4JK5A

Human urokinase-type plasminogen activator (upa) in complex with a bicyclic peptide inhibitor (uk18-d-ser)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Improving binding affinity and stability of Peptide ligands by substituting glycines with d-amino acids.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator
total genus 54
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2013-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4jk5A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4jk5A01
4THNH 5DP7A 3F9GA 2PKSB 1EUFA 1GJ7B 2B5TB 1TFXA 3UWIA 5JB8S 3FFGA 1Y59T 1TLDA 2ZEBA 4AG2A 3PMAB 3A8CA 5C3NA 1GVZA 1TOCB 4Q7XA 2XYAA 1AGJA 3GICB 3PMHB 1O2XA 1TGCA 1GJ9B 1LVMA 4IN1A 3VPKA 1ZMNA 3K65B 1E35B 3GY5A 2D1JA 4RKOB 4BAQB 4X6MA 1HAYB 4CRAA 2GX4A 2HNTF 1Y3XA 4OS5A 4B71A 1C5SA 2UWPA 2FIRH 4B2AA 2CN0H 3RXOA 3FP7E 1TMUH 3M5MA 1BTZA 1ZSLA 1EJNA 1J15A 2BTCE 2UUKB 3T5FH 3BTKE 2OBQA 3ZZ8A 1GCTB 1VGCB 3VB4A 4ABIA 1SGCA 1OXGA 1RRKA 2O9QA 2RCEA 2W3KA 2FWWA 1ELTA 1HAVB 1HB0B 1V2NT 3PTNA 5FPSA 4A1VA 1G30B 5FBIA 2PFEA 3RXJA 3AW0A 1BMMH 4MNYA 1XM1A 4I33A 2NU2E 2J2UA 2BOKA 4WMEA 1NRSH 3RXCA 2ZFSA 2EC9H 5DKMA 1EAIA 3RXTA 4NA8A 2BDBA 1RGQA 4ESTE 1U6QA 2PGQB 1SHYA 4A1XA 1SFIA 5F03A 1PQ8A 2GV7A 2FOEA 3P70B 4ABDA 3RC4A 1PPEE 3GDSA 1C1TA 1XUHA 3RC5A 5JBBS 3U8RH 5ESBA 1DSTA 1WYKA 1AE5A 2D8WA 1BRBE 1J8AA 1TGSZ 1SL3A 2ULLA 3CS7A 4VGCB 3M37A 3F9EA 1P2QA 4CREA 3QGJA 4BAMB 1EZXC 2UWOA 2R2WU 1OWKA 3ZYEA 2VH6A 3PLKA 1OP0A 4JZDH 1MKXH 1NFUA 1GJDB 1HBTH 3ATKA 1YPEH 3E16B 1UTLM 3BEUA 3SUGA 1A5GH 1ZGIA 2VIWA 1O3FA 4UDWH 1C1SA 1P57B 1W13U 2OC7A 1ANDA 2Z6BD 1ZSKA 1GBTA 1P09A 1TA2A 1QY6A 2GDDA 2ODQA 3MO3A 3U8OH 4FUEA 1BMAA 3A84A 2BM2A 2HWLB 3SGBE 2UUJB 4ABGA 4UFGH 2BX3A 1HXFH 1QR3E 1K28D 3IG6B 1OP2A 4KTSA 3RU4D 1Y3YA 1CA0C 2ZZUH 3RXSA 3SO3A 1P2JA 1ZTKA 4IC6A 1EB2A 2PKSC 3KQEA 1N8OC 1QB6A 5A0CA 4AYYB 2VWMA 2C8XB 2BDGA 1NRQH 2W5EA 1K1PA 1Z8JB 3HKJB 3SNEA 2WV5A 3LC5A 1AO5A 3HGNA 3TJUA 3M3TA 1BHXB 2VIOA 1ETTH 1O3GA 1YPKH 4NFFA 4OS6A 1A4WH 1C1OA 1THSH 1IHTH 1E36B 5C2ZA 2R0LA 2I6SA 1GBIA 3ODDA 3U9AH 2PTCE 1QURH 2ZPQA 3BG4B 2GMTC 2Z9KA 3LONA 1SBWA 3RC6A 3STIA 2XC0A 2DE9A 1J9CH 1TIOA 4I8GA 3RLYH 2ZDLA 4I8KA 1HAZB 2SGEE 2SGPE 4NG9H 2RA0A 1E37B 1WSSH 1NFXA 2VWLA 1GMCF 2BXUH 4Y76A 1V2WT 2HPPH 1HAOH 1AVXA 1SLWB 4WF8A 4O9VA 4DGJA 1E34B 2H9TH 2ZQ2A 2BLOA 3PO1B 2G00A 3UQVA 3A7WA 3DFLA 1NC6A 4OGYA 5DP6A 1ANCA 1HAGE 1BTUA 1O2OA 1YC0A 3EE0B 1D3TB 1W11U 4GHQA 2Z94A 1VJ9U 4MNVA 1TABE 2HNTC 1TNKA 4ZXXH 2G5VA 5F8XA 1BBRK 2A2QH 1CT2E 3E8LA 1BTPA 1DPOA 1AI8H 1BMLA 1GMCG 1O2YA 1O2MA 4HTCH 1EJMA 1UHBB 1HAPH 3P8OA 4X1QU 3SGAE 2Q6GA 1A3BH 3FP8E 4ABAA 3R0FA 5C1XA 1KLJH 2ZQ1A 3BEFB 5DJ7A 1ETSH 1Q31A 4RN6A 1ANBA 2V3OH 3LGYA 3S7HB 3VGCB 2GTBA 3I78A 2F9PA 1UTMA 3TGKE 4OS4A 4AFQA 4WVPE 4GLYA 4BTIB 1HGTH 1BJVA 2VJ1A 2ESTE 3SW2B 4E7RG 2ZO3H 1DLKB 5C1YA 2IN2A 3FAOA 1TWXB 3M61U 4J2YB 5H4IB 1Z8GA 1DM4B 2HRVA 3FVFB 1P2OA 1Z7KA 4BXSA 3PWCA 4MPUA 4NWKA 1VITF 3F68H 2QF0A 1BTYA 3A7YA 1GHYH 2FI3E 1LHDH 1YKTA 3B9FH 4U2WA 1TOMH 2QIQA 2VVCA 2PGBB 2ZHWH 1FV9A 3LGVA 2CF9H 1G2MA 1P10A 2V6NA 4J1YA 4NIXA 1SGQE 3S9CA 3SU1A 2CGAA 2F83A 1SGNE 2Q6FA 2VH0A 1QQ4A 3OSYA 3JZ2B 5EG4A 1E0FD 1C4V2 2ANYA 1D6RA 3MU5A 1DICA 3RMOH 2F9UA 2BB4A 2P93A 5AF9H 1GHVH 1C5YB 2GMTB 1PPZA 1UTPA 1KXAA 2YOLA 4ZHLU 1GMDF 3K9XB 1GI5A 2BLWA 1UCYE 1GI3A 4RSPA 2QY0B 4K1TA 3MNSA 2B0FA 3SV8A 3RMLH 2G5NA 3GYMA 3LPRA 3A8AA 1C1NA 2FEQH 3ELAH 4R8TB 2ZHQH 5A09A 1UK3A 1H8IH 4Q80A 1A5IA 1OP8A 2B9LA 2ZTZA 5DP5A 1AZ8A 2NU1E 1C5XB 1GBEA 3KEEA 5FBEA 1DE7H 1O5BB 1VITG 1AY6H 1OKXA 4A6LA 1MTSA 2Q1JA 4Y71A 1ID5H 4KKDA 3F6UH 4MLFB 1EAXA 1NRRH 5B6OA 2AMPA 1B0EA 2OQ5A 2A5IA 4CR9A 1TPAE 5HYOA 2A45B 4XBCA 3U1IB 2EI7A 4B74A 1G36A 4YLQH 5FX6A 2CJIA 3E0NB 1V2VT 2JH0D 4ZROA 1QA0A 2OINA 3GYLB 1GI9B 2Y7XA 4TWWA 2ZCHP 3SJ8A 4XBBA 2CMYA 1CVWH 1BDAA 3QTVH 2XCNA 3KF2A 3OY6U 1GHBG 3ODFA 5IDKA 2FESH 2K1QA 3GDUA 1NROH 2VWNA 1HXEH 1FAXA 3LC3A 2QA9E 3SHAH 3P17H 5C67A 2HVXA 1TNLA 1O3HA 3Q00A 3Q3YA 1HJ8A 1SGFA 4WH6A 3HPTB 2J95A 1D3QB 1J17T 4O03A 3O8CA 2FDAA 2FI5E 1A5HA 2FPZA 2AGEX 1PQAA 4ABFA 3OYPA 3BTTE 1GI6A 1Z71A 5GPIB 3TK9A 2VIVA 4KGAA 3LGWA 2BD5A 1Y8TA 1N6XA 1N8OB 1OWDA 1DITH 4WJG2 1UTKA 2BDHA 4NFEA 1BHXF 5JBAS 1IQHA 2AIPA 4CBNA 2O8UA 1TYNA 1ELFA 1FAKH 1K1OA 1YCPK 1DWCH 3SHCH 3SUDA 3BSQA 1EP5A 5GCHG 4U32A 2TRMA 3ZVEA 1K1JA 4GCHG 3LGTA 4JZ1A 2FP7B 2FOGA 1MKXK 2PKAA 3SNAA 5G4BA 4WMDA 2F9BH 1GL1A 1AIXH 1C2KA 1QIXB 5T6GA 4ABEA 3SV6A 1DUEA 3NUMA 4PROA 1LKAA 4U30A 2OCVB 3BTQE 1SOTA 1C2DA 1C4Y2 1AVGH 1OOKB 5FAHA 4GVUA 1S6HA 3WY8A 1YPLH 1O5EH 4ISHH 2OTVA 1FIWA 1CT0E 4X6OA 4B2CA 1CGIE 1LVOA 4IC5A 3LH3A 1FONA 3VB3A 2XTTB 3PO1C 2BHGA 4MPXA 3R3GB 1O2TA 1ESAA 4FUHA 1SQTA 5J4QA 4JCNA 2ZGXH 3M3VA 1WTGH 3V0XA 2SNVA 1CGJE 1XUIA 2PSXA 2A4QA 1ANEA 2C8ZB 5I46H 2AERH 2D2DA 2VGCB 4U01A 1HAVA 2NWNA 3KNXA 3GY2A 5CE1A 3A88A 1GBFA 2WPJS 2P59A 3K6YA 4K5ZA 3RXHA 2GCHG 3UWJH 1H9HE 1H9LB 4CRBA 4NZQA 4ZKRU 1YBWA 1MBQA 1PPCE 3LJOA 4K1SA 4X1SU 3DT0H 2OP9A 2P8OB 1TX7A 3TVJB 4OGXA 3UTUH 1MTNB 1EPTB 1H9IE 3RXBA 1O3EA 2O8WA 1KSNA 1O2IA 2C8YB 1TRYA 1V3XA 1O2SA 3V13A 1ZJDA 1VCQA 1OPHB 2VIPA 3A7XA 2ZU1A 4JK6A 1SB1H 3QZQA 4X6NA 1SGPE 5E0GA 2F9NA 1TQ7B 2A31A 3SU4A 4TY6A 1MU6B 1W7GH 4XE4A 2ANKH 1ZTLA 1PFXC 3TK6A 5DP4A 2A4OA 5FPTA 2NU0E 4ISLA 5C1UA 4K8YA 5FXLA 1WBGB 1ZPZA 2UUYA 1EQ9A 1O3KA 2AGGX 4CHAB 1KYNA 1T32A 4JYVH 4D7GA 2BDYA 1L4DA 1P03A 2XBVA 1VCWA 1W2KH 1ABIH 3M35A 3S0NA 4JZIA 1O2QA 1TPOA 1S81A 1A46H 1GHBF 4X6PA 1KIGH 1QCPA 1V2JT 1XVMA 3ENSB 1XX9A 3ZZCA 4K2YA 2FLBH 2TGAA 1QBOA 3BN9A 3QX5H 2GD4B 1HRTH 2EI8A 1P3CA 1W12U 3MU1A 2JH5D 3M7UA 1ELCA 1UVSH 1CSOE 1IOEA 1QRZA 1TAWA 1W10U 4X1RU 5DP3A 3SBKA 4AGKA 2NU3E 1WQSA 3I29A 8GCHG 2W3IA 3MO9A 3QZRA 5LPEA 4ZHMU 1N6YA 4KTUA 1H1BA 1UVTH 1NN6A 1HV7A 3ZZ3A 1ELEE 2ZTXA 1NPMA 1YYY1 4NA9H 1K1NA 1O33A 2GDEH 2QV1A 3E3TA 3T29A 3F1SB 2QC2A 1Z8RA 1DUAA 3GCHB 1HPGA 2V35A 4ZHAA 8LPRA 1L1NA 4OS1A 1ZGVA 3KCGH 5L30H 1ESTA 4JZFH 1KXFA 3UR6A 1O2WA 1NFYA 3DFJA 3N7OA 4X2VA 1AB9B 1TALA 1A3EH 3MU0A 1RFNA 4WXIA 3SJKA 4UFDH 2FYRA 1YLDA 1P06A 4DT7B 1GJ8B 1BQYA 2FXRA 1C4U2 4TPIZ 1SMFE 3K2UA 1O3NA 1EB1H 1S6FA 1TMTH 1O35A 2VIDA 1CT4E 4I8LA 1IQGA 1O3IA 3ZV8A 1M9UA 1O31A 1LMWB 1B7XB 3BTME 1C5VA 1SGRE 2STAE 4YOIA 3ZZBA 2FI4E 4K69A 2DE8A 1MD7A 2AS9A 2ZA5A 3CS0A 2M5TA 3M5OA 3OU0A 4XOJA 2FOAA 2TBSA 1W0YH 1GJ5H 2EA3A 3BTWE 3SNDA 1GBCA 2H1UA 1O2VA 2JETB 4ZH8A 1SQAA 2ZU4A 2AIQA 1SFQB 3A80A 1WQVH 2Y82A 3LGUA 1GMHF 2BQ6B 4X2YA 1GI4A 3SJOA 1LDTT 4GSOA 1C2EA 1GHXH 1ELAA 3QDZB 4IMZA 1OS8A 1AU8A 1SI5H 2QYIA 3A81A 3ZZAA 1O2UA 1THRH 2JH6D 1W8BH 1C2FA 3T27A 5F8TA 3D23A 3HKIB 1KLTA 1EX3A 2WPHS 2CV3A 1YPMH 2O8TA 2WYGA 1MZDA 3RXMA 1SOZA 1FIZA 4O97A 1Z1JA 1NY22 1O3DA 1EP6A 1GI8B 2Z3CA 3F9FA 1F0UA 3MNXA 2WINI 2G4TA 3LIWA 5JBCS 1G2LA 2GV6A 3U69H 5BPEA 3UFAA 1MH0A 4JZEH 2Q6DA 3P8NA 4D7FA 1SPJA 2Z9GA 3IWMA 1SQOA 1UCYH 1HLTH 3AASA 2Y5HA 1L1JA 1AE8H 1ZOMA 1ETRH 3F9HA 4XBDA 1DVAH 3ITIA 2A1DB 1F2SE 1XUGA 1UJ1A 5HM2A 1TB6H 1EOJA 1ZHRA 5JB9S 3PTBA 1IQLA 1AD8H 3QO6A 2QXGA 3EYDA 3O8DA 3PLBA 5JYIA 4I31A 4KELA 1WCZA 2VIQA 1O37A 1S0QA 4MTBA 2OC1A 1SGFG 3SI3H 4K60A 1OYTH 1K22H 4TYDA 4X2XA 1XMNB 4B2BA 1LQDB 2ZNKH 2OXSA 2ZGHA 1GBBA 2BD9A 3L6PA 3GCHC 2SGQE 3NPSA 3CENA 2SNWA 4ISOA 2BD8A 2DUCA 2PR3A 1C5TA 4Y0ZE 5E8EH 1BCUH 2BYAX 1YF4A 2XWAA 1NTPA 2FS9A 3ZVFA 3V12A 3E6PH 5HXFA 5DP8A 3UNSA 1W0ZU 1TQ0B 1GBKA 1A1RA 3OY5U 2P3FH 1O2ZA 2VGCC 3A8BA 3TITA 4K3JA 2FX6A 7ESTE 1UVUH 1D6WA 1NS3A 1P0SH 2AMQA 2O8LA 3GCNA 4JYUH 4WH8A 1GJCB 4E7NA 3QTOH 2P3TB 1Q3XA 3M7TA 4X8VH 1GJBB 3NWUA 2ALVA 5F8ZA 2FOMB 2ZTYA 2P8OC 3S69A 2Y6TA 4JK5A 3MHWU 2QXHA 1QHRB 2ZHEH 3GISB 1MTNC 1C5NH 5T3HA 4AGJA 1AFQB 4AZ2B 4NSYA 1X7AC 5L2ZH 1TGTA 1XXFA 2JETC 3URCA 4INKA 1QQUA 2WPIS 2BQWB 4ZUHA 1C1QA 1Y3UA 1AFEH 3B8JA 3KHVA 1VJAU 4DIHH 1SLXB 2W7SA 1V2QT 6CHAB 3GY7A 3PMJA 3HK3B 1O3OA 1D3PB 1C5LH 1NRPH 2OLGA 4MPVA 1UK2A 1BTXA 1MAXA 2XNIA 3DD2H 3RXRA 2GCTB 1DLEA 1LQEA 1HJAC 1ELGA 3E90B 4DCDA 3KQBA 3OX7U 3RXVA 3T62A 3V7TA 2ILNA 2PV9B 1ZHMA 2RA3A 1IQJA 4H4FA 4B1TA 5HMAA 4OS7A 1BITA 1FQ3A 3MH7A 3UOUA 4D9RA 4SGBE 3ZZDA 3KN2A 1C5PA 1V2OT 3NZIA 4Y11E 4F4OC 3ZVGA 1FY4A 4AB9A 4I32A 2SGDE 3SI4H 1MU8B 1ZJKA 1V2UT 6ESTA 5A0BA 1DS2E 1YCPM 3P95A 3W94A 4BTTB 1O32A 1DDJA 5JBTA 1YPGH 1G3BA 2FOHA 1TE0A 3SU3A 1MBMA 4D8NA 1FPCH 2BZ6H 2ZDNA 1NO9H 4QT8C 4UEHH 3NK8A 5IYTA 1CHOF 3O8RA 4TY7A 4DVAU 1VR1H 2GZ8A 2ZU3A 4AG1A 1C1PA 2C4FH 1Y3VA 3BTDE 1HIAA 3LU9B 2C8WB 1KLIH 1QL7A 1YPJH 1O2HA 3H7TA 3H5CB 3P92A 5HM9A 2HNTE 1A0JA 1H8DH 1GHAF 2J92A 1GBJA 2G52A 3U1JB 1JBUH 1HNEE 1HAXB 3SU0A 5T6FA 2IOTA 3LT3A 1O3CA 4BTUB 1ESBA 4X0WU 4UONA 1BTWA 3RMMH 1DWEH 1L0ZA 5ETXA 1HJ9A 1KXEA 3A85A 1MTWA 3SNCA 1UO6A 1GHAG 4AFUA 1AUTC 1G3EA 1GDNA 1NU7B 2CHAB 2CF8H 1NM6A 2BVSH 9ESTA 1UK4A 1BZXE 2BDAA 4FUFA 1IQEA 2VVUA 4I8HA 4YM9A 1UHBA 4Y8YA 1C9TA 4OS2A 2RG3A 4BANB 5AVDA 3RU4T 2ALPA 1MTUA 1CBWB 3SGQE 5FPYA 5JDUB 1C1MA 3A7VA 1HIAB 1P2MA 1JIMA 2BD7A 3BF6H 1RS0A 1SLVB 1S84A 1A0LA 3SV9A 3ATLA 4FUGA 4XFQA 3TH4H 1SGEE 1FDPA 3RXFA 1ELBA 1YLCA 1L1GA 1T8MA 1ZMJA 2H5CA 5T6DA 1AWFH 1QRWA 3LOXA 4F49A 1MAYA 1V6DA 3ZVAA 5GXPA 4XDEA 1HYLA 1MKWK 3LH1A 1PQ5A 1AFQC 2TGTA 3PM3A 1LO6A 3UNQA 3TU7H 1O5DH 1AKSB 1GI1A 4MPWA 2I6QA 3PROA 1G3CA 5LPRA 1P01A 4FUJA 1MQ6A 5DG6A 1WUNH 3RXLA 1FN6A 4GHTA 1IQIA 1TX8A 1GPZA 2H2ZA 3T28A 5EOKA 2J38A 5EW1H 3KQCA 1C1WH 3A82A 3BG4C 2ASUB 7GCHF 2GCTC 3SV7A 4IW4E 1LVBA 5CHAB 4LK4A 1NZQH 1C1VH 1ZRBA 1RJXB 1BBRE 2BX4A 2ZKSA 4X8SH 2ANMH 3RXQA 4YOJA 1ZR0A 4FUDA 1TX6A 4ABBA 3RM2H 3A89A 3AW1A 2H9EH 3SOSA 3TH2H 2J94A 5EPYA 2Y5FA 5E0JA 1T8OA 1DANH 1Z6JH 1C9PA 4X8TH 2BDIA 1AB9C 2OC8A 1OWHA 1YM0A 5TJXA 1AWHB 2A0QB 1ORFA 2TGDA 1MUEB 1TNGA 1ABJH 4WMFA 3HGPA 3JZ1B 3GCOA 1XUKA 3SJIA 2YNBA 1CO7E 1YGCH 4E05H 1VCPA 1KDQB 1P9UA 1KXBA 1EOLA 1O30A 2ZCLP 3BTEE 2BY5X 3GY8A 3UIRA 3QLPH 3TJNA 1GDUA 1C2GA 1D9IA 1O2JA 4X1PU 2ZHDA 1QGFA 8GCHF 4Z6AH 2PUQH 3VB6A 3QWCH 3QN7A 4INLA 3T26A 1SHHB 3LDXH 3SUEA 1CA0B 5A8XA 4DG4A 1H4WA 1F0RA 2FS8A 4FXGH 4TPYA 2HALA 5DK1A 4WXVA 2ZC9H 1C5QA 1LPZB 2ANWA 1V2MT 3EAJA 1Y5AT 2CHAC 1A0HB 2XW9A 4GAWA 1LPKB 3M7QA 2AH4X 1TA6A 1C5MD 1PQ7A 1DWBH 4GPGA 1GHWH 2F3CE 1GWAA 3M5LA 1BB0B 1UVOA 3A8DA 4K1EA 4BAHB 1KXCA 2W26A 2P16A 1CBWC 1DXWA 1NU9A 4AFSA 2IPHA 2BOHB 3SU2A 4DJZB 2BD3A 1CQQA 1JRSA 4ZAEA 2ODPA 5E2PA 1OSSA 1T8NA 2ZFQH 1K1LA 3MMGA 1AUJA 4NIVA 5K0HA 1RTKA 3L3TA 1DSUA 4X1NU 3ZZ6A 2BY7X 4K8BA 1V2TT 1TGNA 1O3JA 4H6TA 1C5OH 1QL9A 2A4GA 4SGAE 4CRDA 1QA7A 4HZHA 1K2I1 5EXMA 2P95A 1GDQA 4H6SB 2TIOA 4X8UH 1TRMA 1Z1IA 1F5RA 1K21H 5EXLA 4CH2B 2ZF0H 4Y7AA 2Y5GA 5LGOA 1ZMLA 2EI6A 1C2HA 3PWBA 1OX1A 3GY3A 1UTJA 3P8FA 1PPFE 3VEQB 3LGIA 2GKVE 2GCHF 3ATWA 3BTHE 1V2ST 9LPRA 2C93B 4ZKOU 4AOQA 1S85A 1LCYA 1L2EA 3MNBA 1C5RA 3W95A 3QGNB 1RXPA 3SU6A 4MQAA 3MFJA 1IQMA 1DOJA 1THPB 4MDSA 1Y5UT 1PPBH 4CRCA 1CGHA 3KQDA 3RUOA 1SGTA 1EAUA 4D9QA 1O36A 1F7ZA 5AFYH 1HDTH 4UE7H 2BY8X 3VXEH 4KP0A 2R9PA 1ZTJA 5EQQA 4B73A 3SU5A 1LVYA 5I25A 1MCTA 1ARCA 1TNHA 3I77A 3EQ0H 3ATMA 5LH8A 1W3CA 3GCTG 3VGCC 3URDA 1RIWC 1O0DH 4MNWA 1K1MA 1DY9A 1V2LT 3SQEE 3TJVA 3SJ9A 3S9AA 2GVFA 3EA9A 2ZU2A 3STJA 5GWZA 2BZAA 1S5SA 4I7YH 4Y10E 2Y81A 3CP7A 5K7RA 1CU1A 3NXPA 1DXPA 1FMGA 3FP6E 3ZYDA 1FI8A 1EKBB 2J34A 2OQUA 2GT8A 1FY8E 1W14U 2W7UA 3MYWA 2JKHA 3P6ZB 1P02A 2LNCA 5GCHF 1QJ7B 1FJSA 3RMNH 4GUXA 1MZAA 5GDSH 2SFAA 2UWLA 3Q76A 3BIVH 1GVLA 1FNIA 2VU8E 4IS5A 1O2PA 1DX5M 1C1UH 1Z8IB 8KME2 1P2IA 2AFQB 4LZ4B 1GJ4H 1GBDA 3OTJE 2WPKS 1SVPA 3DUXH 6GCHG 2ZGCA 2WYJA 1VITH 3C27B 3MI4A 1O5FH 1EZUC 3EA8A 1C5UA 1VZQH 3E1XB 3TGIE 1TPPA 5JPMH 1BA8B 3GDVA 1A2CH 1Z6EA 4ISIH 5BRRE 1XUFA 3ZVCA 2C90B 3UY9A 1LHFH 1RTFB 2ODYB 3RXIA 2OBOA 2FOCA 4B75A 2PWXA 1DWDH 2P3UB 1K9OE 4RKJB 3MH6A 4FU7A 1FY3A 1TNIA 2CXVA 1AN1E 3MH4A 4YESB 1ZSJA 1AVWA 2BD4A 1SGIB 1S0RA 4TWYA 1JIRA 2O8MA 3RXDA 1CHOG 1TGBA 1BTHH 3TNSA 1GI7B 5FHTA 2GGVB 3UPEA 4E06H 4YTAA 3MU4A 3VB7A 1D3DB 1SG8B 3MNCA 2OC0A 8ESTE 2XBWA 3MOCA 1O5AB 1IAUA 4FVDA 1EZSC 1S83A 2ZGJA 1E38B 5CHAC 1G3DA 3PLPA 3Q77A 4IMQA 1AQ7A 4NIWA 4Y6DA 3ZVBA 4NIYA 2FYQA 4NWLA 3FZZA 2PSYA 1L4ZA 2C3SA 2GT7A 4NCYA 1P12E 5HGGA 5ESTE 1FPHH 1F0SA 2XCFA 2FTLE 1QNJA 2PHBA 1P8VC 2QF3A 1FY1A 1V2KT 2GZ9A 1F5LA 2VINA 1NFWA 5FX5A 4AB8A 1CE5A 1GJ6A 3DHKH 2ZECA 3M36A 1FUJA 2J4IA 3DA9B 1WU1A 7KMEH 3RXKA 3ZZ5A 1A61H 1GBHA 2FMJA 3D49H 1XKBC 2TPIZ 3A87A 4NA7A 4Y8ZA 2BVXH 1O38A 1F92A 2A2XH 3E91A 4Y7BA 1T31A 2BXTH 2XWBI 1B0FA 3LJJA 3TK5A 1AHTH 1QJ6B 5E0HA 3KL6A 1AKSA 2GZ7A 2Z9LA 3GY6A 1BRUP 4MG3A 3V3MA 2Z9JA 4WY3A 1MMJN 1UMAH 3MTYA 1SGDE 3MWIU 2BY6X 3A83A 1UTQA 1O3LA 4UFFH 1GBAA 2Z9IA 2AGIX 2WPMS 3H7OA 2VVVA 1MCVA 4Q7ZA 3UOPA 1EPTC 1WOFA 2AMDA 1UVPA 1O5GH 2EEKA 3UQOA 3O8BA 1KXDA 3FZDA 2B7DH 5A0AE 1KDQA 3D62A 1AMHA 1EJAA 2XBXA 1BT7A 4ZKSU 1Q2WA 2QN5T 4DIIH 2G81E 3RXAA 5F6MA 4NZLA 1J16A 1EAWA 1OWEA 1GBMA 1ZPBA 2F9OA 2PUXB 1DY8A 2R3YA 4YZUA 4CHAC 1CHGA 4ABJA 3RXGA 1V2RT 4R0IA 5GJ4B 3VXFH 4AX9H 3SQHE 7GCHG 1UTNA 2WUBA 1RTLA 3RXEA 1GMDG 2A5AA 4YOGA 4BAKB 1T4VH 1UTOA 1QTFA 7LPRA 1EPTA 2ZDMA 1MTVA 1V2PT 3AAVA 2ZFTA 1INCA 1HUTH 1O2LA 1HCGA 1TMBH 4Y79A 2HOBA 5DO4H 2BQ7B 1GG6C 2FOBA 5PTPA 1GHZA 1BUIA 2KAIB 3BTGE 2P94A 1DT2A 2FODA 3SNBA 3D65E 1LPGB 6LPRA 5L6NH 4CRFA 3T2NA 4H42U 2ZU5A 1OWJA 3NKKA 1T8LA 1GVKB 4X2WA 2AEIH 2G4UA 5AHGH 1BMNH 3L33A 1HAHH 2QAAA 1TBQH 2B8OH 1GGDB 5EU8A 4HI3A 1LHGH 4DOQA 3TPIZ 5C5OA 2Z3EA 1UCYK 2FLRH 4FUIA 4ISNA 3SZNA 3ZZ9A 4A92A 1LHCH 3MH5A 5ABWA 1CA8B 1XVOA 4UFEH 4FVBA 3A7TA 5J4SA 3A7ZA 1P3EA 1B5GH 1P04A 3BEIB 3S9BA 1NESE 2G51A 3U8TH 4JMYA 2QXIA 1PYTC 5CMXH 1O3BA 1O2KA 2WV4A 2G8TA 1ZHPA 4BAOB 1C2IA 2HLCA 1O34A 1MD8A 4UD9H 4CBOA 3LKWA 3RM0H 5E2OA 1BRAA 2OUAA 5A8ZA 1ZLRA 4CH8B 4LXBH 3M3SA 5EGMA 3SN8A 1PPHE 2PTNA 4CRGA 3FANA 2ZPRA 1P2KA 1KTSB 1KY9A 1ZZZA 3VB5A 4KTCA 1XXDA 1F0TA 1FY5A 3TLOA 5GIBA 6GCHF 1C1RA 1O2GH 1GBLA 1XUJA 5DP9A 3TNTA 1BOQA 1W7XH 3T25A 5EODA 1EXFA 2WUCA 2G55A 4ZKNU 1EATA 3GOVB 1OYQA 4AYVB 3E0PB 3ATIA 3HK6B 2BY9X 1O2NA 4BXWA 1A7SA 2NU4E 3RU4E 3SORA 1BJUA 1DFPA 1GCTC 1VGCC 3B23B 1C5WB 1QRXA 1QFKH 1YPHC 1GJAB 3AAUA 5FCRA 4HFPB 1QL8A 1IHSH 3SV2H 5EXNA 3QUMP 1NRNH 2R0KA 4BNRA 2SGFE 1AZZA 2FOFA 4Q2KA 2HGTH 1RD3B 2F91A 4NSVA 1MKWH 2BLVA 2PLXA 5C20A 2QXJA 3QK1A 1IQFA 1TONA 2ZHFH 1YP9A 1XKAC 1YPHE 3BIUH 1FN8A 3RLWH 4I8JA 2VWOA 2ZFFH 2A32A 1KTTB 3EA7A 2R2MB 3Q3KA 4YLUA 1LTOA 1G37A 1WV7H 4INHA 1O3AA 1C2LA 3GCTF 1J14A 4Z0KA 4MVNA 2HPQH 2J9NA 2ZI2H 1JWTA 1N1LA 3GY4A 3BV9B 2Y80A 2QGRA 2QCYA 4O3TA 1WAYB 1QBNA 4YO9A 4O3UA 2H6MA 1O3MA 3K6ZA 3BTFE 4IGDA 2THFB 1RIWB 2Y7ZA 1Y5BT 4BOHA 4DURA 1YCPH 3TGJE 2XBYA 1LHEH 5AFZH 4ASHA 3TIUA 5DPAA 4IBLH 3PV4A 2YNAA 2BVRH 2VNTA 2ZDKA 1TBZH 1F5KU 1G9IE 3MO6A 4ZXYH 4FU8A 1S82A 3PYHA 2IJOB 2PKAB 2A4RA 3M5NA 1GI2A 1PYTD 1GGDC 1ARBA 1G32B 4D76A 5SGAE 3MU8A 3RXPA 1FZZA 2ZWLH 1SR5C 1T4UH 1ZYOA 4GCHF 4A7IB 2ZPSA 1MQ5A 2XC5A 2UUFB 3TH3H 5L2YH 2R3UA 1EASA 3RDZA 2BLQA 1D4PB 3C1KA 2GP9B 1T7CA 2V0BA 1ACBE 4XSKU 2WPLS 5EQSA 4YT7H 2ZDVH 1SGYE 4AN7A 1TBRH 4LOYH 5DGJA 2PW8H 2OD3B 3KGPA 1ZPCA 2VB0A 3P8GA 3KIDU 1PPGE 3UR9A 1P05A 1O39A 4Y8XA 2STBE 1ELVA 2ZGBH 3UUZA 3Q3XA 1C5ZB 1GL0E 4A1TA 1C2JA 1C2MA 3AVZA 1JMOH 1JOUB 1O5CB 2FZZA 4IN2A 5EW2H 2XC4A 2ZIQH 2FX4A 1P11E 1Y3WA 1BBRH 3VFEA 1K1IA 1SC8U 3EGKH 2BMGB 3RP2A 1GCDA 2BDCA 5TCCA 2Z3DA 2KAIA 2A5KA 2H9HA 1EZQA 3UREA 1OWIA 6CHAC 3A86A 3ESTA 4Y0YE 2TGPZ 3TJOA 4CR5A 5LPFA 2F9VA 2XRCA 1JRTA 2ZDAH 3UNRA 2A7CA 4HGCA 2FM2A 1O3PB 3ZV9A 1WTHD 1BRCE 1LKBA 2AYWA 3PMBB 2ZP0H 4DY7B 1HJAB 4NGAH 5EQRA 1QBVH 2A7HA 3ZZ7A 4AFZA 1HFDA 2V3HH 5C5NA 3BG8A 1TPSA 1TRNA 5EPNA 4MNXA 4Q7YA 2D26C 1HAIH 4FUCA 4ABHA 4VGCC 3NCLA 2Z7FE 4DW2U 2ZCKP 4FUBA 2BD2A 5A2MH 1IQKA 4JYTA 1P2NA 1QB1A 3U98H 1SSXA 1FLEE 3SUFA 3S7KB 1GG6B 1GI0A 1BIOA 2H5DA 3G01A 2LPRA 5FCKA 2ZFRH 3PB1E 5TCAA 4LZ1H 1GMHG 5A8YA 1NT1A 4YT6H 2SGAA 4B76A 4WWYA 2ZG0H 1FXYA 2A7JA 1JXPA 4ZMAH 3EDXB 1IQNA 1O2RA 1TNJA 2XXLA 4M7GA 3ZZ4A 3ZVDA 4A5TS 1QB9A 2ZFPH 4FU9A 1ELDE 3IITA 1QJ1B 1P9SA 3RXUA 1ZRKA 3HATH 1PJPA 2FTMA 2FO9A 2RDLA 1SLUB 4AORA
chains in the Genus database with same CATH superfamily
4THNH 5DP7A 3F9GA 2PKSB 1EUFA 1GJ7B 3OAAD 2B5TB 1TFXA 3UWIA 5JB8S 3FFGA 1Y59T 1TLDA 2ZEBA 4AG2A 3PMAB 3DCLA 3A8CA 5C3NA 1GVZA 1TOCB 4Q7XA 2XYAA 1AGJA 3OFND 3GICB 3PMHB 1O2XA 1TGCA 1GJ9B 1LVMA 4IN1A 3VPKA 1ZMNA 3K65B 1E35B 3GY5A 1E1RD 2D1JA 4RKOB 4BAQB 2EY4C 4X6MA 1HAYB 4CRAA 2GX4A 2HNTF 1Y3XA 4OS5A 4B71A 1C5SA 2UWPA 2FIRH 4B2AA 2CN0H 3RXOA 3FP7E 1TMUH 2WSSD 3M5MA 1BTZA 1ZSLA 4TT3D 1EJNA 1J15A 2BTCE 2UUKB 3T5FH 3BTKE 2OBQA 4OM9A 1GCTB 1VGCB 3VB4A 3ZZ8A 1SGCA 4ABIA 4B6EA 1OXGA 1RRKA 2O9QA 2RCEA 2W3KA 2FWWA 1ELTA 1HAVB 1HB0B 1V2NT 3PTNA 5FPSA 4A1VA 1G30B 5FBIA 2PFEA 3RXJA 2F43B 3AW0A 1BMMH 2KFWA 4MNYA 1XM1A 4I33A 2NU2E 2J2UA 2BOKA 4WMEA 2YMSB 1NRSH 3RXCA 2ZFSA 2EC9H 5DKMA 1EAIA 3RXTA 4NA8A 4F48B 2BDBA 1RGQA 4ESTE 1U6QA 2PGQB 1SHYA 4A1XA 1SFIA 5F03A 1PQ8A 2GV7A 2FOEA 3P70B 4ABDA 3RC4A 1PPEE 3GDSA 1C1TA 1XUHA 3RC5A 5JBBS 3U8RH 4P00A 5ESBA 1DSTA 1WYKA 1AE5A 2D8WA 1BRBE 1J8AA 1TGSZ 1SL3A 2ULLA 3CS7A 4VGCB 3M37A 3F9EA 1P2QA 4CREA 3QGJA 4BAMB 1EZXC 2UWOA 2R2WU 1OWKA 3ZYEA 2VH6A 3PLKA 1OP0A 4JZDH 1MKXH 1NFUA 1GJDB 1HBTH 3ATKA 1YPEH 3E16B 1UTLM 3BEUA 3SUGA 2KX4A 1A5GH 1ZGIA 2VIWA 1O3FA 4UDWH 1C1SA 1P57B 1W13U 2OC7A 1ANDA 2Z6BD 1ZSKA 1GBTA 1P09A 1TA2A 1QY6A 2GDDA 2ODQA 3MO3A 3U8OH 4FUEA 1BMAA 3A84A 2BM2A 2HWLB 3SGBE 2UUJB 4ABGA 4UFGH 2BX3A 1HXFH 1QR3E 1K28D 3IG6B 1OP2A 4KTSA 3RU4D 1Y3YA 1CA0C 2ZZUH 3RXSA 3SO3A 1P2JA 1ZTKA 4IC6A 1EB2A 2PKSC 3KQEA 1N8OC 1QB6A 5A0CA 4AYYB 2VWMA 2C8XB 2BDGA 1NRQH 2W5EA 1K1PA 1Z8JB 3HKJB 3SNEA 2WV5A 3LC5A 1AO5A 3HGNA 3TJUA 3M3TA 1BHXB 2VIOA 1ETTH 1O3GA 1YPKH 4NFFA 4OS6A 1A4WH 1BMFD 1C1OA 1THSH 1IHTH 1E36B 5C2ZA 2R0LA 2I6SA 1GBIA 3ODDA 3U9AH 2PTCE 1QURH 2ZPQA 3BG4B 2GMTC 2Z9KA 3LONA 3F2FA 1SBWA 5GNDA 3RC6A 3STIA 2XC0A 2DE9A 1J9CH 1TIOA 4I8GA 3RLYH 2ZDLA 4I8KA 1HAZB 2SGEE 2SGPE 4NG9H 2RA0A 1E37B 1WSSH 1NFXA 2VWLA 1GMCF 2BXUH 4Y76A 1V2WT 2HPPH 1HAOH 1AVXA 1SLWB 4WF8A 4O9VA 4DGJA 1E34B 2H9TH 2ZQ2A 2BLOA 3PO1B 2G00A 3UQVA 3A7WA 3DFLA 1NC6A 4OGYA 5DP6A 1ANCA 1HAGE 1BTUA 1O2OA 1YC0A 3EE0B 1D3TB 1W11U 4GHQA 2Z94A 1VJ9U 4MNVA 1TABE 2HNTC 1TNKA 4ZXXH 2G5VA 5F8XA 1BBRK 2A2QH 1CT2E 3E8LA 1BTPA 1DPOA 1AI8H 1BMLA 1GMCG 1O2YA 1O2MA 4HTCH 3ZIAD 1EJMA 1UHBB 1HAPH 3P8OA 4X1QU 3SGAE 2Q6GA 1A3BH 3FP8E 4ABAA 3R0FA 5C1XA 1KLJH 2ZQ1A 3BEFB 5DJ7A 1ETSH 1Q31A 4RN6A 1ANBA 2V3OH 3LGYA 3S7HB 3VGCB 2GTBA 3I78A 2F9PA 1UTMA 3TGKE 4OS4A 4AFQA 4WVPE 4GLYA 4BTIB 1HGTH 5KGOA 2KZ4A 1BJVA 2VJ1A 2ESTE 3SW2B 4E7RG 2ZO3H 1DLKB 5C1YA 2IN2A 3FAOA 1TWXB 3M61U 4J2YB 5H4IB 1WXRA 1Z8GA 1DM4B 2HRVA 3FVFB 1P2OA 1Z7KA 4BXSA 3PWCA 4MPUA 4NWKA 1VITF 3SYJA 3F68H 2QF0A 1BTYA 3A7YA 1GHYH 2FI3E 1LHDH 1YKTA 3B9FH 4U2WA 1TOMH 2QIQA 2VVCA 2PGBB 2ZHWH 1FV9A 3LGVA 2CF9H 1G2MA 1P10A 2V6NA 4J1YA 4NIXA 1SGQE 3S9CA 3SU1A 2CGAA 2F83A 1SGNE 2Q6FA 2VH0A 1QQ4A 1WDIA 3OSYA 3JZ2B 5EG4A 1E0FD 1C4V2 2ANYA 5EJLA 1D6RA 3MU5A 1DICA 2IPQX 3RMOH 2F9UA 2BB4A 2P93A 5AF9H 1GHVH 1C5YB 1UW7A 2GMTB 1PPZA 1UTPA 1KXAA 2YOLA 4ZHLU 1GMDF 3K9XB 1GI5A 2BLWA 1UCYE 1GI3A 4RSPA 2QY0B 4K1TA 3KYGA 3MNSA 2B0FA 3SV8A 3RMLH 2G5NA 3GYMA 3LPRA 1FX0B 3A8AA 1C1NA 2FEQH 3ELAH 4R8TB 2ZHQH 5A09A 1UK3A 1H8IH 4Q80A 2IJD1 1A5IA 1OP8A 2B9LA 2ZTZA 5DP5A 1AZ8A 2NU1E 1C5XB 1GBEA 5B6LA 3KEEA 5FBEA 1DE7H 1O5BB 1VITG 1AY6H 1OKXA 4A6LA 1MTSA 2Q1JA 4Y71A 1ID5H 4KKDA 3F6UH 4MLFB 1EAXA 1NRRH 5B6OA 3F0OA 2AMPA 1B0EA 2OQ5A 2A5IA 4CR9A 1TPAE 5HYOA 2A45B 4XBCA 3U1IB 2EI7A 4B74A 1G36A 4YLQH 5FX6A 2CJIA 3E0NB 1V2VT 2V3MA 2JH0D 4ZROA 1QA0A 2OINA 3GYLB 1GI9B 2Y7XA 4TWWA 2ZCHP 3SJ8A 4XBBA 2CMYA 1CVWH 1BDAA 3QTVH 2XCNA 3KF2A 3OY6U 1GHBG 2YMSD 3ODFA 5IDKA 2FESH 2K1QA 3GDUA 1NROH 2VWNA 1HXEH 1FAXA 3LC3A 1W0JD 2QA9E 4ASUD 3SHAH 3P17H 3U28C 5C67A 2HVXA 1TNLA 1O3HA 3Q00A 3Q3YA 1HJ8A 1SGFA 4WH6A 3HPTB 2J95A 1D3QB 1J17T 4O03A 3O8CA 2FDAA 2FI5E 1A5HA 2FPZA 2AGEX 1PQAA 4ABFA 3OYPA 3BTTE 1GI6A 1Z71A 5GPIB 3TK9A 2VIVA 4KGAA 3LGWA 2BD5A 1Y8TA 1N6XA 1N8OB 1OWDA 1DITH 4WJG2 1UTKA 2BDHA 4NFEA 1BHXF 5JBAS 1IQHA 2AIPA 4CBNA 2O8UA 1TYNA 1ELFA 1FAKH 1K1OA 1YCPK 1DWCH 3SHCH 3SUDA 3BSQA 1EP5A 5GCHG 4U32A 2TRMA 3ZVEA 1K1JA 4GCHG 3LGTA 4JZ1A 2FP7B 2FOGA 1MKXK 1QZ8A 2PKAA 3SNAA 5C94A 5G4BA 4WMDA 2F9BH 1GL1A 1AIXH 1C2KA 1QIXB 5T6GA 4ABEA 3SV6A 1DUEA 3NUMA 4PROA 1LKAA 4U30A 2OCVB 3BTQE 1SOTA 1C2DA 1C4Y2 1AVGH 1OOKB 5FAHA 4GVUA 1S6HA 3WY8A 1YPLH 1O5EH 4ISHH 2OTVA 1FIWA 1CT0E 4X6OA 4B2CA 2WHXA 1CGIE 1LVOA 4IC5A 2KCAA 3LH3A 1FONA 3VB3A 2XTTB 3PO1C 2BHGA 4MPXA 3R3GB 1O2TA 1ESAA 4FUHA 1SQTA 5J4QA 4JCNA 2ZGXH 3M3VA 1WTGH 3V0XA 3GS9A 2SNVA 1CGJE 1XUIA 2PSXA 2A4QA 1ANEA 2C8ZB 5I46H 2AERH 2D2DA 2VGCB 4U01A 1HAVA 2NWNA 3KNXA 3GY2A 5CE1A 3A88A 1GBFA 2WPJS 2P59A 3K6YA 4K5ZA 3RXHA 2GCHG 3UWJH 2OK5A 1H9HE 1H9LB 4CRBA 4NZQA 5DSFA 4ZKRU 1YBWA 1MBQA 1PPCE 3LJOA 4K1SA 4X1SU 3DT0H 2OP9A 2P8OB 1TX7A 3TVJB 4OGXA 3UTUH 1MTNB 1EPTB 3N7EA 1H9IE 3RXBA 1O3EA 2O8WA 1KSNA 1O2IA 2C8YB 1TRYA 1V3XA 1O2SA 3V13A 1ZJDA 1VCQA 1OPHB 2VIPA 3A7XA 2ZU1A 4JK6A 1SB1H 3QZQA 4X6NA 1SGPE 5E0GA 2F9NA 1TQ7B 2A31A 3SU4A 4TY6A 2XNDD 1MU6B 1W7GH 4XE4A 2ANKH 2KCYA 1ZTLA 1PFXC 3TK6A 5DP4A 2A4OA 5FPTA 2NU0E 4ISLA 5C1UA 4K8YA 5FXLA 1WBGB 1ZPZA 2UUYA 1EQ9A 1O3KA 2AGGX 4CHAB 1KYNA 1T32A 4JYVH 4D7GA 2BDYA 1L4DA 1P03A 2XBVA 1VCWA 1W2KH 1ABIH 3M35A 3S0NA 4JZIA 1O2QA 1TPOA 1S81A 1A46H 1GHBF 4X6PA 1KIGH 1QCPA 1V2JT 1XVMA 3ENSB 1XX9A 3ZZCA 4K2YA 1YLNA 2FLBH 2TGAA 1QBOA 3BN9A 3QX5H 2GD4B 1HRTH 2EI8A 1P3CA 1W12U 3MU1A 2JH5D 3M7UA 1ELCA 1UVSH 1CSOE 1IOEA 1QRZA 1TAWA 1W10U 4X1RU 5DP3A 3SBKA 4AGKA 2NU3E 1WQSA 3I29A 8GCHG 2W3IA 3MO9A 3QZRA 5LPEA 4ZHMU 1N6YA 3PV5A 4KTUA 1H1BA 1UVTH 1NN6A 1HV7A 3ZZ3A 1ELEE 2ZTXA 1NPMA 1YYY1 4NA9H 1K1NA 1O33A 2GDEH 2QV1A 3E3TA 3T29A 3F1SB 2QC2A 1Z8RA 1DUAA 3GCHB 1HPGA 2V35A 4ZHAA 8LPRA 3FO8D 1L1NA 4OS1A 1ZGVA 3KCGH 5L30H 1ESTA 4JZFH 1KXFA 3UR6A 1O2WA 1NFYA 3DFJA 3N7OA 4X2VA 1AB9B 1TALA 1A3EH 3MU0A 1RFNA 4WXIA 3SJKA 4UFDH 2FYRA 1YLDA 1P06A 4DT7B 1GJ8B 1BQYA 2FXRA 1C4U2 4TPIZ 1SMFE 3K2UA 1O3NA 1EB1H 1S6FA 1TMTH 1O35A 2VIDA 1CT4E 4I8LA 1IQGA 1O3IA 3ZV8A 1M9UA 1O31A 2RFKC 1LMWB 1B7XB 3BTME 1C5VA 1SGRE 2STAE 4YOIA 3ZZBA 2FI4E 4K69A 2DE8A 1MD7A 2AS9A 2ZA5A 3CS0A 2M5TA 3M5OA 3OU0A 4XOJA 2FOAA 2TBSA 1W0YH 1GJ5H 2EA3A 3BTWE 3SNDA 1GBCA 2H1UA 1O2VA 2JETB 4ZH8A 1SQAA 2ZU4A 2AIQA 1SFQB 3A80A 1WQVH 2Y82A 3LGUA 1GMHF 2BQ6B 4X2YA 1GI4A 3SJOA 1LDTT 4GSOA 1C2EA 1GHXH 1ELAA 3QDZB 4IMZA 1OS8A 1AU8A 1SI5H 2QYIA 3A81A 3ZZAA 1O2UA 1THRH 2JH6D 1W8BH 1C2FA 3T27A 5F8TA 3D23A 3HKIB 3W1EA 1KLTA 1EX3A 2WPHS 2CV3A 1YPMH 2O8TA 2WYGA 3F2GA 1MZDA 3RXMA 1SOZA 1FIZA 2XOKD 4O97A 1Z1JA 1NY22 1O3DA 1E79D 1EP6A 1GI8B 2Z3CA 3F9FA 1F0UA 3MNXA 2WINI 2G4TA 3LIWA 5JBCS 1G2LA 2GV6A 3U69H 5BPEA 3UFAA 1MH0A 4JZEH 2Q6DA 3P8NA 4D7FA 1SPJA 2Z9GA 3IWMA 1SQOA 1UCYH 1HLTH 3AASA 2Y5HA 1L1JA 1AE8H 1ZOMA 1ETRH 3F9HA 4XBDA 1DVAH 3ITIA 2A1DB 4P02A 1F2SE 1XUGA 1UJ1A 5HM2A 1TB6H 1EOJA 1ZHRA 5JB9S 3PTBA 1IQLA 1AD8H 3QO6A 2QXGA 3EYDA 3O8DA 3PLBA 5JYIA 4I31A 4KELA 1WCZA 2WPDD 2VIQA 1O37A 1S0QA 4MTBA 2OC1A 1SGFG 3SI3H 4K60A 1OYTH 1K22H 4TYDA 4X2XA 1XMNB 4B2BA 4RT1A 1LQDB 2ZNKH 2OXSA 2ZGHA 1GBBA 2BD9A 3L6PA 3GCHC 2SGQE 3NPSA 3CENA 2SNWA 4ISOA 2BD8A 2DUCA 2PR3A 1C5TA 4Y0ZE 5E8EH 1BCUH 2BYAX 1YF4A 2J5UA 1NTPA 2FS9A 2XWAA 3ZVFA 3V12A 3E6PH 5HXFA 1KMHB 3N7DA 5DP8A 3UNSA 1W0ZU 1TQ0B 1GBKA 1A1RA 3OY5U 2P3FH 1O2ZA 2VGCC 3A8BA 3TITA 4K3JA 1EFRD 2FX6A 7ESTE 1UVUH 1D6WA 1NS3A 1P0SH 2AMQA 2O8LA 3GCNA 4JYUH 4WH8A 1GJCB 4B6FA 4E7NA 3QTOH 2P3TB 1Q3XA 3M7TA 4X8VH 1GJBB 3NWUA 2ALVA 5F8ZA 2FOMB 2ZTYA 2P8OC 3S69A 2Y6TA 4JK5A 3MHWU 2QXHA 1QHRB 2W6ID 2ZHEH 3GISB 3PV2A 1MTNC 1C5NH 5T3HA 4AGJA 1AFQB 4AZ2B 4NSYA 1X7AC 5L2ZH 1TGTA 1XXFA 2JETC 3URCA 4INKA 1QQUA 2WPIS 2BQWB 2KR7A 4ZUHA 1C1QA 1Y3UA 1AFEH 3B8JA 3KHVA 1VJAU 4DIHH 1SLXB 2W7SA 1V2QT 6CHAB 3GY7A 3PMJA 3HK3B 1O3OA 1D3PB 1C5LH 1NRPH 2OLGA 4MPVA 1UK2A 1BTXA 1MAXA 2XNIA 3DD2H 3RXRA 2GCTB 1DLEA 1LQEA 1HJAC 1ELGA 3E90B 4DCDA 3KQBA 3OX7U 4XD7D 3RXVA 3T62A 3V7TA 2ILNA 2PV9B 1ZHMA 2RA3A 1IQJA 4H4FA 4B1TA 5HMAA 4OS7A 1BITA 1FQ3A 3MH7A 3UOUA 4D9RA 4SGBE 3ZZDA 3KN2A 1C5PA 1V2OT 3NZIA 4Y11E 4F4OC 3ZVGA 1FY4A 4AB9A 4I32A 2SGDE 3SI4H 1MU8B 1ZJKA 1V2UT 1YWUA 6ESTA 5A0BA 1DS2E 1YCPM 3P95A 3W94A 4BTTB 1O32A 1DDJA 5JBTA 1YPGH 1G3BA 2FOHA 1TE0A 2GJGA 3SU3A 1MBMA 4D8NA 1FPCH 2KM0A 2BZ6H 2ZDNA 1NO9H 4QT8C 4UEHH 3NK8A 5IYTA 1CHOF 3O8RA 4TY7A 4DVAU 1VR1H 2GZ8A 2ZU3A 4AG1A 1C1PA 2C4FH 1Y3VA 3BTDE 1HIAA 3LU9B 2C8WB 1KLIH 1QL7A 1YPJH 1O2HA 3H7TA 3H5CB 2EQNA 3P92A 4Z1MD 5HM9A 2HNTE 1A0JA 1S6LA 1H8DH 1GHAF 2CK3D 2J92A 1W0KD 4FOUC 1GBJA 2G52A 3U1JB 3AK5A 1JBUH 1HNEE 1HAXB 3SU0A 5T6FA 2IOTA 3LT3A 1O3CA 4BTUB 1ESBA 4X0WU 4UONA 1BTWA 3RMMH 1DWEH 1L0ZA 5ETXA 1HJ9A 1KXEA 2RDEA 3A85A 1MTWA 5EJZA 3SNCA 1UO6A 1GHAG 3NRLA 4AFUA 1AUTC 1G3EA 1GDNA 1NU7B 2CHAB 2CF8H 1NM6A 2BVSH 9ESTA 1UK4A 1BZXE 2BDAA 4FUFA 2JIZD 1IQEA 2VVUA 4I8HA 2LP6A 4YM9A 1UHBA 4Y8YA 1C9TA 4OS2A 2RG3A 4BANB 5AVDA 3RU4T 2ALPA 1MTUA 1CBWB 3SGQE 5FPYA 5JDUB 1C1MA 3A7VA 1HIAB 1P2MA 1JIMA 2BD7A 3BF6H 1RS0A 1SLVB 1S84A 1A0LA 3SV9A 2WZQA 3ATLA 4FUGA 4XFQA 3TH4H 1SGEE 1FDPA 3RXFA 1ELBA 1YLCA 2F4LA 1L1GA 1T8MA 5C17A 1ZMJA 3EE7A 2H5CA 5T6DA 1AWFH 1QRWA 3LOXA 4F49A 1MAYA 1V6DA 4YXWD 3ZVAA 5GXPA 4XDEA 1HYLA 1MKWK 3LH1A 1PQ5A 1AFQC 2TGTA 3PM3A 1LO6A 3UNQA 3TU7H 1O5DH 1AKSB 1GI1A 4MPWA 2I6QA 3PROA 1G3CA 5LPRA 1P01A 4FUJA 1MQ6A 5DG6A 4HG6A 1WUNH 3RXLA 1FN6A 4GHTA 1IQIA 1TX8A 1GPZA 2H2ZA 1VKYA 3T28A 5IK2D 5EOKA 2J38A 5EW1H 3KQCA 5EJ1A 1C1WH 3A82A 3BG4C 2ASUB 7GCHF 3N99A 2GCTC 4RI0A 3SV7A 4IW4E 1LVBA 5CHAB 4LK4A 1NZQH 1C1VH 2LELA 1ZRBA 1RJXB 1BBRE 2BX4A 2ZKSA 4X8SH 2ANMH 3RXQA 4YOJA 1ZR0A 4FUDA 1TX6A 4ABBA 3RM2H 3A89A 3AW1A 2H9EH 3SOSA 3TH2H 2J94A 5EPYA 2Y5FA 5E0JA 1T8OA 1DANH 1Z6JH 1C9PA 4I86A 2BDIA 1AB9C 4X8TH 2OC8A 1OWHA 1YM0A 5TJXA 1AWHB 2A0QB 1ORFA 2TGDA 1MUEB 1TNGA 1ABJH 4WMFA 3HGPA 3JZ1B 3GCOA 1XUKA 3SJIA 2YNBA 1CO7E 1YGCH 4E05H 1VCPA 1KDQB 1P9UA 1KXBA 1EOLA 1O30A 2ZCLP 3BTEE 2BY5X 3GY8A 3UIRA 3QLPH 3TJNA 1GDUA 1C2GA 1D9IA 1O2JA 4X1PU 2ZHDA 1QGFA 8GCHF 4Z6AH 2PUQH 3VB6A 3QWCH 3WWFA 3QN7A 4INLA 3T26A 1SHHB 2M2AA 3LDXH 3SUEA 1CA0B 5A8XA 4DG4A 1H4WA 1F0RA 2FS8A 4FXGH 4TPYA 2PP6A 2HALA 5DK1A 4WXVA 2ZC9H 1C5QA 2ANWA 1LPZB 1V2MT 3EAJA 1Y5AT 2CHAC 1NBMD 1A0HB 3KQ5A 2XW9A 4GAWA 1LPKB 3M7QA 2AH4X 1TA6A 1C5MD 1PQ7A 1DWBH 4GPGA 1GHWH 2F3CE 1GWAA 3M5LA 1BB0B 1UVOA 3A8DA 4K1EA 4BAHB 1KXCA 2QE7D 2W26A 2P16A 1CBWC 1DXWA 1NU9A 2VBCA 4AFSA 2IPHA 2BOHB 3SU2A 4DJZB 2BD3A 1CQQA 3WW7A 1JRSA 4ZAEA 2ODPA 5E2PA 1OSSA 1T8NA 2ZFQH 1K1LA 3MMGA 1AUJA 4NIVA 5K0HA 1RTKA 3L3TA 1DSUA 4X1NU 3ZZ6A 2BY7X 4K8BA 1V2TT 1TGNA 1O3JA 4H6TA 1C5OH 1QL9A 2A4GA 4SGAE 4CRDA 1QA7A 4HZHA 1K2I1 5EXMA 5CDFE 2P95A 1GDQA 4H6SB 2TIOA 4X8UH 1TRMA 1Z1IA 1F5RA 1K21H 5EXLA 4CH2B 2ZF0H 4Y7AA 2Y5GA 5LGOA 1ZMLA 2EI6A 1C2HA 3PWBA 1OX1A 3GY3A 1UTJA 3P8FA 1PPFE 2QF5A 3VEQB 3LGIA 2GKVE 2GCHF 3ATWA 3BTHE 1V2ST 9LPRA 2C93B 4ZKOU 4AOQA 1S85A 1LCYA 1L2EA 3MNBA 1C5RA 3W95A 3QGNB 1RXPA 3SU6A 1K0HA 4MQAA 3MFJA 1IQMA 1DOJA 1THPB 4MDSA 5FL7D 1Y5UT 1PPBH 4CRCA 1CGHA 3KQDA 3RUOA 1SGTA 1EAUA 4D9QA 1O36A 1F7ZA 5AFYH 5C0UA 1HDTH 4UE7H 2BY8X 3VXEH 4KP0A 2R9PA 1ZTJA 5EQQA 4B73A 3SU5A 1LVYA 5I25A 1MCTA 1ARCA 1TNHA 3I77A 3UAIC 3EQ0H 1COWD 3ATMA 5LH8A 1W3CA 3GCTG 3VGCC 3URDA 1RIWC 1O0DH 4MNWA 5HIYA 1K1MA 1DY9A 1V2LT 3SQEE 3TJVA 3SJ9A 5HIZA 3S9AA 2GVFA 4M9FA 3FOAA 3EA9A 2ZU2A 3STJA 5GWZA 2BZAA 1S5SA 4I7YH 4Y10E 2Y81A 3CP7A 5K7RA 1CU1A 3NXPA 1DXPA 1FMGA 3FP6E 3ZYDA 1FI8A 1EKBB 2J34A 2OQUA 2GT8A 1FY8E 1W14U 2W7UA 3MYWA 2JKHA 3P6ZB 1P02A 2LNCA 5GCHF 1MABB 4Q63A 1QJ7B 4ZCNA 1FJSA 3RMNH 4GUXA 1MZAA 5GDSH 2SFAA 2UWLA 3Q76A 3BIVH 1GVLA 1FNIA 2VU8E 4TSFD 4IS5A 1O2PA 1DX5M 1C1UH 1Z8IB 8KME2 1P2IA 1NBME 2AFQB 2HVYB 4LZ4B 1GJ4H 4ACAA 1GBDA 3OTJE 2WPKS 1SVPA 3DUXH 6GCHG 2ZGCA 2WYJA 1VITH 3C27B 3MI4A 1O5FH 1EZUC 3EA8A 1C5UA 1VZQH 3E1XB 3TGIE 1TPPA 5JPMH 1BA8B 3GDVA 1A2CH 1Z6EA 4ISIH 5BRRE 1XUFA 3ZVCA 1H8ED 2C90B 3UY9A 1LHFH 1RTFB 2ODYB 3RXIA 2OBOA 2FOCA 2V7QD 4B75A 3WWBA 2PWXA 1DWDH 2P3UB 1K9OE 4RKJB 3MH6A 4FU7A 1FY3A 1TNIA 2CXVA 1AN1E 3MH4A 4YESB 1ZSJA 2JJ1D 1AVWA 2BD4A 1SGIB 1S0RA 4TWYA 2O8MA 1JIRA 2K0QA 3RXDA 5KEDA 1CHOG 1TGBA 1BTHH 3TNSA 1GI7B 5FHTA 2GGVB 3UPEA 4E06H 4YTAA 3MU4A 4XRNA 3VB7A 1D3DB 1SG8B 3SZEA 3MNCA 2OC0A 8ESTE 2XBWA 3MOCA 1O5AB 1IAUA 4FVDA 1EZSC 1S83A 2ZGJA 1E38B 5CHAC 1G3DA 3PLPA 3Q77A 4IMQA 1AQ7A 4NIWA 4Y6DA 3ZVBA 4NIYA 2FYQA 4NWLA 3FZZA 2PSYA 1L4ZA 2C3SA 2GT7A 4NCYA 1P12E 5HGGA 5ESTE 1FPHH 1F0SA 2XCFA 2FTLE 1QNJA 2PHBA 1P8VC 2QF3A 1FY1A 1V2KT 2GZ9A 1F5LA 3OEHD 2VINA 1NFWA 5FX5A 4AB8A 1CE5A 1H8HD 1GJ6A 3DHKH 2ZECA 2AHME 3M36A 1FUJA 2J4IA 3DA9B 1WU1A 7KMEH 3RXKA 3ZZ5A 1A61H 1GBHA 2FMJA 3D49H 1XKBC 2TPIZ 3A87A 4NA7A 4Y8ZA 2BVXH 1O38A 1F92A 2A2XH 3MQKC 3E91A 4Y7BA 1T31A 2BXTH 2XWBI 3H09A 3DSGA 1B0FA 3LJJA 3TK5A 1AHTH 1QJ6B 5E0HA 3KL6A 1AKSA 2GZ7A 2Z9LA 3GY6A 1BRUP 4MG3A 3V3MA 2Z9JA 4WY3A 1MMJN 1UMAH 3MTYA 1SGDE 3MWIU 2BY6X 3A83A 1UTQA 3OTPA 4RT0A 1O3LA 4UFFH 1GBAA 2Z9IA 2AGIX 2WPMS 3H7OA 2VVVA 1MCVA 4Q7ZA 3UOPA 1EPTC 5HKKD 1WOFA 2AMDA 1UVPA 1O5GH 2EEKA 3UQOA 3O8BA 1KXDA 3FZDA 2B7DH 5A0AE 1SQRA 1KDQA 3D62A 1AMHA 4AC9A 3FKSD 1EJAA 2XBXA 1BT7A 4ZKSU 1Q2WA 2QN5T 4DIIH 2G81E 3RXAA 5F6MA 5DN6D 5C0TA 4NZLA 1J16A 1EAWA 1OWEA 1GBMA 1ZPBA 2F9OA 2PUXB 1OHHD 1DY8A 2QF4A 2R3YA 4YZUA 4CHAC 1CHGA 4ABJA 3RXGA 1V2RT 4R0IA 5GJ4B 3VXFH 4AX9H 3SQHE 7GCHG 3F2HA 1UTNA 1RTLA 2WUBA 3RXEA 1GMDG 2A5AA 4YOGA 4ACBA 4BAKB 1T4VH 1UTOA 1QTFA 7LPRA 1EPTA 2ZDMA 1MTVA 1V2PT 3AAVA 5T1VA 2ZFTA 1INCA 2J97A 1HUTH 1O2LA 1HCGA 1TMBH 4Y79A 2HOBA 5DO4H 2BQ7B 1GG6C 2FOBA 5PTPA 1GHZA 1BUIA 2KAIB 3BTGE 2P94A 1DT2A 2FODA 3SNBA 3PRBA 3D65E 1LPGB 6LPRA 5L6NH 4CRFA 3T2NA 4H42U 2YMSC 1YY3A 2ZU5A 1OWJA 3NKKA 1T8LA 1GVKB 4X2WA 2AEIH 2JDID 2G4UA 5AHGH 1BMNH 3L33A 1HAHH 2QAAA 1TBQH 2B8OH 1GGDB 5EU8A 4HI3A 1LHGH 4DOQA 3TPIZ 5C5OA 2Z3EA 1UCYK 2FLRH 4FUIA 4DT4A 4ISNA 3SZNA 3ZZ9A 5F53A 4A92A 1LHCH 3MH5A 5ABWA 1CA8B 1XVOA 4UFEH 4FVBA 3A7TA 5J4SA 3A7ZA 1P3EA 1B5GH 1P04A 3BEIB 3S9BA 1NESE 2G51A 3U8TH 4JMYA 3UB0A 2QXIA 1PYTC 5CMXH 1O3BA 1O2KA 2WV4A 2G8TA 1ZHPA 4BAOB 1C2IA 2HLCA 1O34A 1MD8A 4UD9H 4CBOA 3LKWA 3RM0H 5E2OA 1BRAA 2OUAA 3F3BA 5A8ZA 1ZLRA 4CH8B 4LXBH 3M3SA 5EGMA 3SN8A 1PPHE 2PTNA 4CRGA 3FANA 2ZPRA 1P2KA 1KTSB 1KY9A 1ZZZA 3VB5A 2JJ2D 4KTCA 1XXDA 1F0TA 1FY5A 3TLOA 5GIBA 6GCHF 1C1RA 1O2GH 1GBLA 1XUJA 5DP9A 3TNTA 1BOQA 1W7XH 3T25A 5EODA 1EXFA 2WUCA 2G55A 4ZKNU 1EATA 3GOVB 1OYQA 4AYVB 3E0PB 3ATIA 3HK6B 2BY9X 1O2NA 4BXWA 1A7SA 2NU4E 3RU4E 3SORA 1BJUA 1DFPA 1GCTC 1VGCC 3B23B 1C5WB 3F0PA 2W6JD 1QRXA 1QFKH 1YPHC 1GJAB 3AAUA 5FCRA 4HFPB 1QL8A 1IHSH 3SV2H 5EXNA 2L74A 3QUMP 1NRNH 3PRDA 2R0KA 4BNRA 2SGFE 1AZZA 2FOFA 4Q2KA 2HGTH 1RD3B 2F91A 4NSVA 1MKWH 2K8IA 2BLVA 2PLXA 5C20A 2QXJA 3QK1A 1IQFA 1TONA 2ZHFH 5EIYA 1YP9A 1XKAC 1YPHE 3BIUH 1FN8A 3RLWH 4I8JA 2VWOA 2ZFFH 2A32A 1KTTB 2KCPA 3EA7A 2R2MB 3Q3KA 4YLUA 1LTOA 1G37A 1WV7H 3CNRA 4INHA 1O3AA 1C2LA 3GCTF 1J14A 4Z0KA 4MVNA 2HPQH 2J9NA 2ZI2H 1JWTA 1N1LA 3GY4A 3BV9B 2Y80A 5KECA 2QGRA 2QCYA 4O3TA 1WAYB 1QBNA 4YO9A 4O3UA 2H6MA 1O3MA 3K6ZA 3BTFE 4IGDA 3KYFA 1SKYE 2THFB 1RIWB 2J98B 1Y5BT 2Y7ZA 4BOHA 4DURA 1YCPH 3TGJE 2XBYA 1LHEH 5AFZH 4ASHA 3TIUA 5DPAA 3DSPA 4IBLH 3PV4A 2YNAA 2BVRH 2VNTA 2ZDKA 3OEED 4F55A 4FETA 1TBZH 1F5KU 1G9IE 3MO6A 4ZXYH 4FU8A 1S82A 3PYHA 2IJOB 2PKAB 2A4RA 3M5NA 1GI2A 1PYTD 1GGDC 1ARBA 1G32B 4D76A 5SGAE 3MU8A 3RXPA 1FZZA 2ZWLH 1SR5C 1T4UH 1ZYOA 4GCHF 4A7IB 2ZPSA 1MQ5A 2XC5A 2UUFB 3TH3H 5L2YH 2R3UA 1EASA 3RDZA 2BLQA 1D4PB 3C1KA 2GP9B 1T7CA 2V0BA 1ACBE 3VG8A 4XSKU 2WPLS 5EQSA 2KCOA 4YT7H 2ZDVH 1SGYE 4AN7A 1TBRH 4LOYH 5DGJA 2PW8H 2OD3B 3KGPA 1ZPCA 2VB0A 2WV9A 3P8GA 3KIDU 1PPGE 3UR9A 1P05A 1O39A 4Y8XA 2STBE 1ELVA 2ZGBH 3UUZA 3Q3XA 1C5ZB 1GL0E 4A1TA 1C2JA 1C2MA 3AVZA 1JMOH 1JOUB 1O5CB 2FZZA 3DSOA 4IN2A 5EW2H 2XC4A 2ZIQH 2FX4A 1P11E 1Y3WA 1BBRH 3VFEA 1K1IA 1SC8U 3EGKH 2BMGB 3RP2A 1GCDA 2BDCA 5TCCA 2Z3DA 2KAIA 2A5KA 2H9HA 1EZQA 3UREA 1OWIA 6CHAC 3A86A 3ESTA 4Y0YE 2TGPZ 3TJOA 4CR5A 1E1QD 5LPFA 2F9VA 2XRCA 1JRTA 2ZDAH 3FN8A 3UNRA 2A7CA 4HGCA 2FM2A 5CHBA 1O3PB 3ZV9A 1WTHD 1BRCE 1LKBA 2AYWA 3PMBB 2ZP0H 4DY7B 1HJAB 4NGAH 5EQRA 1QBVH 2A7HA 3ZZ7A 4AFZA 1HFDA 2V3HH 5C5NA 3BG8A 1TPSA 1TRNA 5EPNA 4MNXA 3OE7D 4Q7YA 2D26C 1HAIH 4FUCA 4ABHA 4VGCC 3NCLA 2Z7FE 4DW2U 2ZCKP 4FUBA 2BD2A 5A2MH 1IQKA 4JYTA 1P2NA 1QB1A 3U98H 1SSXA 1FLEE 3SUFA 3S7KB 1GG6B 1GI0A 1BIOA 2H5DA 3G01A 2LPRA 5FCKA 2ZFRH 3PB1E 5TCAA 4LZ1H 1GMHG 5A8YA 2L6OA 1NT1A 4YT6H 2HLDD 2SGAA 4WWYA 2ZG0H 1FXYA 2A7JA 1JXPA 4B76A 4ZMAH 3EDXB 1IQNA 1O2RA 1TNJA 2XXLA 4M7GA 3ZZ4A 3ZVDA 2J98A 4Q4LA 4A5TS 1QB9A 2ZFPH 4FU9A 1ELDE 3IITA 1QJ1B 1P9SA 3RXUA 1ZRKA 3HATH 1PJPA 2FTMA 2FO9A 2RDLA 1SLUB 4AORA
chains in the Genus database with same CATH topology
4THNH 5DP7A 3F9GA 2PKSB 1EUFA 1GJ7B 2B5TB 1TFXA 3UWIA 5JB8S 3FFGA 1Y59T 1TLDA 2ZEBA 4AG2A 3PMAB 3A8CA 5C3NA 1GVZA 1TOCB 4Q7XA 2XYAA 1AGJA 3GICB 3PMHB 1O2XA 1TGCA 1GJ9B 1LVMA 4IN1A 3VPKA 1ZMNA 3K65B 1E35B 3GY5A 2D1JA 4RKOB 4BAQB 4X6MA 1HAYB 4CRAA 2GX4A 2HNTF 1Y3XA 4OS5A 4B71A 1C5SA 2UWPA 2FIRH 4B2AA 2CN0H 3RXOA 3FP7E 1TMUH 3M5MA 1BTZA 1ZSLA 1EJNA 1J15A 2BTCE 2UUKB 3T5FH 3BTKE 2OBQA 3ZZ8A 1GCTB 1VGCB 3VB4A 4ABIA 1SGCA 1OXGA 1RRKA 2O9QA 2RCEA 2W3KA 2FWWA 1ELTA 1HAVB 1HB0B 1V2NT 3PTNA 5FPSA 4A1VA 1G30B 5FBIA 2PFEA 3RXJA 3AW0A 1BMMH 4MNYA 1XM1A 4I33A 2NU2E 2J2UA 2BOKA 4WMEA 1NRSH 3RXCA 2ZFSA 2EC9H 5DKMA 1EAIA 3RXTA 4NA8A 2BDBA 1RGQA 4ESTE 1U6QA 2PGQB 1SHYA 4A1XA 1SFIA 5F03A 1PQ8A 2GV7A 2FOEA 3P70B 4ABDA 3RC4A 1PPEE 3GDSA 1C1TA 1XUHA 3RC5A 5JBBS 3U8RH 5ESBA 1DSTA 1WYKA 1AE5A 2D8WA 1BRBE 1J8AA 1TGSZ 1SL3A 2ULLA 3CS7A 4VGCB 3M37A 3F9EA 1P2QA 4CREA 3QGJA 4BAMB 1EZXC 2UWOA 2R2WU 1OWKA 3ZYEA 2VH6A 3PLKA 1OP0A 4JZDH 1MKXH 1NFUA 1GJDB 1HBTH 3ATKA 1YPEH 3E16B 1UTLM 3BEUA 3SUGA 1A5GH 1ZGIA 2VIWA 1O3FA 4UDWH 1C1SA 1P57B 1W13U 2OC7A 1ANDA 2Z6BD 1ZSKA 1GBTA 1P09A 1TA2A 1QY6A 2GDDA 2ODQA 3MO3A 3U8OH 4FUEA 1BMAA 3A84A 2BM2A 2HWLB 3SGBE 2UUJB 4ABGA 4UFGH 2BX3A 1HXFH 1QR3E 1K28D 3IG6B 1OP2A 4KTSA 3RU4D 1Y3YA 1CA0C 2ZZUH 3RXSA 3SO3A 1P2JA 1ZTKA 4IC6A 1EB2A 2PKSC 3KQEA 1N8OC 1QB6A 5A0CA 4AYYB 2VWMA 2C8XB 2BDGA 1NRQH 2W5EA 1K1PA 1Z8JB 3HKJB 3SNEA 2WV5A 3LC5A 1AO5A 3HGNA 3TJUA 3M3TA 1BHXB 2VIOA 1ETTH 1O3GA 1YPKH 4NFFA 4OS6A 1A4WH 1C1OA 1THSH 1IHTH 1E36B 5C2ZA 2R0LA 2I6SA 1GBIA 3ODDA 3U9AH 2PTCE 1QURH 2ZPQA 3BG4B 2GMTC 2Z9KA 3LONA 1SBWA 3RC6A 3STIA 2XC0A 2DE9A 1J9CH 1TIOA 4I8GA 3RLYH 2ZDLA 4I8KA 1HAZB 2SGEE 2SGPE 4NG9H 2RA0A 1E37B 1WSSH 1NFXA 2VWLA 1GMCF 2BXUH 4Y76A 1V2WT 2HPPH 1HAOH 1AVXA 1SLWB 4WF8A 4O9VA 4DGJA 1E34B 2H9TH 2ZQ2A 2BLOA 3PO1B 2G00A 3UQVA 3A7WA 3DFLA 1NC6A 4OGYA 5DP6A 1ANCA 1HAGE 1BTUA 1O2OA 1YC0A 3EE0B 1D3TB 1W11U 4GHQA 2Z94A 1VJ9U 4MNVA 1TABE 2HNTC 1TNKA 4ZXXH 2G5VA 5F8XA 1BBRK 2A2QH 1CT2E 3E8LA 1BTPA 1DPOA 1AI8H 1BMLA 1GMCG 1O2YA 1O2MA 4HTCH 1EJMA 1UHBB 1HAPH 3P8OA 4X1QU 3SGAE 2Q6GA 1A3BH 3FP8E 4ABAA 3R0FA 5C1XA 1KLJH 2ZQ1A 3BEFB 5DJ7A 1ETSH 1Q31A 4RN6A 1ANBA 2V3OH 3LGYA 3S7HB 3VGCB 2GTBA 3I78A 2F9PA 1UTMA 3TGKE 4OS4A 4AFQA 4WVPE 4GLYA 4BTIB 1HGTH 1BJVA 2VJ1A 2ESTE 3SW2B 4E7RG 2ZO3H 1DLKB 5C1YA 2IN2A 3FAOA 1TWXB 3M61U 4J2YB 5H4IB 1Z8GA 1DM4B 2HRVA 3FVFB 1P2OA 1Z7KA 4BXSA 3PWCA 4MPUA 4NWKA 1VITF 3F68H 2QF0A 1BTYA 3A7YA 1GHYH 2FI3E 1LHDH 1YKTA 3B9FH 4U2WA 1TOMH 2QIQA 2VVCA 2PGBB 2ZHWH 1FV9A 3LGVA 2CF9H 1G2MA 1P10A 2V6NA 4J1YA 4NIXA 1SGQE 3S9CA 3SU1A 2CGAA 2F83A 1SGNE 2Q6FA 2VH0A 1QQ4A 3OSYA 3JZ2B 5EG4A 1E0FD 1C4V2 2ANYA 1D6RA 3MU5A 1DICA 3RMOH 2F9UA 2BB4A 2P93A 5AF9H 1GHVH 1C5YB 2GMTB 1PPZA 1UTPA 1KXAA 2YOLA 4ZHLU 1GMDF 3K9XB 1GI5A 2BLWA 1UCYE 1GI3A 4RSPA 2QY0B 4K1TA 3MNSA 2B0FA 3SV8A 3RMLH 2G5NA 3GYMA 3LPRA 3A8AA 1C1NA 2FEQH 3ELAH 4R8TB 2ZHQH 5A09A 1UK3A 1H8IH 4Q80A 1A5IA 1OP8A 2B9LA 2ZTZA 5DP5A 1AZ8A 2NU1E 1C5XB 1GBEA 3KEEA 5FBEA 1DE7H 1O5BB 1VITG 1AY6H 1OKXA 4A6LA 1MTSA 2Q1JA 4Y71A 1ID5H 4KKDA 3F6UH 4MLFB 1EAXA 1NRRH 5B6OA 2AMPA 1B0EA 2OQ5A 2A5IA 4CR9A 1TPAE 5HYOA 2A45B 4XBCA 3U1IB 2EI7A 4B74A 1G36A 4YLQH 5FX6A 2CJIA 3E0NB 1V2VT 2JH0D 4ZROA 1QA0A 2OINA 3GYLB 1GI9B 2Y7XA 4TWWA 2ZCHP 3SJ8A 4XBBA 2CMYA 1CVWH 1BDAA 3QTVH 2XCNA 3KF2A 3OY6U 1GHBG 3ODFA 5IDKA 2FESH 2K1QA 3GDUA 1NROH 2VWNA 1HXEH 1FAXA 3LC3A 2QA9E 3SHAH 3P17H 5C67A 2HVXA 1TNLA 1O3HA 3Q00A 3Q3YA 1HJ8A 1SGFA 4WH6A 3HPTB 2J95A 1D3QB 1J17T 4O03A 3O8CA 2FDAA 2FI5E 1A5HA 2FPZA 2AGEX 1PQAA 4ABFA 3OYPA 3BTTE 1GI6A 1Z71A 5GPIB 3TK9A 2VIVA 4KGAA 3LGWA 2BD5A 1Y8TA 1N6XA 1N8OB 1OWDA 1DITH 4WJG2 1UTKA 2BDHA 4NFEA 1BHXF 5JBAS 1IQHA 2AIPA 4CBNA 2O8UA 1TYNA 1ELFA 1FAKH 1K1OA 1YCPK 1DWCH 3SHCH 3SUDA 3BSQA 1EP5A 5GCHG 4U32A 2TRMA 3ZVEA 1K1JA 4GCHG 3LGTA 4JZ1A 2FP7B 2FOGA 1MKXK 2PKAA 3SNAA 5G4BA 4WMDA 2F9BH 1GL1A 1AIXH 1C2KA 1QIXB 5T6GA 4ABEA 3SV6A 1DUEA 3NUMA 4PROA 1LKAA 4U30A 2OCVB 3BTQE 1SOTA 1C2DA 1C4Y2 1AVGH 1OOKB 5FAHA 4GVUA 1S6HA 3WY8A 1YPLH 1O5EH 4ISHH 2OTVA 1FIWA 1CT0E 4X6OA 4B2CA 1CGIE 1LVOA 4IC5A 3LH3A 1FONA 3VB3A 2XTTB 3PO1C 2BHGA 4MPXA 3R3GB 1O2TA 1ESAA 4FUHA 1SQTA 5J4QA 4JCNA 2ZGXH 3M3VA 1WTGH 3V0XA 2SNVA 1CGJE 1XUIA 2PSXA 2A4QA 1ANEA 2C8ZB 5I46H 2AERH 2D2DA 2VGCB 4U01A 1HAVA 2NWNA 3KNXA 3GY2A 5CE1A 3A88A 1GBFA 2WPJS 2P59A 3K6YA 4K5ZA 3RXHA 2GCHG 3UWJH 1H9HE 1H9LB 4CRBA 4NZQA 4ZKRU 1YBWA 1MBQA 1PPCE 3LJOA 4K1SA 4X1SU 3DT0H 2OP9A 2P8OB 1TX7A 3TVJB 4OGXA 3UTUH 1MTNB 1EPTB 1H9IE 3RXBA 1O3EA 2O8WA 1KSNA 1O2IA 2C8YB 1TRYA 1V3XA 1O2SA 3V13A 1ZJDA 1VCQA 1OPHB 2VIPA 3A7XA 2ZU1A 4JK6A 1SB1H 3QZQA 4X6NA 1SGPE 5E0GA 2F9NA 1TQ7B 2A31A 3SU4A 4TY6A 1MU6B 1W7GH 4XE4A 2ANKH 1ZTLA 1PFXC 3TK6A 5DP4A 2A4OA 5FPTA 2NU0E 4ISLA 5C1UA 4K8YA 5FXLA 1WBGB 1ZPZA 2UUYA 1EQ9A 1O3KA 2AGGX 4CHAB 1KYNA 1T32A 4JYVH 4D7GA 2BDYA 1L4DA 1P03A 2XBVA 1VCWA 1W2KH 1ABIH 3M35A 3S0NA 4JZIA 1O2QA 1TPOA 1S81A 1A46H 1GHBF 4X6PA 1KIGH 1QCPA 1V2JT 1XVMA 3ENSB 1XX9A 3ZZCA 4K2YA 2FLBH 2TGAA 1QBOA 3BN9A 3QX5H 2GD4B 1HRTH 2EI8A 1P3CA 1W12U 3MU1A 2JH5D 3M7UA 1ELCA 1UVSH 1CSOE 1IOEA 1QRZA 1TAWA 1W10U 4X1RU 5DP3A 3SBKA 4AGKA 2NU3E 1WQSA 3I29A 8GCHG 2W3IA 3MO9A 3QZRA 5LPEA 4ZHMU 1N6YA 4KTUA 1H1BA 1UVTH 1NN6A 1HV7A 3ZZ3A 1ELEE 2ZTXA 1NPMA 1YYY1 4NA9H 1K1NA 1O33A 2GDEH 2QV1A 3E3TA 3T29A 3F1SB 2QC2A 1Z8RA 1DUAA 3GCHB 1HPGA 2V35A 4ZHAA 8LPRA 1L1NA 4OS1A 1ZGVA 3KCGH 5L30H 1ESTA 4JZFH 1KXFA 3UR6A 1O2WA 1NFYA 3DFJA 3N7OA 4X2VA 1AB9B 1TALA 1A3EH 3MU0A 1RFNA 4WXIA 3SJKA 4UFDH 2FYRA 1YLDA 1P06A 4DT7B 1GJ8B 1BQYA 2FXRA 1C4U2 4TPIZ 1SMFE 3K2UA 1O3NA 1EB1H 1S6FA 1TMTH 1O35A 2VIDA 1CT4E 4I8LA 1IQGA 1O3IA 3ZV8A 1M9UA 1O31A 1LMWB 1B7XB 3BTME 1C5VA 1SGRE 2STAE 4YOIA 3ZZBA 2FI4E 4K69A 2DE8A 1MD7A 2AS9A 2ZA5A 3CS0A 2M5TA 3M5OA 3OU0A 4XOJA 2FOAA 2TBSA 1W0YH 1GJ5H 2EA3A 3BTWE 3SNDA 1GBCA 2H1UA 1O2VA 2JETB 4ZH8A 1SQAA 2ZU4A 2AIQA 1SFQB 3A80A 1WQVH 2Y82A 3LGUA 1GMHF 2BQ6B 4X2YA 1GI4A 3SJOA 1LDTT 4GSOA 1C2EA 1GHXH 1ELAA 3QDZB 4IMZA 1OS8A 1AU8A 1SI5H 2QYIA 3A81A 3ZZAA 1O2UA 1THRH 2JH6D 1W8BH 1C2FA 3T27A 5F8TA 3D23A 3HKIB 1KLTA 1EX3A 2WPHS 2CV3A 1YPMH 2O8TA 2WYGA 1MZDA 3RXMA 1SOZA 1FIZA 4O97A 1Z1JA 1NY22 1O3DA 1EP6A 1GI8B 2Z3CA 3F9FA 1F0UA 3MNXA 2WINI 2G4TA 3LIWA 5JBCS 1G2LA 2GV6A 3U69H 5BPEA 3UFAA 1MH0A 4JZEH 2Q6DA 3P8NA 4D7FA 1SPJA 2Z9GA 3IWMA 1SQOA 1UCYH 1HLTH 3AASA 2Y5HA 1L1JA 1AE8H 1ZOMA 1ETRH 3F9HA 4XBDA 1DVAH 3ITIA 2A1DB 1F2SE 1XUGA 1UJ1A 5HM2A 1TB6H 1EOJA 1ZHRA 5JB9S 3PTBA 1IQLA 1AD8H 3QO6A 2QXGA 3EYDA 3O8DA 3PLBA 5JYIA 4I31A 4KELA 1WCZA 2VIQA 1O37A 1S0QA 4MTBA 2OC1A 1SGFG 3SI3H 4K60A 1OYTH 1K22H 4TYDA 4X2XA 1XMNB 4B2BA 1LQDB 2ZNKH 2OXSA 2ZGHA 1GBBA 2BD9A 3L6PA 3GCHC 2SGQE 3NPSA 3CENA 2SNWA 4ISOA 2BD8A 2DUCA 2PR3A 1C5TA 4Y0ZE 5E8EH 1BCUH 2BYAX 1YF4A 2XWAA 1NTPA 2FS9A 3ZVFA 3V12A 3E6PH 5HXFA 5DP8A 3UNSA 1W0ZU 1TQ0B 1GBKA 1A1RA 3OY5U 2P3FH 1O2ZA 2VGCC 3A8BA 3TITA 4K3JA 2FX6A 7ESTE 1UVUH 1D6WA 1NS3A 1P0SH 2AMQA 2O8LA 3GCNA 4JYUH 4WH8A 1GJCB 4E7NA 3QTOH 2P3TB 1Q3XA 3M7TA 4X8VH 1GJBB 3NWUA 2ALVA 5F8ZA 2FOMB 2ZTYA 2P8OC 3S69A 2Y6TA 4JK5A 3MHWU 2QXHA 1QHRB 2ZHEH 3GISB 1MTNC 1C5NH 5T3HA 4AGJA 1AFQB 4AZ2B 4NSYA 1X7AC 5L2ZH 1TGTA 1XXFA 2JETC 3URCA 4INKA 1QQUA 2WPIS 2BQWB 4ZUHA 1C1QA 1Y3UA 1AFEH 3B8JA 3KHVA 1VJAU 4DIHH 1SLXB 2W7SA 1V2QT 6CHAB 3GY7A 3PMJA 3HK3B 1O3OA 1D3PB 1C5LH 1NRPH 2OLGA 4MPVA 1UK2A 1BTXA 1MAXA 2XNIA 3DD2H 3RXRA 2GCTB 1DLEA 1LQEA 1HJAC 1ELGA 3E90B 4DCDA 3KQBA 3OX7U 3RXVA 3T62A 3V7TA 2ILNA 2PV9B 1ZHMA 2RA3A 1IQJA 4H4FA 4B1TA 5HMAA 4OS7A 1BITA 1FQ3A 3MH7A 3UOUA 4D9RA 4SGBE 3ZZDA 3KN2A 1C5PA 1V2OT 3NZIA 4Y11E 4F4OC 3ZVGA 1FY4A 4AB9A 4I32A 2SGDE 3SI4H 1MU8B 1ZJKA 1V2UT 6ESTA 5A0BA 1DS2E 1YCPM 3P95A 3W94A 4BTTB 1O32A 1DDJA 5JBTA 1YPGH 1G3BA 2FOHA 1TE0A 3SU3A 1MBMA 4D8NA 1FPCH 2BZ6H 2ZDNA 1NO9H 4QT8C 4UEHH 3NK8A 5IYTA 1CHOF 3O8RA 4TY7A 4DVAU 1VR1H 2GZ8A 2ZU3A 4AG1A 1C1PA