PPZA 1DWDH 3LPRA 1RTFB 1GI9B 1OP0A 4ZKSU 4WVPE 2VIVA 1T8OA 4Z0KA 5DP4A 3W94A 5B6OA 1K1MA 1TGTA 1F7ZA 5J4SA 4ZH8A 2SNWA 3SN8A 5JB9S 1Z8RA 4FUIA 3PLBA 1GBMA 2SGFE 1TFXA 1ESBA 1GMCG 1J8AA 2WPIS 4GHTA 4IGDA 5DP9A 3H5CB 1D6RA 3OX7U 3A8CA 4FVBA 1ELFA 4KTUA 1L1NA 1VITF 1AUTC 2W7UA 4MPUA 1KDQB 3BTDE 4YLUA 2VB0A 3E0PB 4K69A 1NY22 5JBCS 3RXBA 4I8HA 1PQ8A 1TABE 2RA0A 2BD5A 1WCZA 4K2YA 6GCHG 2AFQB 3RC6A 3SJOA 3A7WA 1O2UA 1GI2A 4XBBA 4O3TA 1C1QA 1BBRE 1FY3A 4AYYB 1S6FA 1O3MA 1VR1H 2VIQA 3QZQA 6ESTA 2Z9IA 2FOCA 3UQVA 4IBLH 3ZVBA 5BRRE 1QA0A 4FUHA 1O3NA 1C5QA 2B8OH 3GY3A 1O3DA 1IQKA 3SJIA 1MBQA 1HAVA 2XWBI 1YPJH 3BF6H 1KDQA 1QHRB 2ZHDA 3EA7A 3RXMA 4WH8A 2GV7A 1NPMA 3TK5A 2A7HA 4CRBA 2XWAA 2VWNA 2ZHFH 1GMCF 4BAMB 4AFUA 3TVJB 2QN5T 1LKAA 3GCHB 1TGCA 1AQ7A 2Y82A 5E2OA 1FQ3A 4YESB 2PHBA 3EYDA 4X1NU 1AY6H 4MNXA 2F91A 2P3UB 3EQ0H 1Z7KA 4DIIH 1LVOA 3L6PA 1S6HA 3EA8A 1V2TT 3U9AH 2BY6X 3LKWA 2FTMA 3E0NB 1HYLA 1EP6A 1ZR0A 1TMTH 1S85A 2AMQA 4X8UH 4K1TA 4J1YA 1NROH 1PYTC 4Y8ZA 2BZ6H 1C1SA 3U98H 1AVGH 2ALVA 1FMGA 3BV9B 1BHXF 2ASUB 1SGTA 1FUJA 1W14U 5FCRA 2ZU1A 3BG8A 1S84A 2OD3B 1D3DB 1QR3E 1O36A 5E0GA 2PW8H 1LHCH 2WPMS 4WF8A 3ZZ7A 1WAYB 2W5EA 1P09A 2A1DB 2ZGHA 3F6UH 5EPYA 3W95A 4DJZB 3TU7H 3SU4A 5DG6A 2ZWLH 8GCHF 3S9CA 3SGAE 1MAYA 1XVOA 1DOJA 4IN2A 1TA2A 4MVNA 1BTYA 2CGAA 4H6SB 1TRNA 2SGPE 3UR6A 2ULLA 3K6YA 1J14A 5GXPA 3BEIB 1EAXA 1AIXH 3LGIA 3DA9B 4YM9A 3MWIU 2GZ7A 5T6FA 4CRAA 1TGSZ 1WV7H 1ZJDA 2F9NA 1AB9C 1UTQA 1LQEA 1DT2A 5GDSH 2Y5FA 1DWBH 4HZHA 2W26A 3JZ2B 2O8WA 5J4QA 1JIRA 4X1PU 1O3JA 1O5EH 5E8EH 3TK9A 3U1JB 3HATH 1THRH 3BIVH 1BMAA 5FX6A 1NRSH 2FOAA 3BTME 2O8TA 1HNEE 5L6NH 2B7DH 1UK3A 2A5AA 1MTNB 5T3HA 4RN6A 2P3TB 2G4UA 4FXGH 1MQ5A 4X6MA 1NRQH 1NS3A 1OWIA 4UD9H 1HJ9A 3A81A 2V35A 3NZIA 1QBNA 1W12U 5L30H 3GDSA 1LPZB 3TNSA 1O3GA 1RD3B 4CH8B 1A61H 1PPFE 1XM1A 2WUCA 3QUMP 1FNIA 3KHVA 2F9OA 1IHSH 1V2RT 1ZTLA 1AVXA 1P04A 3RXUA 4AB9A 2P93A 2CF9H 3P8OA 1GHYH 2H1UA 1QRWA 3MO6A 2VIPA 1CT2E 2EA3A 1C2GA 1Y3WA 1VCWA 4JZFH 2GMTB 3UNSA 3E1XB 1QL7A 4OS5A 1JRTA 1S81A 1Z1IA 4Y7BA 1B7XB 1BJVA 4X0WU 1ZPZA 2C3SA 4NZQA 2A5IA 3M35A 5EW1H 1XXDA 1MZAA 1O39A 1V2LT 1GJBB 4AZ2B 4MPVA 1O2PA 1GI0A 4E7NA 5EOKA 1YPHE 2EI6A 2QIQA 1GJ8B 2FOMB 1TQ0B 3MOCA 2J95A 4YO9A 1MAXA 2JKHA 3E16B 2VNTA 2Z9GA 3Q00A 1WYKA 3GOVB 3OY6U 1C5RA 1C5VA 1ELCA 1V2JT 3GCHC 1RGQA 2R0KA 2FI3E 7ESTE 3KF2A 1SHYA 2YOLA 4IC6A 5AFYH 2JH6D 3RXPA 1ESTA 3T29A 1ZPCA 1E38B 2HOBA 3STJA 1SR5C 1C2KA 4AG1A 3NPSA 1E34B 4I8GA 4I8KA 1IHTH 3MH7A 3A7TA 2O8UA 4FUJA 2H9EH 3FZZA 4WXIA 3L33A 2Y80A 1V2PT 1ELGA 1DPOA 1BITA 1VITH 1ZMNA 2PV9B 1XXFA 1Q2WA 5DKMA 4YLQH 4ZXXH 1B5GH 1OS8A 1W13U 2B0FA 2EC9H 5F8XA 4F4OC 3IG6B 2XC5A 3HK6B 4B1TA 1SGFG 5BPEA 1S0QA 5F8ZA 1Z8IB 4X6NA 1EX3A 1C1TA 2FOBA 2RG3A 1NRRH 1AI8H 1P8VC 2H9HA 2GTBA 4B73A 1WQSA 3UUZA 4MDSA 1K1LA 5C67A 1A2CH 1YCPM 1EOLA 4Q80A 2ZFSA 3U1IB 2ZU2A 5LPFA 1ZRBA 4D7GA 3SNDA 2OC0A 3S7HB 1G3BA 3MH6A 1AKSB 4XBDA 2PLXA 3SNAA 3ZZCA 2CJIA 4GCHG 1C5PA 2XW9A 1LHDH 4NSYA 3SO3A 5I25A 2TGDA 2Z9LA 1SGRE 3MH4A 1HAZB 1O3CA 1BBRK 2BM2A 1UVOA 4YT6H 2GX4A 4OS7A 2BZAA 4O03A 1EB2A 1C5OH 1CU1A 4BAKB 2ZF0H 4AX9H 5LPEA 1SLVB 3GYLB 1N6XA 1O0DH 2ZZUH 3VB5A 4MNVA 3AASA 1C1OA 2ZP0H 2P59A 3ATMA 1CGIE 2ZHEH 3QWCH 2QGRA 3RMMH 1G2LA 4A1VA 3ITIA 4WMDA 3EGKH 2OBQA 4ISOA 3TH2H 3B8JA 2YNAA 4JK5A 1XUHA 2ZCKP 3B23B 2JH0D 1G9IE 4JZDH 1BTHH 2Z94A 3M3SA 4XOJA 2GMTC 5A8YA 1O2TA 1SOTA 1J9CH 2TPIZ 3RXSA 1EP5A 1AFEH 4GSOA 1V6DA 1O3EA 4FUFA 6LPRA 1HXFH 3H7TA 1A7SA 2FXRA 3LOXA 1TOMH 5E0JA 2XCFA 4TYDA 2BYAX 2AS9A 1AO5A 1TX8A 1HJAC 1G30B 2WPHS 1ABJH 1YPHC 2BOHB 4H6TA 4FVDA 1BRCE 2XBXA 5EXLA 2D26C 1N8OC 5CE1A 4JZEH 1XVMA 1CE5A 2GVFA 1RIWB 2NU0E 3HGPA 5LH8A 3MI4A 1O3FA 4SGAE 3SNCA 1GI3A 1P2IA 3DUXH 1O2RA 1GG6B 1EZSC 1CT4E 1SLUB 3LGUA 3RM0H 1J15A 3PMJA 1P0SH 3V3MA 4WMEA 4Y76A 4Q7YA 2TGAA 4UFGH 2AH4X 1GJ7B 3OU0A 2BDAA 5FPYA 4OGYA 1ID5H 1EZXC 2Q6DA 1HRTH 4GAWA 1FY1A 3VXFH 3P70B 1SLXB 3S0NA 1BZXE 1SGQE 5FCKA 1UTJA 1P05A 2WYJA 4Y7AA 1IQEA 4BOHA 2BD7A 4LZ4B 4ABAA 1ZRKA 3VB4A 1ZOMA 1A5IA 1EJAA 4M7GA 3QN7A 5FBEA 2NWNA 2DE8A 2W3IA 4UEHH 5F6MA 4CRDA 1O33A 1DFPA 3RXVA 1C2JA 3KQBA 1T8MA 3IWMA 3UIRA 2ZPQA 3QO6A 3A7VA 3PMHB 3KQCA 1JBUH 1L4ZA 2XBVA 4AYVB 3STIA 1OWKA 1AWFH 2WPKS 3SU1A 1Y59T 3MO3A 3RDZA 1P2MA 3GY8A 3ZZ5A 3FP7E 5FX5A 3O8BA 2GP9B 2A7JA 4JYTA 3V7TA 1O2YA 5HMAA 1YYY1 4X6OA 1C2MA 1KLIH 1OP8A 3MHWU 4NGAH 3UR9A 4ISLA 3EA9A 5DP8A 1GJ5H 4BTTB 4MQAA 1ORFA 4X2YA 3L3TA 2VH0A 2ZTYA 1PYTD 1EPTA 4INKA 3RU4D 2BQ6B 3JZ1B 5C1XA 3MU0A 3TGKE 3RXJA 2FM2A 3AAVA 1MTUA 1QRZA 2G52A 4HGCA 4TWYA 5HXFA 5E0HA 4WH6A 1O2LA 1NFXA 4QT8C 1ZLRA 1IQJA 1D3TB 4KGAA 1Y8TA 5EXNA 2FMJA 1D6WA 1T31A 1NO9H 3F1SB 2HPQH 1A5GH 1HFDA 1GMDF 1HPGA 1VZQH 1C1VH 3P8FA 1UMAH 3RLWH 3D23A 4I33A 1GL1A 3K2UA 5A8XA 1GI5A 2ZFTA 1LDTT 2RDLA 4ZHAA 3CS7A 4Y0YE 1Z8JB 1ELVA 3TJVA 1A1RA 1CSOE 1L2EA 2QXGA 4I31A 1V2MT 1BBRH 3M5OA 1DY8A 1Y5BT 4AFSA 3PLPA 2G51A 3ESTA 3MU5A 4IW4E 3A7YA 1W7GH 2F9UA 2FP7B 4NWKA 1TQ7B 4B76A 3A87A 3BTTE 3AW1A 2FTLE 3ATWA 4K1SA 1EZUC 2ZPRA 1RFNA 5TCAA 1TLDA 1GMHG 4Q7XA 1XKBC 4DOQA 1QQUA 1ACBE 2THFB 2FIRH 2ZFPH 4ABEA 1YLDA 4DY7B 2ZFQH 2EI7A 1V2UT 2ZPSA 4MPWA 1LVMA 1MTWA 2R9PA 2ZDVH 4ZKRU 1SG8B 1SQOA 1SFQB 2XYAA 4R8TB 2F9PA 2O8LA 3ZVAA 1BCUH 1GG6C 5L2YH 1S0RA 2GCHG 1WBGB 2K1QA 1V2KT 2I6SA 4B71A 2P95A 1IQNA 1C5WB 1GBLA 2ZA5A 1EAWA 5JDUB 1O5DH 3RXCA 1GBIA 2PKAB 1TRMA 1HIAB 2FOEA 1SB1H 4BAHB 1EKBB 1O5GH 1FI8A 4UDWH 3EAJA 1GHWH 1O2ZA 4J2YB 4AORA 1UTLM 2TGTA 3LDXH 1C1MA 2A4RA 3BTHE 4DIHH 1HGTH 1DY9A 1P06A 2BD8A 2A7CA 3N7OA 3EDXB 4VGCB 1LHFH 1EPTC 2STBE 1O37A 2FS9A 1KSNA 4NWLA 2C8WB 1DWEH 3MNXA 3SV8A 1T32A 3RXKA 2AERH 4NSVA 1MU6B 2ZCLP 1RS0A 2A5KA 3UTUH 3MU8A 1SBWA 2PKAA 1QNJA 1H1BA 2ZC9H 3I78A 1IQGA 3UPEA 4NA7A 1HIAA 2Z6BD 1MD7A 2A2XH 4KTSA 4OGXA 2ZCHP 3AAUA 3OTJE 4D7FA 3B9FH 5GJ4B 1VGCB 1QB9A 4Q7ZA 4AG2A 1FN8A 1GGDB 4YTAA 2VH6A 1LPGB 4AFZA 1O32A 2ANYA 2BB4A 4OS1A 4DVAU 3DHKH 1K1PA 2BXUH 2UUJB 1GBAA 1CO7E 1CBWB 1JXPA 1DE7H 1TOCB 2EEKA 2JETB 1H9IE 2VVUA 3LH1A 3TNTA 1YGCH 1DM4B 1J17T 1NZQH 4CH2B 1FJSA 3TLOA 2TRMA 1C1PA 3VB3A 3A84A 1GI7B 1A5HA 3C1KA 3M3VA 6GCHF 1DWCH 4JYVH 4ZKOU 1HAHH 3QTVH 4TY6A 1F5LA 4O3UA 3BEUA 4E06H 1MQ6A 1WU1A 3F9EA 3R3GB 1J16A 2BY9X 1LKBA 1ZSKA 2V3OH 3M5LA 5HM9A 1MMJN 2Z7FE 1ELEE 2DE9A 3LIWA 1C5YB 1O3BA 3MYWA 2W7SA 3BTQE 1AUJA 4KTCA 2AYWA 4D8NA 3BEFB 2SGQE 2PKSB 5DPAA 4A6LA 3LGWA 1F0UA 5CHAB 3RMLH 2XC4A 2SGDE 3AVZA 4CHAB 1GBCA 2GKVE 3SU2A 3TPIZ 4OS4A 5FPSA 1BMMH 1BDAA 2O8MA 3ZV8A 2O9QA 1UCYE 1SLWB 4WMFA 1Z1JA 2ZFRH 1K22H 3ZYEA 1JOUB 1GCDA 1UTPA 5EG4A 3RP2A 2OXSA 2VGCC 1ZMLA 4I32A 5A0AE 3S9BA 3LC3A 2OINA 2D2DA 3URCA 1C2IA 2BDIA 3GICB 5FHTA 4IMZA 2OLGA 1SGFA 3RUOA 2V3HH 3HGNA 5JB8S 4I7YH 2Y7ZA 1C9PA 1C2FA 2ANKH 3K6ZA 1EOJA 1HDTH 3RLYH 1TPAE 2ZTZA 1EUFA 1UVSH 1O2OA 1UJ1A 2ZHWH 7GCHG 1GHBG 1ANBA 7LPRA 4GLYA 4A7IB 1TGNA 2NU2E 2GDEH 3RMNH 3LJOA 4KP0A 1A0JA 1UVUH 1YP9A 4DURA 3I77A 3SJKA 1TAWA 1VJ9U 5FPTA 1KY9A 1JMOH 4Z6AH 3ODFA 2P8OB 3KQEA 1AGJA 3TK6A 1AZZA 1C1UH 1V2NT 1YF4A 2LNCA 3UQOA 1OXGA 3O8RA 1YCPK 1P2OA 4DCDA 4VGCC 1BTZA 1SC8U 3ATIA 4CREA 2Y6TA 1NFYA 4ASHA 4I8LA 2FX4A 1ANEA 1NTPA 2PSXA 3NUMA 1GBEA 3SJ8A 3KN2A 1Y3YA 1TNLA 2ZFFH 2UUYA 3ZVEA 1NU9A 5C5NA 1GBHA 2OUAA 1WSSH 4YZUA 2WINI 1GGDC 1A0HB 1O2SA 3BTKE 1P2NA 4JCNA 3BTEE 3PWBA 5EODA 1OWJA 1ZGVA 1P12E 1VCQA 1V2OT 1C1RA 4FUDA 1GHBF 3HKJB 1HB0B 3SNBA 2ZQ1A 1AWHB 1WUNH 2BMGB 3LGTA 2JETC 1DUEA 4THNH 2VWMA 4ZUHA 1QA7A 1AD8H 4TPYA 3HK3B 3SNEA 3A8DA 1KLTA 5DGJA 1DDJA 4WXVA 2J92A 1C5UA 5DK1A 3ZZ3A 2HNTE 1EJNA 1RJXB 1SMFE 1QL9A 2P94A 3UY9A 2ZQ2A 2XCNA 2W3KA 4TPIZ 1TYNA 1NM6A 1E0FD 1D9IA 1DUAA 1FLEE 1EZQA 4IN1A 4WY3A 4CRFA 1F0RA 2Z9KA 1O2GH 3SHAH 1XUJA 2BDBA 1NC6A 3Q76A 3S9AA 2BY5X 5K0HA 1D3QB 1GJCB 2GD4B 2QXIA 3FFGA 1P2QA 2OBOA 3UOPA 2GT8A 1TBZH 3RXAA 1O2IA 1AN1E 5GCHG 8KME2 2GCTB 2PKSC 3T62A 5CHAC 1HJ8A 3SI4H 4CHAC 1XMNB 1QRXA 1TMBH 3SJ9A 2QF3A 4RSPA 1ZHRA 3ZVCA 1SL3A 4BXSA 3SHCH 1PPBH 1QBOA 1TNKA 1C2EA 1PQAA 1V2QT 2J38A 2A31A 3VXEH 3NK8A 3SGQE 2QXJA 5AHGH 1BOQA 3OYPA 5LGOA 3SQEE 2NU3E 2FI4E 5C1YA 4AFQA 1TONA 3M7QA 1LVBA 2FEQH 2G81E 5DP7A 2VWOA 4AGJA 4B2BA 1RTLA 2PFEA 1GJ4H 3U69H 4BANB 1GHAG 3UREA 1HAGE 5F03A 2VWLA 5GWZA 2ZDLA 3VB6A 5A0CA 2ZGCA 3TH4H 4D9QA 3I29A 1O2VA 1ELBA 1MTVA 2FDAA 1MTNC 1DVAH 1GDQA 1FXYA 1SHHB 3GY5A 2P8OC 4GPGA 2UWOA 1EATA 4ZXYH 1C5MD 3SBKA 3O8DA 1IQIA 1F92A 2V6NA 1YC0A 2OQUA 2BVXH 1C5LH 1QURH 3SI3H 2BLQA 1Z8GA 1AKSA 1LTOA 3D62A 1NFUA 3K65B 4JZIA 4X8SH 3QLPH 5C1UA 3Q3KA 3V12A 1O3PB 1TE0A 4B2CA 4XE4A 2ANWA 4HFPB 3SOSA 4AB8A 1CA0B 3ZZ9A 1SI5H 2BDHA 4ABFA 4SGBE 1QB1A 3LC5A 2BOKA 1GBDA 1GHAF 1YCPH 4GCHF 2C8ZB 1E36B 2C8YB 1F2SE 3KEEA 1BRAA 2R2MB 3VEQB 2FS8A 4E7RG 1FPCH 1GI8B 1JIMA 7KMEH 1WTHD 2VINA 2NU4E 2A4GA 2HNTC 1SSXA 4U01A 3GCTG 2FZZA 1GVLA 1YLCA 2VJ1A 5ESBA 4ZKNU 1SGPE 5ETXA 3TITA 3A7XA 1O2JA 1TIOA 1THPB 4PROA 5IDKA 3UWIA 2Q6GA 1MUEB 1SQTA 1BTWA 3PO1B 1O34A 1UCYK 5DP6A 1NFWA 4CBNA 4CRGA 3ZZDA 3RXLA 5TCCA 2XTTB 4INHA 3SV6A 1QBVH 1IQMA 1W3CA 1G3DA 1P10A 2GCTC 1ZZZA 1P01A 2ZU4A 4Y11E 1GHZA 4D9RA 3UNQA 2G5NA 1E37B 2J4IA 4MNYA 3LGVA 2XXLA 2HLCA 3KGPA 2FYQA 4NG9H 4TY7A 1L4DA 3U8TH 5HM2A 2WYGA 3BN9A 1TPOA 3IITA 1LMWB 1DSUA 1YPKH 2AGIX 3F9HA 4I8JA 4O97A 2OC7A 2Z9JA 1HAYB 3M7TA 3UWJH 1ZGIA 1AE5A 2ZHQH 1V3XA 3E3TA 1MZDA 4YOJA 4ABJA 1FY8E 1PQ7A 3DD2H 2Z3CA 2HNTF 3F9GA 4F49A 2Y5HA 2EI8A 1BUIA 1F5KU 3PYHA 3RXQA 6CHAB 1IQHA 2IPHA 4R0IA 1K2I1 3KQDA 4A5TS 3GY2A 1MTSA 5AF9H 1O3OA 4K8YA 1OWEA 1HAIH 1BMLA 3O8CA 3ENSB 1TBRH 4ZMAH 1F0SA 5T6DA 3A89A 2ZU5A 2BD3A 1C4U2 1FY4A 2FOHA 4ZAEA 1C9TA 3BTWE 5JBBS 2CMYA 5K7RA 2JH5D 4ABGA 4A92A 3TGIE 3UNRA 1G32B 1Z71A 4K5ZA 1O2MA 5EU8A 1H4WA 1QGFA 1WQVH 3RU4T 1HAPH 1IOEA 4OS2A 3BG4B 3ZVDA 1VCPA 3TJNA 1V2ST 1AE8H 4RKOB 1E35B 1KYNA 4MLFB 1UTNA 3A86A 5DO4H 5DJ7A 1W8BH 1CA0C 1G2MA 2XC0A 2FO9A 2PR3A 3SU3A 3LONA 1SGDE 1O2XA 8ESTE 2F9BH 1BA8B 2QYIA 1TNGA 3U8RH 4JZ1A 4ZROA 3ZV9A 3D65E 4CRCA 5G4BA 2ZEBA 4Y71A 1BTXA 1P3EA 2Q1JA 3D49H 2QA9E 2ALPA 1P03A 3MO9A 2BHGA 1UTMA 1ZTKA 1W2KH 1RIWC 3RXFA 1V2VT 1H9LB 3P6ZB 3HPTB 4X2VA 5DP5A 1VITG 1A3BH 4JK6A 1WTGH 1Y3UA 2OTVA 3ZVGA 3Q3YA 1MKXK 2ZDNA 4FUGA 1LO6A 4HTCH 1EASA 4NZLA 2C90B 5AVDA 2H2ZA 3E90B 1P2JA 1Y5UT 1TNJA 3WY8A 3PLKA 1H8DH 3BTGE 1QQ4A 3PO1C 2BY8X 1Z6EA 1NT1A 3FZDA 1UTOA 5FXLA 1C5TA 1HAXB 2QC2A 4LXBH 2BX4A 3MFJA 3VB7A 2UUFB 1OP2A 2WV5A 1GDNA 1SGNE 3FVFB 3Q3XA 2QY0B 1GMHF 3QTOH 4BTUB 2ESTE 1GBTA 1T8NA 1W0YH 1LVYA 3T25A 1AHTH 2ZDMA 3T2NA 3SU5A 2B5TB 4FU8A 3SV7A 3ZYDA 1CA8B 4K8BA 5JYIA 5FAHA 1HAVB 3ZZAA 1KTSB 4GHQA 2A0QB 1UCYH 2GCHF 1XUGA 5PTPA 2HVXA 1GBKA 1PPHE 2FLRH 3NCLA 1CVWH 1P2KA 4NA9H 1ESAA 1NRNH 2FODA 2GV6A 1OWDA 3P8GA 1CT0E 2C93B 1G36A 4NIYA 1OX1A 1G37A 2SGAA 2BD2A 2OC8A 1D4PB 2HRVA 3A8AA 2ZNKH 4GUXA 3TIUA 6CHAC 1INCA 2AMDA 2Z3DA 1GL0E 1PJPA 1H9HE 2IOTA 4X1RU 5L2ZH 1IQFA 1S82A 4JMYA 2P16A 3MNBA 4H4FA 1DICA 1HBTH 1M9UA 1YM0A 1O3LA 2I6QA 5ESTE 1OOKB 1ZMJA 3LT3A 1YPEH 2FX6A 2VVVA 1LPKB 4LZ1H 4X8VH 1MKWK 3NWUA 1O2HA 2DUCA 4NIWA 2R3YA 2IN2A 2PTCE 1KXDA 1O3AA 4Y0ZE 1T4VH 2XRCA 3M5NA 3RXDA 8GCHG 3ZZBA 4X2XA 3NXPA 3BG4C 1A4WH 2BDCA 4X1SU 3LH3A 2SNVA 4Y79A 1K1IA 2OP9A 1SQAA 3URDA 1S5SA 1T4UH
chains in the Genus database with same CATH superfamily
1GI6A 1EQ9A 1O35A 5A2MH 2GT7A 1NN6A 4MG3A 3PV2A 1HLTH 1DLKB 4KKDA 1DS2E 5A0BA 4MPXA 3CS0A 3SZNA 1O5BB 3GCNA 5JBTA 2ZECA 1FAKH 1OYQA 2J9NA 3OEHD 1DXWA 5DN6D 2GZ9A 2QV1A 1TPPA 1AZ8A 1CHGA 4FETA 4OS6A 4A1TA 1MCTA 1UTKA 3T5FH 4AGKA 4B2AA 1QJ7B 1BIOA 2HWLB 2ZGXH 5E2PA 3NKKA 3OSYA 2ZGJA 1G3EA 3UOUA 2FYRA 1MH0A 1C1NA 5DP3A 4Q63A 4DG4A 1GI4A 1EXFA 3A8BA 2BQWB 1SVPA 2BLWA 3PWCA 2A2QH 3ATKA 1Q31A 4D76A 1XKAC 1SFIA 1IQLA 3DFJA 2J2UA 1FAXA 2ODYB 1EAUA 3PV4A 1BT7A 4A1XA 1C2DA 1K9OE 1B0EA 1FN6A 4U32A 2GDDA 1C5XB 2Y7XA 1GI1A 1PPCE 1ZJKA 2FLBH 1HV7A 3GY4A 5IYTA 2FWWA 2HGTH 4LOYH 2RFKC 2UWLA 3SUEA 3RXHA 2QE7D 1K28D 3PMAB 2HPPH 1AMHA 1T8LA 1ZPBA 3T28A 5SGAE 1GPZA 3MNSA 4YOIA 3VFEA 2H9TH 1ETTH 2PSYA 3DT0H 1C5ZB 1MU8B 5B6LA 1XUKA 4ZHMU 1MKXH 2TBSA 1P3CA 2UWPA 1K1OA 1TGBA 1U6QA 2G4TA 1KXAA 2JJ1D 4LK4A 2BXTH 3RC5A 5C0TA 1ANCA 2XNDD 3KYGA 1XUFA 1UK2A 1ZHPA 2CN0H 2KM0A 2QXHA 1VGCC 2Q6FA 2ZIQH 3SV9A 2A4OA 1C2LA 1LHGH 1K1JA 3E91A 1FONA 1O3KA 1P9SA 3FP8E 3P92A 3QGNB 5HYOA 2OC1A 1GJDB 4FUEA 1Q3XA 1RTKA 4K1EA 1A46H 7GCHF 3BIUH 3GY7A 2LPRA 3KL6A 3TJOA 2W6JD 1NU7B 4INLA 3SUGA 3VG8A 4NFFA 1CBWC 8LPRA 4AN7A 1O3HA 3M3TA 1L1GA 2NU1E 1C1WH 1OSSA 2BLVA 3A83A 4UFDH 3CP7A 3QZRA 4BXWA 3OY5U 2CF8H 4F55A 3KCGH 3SGBE 4IMQA 2XBWA 2QF0A 3ZZ8A 1EFRD 1TALA 2VU8E 3ZZ4A 1ZSLA 3GDUA 1TWXB 2QCYA 1SGEE 4H42U 4ABHA 1F5RA 2RDEA 1HJAB 5T6GA 1KXBA 5A8ZA 2YNBA 5EXMA 2VIDA 3OFND 1O3IA 3TH3H 2JIZD 4X2WA 1FV9A 1N8OB 2BY7X 2M5TA 3M61U 3RC4A 5A09A 5C3NA 2GGVB 3EE0B 1BRBE 1CQQA 1BMNH 2KZ4A 1QCPA 5H4IB 1V2WT 3SU0A 2F3CE 1P57B 3UFAA 5LPRA 1FPHH 1CGHA 1OPHB 4O9VA 4WJG2 3RXGA 3E8LA 4UFEH 4ABBA 1C5NH 2FOFA 1MKWH 2RCEA 2ZGBH 1EJMA 2XBYA 2WUBA 1C4Y2 2R3UA 4ABDA 1PPEE 1QL8A 1Y5AT 4JYUH 1BTUA 5GIBA 1MD8A 1ZYOA 2F83A 3P17H 1GBFA 1GJAB 1YBWA 5ABWA 2BVRH 1ELDE 1HCGA 4DT7B 3QDZB 2F9VA 1MCVA 1QJ6B 3RMOH 2CXVA 1EAIA 1LHEH 1H8IH 1W7XH 4FUBA 1GDUA 3SUFA 4B74A 1EB1H 1CGJE 1GCTB 4X8TH 3VGCB 1O5CB 2ZU3A 4Q2KA 3A82A 3BSQA 1S83A 2ODQA 3BTFE 3LGYA 1BRUP 1Y3VA 2ZTXA 3KNXA 2KFWA 1GVZA 2A32A 1TX6A 1ZTJA 1BJUA 1SGCA 3GY6A 3SW2B 3RXIA 3V0XA 1X7AC 3PROA 3VPKA 3PB1E 2AHME 3S69A 1FIZA 5C5OA 1L1JA 4Y8XA 4ABIA 3P95A 1SOZA 3R0FA 4FUCA 1G3CA 1GJ6A 5GCHF 4ISIH 1S6LA 4NFEA 4BAQB 4UE7H 2AMPA 5CDFE 2CHAB 1TNIA 1JWTA 1TNHA 2V0BA 4CR9A 3TGJE 3F9FA 5EJLA 4UONA 4FU7A 2BX3A 3G01A 1UHBB 3F2FA 3K9XB 3SZEA 2PUQH 3ZZ6A 1O30A 4IS5A 1TMUH 3WWFA 5EJZA 4ISNA 2BVSH 4Y10E 2BDGA 5I46H 1DITH 1WXRA 2ZG0H 2PWXA 1PPGE 2G8TA 2D1JA 4U30A 1P9UA 5EGMA 4M9FA 2CV3A 3M5MA 4MNWA 5EQQA 3OE7D 4HI3A 2AEIH 5EQSA 1TA6A 2FI5E 4NA8A 3RXRA 3UAIC 3MU4A 1KTTB 1QB6A 1KXCA 1HUTH 1VJAU 3MH5A 1GJ9B 3MTYA 1XUIA 4NIXA 4RKJB 3LU9B 1KLJH 3HKIB 4ZCNA 2QAAA 4MTBA 3RXTA 4TWWA 1SPJA 3U8OH 2OQ5A 1O38A 1GBBA 2SFAA 1Y3XA 3FANA 3SV2H 2C8XB 1UHBA 2PUXB 2VVCA 3PMBB 3MMGA 3PTBA 5C20A 2VBCA 1RXPA 2AIQA 1O2QA 4CR5A 2Y5GA 2BLOA 3RXEA 4XSKU 1W11U 2RA3A 5GPIB 1DSTA 4AOQA 1FIWA 1W0ZU 2ZDKA 4K3JA 3V13A 4Y6DA 1AFQB 1O2KA 2J34A 4WWYA 1GHVH 2A4QA 2BTCE 1QIXB 5EPNA 2VIOA 3FP6E 1MBMA 3TJUA 2TIOA 1GBJA 1QJ1B 1B0FA 2H5DA 1ETSH 3RXOA 1YLNA 2ANMH 1ARCA 1ZHMA 1UK4A 4BNRA 3SUDA 1THSH 4RT0A 4GVUA 3DFLA 2VIWA 4BAOB 4BTIB 2STAE 1Z6JH 3SQHE 1DANH 1OKXA 1OWHA 2OCVB 2G5VA 1LCYA 4ESTE 4IC5A 2H5CA 1A3EH 1ELTA 1FDPA 1UW7A 4KELA 1TRYA 1UO6A 3CENA 3KIDU 2BDYA 3A80A 2FOGA 3T27A 3SORA 1ABIH 5CMXH 1SGYE 1CHOG 2Z3EA 3A7ZA 1GVKB 2ZI2H 3SU6A 1AVWA 4YOGA 1O2WA 3PTNA 1O31A 4DGJA 1O2NA 2TGPZ 1TPSA 3A85A 3GCTF 1EPTB 3E6PH 3GYMA 1F0TA 2IJOB 1FZZA 4NCYA 2GZ8A 1DX5M 1GCTC 2WPLS 3GDVA 3VGCC 1GMDG 1KIGH 1BHXB 4P02A 2FESH 4YT7H 2SGEE 3QK1A 4UFFH 2YMSD 3ATLA 2HALA 4XFQA 5HGGA 1RRKA 2PGBB 1L0ZA 1N1LA 1HXEH 4DT4A 1PFXC 2FPZA 4K60A 1K21H 1N6YA 2P3FH 5EQRA 3AK5A 1ANDA 3RM2H 2CHAC 1O5FH 9ESTA 4X1QU 2R0LA 3AW0A 4XDEA 1P02A 3H7OA 3M7UA 5C2ZA 2XNIA 4E05H 3T26A 5TJXA 2ILNA 2PGQB 3M36A 4XBCA 3FAOA 1CHOF 5EW2H 1YPGH 1T7CA 3OEED 4ZHLU 1K1NA 1BB0B 1PQ5A 3A88A 1KXEA 1YKTA 2KAIB 1NRPH 3LJJA 1UVPA 2AIPA 1C2HA 1KXFA 3C27B 1DLEA 9LPRA 2ODPA 3GISB 1BQYA 1DXPA 4U2WA 1NESE 2D8WA 4X6PA 2Y81A 1BTPA 1XX9A 1TBQH 2WV4A 2BD9A 2H6MA 5F8TA 2J94A 1ELAA 1YPLH 1C4V2 1A0LA 3RU4E 1AU8A 1QTFA 1ZSJA 2ZO3H 5HIYA 2ZKSA 5AFZH 1JRSA 2V3MA 1ETRH 1SGIB 2R2WU 5DSFA 1W10U 1LQDB 2C4FH 4DW2U 2KAIA 1P11E 4NIVA 1O5AB 1OYTH 5JBAS 4ISHH 5JPMH 5FBIA 1TB6H 3M37A 3Q77A 1GHXH 1IAUA 1D3PB 3PM3A 4FU9A 1AFQC 3QX5H 4Y8YA 1QY6A 1QFKH 4CBOA 1C5SA 5KEDA 3ELAH 3S7KB 1FY5A 1HAOH 1ARBA 1UVTH 2J97A 2ZDAH 4ACAA 4B75A 1WOFA 1YPMH 2G55A 2UUKB 2B9LA 2VGCB 3GCOA 3MNCA 3MU1A 2WPJS 3QGJA 2G00A 2PTNA 1AB9B 2BD4A 2AGEX 3P8NA 1GWAA 3ZVFA 2BQ7B 3ODDA 2AGGX 2A45B 1TX7A 3F68H 3UB0A 1PPZA 1DWDH 3LPRA 1RTFB 1GI9B 1OP0A 4ZKSU 4WVPE 2VIVA 1T8OA 4Z0KA 5DP4A 3W94A 5B6OA 1K1MA 1TGTA 1F7ZA 5J4SA 4ZH8A 2SNWA 3SN8A 5JB9S 1Z8RA 4FUIA 3PLBA 1GBMA 2SGFE 1TFXA 1ESBA 1GMCG 1J8AA 2WPIS 4GHTA 4IGDA 5DP9A 3H5CB 1D6RA 3OX7U 3A8CA 4FVBA 1ELFA 4KTUA 1L1NA 1VITF 1AUTC 2W7UA 4MPUA 1KDQB 3BTDE 4YLUA 2VB0A 3E0PB 4K69A 1NY22 5JBCS 3RXBA 4I8HA 1PQ8A 1TABE 2RA0A 2BD5A 1WCZA 4K2YA 6GCHG 2AFQB 3RC6A 3SJOA 3A7WA 1O2UA 1GI2A 4XBBA 4O3TA 1C1QA 1BBRE 1FY3A 4AYYB 1S6FA 1O3MA 1VR1H 2VIQA 3QZQA 6ESTA 2Z9IA 2FOCA 3UQVA 4IBLH 3ZVBA 3DSGA 2IPQX 5BRRE 1QA0A 4FUHA 1O3NA 1C5QA 2B8OH 3GY3A 1O3DA 1IQKA 3SJIA 1MBQA 1HAVA 2XWBI 1YPJH 3BF6H 1KDQA 1QHRB 2ZHDA 3EA7A 3RXMA 4WH8A 2GV7A 1NPMA 3TK5A 2A7HA 4CRBA 2XWAA 2VWNA 2ZHFH 1GMCF 4BAMB 4AFUA 3TVJB 3N7DA 2QN5T 4Q4LA 1LKAA 3GCHB 1TGCA 1AQ7A 2Y82A 5E2OA 1FQ3A 4YESB 2PHBA 3EYDA 4X1NU 1AY6H 4MNXA 2F91A 2P3UB 3EQ0H 1Z7KA 4DIIH 1LVOA 3L6PA 1S6HA 3EA8A 1V2TT 3U9AH 2BY6X 3LKWA 2FTMA 3E0NB 1HYLA 1EP6A 1ZR0A 1TMTH 1S85A 2AMQA 4X8UH 4K1TA 4J1YA 1NROH 1PYTC 4Y8ZA 2BZ6H 1C1SA 3U98H 1AVGH 2ALVA 1FMGA 3BV9B 1BHXF 2ASUB 1SGTA 1FUJA 1W14U 5FCRA 2ZU1A 3BG8A 1S84A 2OD3B 1D3DB 3F2GA 1QR3E 1O36A 5E0GA 2PW8H 1LHCH 2WPMS 4WF8A 3ZZ7A 1WAYB 2W5EA 1P09A 2A1DB 2ZGHA 3F6UH 5EPYA 3W95A 4DJZB 3TU7H 3SU4A 5DG6A 2ZWLH 8GCHF 3S9CA 3SGAE 1MAYA 3F0PA 1XVOA 1DOJA 4IN2A 1TA2A 4MVNA 1BTYA 2CGAA 4H6SB 1TRNA 2SGPE 3UR6A 2ULLA 3K6YA 1J14A 5GXPA 3BEIB 1EAXA 1AIXH 3LGIA 1K0HA 3DA9B 4YM9A 3MWIU 2GZ7A 5T6FA 4CRAA 1TGSZ 1WV7H 1ZJDA 2F9NA 1AB9C 1UTQA 1LQEA 1DT2A 5GDSH 2Y5FA 1DWBH 4HZHA 2W26A 3JZ2B 2O8WA 5J4QA 1JIRA 4X1PU 1O3JA 1O5EH 5E8EH 3TK9A 3U1JB 3HATH 1THRH 3BIVH 1BMAA 2WZQA 5FX6A 1NRSH 2FOAA 3BTME 2O8TA 1HNEE 4RI0A 5L6NH 2B7DH 1UK3A 2A5AA 1MTNB 5T3HA 4RN6A 2P3TB 2G4UA 4FXGH 1MQ5A 4X6MA 1NRQH 1NS3A 1OWIA 4UD9H 1HJ9A 3A81A 2V35A 3NZIA 1QBNA 1W12U 5L30H 3GDSA 1LPZB 3TNSA 1O3GA 1RD3B 4CH8B 1A61H 4TSFD 1PPFE 1XM1A 2WUCA 3QUMP 1FNIA 3KHVA 2F9OA 1IHSH 1E1RD 1V2RT 1ZTLA 1AVXA 1P04A 3RXUA 4AB9A 2P93A 2CF9H 3P8OA 1GHYH 2H1UA 1QRWA 3MO6A 2VIPA 1CT2E 2EA3A 1C2GA 1Y3WA 1VCWA 4JZFH 2GMTB 3UNSA 3E1XB 1QL7A 4OS5A 1JRTA 1S81A 1Z1IA 4Y7BA 1B7XB 1BJVA 5C17A 4X0WU 1ZPZA 2C3SA 3KYFA 4NZQA 2A5IA 3M35A 5EW1H 1XXDA 1MZAA 1O39A 1V2LT 1GJBB 4ACBA 4MPVA 4AZ2B 1O2PA 1GI0A 4E7NA 5EOKA 1YPHE 2EI6A 2QIQA 1GJ8B 2FOMB 1TQ0B 3PRDA 3MOCA 2J95A 4YO9A 1MAXA 2JKHA 3E16B 2VNTA 2Z9GA 3Q00A 4YXWD 1WYKA 3GOVB 3OY6U 1C5RA 1C5VA 1ELCA 1V2JT 3GCHC 1RGQA 2R0KA 2FI3E 7ESTE 2KCOA 3KF2A 1SHYA 2YOLA 4IC6A 5AFYH 2JH6D 3RXPA 1ESTA 3T29A 5T1VA 1ZPCA 1E38B 2KR7A 2HOBA 3STJA 1SR5C 1C2KA 4AG1A 3NPSA 1E34B 4I8GA 4I8KA 1IHTH 3MH7A 3A7TA 2O8UA 4FUJA 2H9EH 3FZZA 4WXIA 3L33A 2Y80A 1V2PT 3DSPA 1ELGA 1DPOA 1BITA 1VITH 1ZMNA 2PV9B 1XXFA 1Q2WA 5DKMA 4YLQH 2IJD1 4ZXXH 5KGOA 1B5GH 1OS8A 1W13U 2B0FA 2EC9H 5F8XA 4F4OC 3IG6B 2QF4A 2XC5A 3HK6B 4B1TA 1SGFG 5BPEA 1S0QA 5F8ZA 1Z8IB 4X6NA 1EX3A 1C1TA 2FOBA 2RG3A 1NRRH 1AI8H 1P8VC 2H9HA 2GTBA 4B73A 1WQSA 3UUZA 4MDSA 1K1LA 2W6ID 5C67A 3SYJA 1A2CH 1YCPM 1EOLA 4Q80A 2ZFSA 3U1IB 1VKYA 1YWUA 2ZU2A 5LPFA 1ZRBA 4D7GA 3SNDA 2OC0A 3S7HB 1G3BA 3MH6A 1AKSB 4XBDA 2PLXA 3SNAA 3ZZCA 2CJIA 4GCHG 1C5PA 1SQRA 2XW9A 1LHDH 4NSYA 3F2HA 3SO3A 5I25A 2TGDA 2Z9LA 1SGRE 3MH4A 1HAZB 1O3CA 1BBRK 2BM2A 1UVOA 4YT6H 2GX4A 2PP6A 4OS7A 2BZAA 4O03A 1EB2A 1C5OH 1CU1A 4BAKB 2ZF0H 4AX9H 5LPEA 1SLVB 3GYLB 1N6XA 1O0DH 2ZZUH 2JDID 3VB5A 4MNVA 3AASA 1C1OA 2ZP0H 2P59A 3ATMA 1CGIE 2ZHEH 3OTPA 2QGRA 3QWCH 3RMMH 1G2LA 4A1VA 3ITIA 4WMDA 3EGKH 2OBQA 4ISOA 3TH2H 3B8JA 2YNAA 4JK5A 1XUHA 2ZCKP 3B23B 2JH0D 1G9IE 4JZDH 1BTHH 2Z94A 2J5UA 3M3SA 4XOJA 2GMTC 5A8YA 1O2TA 1SOTA 1J9CH 2TPIZ 3RXSA 1EP5A 3DSOA 1AFEH 4GSOA 1V6DA 1O3EA 4FUFA 6LPRA 1HXFH 3H7TA 1A7SA 2FXRA 3LOXA 1TOMH 3OAAD 5E0JA 2XCFA 4TYDA 2BYAX 4P00A 2AS9A 1AO5A 1TX8A 1HJAC 1G30B 2WPHS 1ABJH 1YPHC 2BOHB 4H6TA 4FVDA 1BRCE 2XBXA 5EXLA 2D26C 1N8OC 5CE1A 4JZEH 1XVMA 1CE5A 2GVFA 1RIWB 2NU0E 3HGPA 5LH8A 3MI4A 1O3FA 4SGAE 3SNCA 4HG6A 1GI3A 1P2IA 3DUXH 1O2RA 1GG6B 1EZSC 1CT4E 1SLUB 3LGUA 3RM0H 1J15A 3PMJA 1P0SH 3V3MA 4WMEA 4Y76A 4Q7YA 2TGAA 4UFGH 2AH4X 1GJ7B 3OU0A 2BDAA 5FPYA 4OGYA 1ID5H 1EZXC 2Q6DA 1HRTH 4GAWA 1FY1A 3VXFH 3P70B 1SLXB 3S0NA 1BZXE 1SGQE 5FCKA 1UTJA 1P05A 2WYJA 4Y7AA 1IQEA 4BOHA 2BD7A 1MABB 4LZ4B 4ABAA 1ZRKA 3VB4A 1ZOMA 1A5IA 1EJAA 4M7GA 3QN7A 5FBEA 2NWNA 2DE8A 2W3IA 4UEHH 5F6MA 4CRDA 1O33A 1DFPA 3RXVA 1C2JA 3KQBA 1T8MA 3IWMA 4OM9A 3UIRA 2ZPQA 3QO6A 3A7VA 3PMHB 3KQCA 1JBUH 1L4ZA 2XBVA 4AYVB 3STIA 1OWKA 1AWFH 2WPKS 3SU1A 2KX4A 1Y59T 2KCPA 3MO3A 1H8HD 3RDZA 1P2MA 3GY8A 3ZZ5A 3FP7E 5FX5A 3O8BA 2GP9B 2A7JA 4JYTA 3V7TA 1O2YA 5HMAA 1YYY1 4X6OA 1C2MA 1KLIH 1OP8A 3MHWU 1NBME 4NGAH 3UR9A 1FX0B 4ISLA 3EA9A 5DP8A 1GJ5H 4BTTB 4MQAA 1ORFA 4X2YA 3L3TA 5KECA 2VH0A 2ZTYA 1PYTD 1EPTA 4INKA 3RU4D 2BQ6B 3JZ1B 5C1XA 2CK3D 3H09A 3MU0A 3TGKE 3RXJA 2FM2A 2EY4C 3AAVA 1MTUA 1QRZA 2G52A 4HGCA 4TWYA 5HXFA 5E0HA 4WH6A 1O2LA 1NFXA 4QT8C 1ZLRA 1IQJA 1D3TB 4KGAA 1Y8TA 5EXNA 2FMJA 1D6WA 1T31A 1NO9H 3F1SB 2HPQH 1A5GH 1HFDA 1GMDF 1HPGA 1VZQH 1C1VH 3P8FA 1UMAH 3RLWH 3D23A 4I33A 1GL1A 3K2UA 5A8XA 1GI5A 2ZFTA 1LDTT 2RDLA 4ZHAA 3CS7A 4Y0YE 1Z8JB 1ELVA 3TJVA 1A1RA 1CSOE 1L2EA 2QXGA 4I31A 1V2MT 1BBRH 3M5OA 1DY8A 1Y5BT 4AFSA 3PLPA 2G51A 3ESTA 3MU5A 4IW4E 3A7YA 1W7GH 2F9UA 2FP7B 4NWKA 1TQ7B 4B76A 3A87A 3BTTE 3AW1A 2FTLE 3ATWA 4K1SA 1EZUC 4F48B 2ZPRA 1RFNA 5TCAA 1TLDA 1GMHG 4Q7XA 1XKBC 4Z1MD 4DOQA 1QQUA 1ACBE 2THFB 2FIRH 2ZFPH 4ABEA 1YLDA 4DY7B 2ZFQH 2EI7A 1V2UT 2ZPSA 4MPWA 1LVMA 1MTWA 2R9PA 2ZDVH 4ZKRU 1SG8B 1SQOA 1SFQB 2XYAA 4R8TB 2F9PA 2O8LA 3ZVAA 1BCUH 1GG6C 5L2YH 1S0RA 2GCHG 1WBGB 2K1QA 1V2KT 2I6SA 4B71A 4ASUD 2P95A 1IQNA 1C5WB 1GBLA 2ZA5A 1EAWA 5JDUB 1O5DH 3RXCA 1GBIA 2PKAB 1TRMA 5HKKD 1HIAB 2FOEA 1SB1H 4BAHB 1EKBB 1O5GH 1FI8A 4UDWH 3EAJA 1GHWH 1O2ZA 4J2YB 4AORA 1UTLM 2TGTA 3LDXH 1C1MA 2A4RA 3BTHE 4DIHH 1HGTH 1DY9A 1P06A 2BD8A 2A7CA 3N7OA 2LP6A 3NRLA 3EDXB 4VGCB 1LHFH 1EPTC 2STBE 1O37A 2FS9A 1KSNA 2LELA 4NWLA 2C8WB 1DWEH 3MNXA 3SV8A 1T32A 3RXKA 2AERH 4NSVA 1MU6B 2ZCLP 1RS0A 2A5KA 3UTUH 3MU8A 1SBWA 2PKAA 1QNJA 1H1BA 2ZC9H 3I78A 1IQGA 3UPEA 4NA7A 1HIAA 2Z6BD 1MD7A 2A2XH 4KTSA 4OGXA 2ZCHP 3AAUA 3OTJE 4D7FA 3B9FH 5GJ4B 1VGCB 1QB9A 4Q7ZA 4AG2A 1FN8A 1GGDB 4YTAA 2VH6A 1LPGB 4AFZA 1O32A 2ANYA 2BB4A 4OS1A 2EQNA 4DVAU 3DHKH 5C94A 1K1PA 2BXUH 2UUJB 1GBAA 4B6EA 1CO7E 1CBWB 1JXPA 1DE7H 1TOCB 2EEKA 2JETB 1H9IE 2VVUA 3LH1A 3TNTA 1YGCH 1DM4B 1J17T 1NZQH 3CNRA 4CH2B 1FJSA 3TLOA 2TRMA 1C1PA 3VB3A 3A84A 1GI7B 1A5HA 3C1KA 2WV9A 3M3VA 6GCHF 1DWCH 3KQ5A 4JYVH 4ZKOU 1HAHH 3QTVH 4TY6A 1F5LA 4O3UA 3BEUA 4E06H 1MQ6A 1WU1A 3F9EA 3FOAA 3R3GB 1J16A 2BY9X 1LKBA 1ZSKA 2V3OH 3M5LA 5HM9A 1MMJN 2Z7FE 4FOUC 4B6FA 1ELEE 2DE9A 3LIWA 1C5YB 1O3BA 3MYWA 2W7SA 3BTQE 1AUJA 4KTCA 2AYWA 4D8NA 3BEFB 2SGQE 2PKSB 5DPAA 4A6LA 3LGWA 1F0UA 5CHAB 3RMLH 2XC4A 2SGDE 3AVZA 4CHAB 1GBCA 2GKVE 3SU2A 3TPIZ 4OS4A 5FPSA 1BMMH 1BDAA 2O8MA 3ZV8A 2O9QA 1UCYE 1SLWB 4WMFA 1Z1JA 2ZFRH 1K22H 2QF5A 3ZYEA 1JOUB 2WPDD 1GCDA 1UTPA 5EG4A 3RP2A 2OXSA 2VGCC 1ZMLA 4I32A 5A0AE 3S9BA 3LC3A 1QZ8A 2OINA 2D2DA 3URCA 1C2IA 2BDIA 3GICB 3PRBA 5FHTA 4IMZA 2OLGA 1SGFA 3RUOA 2V3HH 3HGNA 5JB8S 4I7YH 2Y7ZA 1C9PA 1C2FA 2ANKH 1YY3A 1EOJA 3K6ZA 1HDTH 3RLYH 1TPAE 2ZTZA 1EUFA 1UVSH 1O2OA 1UJ1A 2ZHWH 7GCHG 1GHBG 1ANBA 7LPRA 4GLYA 4A7IB 1TGNA 2NU2E 2GDEH 3RMNH 3LJOA 4KP0A 1A0JA 1UVUH 1YP9A 4DURA 3I77A 3SJKA 1TAWA 1VJ9U 5FPTA 1KY9A 1JMOH 4Z6AH 1OHHD 2P8OB 3ODFA 3KQEA 1AGJA 3TK6A 1AZZA 1C1UH 1V2NT 1YF4A 2LNCA 3N99A 1OXGA 5CHBA 1YCPK 3UQOA 3O8RA 1P2OA 4DCDA 4VGCC 1BTZA 1SC8U 3ATIA 4CREA 2Y6TA 1NFYA 4ASHA 4I8LA 2FX4A 1SKYE 1ANEA 1NTPA 2PSXA 3NUMA 1GBEA 3SJ8A 3KN2A 1Y3YA 1TNLA 2ZFFH 2UUYA 3ZVEA 1NU9A 5C5NA 1GBHA 2OUAA 1WSSH 4YZUA 2WINI 1GGDC 1A0HB 1O2SA 3BTKE 1P2NA 2F4LA 4JCNA 3BTEE 3PWBA 5EODA 1OWJA 1ZGVA 1P12E 1VCQA 1V2OT 2KCYA 1C1RA 4FUDA 1GHBF 3HKJB 1HB0B 3SNBA 2ZQ1A 2JJ2D 1AWHB 1WUNH 2BMGB 3LGTA 2JETC 1DUEA 4THNH 2VWMA 4ZUHA 1QA7A 1AD8H 4TPYA 3HK3B 3SNEA 3A8DA 1KLTA 5DGJA 1DDJA 4WXVA 2J92A 1C5UA 5DK1A 2WSSD 3ZZ3A 2HNTE 1EJNA 1RJXB 1SMFE 1QL9A 2P94A 3UY9A 2ZQ2A 2XCNA 2W3KA 4TPIZ 1TYNA 1NM6A 1E0FD 3F3BA 1D9IA 1DUAA 1FLEE 1EZQA 2L6OA 4IN1A 4WY3A 4CRFA 1F0RA 2Z9KA 1O2GH 3SHAH 1XUJA 2BDBA 1NC6A 3Q76A 5F53A 2OK5A 3S9AA 2J98B 2BY5X 5K0HA 1D3QB 1GJCB 2GD4B 2QXIA 3FFGA 1P2QA 2OBOA 3UOPA 2GT8A 1TBZH 3RXAA 1O2IA 1AN1E 5GCHG 8KME2 2GCTB 2PKSC 3T62A 5CHAC 1HJ8A 3SI4H 4CHAC 1XMNB 1QRXA 3W1EA 1TMBH 3SJ9A 2QF3A 4RSPA 1ZHRA 3ZVCA 1SL3A 4BXSA 3SHCH 1PPBH 1QBOA 1TNKA 1C2EA 1PQAA 1V2QT 2J38A 2A31A 3VXEH 3NK8A 3SGQE 2QXJA 5AHGH 1BOQA 2J98A 3OYPA 5LGOA 3SQEE 2NU3E 2FI4E 2K8IA 5C1YA 4AFQA 1TONA 3M7QA 1LVBA 2FEQH 2G81E 5DP7A 2VWOA 4AGJA 4B2BA 1RTLA 2PFEA 1GJ4H 3U69H 4BANB 1GHAG 3UREA 1HAGE 5F03A 2L74A 2VWLA 5GWZA 2ZDLA 3VB6A 5A0CA 2ZGCA 3TH4H 4D9QA 3I29A 1O2VA 1ELBA 1MTVA 2FDAA 1MTNC 1DVAH 1GDQA 1FXYA 1SHHB 3GY5A 3DCLA 2P8OC 4GPGA 2UWOA 1EATA 4ZXYH 1C5MD 3SBKA 3O8DA 1IQIA 1F92A 3GS9A 4TT3D 2V6NA 1YC0A 2OQUA 2BVXH 1C5LH 1QURH 3SI3H 2BLQA 1Z8GA 1AKSA 1LTOA 3D62A 1NFUA 3K65B 4JZIA 4X8SH 3QLPH 5C1UA 3Q3KA 3V12A 1O3PB 1TE0A 4B2CA 4XE4A 2ANWA 4HFPB 3SOSA 5FL7D 4AB8A 1CA0B 3ZZ9A 1SI5H 2BDHA 4ABFA 4SGBE 1QB1A 3LC5A 2BOKA 1GBDA 1GHAF 3WW7A 1YCPH 4GCHF 2C8ZB 1E36B 3F0OA 2C8YB 1F2SE 3KEEA 1BRAA 2R2MB 3VEQB 2WHXA 2FS8A 4E7RG 1FPCH 2GJGA 1GI8B 1JIMA 2KCAA 7KMEH 1WTHD 2VINA 2NU4E 2A4GA 2HNTC 1SSXA 4U01A 3GCTG 2FZZA 1GVLA 1YLCA 2VJ1A 5ESBA 5C0UA 4ZKNU 1SGPE 5ETXA 3TITA 3A7XA 1COWD 1O2JA 1TIOA 1THPB 4PROA 5IDKA 3WWBA 3UWIA 2Q6GA 1MUEB 1SQTA 1BTWA 3PO1B 1O34A 1UCYK 1WDIA 5DP6A 1NFWA 4CBNA 5GNDA 4CRGA 3ZZDA 3RXLA 5TCCA 2XTTB 1NBMD 4INHA 3SV6A 1QBVH 1IQMA 1W3CA 1G3DA 1P10A 2GCTC 3EE7A 1ZZZA 1P01A 2ZU4A 4Y11E 1GHZA 4D9RA 3UNQA 2G5NA 1E37B 2J4IA 4MNYA 3LGVA 2XXLA 2HLCA 3KGPA 2FYQA 4NG9H 4TY7A 1L4DA 3U8TH 5HM2A 2WYGA 3BN9A 1TPOA 3IITA 1LMWB 1DSUA 1YPKH 2AGIX 3F9HA 4I8JA 4O97A 2OC7A 2Z9JA 1HAYB 3M7TA 3ZIAD 3UWJH 1ZGIA 4AC9A 1AE5A 2ZHQH 1V3XA 3E3TA 1MZDA 4YOJA 4ABJA 1FY8E 1PQ7A 3DD2H 2Z3CA 2HNTF 3F9GA 4F49A 2Y5HA 2EI8A 1BUIA 1F5KU 3PYHA 3RXQA 6CHAB 1IQHA 2IPHA 4R0IA 1K2I1 3KQDA 2K0QA 3GY2A 4A5TS 1MTSA 5AF9H 1O3OA 4K8YA 1OWEA 1HAIH 1BMLA 3O8CA 3FO8D 2HVYB 3ENSB 1TBRH 4ZMAH 1F0SA 5T6DA 3A89A 2ZU5A 2BD3A 1C4U2 1FY4A 2FOHA 4ZAEA 1C9TA 1KMHB 3BTWE 5JBBS 2CMYA 5K7RA 2JH5D 4ABGA 4A92A 3TGIE 3UNRA 1G32B 1Z71A 4K5ZA 1O2MA 5EU8A 1H4WA 1QGFA 1WQVH 3RU4T 1HAPH 1IOEA 4OS2A 3BG4B 3ZVDA 1VCPA 3TJNA 1V2ST 1AE8H 2YMSB 1E35B 4RKOB 1KYNA 4MLFB 1W0JD 1UTNA 3A86A 5DO4H 5DJ7A 1W8BH 1CA0C 1G2MA 2XC0A 2FO9A 2PR3A 3SU3A 3LONA 4I86A 1SGDE 1O2XA 8ESTE 2F9BH 1BA8B 2QYIA 1TNGA 3U8RH 4JZ1A 4ZROA 3ZV9A 3D65E 4CRCA 5G4BA 2ZEBA 4Y71A 1BTXA 1P3EA 2Q1JA 3D49H 2QA9E 2ALPA 1P03A 3MO9A 2BHGA 1UTMA 1ZTKA 1W2KH 1RIWC 3RXFA 1V2VT 1H9LB 3FN8A 3P6ZB 3HPTB 4X2VA 5DP5A 1VITG 1A3BH 4JK6A 1WTGH 1Y3UA 2OTVA 3ZVGA 3Q3YA 2XOKD 1MKXK 2ZDNA 1E1QD 4FUGA 1LO6A 4HTCH 1EASA 4NZLA 2C90B 5AVDA 2H2ZA 5EJ1A 3E90B 1P2JA 1Y5UT 1TNJA 3WY8A 3PLKA 1H8DH 3BTGE 1QQ4A 4XD7D 3PO1C 2BY8X 1Z6EA 1NT1A 3FZDA 1BMFD 1UTOA 5FXLA 1C5TA 1HAXB 2QC2A 4LXBH 2BX4A 4RT1A 3MFJA 3VB7A 2F43B 2UUFB 1OP2A 5EIYA 2WV5A 1GDNA 1SGNE 3FVFB 3Q3XA 2QY0B 1GMHF 3QTOH 4BTUB 3FKSD 2ESTE 1GBTA 1T8NA 2HLDD 1W0YH 1LVYA 3T25A 1AHTH 2ZDMA 3T2NA 3SU5A 2B5TB 4FU8A 3SV7A 3ZYDA 1CA8B 4K8BA 5JYIA 5FAHA 1HAVB 3ZZAA 1KTSB 4GHQA 2A0QB 1W0KD 1UCYH 2GCHF 1XUGA 5PTPA 2HVXA 1GBKA 1PPHE 2FLRH 3NCLA 1CVWH 1P2KA 4NA9H 1ESAA 1NRNH 2FODA 2GV6A 1OWDA 3P8GA 1CT0E 2C93B 1G36A 4NIYA 1OX1A 1G37A 2SGAA 2BD2A 2OC8A 1D4PB 2HRVA 3PV5A 2M2AA 3A8AA 2ZNKH 1H8ED 4GUXA 3TIUA 6CHAC 1INCA 1E79D 2AMDA 2Z3DA 1GL0E 1PJPA 1H9HE 2IOTA 4X1RU 5IK2D 4XRNA 5HIZA 5L2ZH 1IQFA 1S82A 4JMYA 2P16A 3MNBA 3N7EA 4H4FA 1DICA 1HBTH 1M9UA 1YM0A 1O3LA 2I6QA 5ESTE 1OOKB 1ZMJA 3LT3A 1YPEH 2FX6A 2VVVA 1LPKB 4LZ1H 4X8VH 1MKWK 3NWUA 1O2HA 2DUCA 4NIWA 2R3YA 2IN2A 2PTCE 1KXDA 1O3AA 4Y0ZE 1T4VH 2XRCA 3M5NA 3RXDA 8GCHG 3ZZBA 4X2XA 3NXPA 3BG4C 1A4WH 2BDCA 3U28C 2YMSC 4X1SU 3MQKC 3LH3A 2SNVA 4Y79A 1K1IA 2OP9A 2V7QD 1SQAA 3URDA 1S5SA 1T4UH
chains in the Genus database with same CATH topology
1GI6A 1EQ9A 1O35A 5A2MH 2GT7A 1NN6A 4MG3A 1HLTH 1DLKB 4KKDA 1DS2E 5A0BA 4MPXA 3CS0A 3SZNA 1O5BB 3GCNA 5JBTA 2ZECA 1FAKH 1OYQA 2J9NA 1DXWA 2GZ9A 2QV1A 1TPPA 1AZ8A 1CHGA 4OS6A 4A1TA 1MCTA 1UTKA 3T5FH 4AGKA 4B2AA 1QJ7B 1BIOA 2HWLB 2ZGXH 5E2PA 3NKKA 3OSYA 2ZGJA 1G3EA 3UOUA 2FYRA 1MH0A 1C1NA 5DP3A 4DG4A 1GI4A 1EXFA 3A8BA 2BQWB 1SVPA 2BLWA 3PWCA 2A2QH 3ATKA 1Q31A 4D76A 1XKAC 1SFIA 1IQLA 3DFJA 2J2UA 1FAXA 2ODYB 1EAUA 3PV4A 1BT7A 4A1XA 1C2DA 1K9OE 1B0EA 1FN6A 4U32A 2GDDA 1C5XB 2Y7XA 1GI1A 1PPCE 1ZJKA 2FLBH 1HV7A 3GY4A 5IYTA 2FWWA 2HGTH 4LOYH 2UWLA 3SUEA 3RXHA 1K28D 3PMAB 2HPPH 1AMHA 1T8LA 1ZPBA 3T28A 5SGAE 1GPZA 3MNSA 4YOIA 3VFEA 2H9TH 1ETTH 2PSYA 3DT0H 1C5ZB 1MU8B 1XUKA 4ZHMU 1MKXH 2TBSA 1P3CA 2UWPA 1K1OA 1TGBA 1U6QA 2G4TA 1KXAA 4LK4A 2BXTH 3RC5A 1ANCA 1XUFA 1UK2A 1ZHPA 2CN0H 2QXHA 3SV9A 1VGCC 2Q6FA 2ZIQH 2A4OA 1C2LA 1LHGH 1K1JA 3E91A 1FONA 1O3KA 1P9SA 3FP8E 3P92A 3QGNB 5HYOA 2OC1A 1GJDB 4FUEA 1Q3XA 1RTKA 4K1EA 1A46H 7GCHF 3BIUH 3GY7A 2LPRA 3KL6A 3TJOA 1NU7B 4INLA 3SUGA 4NFFA 1CBWC 8LPRA 4AN7A 1O3HA 3M3TA 1L1GA 2NU1E 1C1WH 1OSSA 2BLVA 3A83A 4UFDH 3CP7A 3QZRA 4BXWA 3OY5U 2CF8H 3KCGH 3SGBE 4IMQA 2XBWA 2QF0A 3ZZ8A 1TALA 2VU8E 3ZZ4A 1ZSLA 3GDUA 1TWXB 2QCYA 1SGEE 4H42U 4ABHA 1F5RA 1HJAB 5T6GA 1KXBA 5A8ZA 2YNBA 5EXMA 2VIDA 1O3IA 3TH3H 4X2WA 1FV9A 1N8OB 2BY7X 2M5TA 3M61U 3RC4A 5A09A 5C3NA 2GGVB 3EE0B 1BRBE 1CQQA 1BMNH 1QCPA 5H4IB 1V2WT 3SU0A 2F3CE 1P57B 3UFAA 5LPRA 1FPHH 1CGHA 1OPHB 4O9VA 4WJG2 3RXGA 3E8LA 4UFEH 4ABBA 1C5NH 2FOFA 1MKWH 2RCEA 2ZGBH 1EJMA 2XBYA 2WUBA 1C4Y2 2R3UA 4ABDA 1PPEE 1QL8A 1Y5AT 4JYUH 1BTUA 5GIBA 1MD8A 1ZYOA 2F83A 3P17H 1GBFA 1GJAB 1YBWA 5ABWA 2BVRH 1ELDE 1HCGA 4DT7B 3QDZB 2F9VA 1MCVA 1QJ6B 3RMOH 2CXVA 1EAIA 1LHEH 1H8IH 1W7XH 4FUBA 1GDUA 3SUFA 4B74A 1EB1H 1CGJE 1GCTB 4X8TH 3VGCB 1O5CB 2ZU3A 4Q2KA 3A82A 3BSQA 1S83A 2ODQA 3BTFE 3LGYA 1BRUP 1Y3VA 2ZTXA 3KNXA 1GVZA 2A32A 1TX6A 1ZTJA 1BJUA 1SGCA 3GY6A 3SW2B 3RXIA 3V0XA 1X7AC 3PROA 3VPKA 3PB1E 3S69A 1FIZA 5C5OA 1L1JA 4Y8XA 4ABIA 3P95A 1SOZA 3R0FA 4FUCA 1G3CA 1GJ6A 5GCHF 4ISIH 4NFEA 4BAQB 4UE7H 2AMPA 2CHAB 1TNIA 1JWTA 1TNHA 2V0BA 4CR9A 3TGJE 3F9FA 4UONA 4FU7A 2BX3A 3G01A 1UHBB 3K9XB 2PUQH 3ZZ6A 1O30A 4IS5A 1TMUH 4ISNA 2BVSH 4Y10E 2BDGA 5I46H 1DITH 2ZG0H 2PWXA 1PPGE 2G8TA 2D1JA 4U30A 1P9UA 5EGMA 2CV3A 3M5MA 4MNWA 5EQQA 4HI3A 2AEIH 5EQSA 1TA6A 2FI5E 4NA8A 3RXRA 3MU4A 1KTTB 1QB6A 1KXCA 1HUTH 1VJAU 3MH5A 1GJ9B 3MTYA 1XUIA 4NIXA 4RKJB 3LU9B 1KLJH 3HKIB 2QAAA 4MTBA 3RXTA 4TWWA 1SPJA 3U8OH 2OQ5A 1O38A 1GBBA 2SFAA 1Y3XA 3FANA 3SV2H 2C8XB 1UHBA 2PUXB 2VVCA 3PMBB 3MMGA 3PTBA 5C20A 1RXPA 2AIQA 1O2QA 4CR5A 2Y5GA 2BLOA 3RXEA 4XSKU 1W11U 2RA3A 5GPIB 1DSTA 4AOQA 1FIWA 1W0ZU 2ZDKA 4K3JA 3V13A 4Y6DA 1AFQB 1O2KA 2J34A 4WWYA 1GHVH 2A4QA 2BTCE 1QIXB 5EPNA 2VIOA 3FP6E 1MBMA 3TJUA 2TIOA 1GBJA 1QJ1B 1B0FA 2H5DA 1ETSH 3RXOA 2ANMH 1ARCA 1ZHMA 1UK4A 4BNRA 3SUDA 1THSH 4GVUA 3DFLA 2VIWA 4BAOB 4BTIB 2STAE 1Z6JH 3SQHE 1DANH 1OKXA 1OWHA 2OCVB 2G5VA 1LCYA 4ESTE 4IC5A 1A3EH 2H5CA 1ELTA 1FDPA 4KELA 1TRYA 1UO6A 3CENA 3KIDU 2BDYA 3A80A 2FOGA 3T27A 3SORA 1ABIH 5CMXH 1SGYE 1CHOG 2Z3EA 3A7ZA 1GVKB 2ZI2H 3SU6A 1AVWA 4YOGA 1O2WA 3PTNA 1O31A 4DGJA 1O2NA 2TGPZ 1TPSA 3A85A 3GCTF 1EPTB 3E6PH 3GYMA 1F0TA 2IJOB 1FZZA 4NCYA 2GZ8A 1DX5M 1GCTC 2WPLS 3GDVA 3VGCC 1GMDG 1KIGH 1BHXB 2FESH 4YT7H 2SGEE 3QK1A 4UFFH 3ATLA 2HALA 4XFQA 5HGGA 1RRKA 2PGBB 1L0ZA 1N1LA 1HXEH 1PFXC 2FPZA 4K60A 1K21H 1N6YA 2P3FH 5EQRA 1ANDA 3RM2H 2CHAC 1O5FH 9ESTA 4X1QU 2R0LA 3AW0A 4XDEA 1P02A 3H7OA 3M7UA 5C2ZA 2XNIA 4E05H 3T26A 5TJXA 2ILNA 2PGQB 3M36A 4XBCA 3FAOA 1CHOF 5EW2H 1YPGH 1T7CA 4ZHLU 1K1NA 1BB0B 1PQ5A 3A88A 1KXEA 1YKTA 2KAIB 1NRPH 3LJJA 1UVPA 2AIPA 1C2HA 1KXFA 3C27B 1DLEA 9LPRA 2ODPA 3GISB 1BQYA 1DXPA 4U2WA 1NESE 2D8WA 4X6PA 2Y81A 1BTPA 1XX9A 1TBQH 2WV4A 2BD9A 2H6MA 5F8TA 2J94A 1ELAA 1YPLH 1C4V2 1A0LA 3RU4E 1AU8A 1QTFA 1ZSJA 2ZO3H 2ZKSA 5AFZH 1JRSA 1ETRH 1SGIB 2R2WU 1W10U 1LQDB 2C4FH 4DW2U 2KAIA 1P11E 4NIVA 1O5AB 1OYTH 5JBAS 4ISHH 5JPMH 5FBIA 1TB6H 3M37A 3Q77A 1GHXH 1IAUA 1D3PB 3PM3A 4FU9A 1AFQC 3QX5H 4Y8YA 1QY6A 1QFKH 4CBOA 1C5SA 3ELAH 3S7KB 1FY5A 1HAOH 1ARBA 1UVTH 2ZDAH 4B75A 1WOFA 1YPMH 2G55A 2UUKB 2B9LA 2VGCB 3GCOA 3MNCA 3MU1A 2WPJS 3QGJA 2G00A 2PTNA 1AB9B 2BD4A 2AGEX 3P8NA 1GWAA 3ZVFA 2BQ7B 3ODDA 2AGGX 2A45B 1TX7A 3F68H 1PPZA 1DWDH 3LPRA 1RTFB 1GI9B 1OP0A 4ZKSU 4WVPE 2VIVA 1T8OA 4Z0KA 5DP4A 3W94A 5B6OA 1K1MA 1TGTA 1F7ZA 5J4SA 4ZH8A 2SNWA 3SN8A 5JB9S 1Z8RA 4FUIA 3PLBA 1GBMA 2SGFE 1TFXA 1ESBA 1GMCG 1J8AA 2WPIS 4GHTA 4IGDA 5DP9A 3H5CB 1D6RA 3OX7U 3A8CA 4FVBA 1ELFA 4KTUA 1L1NA 1VITF 1AUTC 2W7UA 4MPUA 1KDQB 3BTDE 4YLUA 2VB0A 3E0PB 4K69A 1NY22 5JBCS 3RXBA 4I8HA 1PQ8A 1TABE 2RA0A 2BD5A 1WCZA 4K2YA 6GCHG 2AFQB 3RC6A 3SJOA 3A7WA 1O2UA 1GI2A 4XBBA 4O3TA 1C1QA 1BBRE 1FY3A 4AYYB 1S6FA 1O3MA 1VR1H 2VIQA 3QZQA 6ESTA 2Z9IA 2FOCA 3UQVA 4IBLH 3ZVBA 5BRRE 1QA0A 4FUHA 1O3NA 1C5QA 2B8OH 3GY3A 1O3DA 1IQKA 3SJIA 1MBQA 1HAVA 2XWBI 1YPJH 3BF6H 1KDQA 1QHRB 2ZHDA 3EA7A 3RXMA 4WH8A 2GV7A 1NPMA 3TK5A 2A7HA 4CRBA 2XWAA 2VWNA 2ZHFH 1GMCF 4BAMB 4AFUA 3TVJB 2QN5T 1LKAA 3GCHB 1TGCA 1AQ7A 2Y82A 5E2OA 1FQ3A 4YESB 2PHBA 3EYDA 4X1NU 1AY6H 4MNXA 2F91A 2P3UB 3EQ0H 1Z7KA 4DIIH 1LVOA 3L6PA 1S6HA 3EA8A 1V2TT 3U9AH 2BY6X 3LKWA 2FTMA 3E0NB 1HYLA 1EP6A 1ZR0A 1TMTH 1S85A 2AMQA 4X8UH 4K1TA 4J1YA 1NROH 1PYTC 4Y8ZA 2BZ6H 1C1SA 3U98H 1AVGH 2ALVA 1FMGA 3BV9B 1BHXF 2ASUB 1SGTA 1FUJA 1W14U 5FCRA 2ZU1A 3BG8A 1S84A 2OD3B 1D3DB 1QR3E 1O36A 5E0GA 2PW8H 1LHCH 2WPMS 4WF8A 3ZZ7A 1WAYB 2W5EA 1P09A 2A1DB 2ZGHA 3F6UH 5EPYA 3W95A 4DJZB 3TU7H 3SU4A 5DG6A 2ZWLH 8GCHF 3S9CA 3SGAE 1MAYA 1XVOA 1DOJA 4IN2A 1TA2A 4MVNA 1BTYA 2CGAA 4H6SB 1TRNA 2SGPE 3UR6A 2ULLA 3K6YA 1J14A 5GXPA 3BEIB 1EAXA 1AIXH 3LGIA 3DA9B 4YM9A 3MWIU 2GZ7A 5T6FA 4CRAA 1TGSZ 1WV7H 1ZJDA 2F9NA 1AB9C 1UTQA 1LQEA 1DT2A 5GDSH 2Y5FA 1DWBH 4HZHA 2W26A 3JZ2B 2O8WA 5J4QA 1JIRA 4X1PU 1O3JA 1O5EH 5E8EH 3TK9A 3U1JB 3HATH 1THRH 3BIVH 1BMAA 5FX6A 1NRSH 2FOAA 3BTME 2O8TA 1HNEE 5L6NH 2B7DH 1UK3A 2A5AA 1MTNB 5T3HA 4RN6A 2P3TB 2G4UA 4FXGH 1MQ5A 4X6MA 1NRQH 1NS3A 1OWIA 4UD9H 1HJ9A 3A81A 2V35A 3NZIA 1QBNA 1W12U 5L30H 3GDSA 1LPZB 3TNSA 1O3GA 1RD3B 4CH8B 1A61H 1PPFE 1XM1A 2WUCA 3QUMP 1FNIA 3KHVA 2F9OA 1IHSH 1V2RT 1ZTLA 1AVXA 1P04A 3RXUA 4AB9A 2P93A 2CF9H 3P8OA 1GHYH 2H1UA 1QRWA 3MO6A 2VIPA 1CT2E 2EA3A 1C2GA 1Y3WA 1VCWA 4JZFH 2GMTB 3UNSA 3E1XB 1QL7A 4OS5A 1JRTA 1S81A 1Z1IA 4Y7BA 1B7XB 1BJVA 4X0WU 1ZPZA 2C3SA 4NZQA 2A5IA 3M35A 5EW1H 1XXDA 1MZAA 1O39A 1V2LT 1GJBB 4AZ2B 4MPVA 1O2PA 1GI0A 4E7NA 5EOKA 1YPHE 2EI6A 2QIQA 1GJ8B 2FOMB 1TQ0B 3MOCA 2J95A 4YO9A 1MAXA 2JKHA 3E16B 2VNTA 2Z9GA 3Q00A 1WYKA 3GOVB 3OY6U 1C5RA 1C5VA 1ELCA 1V2JT 3GCHC 1RGQA 2R0KA 2FI3E 7ESTE 3KF2A 1SHYA 2YOLA 4IC6A 5AFYH 2JH6D 3RXPA 1ESTA 3T29A 1ZPCA 1E38B 2HOBA 3STJA 1SR5C 1C2KA 4AG1A 3NPSA 1E34B 4I8GA 4I8KA 1IHTH 3MH7A 3A7TA 2O8UA 4FUJA 2H9EH 3FZZA 4WXIA 3L33A 2Y80A 1V2PT 1ELGA 1DPOA 1BITA 1VITH 1ZMNA 2PV9B 1XXFA 1Q2WA 5DKMA 4YLQH 4ZXXH 1B5GH 1OS8A 1W13U 2B0FA 2EC9H 5F8XA 4F4OC 3IG6B 2XC5A 3HK6B 4B1TA 1SGFG 5BPEA 1S0QA 5F8ZA 1Z8IB 4X6NA 1EX3A 1C1TA 2FOBA 2RG3A 1NRRH 1AI8H 1P8VC 2H9HA 2GTBA 4B73A 1WQSA 3UUZA 4MDSA 1K1LA 5C67A 1A2CH 1YCPM 1EOLA 4Q80A 2ZFSA 3U1IB 2ZU2A 5LPFA 1ZRBA 4D7GA 3SNDA 2OC0A 3S7HB 1G3BA 3MH6A 1AKSB 4XBDA 2PLXA 3SNAA 3ZZCA 2CJIA 4GCHG 1C5PA 2XW9A 1LHDH 4NSYA 3SO3A 5I25A 2TGDA 2Z9LA 1SGRE 3MH4A 1HAZB 1O3CA 1BBRK 2BM2A 1UVOA 4YT6H 2GX4A 4OS7A 2BZAA 4O03A 1EB2A 1C5OH 1CU1A 4BAKB 2ZF0H 4AX9H 5LPEA 1SLVB 3GYLB 1N6XA 1O0DH 2ZZUH 3VB5A 4MNVA 3AASA 1C1OA 2ZP0H 2P59A 3ATMA 1CGIE 2ZHEH 3QWCH 2QGRA 3RMMH 1G2LA 4A1VA 3ITIA 4WMDA 3EGKH 2OBQA 4ISOA 3TH2H 3B8JA 2YNAA 4JK5A 1XUHA 2ZCKP 3B23B 2JH0D 1G9IE 4JZDH 1BTHH 2Z94A 3M3SA 4XOJA 2GMTC 5A8YA 1O2TA 1SOTA 1J9CH 2TPIZ 3RXSA 1EP5A 1AFEH 4GSOA 1V6DA 1O3EA 4FUFA 6LPRA 1HXFH 3H7TA 1A7SA 2FXRA 3LOXA 1TOMH 5E0JA 2XCFA 4TYDA 2BYAX 2AS9A 1AO5A 1TX8A 1HJAC 1G30B 2WPHS 1ABJH