4JK5A

Human urokinase-type plasminogen activator (upa) in complex with a bicyclic peptide inhibitor (uk18-d-ser)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Improving binding affinity and stability of Peptide ligands by substituting glycines with d-amino acids.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 54
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2013-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4jk5A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4jk5A01
3F68H 3SOSA 1G2LA 1Q2WA 2FP7B 3SJ9A 2ANKH 2BDCA 5DJ7A 1O3OA 3VFEA 5ABWA 2GV6A 4WWYA 2A7CA 1MU8B 1WU1A 5DG6A 1Z6JH 1GBBA 2FOHA 1ZTJA 4IGDA 2BQ7B 1OWEA 5FPTA 2BVXH 3FP7E 5A0BA 5JBTA 1TNIA 2TPIZ 1NFXA 3KN2A 3E8LA 1SC8U 1ORFA 2ASUB 1SLWB 1O2UA 1AMHA 4Y10E 1S5SA 3GYMA 8KME2 3ZZ6A 1IQIA 2XBXA 1FXYA 2ZHQH 3LGWA 5FXLA 1KTTB 2JH0D 2R3UA 2BLOA 1JOUB 2ZCKP 1RS0A 5SGAE 4CRGA 1C2JA 1P2MA 5FAHA 4IW4E 1LHDH 2NU3E 3ZZ8A 1ELVA 3RXEA 2UUYA 3SGBE 3ENSB 3HGNA 5E0HA 1PFXC 1O38A 2P3FH 4WF8A 2PR3A 2JETC 4VGCC 8ESTE 1CA0C 5GJ4B 4KELA 3K65B 3RLWH 4E05H 3LGVA 4DIHH 1GG6C 2FODA 1UVOA 1C2GA 5GDSH 1C2MA 1P8VC 2AMQA 1DS2E 1NU7B 1O5EH 1CGHA 1P11E 3UNQA 3UQOA 5JYIA 1ARBA 4I8LA 1XKBC 1HIAB 1V2WT 1D6WA 1HPGA 2D8WA 1A3BH 1GGDC 4RN6A 4U2WA 3GY4A 2ZGCA 4B75A 5EPNA 1HAVA 2Y5GA 1AVXA 1C1SA 1L1GA 6ESTA 4MLFB 1L4ZA 2THFB 1TBZH 2QXJA 1BBRH 1LPZB 2VNTA 3QUMP 1UK2A 3GICB 3SUDA 7GCHG 4H6SB 4B2BA 1ZZZA 1GMCG 3SW2B 3A83A 1FONA 3BIUH 1VGCC 2OINA 1GI1A 2FZZA 1TYNA 1TA2A 1TMTH 2G55A 3RXLA 3C27B 1V2KT 1LKAA 4YOIA 2Z94A 4ABBA 1K28D 5L2YH 2VB0A 2WV4A 4BTIB 3NZIA 2BQ6B 1GJCB 1WAYB 3T29A 3TITA 1DWCH 1C1WH 2BD7A 1KIGH 3KIDU 1RD3B 3RXVA 5FCRA 4JYUH 3RMMH 1W0YH 3KNXA 1THRH 3P6ZB 3QN7A 1EJMA 3S69A 3U8OH 1IQMA 4YT7H 1BTWA 4AYVB 1RXPA 1HB0B 1SVPA 1ZMLA 5EQQA 1S82A 1NRPH 1FAKH 3KQCA 1FNIA 1MD8A 4NIXA 1TIOA 1L1JA 3R0FA 2J95A 4KKDA 4B73A 2G5NA 4D7FA 5GCHF 3LU9B 1TX8A 3E3TA 1O37A 2PKAB 5C1XA 1BTPA 2UWPA 1G3EA 5DK1A 3A86A 3ZZ5A 3A85A 1ELGA 3BTQE 1AO5A 1W7XH 4Y0ZE 1JIRA 1P9UA 4ABEA 2A45B 2VGCB 4DURA 1QURH 2Z3EA 1SG8B 1O3KA 2FS8A 1AFEH 1ELAA 1O2MA 4A5TS 1D4PB 4GHQA 4YESB 1UVTH 3ODDA 1ZHRA 2LNCA 2ZHFH 3VXEH 3PM3A 1HBTH 1Z71A 5L2ZH 1C1TA 4UFEH 2Y7ZA 1EPTA 4IN1A 3TK6A 1EZUC 2UWOA 4CRFA 2ZP0H 2A7JA 2D26C 1O31A 1GBJA 1K21H 4X8TH 2R0LA 2PHBA 1KDQB 2ZPQA 4A7IB 1G3DA 3ZYEA 2FLRH 2SGQE 1MAXA 2RA3A 4HGCA 2O8MA 3A82A 3U8TH 3E0NB 5ETXA 5C1YA 3TGIE 1O5BB 1W3CA 1MBMA 3M7TA 4ABIA 3U9AH 1LVMA 1MCVA 2FI3E 1P2JA 2VVCA 5FPSA 1G30B 2W3IA 4INLA 1VJ9U 1C5OH 1C1UH 1GHBF 3BTHE 3K6YA 1E37B 1VCPA 1LQDB 5FHTA 3RC4A 5EW1H 3RXSA 2C93B 5IDKA 2RDLA 1T8LA 3V12A 2V6NA 1DUEA 1G2MA 4ASHA 1JMOH 3DFJA 1Y8TA 2AS9A 1CE5A 4FUGA 1OSSA 1MTSA 4BANB 1O30A 4WJG2 1GI9B 4U30A 4OS5A 1YPGH 3SV6A 3LGUA 1S0QA 4FUFA 1S6HA 1RTFB 1EX3A 1K1PA 2ZPRA 2O8LA 1FQ3A 1W12U 2WPJS 3QGJA 1MCTA 1MKWK 2STBE 4ZXYH 1FY1A 1AKSA 2P8OB 2AYWA 2F9NA 4NZLA 1J14A 1DT2A 1N6YA 5F8XA 3GDUA 4AORA 4B74A 2F3CE 1EASA 2FO9A 3RUOA 5T6DA 2FOGA 1TFXA 1TQ0B 4Y71A 1V2JT 4J1YA 2NU2E 2G8TA 5GIBA 1C9PA 1HNEE 4AGKA 1AQ7A 2C4FH 1SBWA 1S0RA 1ZJDA 2JH6D 2P3UB 4AX9H 1H9HE 1NN6A 3AAUA 1ZHMA 2VWNA 4XBBA 1AVWA 1O2HA 2B0FA 1QR3E 1TNHA 4AFSA 3GCTF 1NY22 1IQHA 5T6FA 1RJXB 4AFZA 2BXTH 5C67A 4DOQA 1NM6A 1HAIH 2PGQB 2BD8A 3TGKE 1ZTKA 3BTTE 5GPIB 1GCDA 1C5XB 3BIVH 1NFUA 3KQBA 3M3VA 5A0CA 5CHAC 4I8KA 1TX7A 2SGAA 1ELDE 2H1UA 3SJ8A 1UVUH 1C2IA 3SHAH 1QBVH 2DUCA 1GI6A 1H9LB 1HJAB 1WQSA 2H9HA 1IOEA 1V2QT 3V13A 1IHSH 4ZROA 4ABAA 1A5HA 5A8YA 1KXCA 3M5MA 1XUIA 4K1SA 4IBLH 1B5GH 3A88A 3BEUA 4X6MA 2ZFFH 1O3JA 1P02A 2Y7XA 4IN2A 3O8CA 1L2EA 1HXEH 4E7RG 5F03A 2VIOA 3TH3H 1JRSA 1MTNB 3EDXB 1ABIH 1W11U 2XW9A 5T3HA 1P3EA 1FIZA 1QL9A 2C8ZB 1LDTT 1IQFA 3A7TA 4QT8C 1BRUP 4A1TA 4BTUB 1LTOA 2WV5A 3URCA 1BHXB 4JCNA 2V35A 3TK9A 2P16A 2NWNA 2BD5A 2QXHA 4UEHH 3SZNA 1T31A 5TJXA 2BX4A 2Z9JA 1GDUA 3TH2H 2XRCA 1O3PB 2FWWA 3TK5A 1QCPA 1SPJA 1Y5BT 4KTCA 1CSOE 1JIMA 2HVXA 1ESTA 1MKWH 3T26A 1V2LT 1ZPBA 3SQEE 4X6OA 1NC6A 1XUKA 2C3SA 3EQ0H 1HFDA 1LHCH 1XX9A 2G00A 4HTCH 1GI0A 1LVBA 1ELCA 2J2UA 2VIQA 3EA8A 1O2WA 3PO1C 3EYDA 3S0NA 4INHA 3TH4H 1O2OA 1O2RA 1LHGH 1BT7A 1NRSH 1ZHPA 2Z3DA 2B8OH 1SQOA 1C5PA 2BM2A 1OP2A 5HMAA 4LXBH 5F8TA 1CHGA 2D1JA 3RP2A 3VB6A 4K1TA 2AGEX 4HI3A 5EODA 1HXFH 3GOVB 4JYVH 1ANCA 3A7XA 4NIYA 2ZZUH 2ZWLH 3NPSA 2A31A 4OS1A 1TQ7B 4CBNA 5J4QA 2P94A 1SGPE 2QV1A 3BTEE 3DA9B 1GMCF 1O3HA 1F5KU 1LPKB 1N6XA 1W2KH 3A8BA 3S9BA 1ZMNA 4U01A 9LPRA 1CGIE 5JBCS 4X0WU 3S9CA 1AWFH 1HAZB 3SUFA 3SBKA 1FY8E 4A1VA 1QB6A 4MPWA 1SSXA 2BY8X 2VIDA 5AFZH 2ZCHP 1NS3A 3SU2A 4R8TB 3H7TA 3GYLB 3Q76A 1GI2A 1GBHA 1CGJE 3O8BA 2OC1A 4BOHA 1Q3XA 3LT3A 4R0IA 3LC5A 2QF3A 4UFDH 1ELFA 2SFAA 2HALA 3UFAA 1O3EA 1KXEA 4IMQA 1JBUH 3UPEA 2GZ7A 1SGNE 2NU0E 3MH4A 2OC7A 5JBAS 3RXQA 5ESTE 2H2ZA 1TRYA 1ETTH 1XVMA 2FDAA 2SGPE 1J9CH 3SI3H 1VITG 1GI7B 5B6OA 4ISNA 1GI8B 3TPIZ 2GKVE 2GTBA 3ZV8A 4K3JA 1HAOH 3DHKH 4X2WA 1QJ7B 1FUJA 1SGIB 3PV4A 3OY6U 2OBQA 2FMJA 5HXFA 4ISOA 1BJVA 2TGAA 1PQAA 4DCDA 5IYTA 1Z8JB 2A4GA 1AY6H 4AB9A 1OX1A 2AH4X 4VGCB 1IQKA 4MPVA 3A80A 1B0EA 2OXSA 2AFQB 3SGQE 1E38B 2ULLA 2GZ9A 3MWIU 1O3MA 2FYRA 4DW2U 1O0DH 2HRVA 4AN7A 4NIWA 1OP8A 1O5GH 3B23B 1QRXA 1EP5A 4X1PU 1UHBB 3SV8A 1OWIA 1O2SA 3GY3A 1NRNH 2BVSH 1D3TB 1BJUA 4NIVA 1E35B 1H4WA 1K2I1 4K8YA 3T28A 4ABJA 3EGKH 1ANDA 3P8OA 3TJUA 1BMNH 1LCYA 2A5IA 3SO3A 1GJ6A 3UNSA 2GDDA 3E0PB 5EXNA 1BITA 2ZHEH 2ALPA 2O8TA 2FXRA 1T8OA 3LDXH 4O3TA 1SLVB 2Z3CA 1HAGE 1PJPA 1AI8H 2OC0A 1TWXB 2CJIA 2WINI 3RXKA 2R9PA 3A8AA 1GVLA 1AE8H 1DY9A 3OYPA 2QAAA 3E91A 4LOYH 4X2VA 1QGFA 3SGAE 4Z6AH 4MTBA 1WSSH 3PTBA 5AVDA 4NFFA 2ZTXA 1BA8B 1GL0E 2H6MA 4A6LA 2AGIX 5JPMH 1TBQH 2ZGJA 3MOCA 1J15A 4JZFH 3SUEA 2J34A 4MPUA 2JH5D 1KXAA 4Q7XA 3A8CA 1C5QA 2QC2A 1GDQA 1PPHE 2Y82A 1C2KA 4FVBA 5FPYA 1BUIA 5LPFA 4X6NA 5FBEA 1MQ5A 1FY3A 4TWYA 1MQ6A 4YTAA 2Z9LA 3RU4E 1NRRH 1TPOA 4ZH8A 1D3DB 5AFYH 3L33A 2ZTZA 4DGJA 2A5KA 4I33A 4IC6A 5FX5A 3T25A 1BTYA 4CH2B 3MYWA 1UK4A 4AOQA 1D3QB 3MNSA 3A7YA 5JBBS 1Z7KA 4KGAA 1MAYA 1EAUA 2Y5HA 1UMAH 1ETSH 1PQ8A 1V6DA 4K60A 5E8EH 1RRKA 1FIWA 2YNAA 2G5VA 1SHYA 1NZQH 4CR9A 3RXGA 1GJAB 2F9BH 2A5AA 2FTLE 1KTSB 1YF4A 1LHEH 1H8IH 5BPEA 1EZQA 4YLUA 4JYTA 3SU3A 3UIRA 1ZPCA 1E34B 3BSQA 4X1SU 1C2DA 2F91A 2WYGA 3FZDA 5K7RA 3SN8A 5E2PA 5EQSA 1TBRH 3RC5A 1X7AC 4X1QU 4D9QA 2OUAA 3LIWA 1EPTC 1UTPA 2R2MB 1QBNA 1QBOA 2HWLB 1DDJA 3BTGE 2ZCLP 1GBLA 1GVKB 2QXIA 3IG6B 1O3NA 4H42U 1V2ST 3ZZAA 3QLPH 1TAWA 3HKIB 2BTCE 1F0SA 3E6PH 3SJIA 1KXDA 4JZIA 1U6QA 4NZQA 3DUXH 3AAVA 3I77A 1EJNA 1HAXB 1O3IA 2Y6TA 2BLVA 1GCTB 2OCVB 1IQJA 2ZTYA 2SNVA 3BEIB 3ZVGA 1KSNA 1A61H 3LH1A 2A7HA 1P2QA 3I78A 1ESAA 3P92A 1AUJA 1VR1H 3BEFB 2TBSA 4MNVA 4WVPE 4MNXA 4ABDA 4AYYB 2AEIH 3D49H 2BXUH 2HNTF 4GVUA 5A8ZA 1CBWB 2K1QA 5CE1A 3LH3A 2H9EH 4WMDA 1LKBA 1RIWC 2VVVA 3KQEA 3M3SA 1HAHH 2RG3A 1C4U2 4J2YB 1MTUA 2CHAB 1W10U 2ESTE 4MPXA 1NESE 2WPLS 2QN5T 4ZKRU 2ZGXH 3FANA 4OS6A 3ZVBA 1YGCH 1GJ5H 1P04A 2J4IA 4JK5A 3TJVA 5LPEA 1ETRH 3U8RH 2SNWA 1V2TT 5FBIA 1O3CA 2R3YA 5FX6A 3E16B 4ZXXH 1W8BH 1DFPA 4RKJB 1DPOA 1N8OC 3A7VA 4FUCA 1B0FA 3JZ2B 3STJA 4ZHMU 4Y8ZA 2A2XH 2HPPH 1DXWA 4UFGH 2KAIB 1WQVH 4WMFA 1AFQB 1MD7A 4AFUA 1AHTH 2OQ5A 5A8XA 3KHVA 1J8AA 1JRTA 2OD3B 3Q3KA 3MNBA 2BHGA 3UTUH 2J9NA 4XSKU 2AIPA 3VEQB 3VB3A 3SU4A 4DG4A 1DWDH 1QB1A 2BOKA 1SL3A 2PKSB 3NWUA 1KXBA 1SI5H 1Y5AT 2W7UA 4CRBA 1WOFA 1ZTLA 1MUEB 4CHAB 1O5AB 2ZNKH 3U69H 4AZ2B 3TNSA 2VJ1A 3SI4H 2ZHDA 2XBYA 5I25A 4B76A 2BYAX 3RXPA 1VITF 1DWBH 2GDEH 4OS4A 2GX4A 1V2PT 1A46H 2SGFE 2ZECA 2QCYA 1A0HB 3DT0H 1UTOA 3RMOH 1ZSLA 4O9VA 3ZZCA 1C5YB 1YYY1 3OTJE 3GY6A 4Y6DA 1V2MT 2PTCE 1ZR0A 4YLQH 3EAJA 4K8BA 1O35A 3ATKA 3MO9A 3TJNA 1EP6A 4MNYA 5LPRA 4OS7A 4XBCA 3ZZ3A 1AB9C 1WUNH 2C8YB 2HOBA 3GCHC 1GHVH 1JXPA 1PPGE 3VGCC 2AIQA 1SFQB 1YCPK 3D23A 3MTYA 4MQAA 1MKXK 4LZ4B 4B71A 1JWTA 1EQ9A 2Y81A 3ATMA 1CO7E 2BDHA 1P09A 3VPKA 2P59A 2ZIQH 3LGYA 4E7NA 4TPIZ 3ZZ4A 2BB4A 3HGPA 5DP3A 3P8FA 4F4OC 1T4VH 2EI8A 5EPYA 1ZGVA 3QX5H 5E2OA 1O2ZA 3SV9A 1BMLA 5EW2H 4YT6H 2Q6DA 2NU4E 1ZSKA 1PPBH 1EUFA 3UOPA 2FLBH 2A2QH 1O3AA 2FX4A 2Z9IA 4Y79A 1GJDB 1SB1H 1TGTA 3GY7A 4FUJA 4YZUA 4A92A 1AUTC 1FY5A 3OSYA 1L4DA 1BMAA 4JZDH 5BRRE 4B2CA 2XBWA 5DO4H 1F2SE 3TU7H 2BMGB 1O5CB 2AGGX 1YPMH 2BX3A 1TE0A 3RXFA 2BLQA 5EXMA 1OWHA 2FM2A 3PTNA 2C8XB 4A1XA 4XE4A 1HLTH 1F5LA 4ABFA 1Q31A 1LQEA 1C5VA 1YBWA 1SGQE 2A4OA 4Q7YA 1THSH 2VWLA 5L30H 2UUFB 2B5TB 1GDNA 3A7ZA 3PMBB 1FZZA 1SOTA 1BRAA 1C5SA 1O3DA 1W13U 1Y5UT 2F83A 4BNRA 4DJZB 5DGJA 2G4TA 3SU1A 3UREA 2BDIA 1NTPA 3FAOA 2Z9GA 2VU8E 2A4QA 3BV9B 5GXPA 3RU4T 2PUQH 1SQAA 3H5CB 2BDBA 4UFFH 1H9IE 4B1TA 1Y3UA 3PB1E 1TPAE 3CS7A 8LPRA 3UQVA 1CHOG 1LO6A 4GPGA 4E06H 1BDAA 3MO6A 3LKWA 2EI7A 2EA3A 1K1LA 4AGJA 1SGFG 1OWDA 2Z9KA 3VB5A 1SR5C 1IQLA 3P95A 2QF0A 1EATA 2VGCC 3SORA 3K2UA 3RMLH 1AGJA 1FDPA 4BAKB 1P57B 3O8DA 3VB7A 4ZKOU 1PQ5A 3MH7A 4JK6A 2ZDAH 5JDUB 1BOQA 1SFIA 1CVWH 4TWWA 1C1VH 1EZXC 3EA9A 1YCPH 2BZAA 1GMDG 9ESTA 4WMEA 1O3BA 4TYDA 3QTVH 2SGDE 2R2WU 1PPCE 2WUCA 1D3PB 1EOLA 3MH6A 4YO9A 1ELBA 3V0XA 1GJ4H 2ZU3A 2BLWA 1OYQA 1KLJH 2FEQH 3D62A 1HIAA 1MTVA 2B9LA 2EC9H 3PLBA 1A5GH 1C1NA 1XUGA 2HLCA 1MMJN 2CMYA 4Q2KA 2GMTB 1HAVB 2A1DB 2FOEA 2XBVA 3S9AA 2OTVA 3MU1A 2GCTC 3LOXA 3A81A 1QIXB 1O2PA 4GCHG 1OOKB 5DP6A 1PYTC 1ZOMA 2ZHWH 1HJ8A 1K9OE 1C2LA 3GDSA 2BY9X 1UTMA 3QGNB 3MU8A 2IJOB 4JMYA 4X6PA 3BTKE 1YPHC 4X8SH 2ZDNA 4CRDA 2WUBA 1C1RA 2CN0H 5C20A 5EU8A 7GCHF 3KQDA 3A89A 3M36A 5TCCA 4GLYA 4MVNA 3M37A 5EG4A 2Q6GA 4ISLA 3RLYH 3RM0H 3GDVA 4IMZA 3ZV9A 1BRBE 1K1JA 4CH8B 1TALA 1UCYE 1TA6A 5C5OA 1GMHG 3QTOH 2P8OC 1QL8A 4GSOA 1XVOA 3QK1A 4ZKNU 1T4UH 3F6UH 3P17H 3UNRA 4UDWH 1VCWA 1A2CH 5DP4A 1Z8IB 2ANWA 1QB9A 1P03A 1NO9H 1O2YA 3R3GB 2PKAA 1XUHA 1ZJKA 3O8RA 4UD9H 5EXLA 1GL1A 1GJ8B 3RXHA 3PYHA 5DKMA 1Z1JA 2ILNA 3BTME 4FVDA 3ATWA 1TPPA 3ZVCA 2GD4B 3UUZA 4ZKSU 3L3TA 2UUJB 2ZFSA 2FPZA 4NSYA 2VWOA 2PUXB 3BG4C 4O03A 3E1XB 2HNTC 1QHRB 1YM0A 1QA0A 3BF6H 1VZQH 1J16A 2PSYA 1BTHH 2JETB 1CA0B 1XXDA 4Z0KA 2ANMH 1O2JA 1O2XA 1P9SA 3MH5A 4NGAH 1HJAC 1QRZA 3AW0A 3ATIA 5C1UA 1GG6B 2ZU5A 1EPTB 1BCUH 4DVAU 4I8GA 3ZZDA 4THNH 1KDQA 1HRTH 2RA0A 3P8NA 1C9TA 2W5EA 3RXBA 1RGQA 1O2TA 1GGDB 3PMHB 1F7ZA 3ESTA 2GP9B 3LGIA 3MU5A 1T7CA 2AMDA 3EE0B 1K22H 2DE8A 2VIVA 4JZ1A 4D7GA 1O2NA 1XUJA 2CXVA 2ZU4A 5A2MH 4F49A 3SNDA 5C5NA 3RXJA 3A84A 5G4BA 3SU6A 2PFEA 4FUIA 3HK6B 1VGCB 1V2UT 5PTPA 2F9OA 1AU8A 1AD8H 3NK8A 3HKJB 4Y76A 3ZZ7A 1NPMA 1QTFA 1DM4B 1GI4A 4ESTE 3MHWU 5JB8S 2BZ6H 3ITIA 1RIWB 1BBRE 2OC8A 3NUMA 2Y80A 2UWLA 1AZ8A 3RXIA 4X2YA 1OS8A 1SGTA 3RDZA 2W3KA 1GJBB 2XC0A 1P2OA 1SGFA 2P3TB 1W0ZU 1AKSB 1IQGA 4BAHB 5HM2A 1NFYA 5CMXH 1DLKB 3K6ZA 1OP0A 1BRCE 4XFQA 1O39A 2ZFPH 3T2NA 1UTLM 4ZUHA 1TOMH 2PSXA 2VVUA 3L6PA 2TIOA 3PROA 2PTNA 2VWMA 3GY5A 5A0AE 5EGMA 1QY6A 4HFPB 1YC0A 2XWAA 1XKAC 4Y7BA 1UTNA 2UUKB 3MI4A 3TIUA 2Z6BD 5E0JA 1CU1A 1EOJA 3P70B 3TJOA 2O9QA 4D76A 5JB9S 1O5FH 1DUAA 1YPJH 1TX6A 1HYLA 4K1EA 1FI8A 1GHYH 4Q80A 4UONA 4SGAE 1WYKA 1DOJA 1V2NT 3FVFB 1O3LA 2XCFA 1FN8A 1MZDA 1TPSA 5DP5A 5A09A 1ZPZA 3RU4D 1ZRBA 3LC3A 1SGDE 1TNLA 4KP0A 1LMWB 2XNIA 1SGEE 2J38A 4DIIH 1GI5A 1AE5A 6GCHG 1S81A 2ZDKA 4BAQB 1GBMA 1YPKH 3U98H 2FOMB 1G3CA 4CRCA 1V3XA 2P93A 1DICA 2ZEBA 4CBOA 3RXOA 3NKKA 1PQ7A 1PPFE 1SHHB 2OLGA 1K1NA 2YNBA 2WYJA 1CHOF 3IITA 3LGTA 4WY3A 1TOCB 1GHZA 2TGTA 4KTUA 2FOCA 1AB9B 1D9IA 1GBTA 1O36A 4OGYA 2FI5E 1QNJA 3RXUA 3B9FH 1BTZA 3RXRA 3GCHB 1TRNA 3GY2A 1QQUA 1O2LA 1FV9A 1NU9A 4I8JA 3VGCB 3FP6E 1WBGB 4X1RU 3S7HB 1WCZA 3Q00A 3MU4A 1K1MA 5C2ZA 2EI6A 1P05A 3MFJA 3RM2H 1ZGIA 2XTTB 2BVRH 2XXLA 2BD3A 2A32A 2ODPA 2V0BA 1GBEA 2GCHG 1IAUA 2XYAA 4JZEH 4Y0YE 1GMDF 5HM9A 8GCHG 4LZ1H 4NA7A 2PGBB 1P10A 2FI4E 4NSVA 4YM9A 2QIQA 1S84A 1QJ1B 2HPQH 2W7SA 2ZQ2A 1INCA 2BDYA 1VCQA 4X8VH 1C2EA 1AIXH 1DANH 2ZDMA 3F9FA 4DT7B 1EJAA 1ZRKA 4MG3A 2Y5FA 1QQ4A 1O3GA 3RXDA 1KLIH 4ISIH 2SGEE 3AASA 1C2HA 2ALVA 1CT0E 2ZPSA 1A5IA 4PROA 3PLKA 4XOJA 5T6GA 3SQHE 3LPRA 1OKXA 1OWJA 1ZMJA 3I29A 5C3NA 3NCLA 1F0RA 2F9UA 1TLDA 4GCHF 1C1MA 3Q3YA 3BTDE 2ZC9H 3D65E 3TVJB 4O97A 2HGTH 1TRMA 2F9VA 1ZYOA 4I32A 4TPYA 3T5FH 1AZZA 3DFLA 3KL6A 4I31A 3E90B 2STAE 4BXSA 1QL7A 3ODFA 2J92A 1C5MD 1GBDA 1A3EH 4SGBE 2ANYA 1TGCA 5CHAB 1DWEH 4I7YH 3LJOA 1SQTA 1YPLH 1UVPA 2CF9H 1LPGB 5E0GA 4K2YA 1P06A 1BHXF 1O2KA 6CHAC 4AFQA 4FU9A 2TGPZ 3LONA 4H4FA 2ZKSA 4FUEA 4WXVA 3TNTA 3SUGA 3A8DA 1GMHF 1F5RA 1C1OA 1HDTH 2GVFA 2ZU1A 3KF2A 4D9RA 2G4UA 1MU6B 4CRAA 1NRQH 4I8HA 3ELAH 5L6NH 3P8GA 1H8DH 1Z1IA 1AWHB 3OY5U 1WTGH 1B7XB 1TB6H 4Q7ZA 1DE7H 3F9EA 4NCYA 4HZHA 1XXFA 4CR5A 2H5CA 1FAXA 3UR6A 1QFKH 1HAPH 4NWLA 1F0TA 1E36B 4GUXA 1GPZA 1SOZA 1FLEE 1OWKA 2ZDVH 2QGRA 4BAOB 2VH6A 1Y3VA 4KTSA 2FESH 1ELEE 3RXCA 2NU1E 1MZAA 1V2OT 3HPTB 2VIWA 1UHBA 1YLCA 1C1QA 2BOHB 3A87A 4OS2A 2FS9A 1YPHE 1OYTH 1LVYA 2ZA5A 2TGDA 1NROH 2CV3A 2Q1JA 1BTXA 1GJ9B 4Y8XA 1SGCA 1IQEA 1L1NA 1GBCA 3ZVEA 2A0QB 3PO1B 2GCTB 3S7KB 1Y3WA 2ZF0H 2IPHA 2GV7A 2OBOA 2I6QA 1H1BA 3SV2H 1TGBA 1ABJH 2ZI2H 1PYTD 2ZDLA 1RFNA 4M7GA 4FU7A 2PLXA 1O2VA 1G32B 4GAWA 4UE7H 1T8MA 1HJ9A 2QXGA 1EB1H 1LHFH 1C5WB 1GWAA 5ESBA 2BQWB 1MBQA 4NA8A 4B2AA 1D6RA 4NA9H 2BY7X 3TLOA 1GCTC 1A0LA 1GHAG 1T32A 2EEKA 3PMJA 1GBFA 3ZZ9A 4YOJA 4INKA 1SGYE 2XWBI 3CP7A 3SNEA 4Y8YA 2BY5X 1ID5H 4ZAEA 1TGNA 3KCGH 1QA7A 3QZQA 4GHTA 1O2IA 1FPHH 2PWXA 1K1IA 1ANBA 1C1PA 3GY8A 1GI3A 2XC4A 1CBWC 2GT7A 1G9IE 2ZU2A 3VXFH 1GHWH 3T27A 2IOTA 2HNTE 2CHAC 3QDZB 3KEEA 2FIRH 3NXPA 2VIPA 1P0SH 5F8ZA 3EA7A 1C4V2 1A0JA 2FYQA 3QO6A 3W95A 3ZYDA 2JKHA 1L0ZA 1S6FA 3RC6A 1EB2A 2BD4A 2C90B 3HATH 5EOKA 3STIA 2D2DA 3AW1A 3OX7U 1FJSA 3WY8A 2ZGBH 1PPZA 1ELTA 2ODYB 2GT8A 3BG4B 1P3CA 1GBAA 3SU5A 1C5NH 3SNAA 2ZGHA 1YLDA 3PMAB 1W14U 2M5TA 3UOUA 1M9UA 3CS0A 1C4Y2 1A7SA 2FX6A 1O34A 1P01A 1BMMH 1F92A 3BN9A 1AFQC 4BAMB 3C1KA 1SLXB 4NG9H 3GISB 3T62A 1VJAU 1BTUA 4K5ZA 5LGOA 3SNCA 3VB4A 3F9GA 5TCAA 2PKSC 4BTTB 4LK4A 1F0UA 1P12E 2W26A 1DLEA 5FCKA 1ZLRA 5K0HA 2BD9A 2FOBA 3ZVAA 1SLUB 5DP7A 4RSPA 4CHAC 2DE9A 3V3MA 6GCHF 2ZO3H 1MKXH 1S85A 1UTQA 1YCPM 5J4SA 2LPRA 3LJJA 3MNXA 3OU0A 1O2GH 1GBIA 1S83A 3JZ1B 4FUDA 4X1NU 1AVGH 3SV7A 1IQNA 4YOGA 5EQRA 5LH8A 1A1RA 1AN1E 4U32A 1FY4A 1RTKA 3M5LA 4CREA 1C5ZB 1E0FD 2ZQ1A 3AVZA 2AERH 2VINA 4NWKA 1P2NA 3IWMA 1G37A 2OP9A 1CT4E 5AHGH 3W94A 4AG2A 1TGSZ 1CA8B 5HYOA 2QYIA 1MH0A 1MTWA 1BQYA 3DD2H 1DSUA 1O33A 3V7TA 1EKBB 2G52A 2G81E 2XCNA 1ANEA 1ZSJA 3URDA 1TNKA 1YPEH 1DVAH 2WPIS 1KY9A 2VH0A 3SJOA 1CQQA 3F9HA 2GCHF 1EAWA 5DP8A 2RCEA 3UWJH 8GCHF 7KMEH 1QJ6B 1FN6A 3MU0A 1QRWA 3KGPA 2CGAA 4WXIA 3ZZBA 3SHCH 5HGGA 3FP8E 1THPB 3QWCH 1TMBH 3TGJE 1EAIA 4WH6A 2J94A 2WPHS 4AG1A 2FOFA 3QZRA 2BDAA 4FUBA 5GCHG 1O3FA 1WV7H 2O8WA 3Q3XA 2H5DA 4XDEA 3SNBA 4ISHH 4IS5A 1TNJA 4XBDA 1PPEE 1UCYK 2WPKS 3HK3B 3BTWE 1FMGA 2QY0B 1DX5M 2P95A 1C5LH 2KAIA 3MNCA 3PWCA 2O8UA 1C5TA 3ATLA 3BG8A 3F1SB 1HUTH 2GGVB 1UO6A 7ESTE 3U1JB 2CF8H 2F9PA 4BXWA 3Q77A 5DP9A 1BIOA 3PLPA 1P2KA 3FZZA 4FUHA 4RKOB 1V2VT 1EZSC 5GWZA 1EXFA 1OPHB 1Z8RA 3G01A 1TMUH 5AF9H 3FFGA 2GZ8A 1YKTA 1TABE 4ZMAH 3B8JA 1BB0B 1GJ7B 1N1LA 1SMFE 2B7DH 3GCOA 3M5OA 3M3TA 4X2XA 4O3UA 1RTLA 2PW8H 5F6MA 2G51A 1DSTA 2Q6FA 1TNGA 1CT2E 2ZFTA 2BY6X 2AMPA 4MDSA 2ZG0H 3ZVFA 1NT1A 1KXFA 2V3OH 2YOLA 3SU0A 1G36A 1SGRE 2C8WB 2WPMS 2XC5A 3K9XB 4DY7B 1GHBG 2FTMA 5H4IB 2OQUA 4X8UH 2H9TH 2ZFQH 2A4RA 2ZFRH 1Y3YA 4ZHAA 3RXTA 3U1IB 3UR9A 5I46H 1MTNC 1FPCH 1O32A 1C5UA 1C5RA 3M61U 1C2FA 1HCGA 4WH8A 4Y11E 2BD2A 5DPAA 3H7OA 1HV7A 3CENA 2BDGA 1ACBE 1VITH 3GCNA 4MNWA 1K1OA 4ABHA 1Z8GA 1UTKA 4FXGH 1Y59T 1IHTH 3MO3A 1O2QA 3A7WA 3PWBA 2Z7FE 2PV9B 4FU8A 1HGTH 1UVSH 1A4WH 1DITH 6LPRA 1V2RT 1GBKA 3RXMA 1Y3XA 1WTHD 1XUFA 4Y7AA 4H6TA 2V3HH 3MMGA 2QA9E 1TONA 4OGXA 1NFWA 3BTFE 3UWIA 2R0KA 1UK3A 1G3BA 3M7QA 1LVOA 1ARCA 1XM1A 2GMTC 1J17T 1ESBA 1DXPA 1GVZA 3ZVDA 4AB8A 1O5DH 1BBRK 1KLTA 1UCYH 3RXAA 4K69A 1EAXA 1P2IA 1UTJA 3N7OA 3GCTG 2I6SA 1YP9A 4TY7A 1HAYB 4D8NA 3RMNH 1N8OB 3SJKA 1XMNB 4NFEA 4ZHLU 7LPRA 3UY9A 1OXGA 1DY8A 1GHAF 2ODQA 3M7UA 2TRMA 1Z6EA 4ABGA 4IC5A 1UJ1A 1KYNA 1T8NA 2FOAA 1BZXE 3M5NA 6CHAB 2IN2A 1W7GH 4TY6A 3M35A 1GHXH
chains in the Genus database with same CATH superfamily
2JDID 3F68H 3SOSA 1G2LA 1Q2WA 2FP7B 3SJ9A 2ANKH 4Q4LA 2BDCA 5DJ7A 1O3OA 3KQ5A 3VFEA 5ABWA 2GV6A 4WWYA 2A7CA 1MU8B 1WU1A 5DG6A 1Z6JH 1GBBA 2FOHA 1ZTJA 4IGDA 2BQ7B 1OWEA 5FPTA 2BVXH 3FP7E 5A0BA 5JBTA 1TNIA 2TPIZ 1NFXA 3KN2A 3E8LA 1SC8U 1ORFA 2ASUB 1SLWB 1O2UA 1AMHA 4Y10E 1S5SA 3GYMA 8KME2 3ZZ6A 1IQIA 2XBXA 1FXYA 2ZHQH 3LGWA 5FXLA 1KTTB 2JH0D 2R3UA 2BLOA 1JOUB 2ZCKP 1RS0A 5SGAE 5T1VA 4CRGA 1KMHB 1C2JA 1P2MA 5FAHA 4IW4E 1LHDH 2NU3E 3ZZ8A 1ELVA 3RXEA 2UUYA 3SGBE 3ENSB 3HGNA 5E0HA 1PFXC 1O38A 2P3FH 4WF8A 2PR3A 2JETC 4VGCC 8ESTE 1CA0C 5GJ4B 4KELA 3K65B 3RLWH 4E05H 3LGVA 4DIHH 2F43B 3OTPA 1GG6C 2FODA 1UVOA 1C2GA 5GDSH 1C2MA 1P8VC 2AMQA 1DS2E 1NU7B 1O5EH 1CGHA 1P11E 3UNQA 3UQOA 5JYIA 1ARBA 4I8LA 1XKBC 1HIAB 1V2WT 1D6WA 1HPGA 2D8WA 1A3BH 1GGDC 4RN6A 4U2WA 3GY4A 2ZGCA 4B75A 5EPNA 1HAVA 2Y5GA 1AVXA 1C1SA 1L1GA 6ESTA 4MLFB 1L4ZA 2THFB 1TBZH 5IK2D 2QXJA 1BBRH 1LPZB 2VNTA 3QUMP 1UK2A 3GICB 3SUDA 7GCHG 4H6SB 4B2BA 1ZZZA 1GMCG 3SW2B 3A83A 1FONA 3BIUH 1VGCC 2OINA 1GI1A 2FZZA 1TYNA 1TA2A 1TMTH 2G55A 5EJ1A 3RXLA 3C27B 1V2KT 1LKAA 4YOIA 2Z94A 4ABBA 1K28D 5L2YH 2VB0A 2WV4A 4BTIB 3NZIA 2BQ6B 1GJCB 1WAYB 3T29A 3TITA 1DWCH 1C1WH 2BD7A 4P02A 1KIGH 3KIDU 1RD3B 3RXVA 5FCRA 4JYUH 3RMMH 1W0YH 3KNXA 1THRH 3P6ZB 3QN7A 1EJMA 3S69A 3U8OH 1H8HD 4Z1MD 1IQMA 4YT7H 1BTWA 4AYVB 1RXPA 1HB0B 1SVPA 1ZMLA 5EQQA 1S82A 1NRPH 1FAKH 3KQCA 1FNIA 1MD8A 4NIXA 1TIOA 1L1JA 2L6OA 3R0FA 2J95A 4KKDA 4B73A 2G5NA 4D7FA 5GCHF 3LU9B 1TX8A 3E3TA 1O37A 2PKAB 5C1XA 5C0UA 1BTPA 2UWPA 1G3EA 5C0TA 5DK1A 3A86A 3ZZ5A 3A85A 1ELGA 3BTQE 1AO5A 1W7XH 1QZ8A 4Y0ZE 1JIRA 1P9UA 4ABEA 2A45B 2VGCB 4DURA 1QURH 2Z3EA 1SG8B 1O3KA 2FS8A 1AFEH 1ELAA 1O2MA 2KR7A 1D4PB 4A5TS 4GHQA 4YESB 1UVTH 3ODDA 1ZHRA 5C94A 2LNCA 2ZHFH 3VXEH 3PM3A 5C17A 1HBTH 1Z71A 1H8ED 5L2ZH 3F2HA 4RT1A 5B6LA 1C1TA 1SQRA 4UFEH 2Y7ZA 1EPTA 4IN1A 3TK6A 1EZUC 2UWOA 4CRFA 2ZP0H 2A7JA 2D26C 1O31A 1GBJA 1K21H 4X8TH 2R0LA 2PHBA 1KDQB 2ZPQA 4A7IB 1G3DA 3ZYEA 2FLRH 2SGQE 1MAXA 2RA3A 4HGCA 2O8MA 3A82A 3U8TH 3E0NB 5ETXA 5C1YA 3TGIE 1O5BB 1W3CA 1MBMA 3M7TA 4ABIA 3U9AH 1LVMA 1MCVA 2FI3E 1P2JA 2VVCA 3PRDA 5FPSA 1G30B 2W3IA 4INLA 1VJ9U 1C5OH 1C1UH 1GHBF 3BTHE 3K6YA 1E37B 1VCPA 1LQDB 5FHTA 3RC4A 5EW1H 3RXSA 2C93B 5IDKA 2RDLA 1T8LA 3V12A 2V6NA 1DUEA 1G2MA 4ASHA 1JMOH 3DFJA 1Y8TA 2AS9A 1CE5A 4FUGA 1OSSA 1MTSA 5FL7D 4BANB 2KCAA 1O30A 4WJG2 1GI9B 4U30A 4OS5A 1NBMD 1YPGH 3SV6A 3LGUA 1S0QA 4FUFA 1S6HA 1RTFB 1EX3A 1K1PA 2ZPRA 2O8LA 1FQ3A 1W12U 2WPJS 3QGJA 1MCTA 1MKWK 2STBE 4ZXYH 1FY1A 1AKSA 2P8OB 2AYWA 1YLNA 2F9NA 4NZLA 1YY3A 1J14A 1DT2A 1N6YA 5F8XA 3GDUA 4AORA 2KCYA 4B6EA 4B74A 2F3CE 2YMSD 1EASA 2FO9A 3RUOA 5T6DA 2FOGA 1TFXA 4RT0A 1TQ0B 4Y71A 1V2JT 2XNDD 2NU2E 2G8TA 4J1YA 5GIBA 1C9PA 1HNEE 3FN8A 4AGKA 1AQ7A 2C4FH 1SBWA 1S0RA 1ZJDA 2JH6D 2P3UB 4AX9H 1H9HE 1NN6A 3AAUA 1ZHMA 2VWNA 2KFWA 4XBBA 1AVWA 1O2HA 2B0FA 1QR3E 1TNHA 4AFSA 3GCTF 1NY22 1IQHA 5T6FA 1RJXB 4AFZA 2BXTH 5C67A 4DOQA 1NM6A 1W0KD 1HAIH 2PGQB 2BD8A 3TGKE 1ZTKA 3BTTE 5GPIB 1GCDA 2EY4C 1C5XB 3BIVH 1NFUA 3KQBA 3M3VA 5A0CA 5CHAC 4I8KA 1TX7A 2SGAA 1ELDE 2H1UA 3SJ8A 1UVUH 1C2IA 3SHAH 1QBVH 2DUCA 1GI6A 1H9LB 1HJAB 2JJ2D 1WQSA 2H9HA 1IOEA 1V2QT 3V13A 1IHSH 4ZROA 4ABAA 1A5HA 5A8YA 1KXCA 3M5MA 1XUIA 4K1SA 4IBLH 1B5GH 3A88A 3BEUA 4X6MA 2ZFFH 1O3JA 1P02A 2Y7XA 4IN2A 3O8CA 4P00A 1L2EA 1HXEH 4E7RG 5F03A 2VIOA 3TH3H 1JRSA 1MTNB 3EDXB 1ABIH 1W11U 2XW9A 5T3HA 1P3EA 1FIZA 1QL9A 2C8ZB 4F48B 1LDTT 1IQFA 3A7TA 4QT8C 1BRUP 4A1TA 4BTUB 1LTOA 2WV5A 3URCA 1BHXB 4JCNA 2V35A 2L74A 3TK9A 2P16A 2NWNA 2BD5A 2QXHA 4UEHH 3SZNA 1T31A 5TJXA 2KCPA 2BX4A 2Z9JA 1GDUA 3TH2H 2XRCA 1O3PB 2FWWA 3TK5A 1QCPA 2WSSD 1SPJA 1Y5BT 4KTCA 1CSOE 1WXRA 1JIMA 2HVXA 1ESTA 1MKWH 3T26A 1V2LT 3H09A 1ZPBA 3SQEE 4X6OA 1NC6A 1XUKA 2C3SA 3EQ0H 1HFDA 1LHCH 1XX9A 2G00A 4HTCH 1GI0A 1LVBA 1ELCA 2J2UA 2VIQA 3EA8A 2VBCA 1O2WA 3PO1C 3EYDA 3S0NA 4INHA 3TH4H 1O2OA 1O2RA 1LHGH 1BT7A 1NRSH 1ZHPA 2Z3DA 2B8OH 5KEDA 1SQOA 1C5PA 2BM2A 1OP2A 5HMAA 4LXBH 5F8TA 1CHGA 2D1JA 3RP2A 3VB6A 4K1TA 2AGEX 4HI3A 5EODA 1HXFH 4F55A 3GOVB 4JYVH 1ANCA 3A7XA 4NIYA 2ZZUH 2ZWLH 3NPSA 2A31A 1E79D 4OS1A 1TQ7B 4CBNA 5J4QA 2P94A 1SGPE 2QV1A 3BTEE 3DA9B 1GMCF 1O3HA 1F5KU 1LPKB 1N6XA 5HIZA 1W2KH 3A8BA 3S9BA 1ZMNA 4U01A 9LPRA 1CGIE 5JBCS 4X0WU 3S9CA 1AWFH 1HAZB 3SUFA 3SBKA 1FY8E 4A1VA 1QB6A 4MPWA 1SSXA 2BY8X 2VIDA 5AFZH 2ZCHP 1NS3A 3SU2A 4R8TB 3H7TA 3GYLB 3Q76A 1GI2A 1GBHA 1CGJE 3O8BA 2OC1A 4BOHA 1Q3XA 3LT3A 4R0IA 3LC5A 2QF3A 4UFDH 1ELFA 2SFAA 2HALA 3UFAA 1O3EA 1KXEA 4IMQA 3DSOA 1JBUH 3UPEA 2GZ7A 1SGNE 2NU0E 3MH4A 2OC7A 5JBAS 3RXQA 5ESTE 4OM9A 2H2ZA 1TRYA 1ETTH 1XVMA 2FDAA 3FOAA 2SGPE 1J9CH 3SI3H 1VITG 1GI7B 5B6OA 4ISNA 1GI8B 3TPIZ 2GKVE 2GTBA 3ZV8A 4K3JA 1HAOH 3DHKH 4X2WA 1QJ7B 1FUJA 1SGIB 3PV4A 3OY6U 2OBQA 2FMJA 3VG8A 4ISOA 5HXFA 1BJVA 2TGAA 1PQAA 4DCDA 5IYTA 1Z8JB 2A4GA 1AY6H 4AB9A 1OX1A 2AH4X 4VGCB 1IQKA 4MPVA 3A80A 5DN6D 1B0EA 2OXSA 2AFQB 5HIYA 5F53A 1WDIA 3SGQE 1E38B 2ULLA 2GZ9A 3MWIU 1O3MA 2FYRA 4DW2U 1O0DH 2HRVA 4AN7A 4NIWA 1OP8A 1O5GH 3B23B 1QRXA 1EP5A 4X1PU 1UHBB 3SV8A 1OWIA 1O2SA 3GY3A 1NRNH 2BVSH 1D3TB 1BJUA 4NIVA 1E35B 1H4WA 1K2I1 4K8YA 3T28A 4ABJA 3EGKH 1ANDA 3P8OA 3TJUA 2AHME 1BMNH 1LCYA 2A5IA 3SO3A 1GJ6A 3UNSA 2GDDA 3E0PB 5EXNA 1BITA 2ZHEH 2ALPA 2O8TA 2FXRA 1T8OA 3LDXH 4O3TA 1SLVB 2Z3CA 1HAGE 1PJPA 1AI8H 2OC0A 1TWXB 2CJIA 2WINI 3RXKA 2R9PA 3A8AA 2WV9A 1GVLA 1AE8H 1DY9A 3OYPA 2QAAA 3E91A 4LOYH 4X2VA 1QGFA 3SGAE 4Z6AH 2K0QA 4MTBA 1WSSH 3PTBA 5AVDA 4NFFA 2ZTXA 1BA8B 1GL0E 2H6MA 4A6LA 2AGIX 5JPMH 1TBQH 2WHXA 2ZGJA 3MOCA 5CHBA 4ASUD 1J15A 4JZFH 1FX0B 3SUEA 2J34A 2LP6A 4MPUA 2JH5D 1KXAA 4Q7XA 3A8CA 1C5QA 2QC2A 1GDQA 1PPHE 2Y82A 1C2KA 4FVBA 5FPYA 1BUIA 5LPFA 4X6NA 5FBEA 1MQ5A 1FY3A 4TWYA 1MQ6A 4YTAA 2Z9LA 3RU4E 1NRRH 1TPOA 4ZH8A 1D3DB 5AFYH 3L33A 2ZTZA 4DGJA 2A5KA 4I33A 4IC6A 5FX5A 3T25A 1BTYA 4CH2B 3MYWA 1UK4A 4AOQA 1D3QB 1K0HA 3MNSA 3A7YA 5JBBS 1Z7KA 4KGAA 1MAYA 1EAUA 2Y5HA 1UMAH 1ETSH 1PQ8A 1V6DA 4K60A 5E8EH 1RRKA 1S6LA 1FIWA 2YNAA 2G5VA 1SHYA 1NZQH 4CR9A 3RXGA 1GJAB 2F9BH 1W0JD 2A5AA 2FTLE 1KTSB 1YF4A 1LHEH 1H8IH 5BPEA 1EZQA 2J98B 1YWUA 4YLUA 4JYTA 3SU3A 3UIRA 1ZPCA 1E34B 3BSQA 4X1SU 1C2DA 2F91A 2WYGA 3FZDA 5K7RA 3SN8A 5E2PA 5EQSA 1TBRH 3RC5A 1X7AC 4X1QU 4D9QA 2OUAA 3LIWA 1EPTC 1UTPA 2M2AA 2R2MB 1QBNA 1QBOA 2HWLB 1DDJA 2K8IA 3BTGE 2ZCLP 1GBLA 1GVKB 2QXIA 3IG6B 1O3NA 4H42U 1V2ST 3ZZAA 3QLPH 1TAWA 3HKIB 2BTCE 3N7EA 2RDEA 1F0SA 3E6PH 3F0PA 3SJIA 1KXDA 4JZIA 1U6QA 4NZQA 3DUXH 3AAVA 3I77A 1EJNA 1HAXB 1O3IA 2Y6TA 2BLVA 1GCTB 2OCVB 1IQJA 2ZTYA 2SNVA 3BEIB 3ZVGA 1KSNA 1A61H 3LH1A 2A7HA 1P2QA 3I78A 1ESAA 3P92A 1AUJA 1VR1H 3BEFB 2TBSA 4MNVA 4WVPE 4MNXA 4ABDA 4AYYB 2AEIH 3KYFA 3D49H 3FO8D 2BXUH 2HNTF 4GVUA 5A8ZA 1CBWB 2K1QA 5CE1A 3LH3A 2H9EH 4WMDA 1LKBA 1RIWC 2VVVA 3KQEA 3M3SA 1HAHH 2RG3A 1C4U2 4J2YB 1MTUA 2CHAB 1W10U 2ESTE 4MPXA 1NESE 2WPLS 2QN5T 4ZKRU 2ZGXH 3FANA 4OS6A 3ZVBA 1YGCH 1GJ5H 1P04A 2J4IA 4JK5A 3TJVA 5LPEA 1ETRH 3U8RH 2SNWA 1V2TT 5FBIA 1O3CA 2R3YA 5FX6A 3E16B 4ZXXH 1W8BH 1DFPA 4RKJB 3F3BA 4TSFD 1DPOA 1N8OC 3A7VA 4FUCA 1B0FA 3JZ2B 4XD7D 3STJA 4ZHMU 4Y8ZA 2A2XH 2HPPH 3MQKC 1DXWA 4UFGH 2KAIB 1WQVH 4WMFA 1AFQB 1MD7A 4AFUA 1AHTH 2OQ5A 5A8XA 3KHVA 1J8AA 1JRTA 2OD3B 3Q3KA 3MNBA 2BHGA 3UTUH 2J9NA 4XSKU 2AIPA 3VEQB 3VB3A 3SU4A 4DG4A 1DWDH 1QB1A 2BOKA 1SL3A 2PKSB 3NWUA 4ZCNA 1KXBA 1SI5H 1Y5AT 2W7UA 4CRBA 1WOFA 1ZTLA 1MUEB 4CHAB 1O5AB 2ZNKH 3U69H 4AZ2B 3TNSA 2VJ1A 3SI4H 2ZHDA 3DSPA 2XBYA 5I25A 4B76A 2BYAX 3RXPA 1VITF 1DWBH 2GDEH 4OS4A 2GX4A 4M9FA 1V2PT 1A46H 2SGFE 2ZECA 2QCYA 3SYJA 1A0HB 3DT0H 1UTOA 3RMOH 1ZSLA 4O9VA 3ZZCA 1C5YB 1YYY1 3OTJE 3GY6A 4Y6DA 1V2MT 2PTCE 1ZR0A 4YLQH 3EAJA 4K8BA 1O35A 3ATKA 3MO9A 3TJNA 1EP6A 4MNYA 5LPRA 4OS7A 4XBCA 3ZZ3A 1AB9C 1WUNH 3OEED 2C8YB 2HOBA 3GCHC 1GHVH 1JXPA 2QF4A 1PPGE 3VGCC 2AIQA 1SFQB 1YCPK 3D23A 3MTYA 4MQAA 3WW7A 1MKXK 4LZ4B 4B71A 1JWTA 1EQ9A 2Y81A 2J97A 3ATMA 1CO7E 2BDHA 1P09A 3VPKA 2P59A 2ZIQH 3LGYA 4E7NA 4TPIZ 3ZZ4A 2BB4A 3HGPA 5DP3A 3P8FA 4F4OC 1T4VH 2EI8A 5EPYA 1ZGVA 3QX5H 5E2OA 2WZQA 1O2ZA 3SV9A 1BMLA 5EW2H 4YT6H 2Q6DA 2NU4E 1ZSKA 1PPBH 1EUFA 3UOPA 2FLBH 2A2QH 1O3AA 2FX4A 2Z9IA 4Y79A 1GJDB 1SB1H 1TGTA 3GY7A 2YMSB 4FUJA 4YZUA 5EJZA 4A92A 1AUTC 3OFND 1FY5A 3OSYA 1L4DA 1BMAA 4JZDH 5BRRE 4B2CA 2XBWA 5DO4H 1F2SE 3TU7H 2BMGB 2W6JD 1O5CB 2AGGX 1YPMH 2BX3A 1TE0A 3RXFA 2BLQA 5EXMA 1OWHA 2FM2A 3PTNA 2C8XB 4A1XA 4XE4A 1HLTH 1F5LA 4ABFA 1Q31A 1LQEA 1C5VA 1YBWA 1SGQE 2A4OA 4Q7YA 1THSH 2VWLA 5L30H 2UUFB 2B5TB 1GDNA 3A7ZA 3PMBB 1FZZA 1SOTA 1BRAA 1C5SA 1O3DA 1W13U 1Y5UT 2F83A 4BNRA 4DJZB 5DGJA 2G4TA 3SU1A 3UREA 2BDIA 1NTPA 3FAOA 2Z9GA 2VU8E 3U28C 2A4QA 3BV9B 5GXPA 3RU4T 2PUQH 1SQAA 3H5CB 2BDBA 4UFFH 1H9IE 4B1TA 1Y3UA 3PB1E 1TPAE 3CS7A 8LPRA 3OEHD 3UQVA 1CHOG 1LO6A 4GPGA 4E06H 1BDAA 2OK5A 3MO6A 3LKWA 2EI7A 2EA3A 1K1LA 4AGJA 1SGFG 1OWDA 2Z9KA 3VB5A 1SR5C 1IQLA 3P95A 2QF0A 1EATA 2VGCC 3SORA 3K2UA 3RMLH 1AGJA 1FDPA 4BAKB 1P57B 3O8DA 3VB7A 4ZKOU 1PQ5A 5CDFE 3MH7A 4JK6A 2ZDAH 5JDUB 1BOQA 1SFIA 1CVWH 4TWWA 1C1VH 1EZXC 4FOUC 3EA9A 1YCPH 2BZAA 1GMDG 9ESTA 4WMEA 1O3BA 4TYDA 3QTVH 4I86A 2SGDE 2R2WU 1PPCE 2WUCA 1D3PB 1EOLA 3MH6A 4YO9A 1ELBA 3V0XA 1GJ4H 2ZU3A 2BLWA 1OYQA 1KLJH 2FEQH 3D62A 1HIAA 3OE7D 1MTVA 2B9LA 2EC9H 2IPQX 3PLBA 1A5GH 1C1NA 1XUGA 2HLCA 1MMJN 2CMYA 4Q2KA 2QE7D 2GMTB 1HAVB 2A1DB 2FOEA 2XBVA 3S9AA 2OTVA 2J5UA 3MU1A 2GCTC 3LOXA 3A81A 1QIXB 1O2PA 5GNDA 4GCHG 1OOKB 5DP6A 1PYTC 1ZOMA 2ZHWH 1HJ8A 1K9OE 1C2LA 3GDSA 2BY9X 1UTMA 3QGNB 3MU8A 2IJOB 4JMYA 4X6PA 3BTKE 1YPHC 4X8SH 2ZDNA 4CRDA 2WUBA 1C1RA 2CN0H 5C20A 4HG6A 5EU8A 7GCHF 3KQDA 3A89A 3M36A 5TCCA 4GLYA 4MVNA 3UB0A 3M37A 5EG4A 2Q6GA 4ISLA 3RLYH 3PRBA 3RM0H 3GDVA 4IMZA 3ZV9A 1BRBE 1K1JA 4CH8B 1TALA 1UCYE 1TA6A 5C5OA 1GMHG 3QTOH 2P8OC 1QL8A 4GSOA 1XVOA 3QK1A 4ZKNU 1T4UH 3F6UH 3P17H 3UNRA 4UDWH 1VCWA 1A2CH 5DP4A 1Z8IB 2ANWA 1QB9A 1P03A 1NO9H 1O2YA 3R3GB 5HKKD 2PKAA 1XUHA 1ZJKA 3O8RA 4UD9H 5EXLA 1GL1A 5EIYA 1GJ8B 3RXHA 3KYGA 3PYHA 5DKMA 1Z1JA 2ILNA 3BTME 2PP6A 2GJGA 4FVDA 3ATWA 1TPPA 1COWD 3ZVCA 2GD4B 3UUZA 4ZKSU 3L3TA 2UUJB 2ZFSA 2FPZA 4NSYA 2VWOA 3SZEA 2PUXB 3BG4C 4O03A 3E1XB 3UAIC 2HNTC 1QHRB 1YM0A 1QA0A 3BF6H 1VZQH 1J16A 3ZIAD 2PSYA 1BTHH 2JETB 1CA0B 1XXDA 4Z0KA 2ANMH 1O2JA 1O2XA 1P9SA 3MH5A 4NGAH 1HJAC 1QRZA 3AW0A 3ATIA 5C1UA 1GG6B 2ZU5A 1EPTB 1BCUH 4DVAU 4I8GA 3ZZDA 4THNH 1KDQA 1HRTH 2RA0A 3P8NA 1C9TA 2W5EA 4DT4A 3RXBA 1RGQA 1O2TA 1GGDB 3PMHB 1F7ZA 3ESTA 3N7DA 2GP9B 3LGIA 3MU5A 1T7CA 2AMDA 3EE0B 1K22H 2DE8A 2VIVA 4JZ1A 4D7GA 1O2NA 1XUJA 2CXVA 2ZU4A 5A2MH 4F49A 3SNDA 5C5NA 3RXJA 3A84A 2KM0A 5G4BA 3SU6A 2PFEA 4FUIA 3HK6B 1VGCB 1V2UT 5PTPA 2F9OA 5KECA 1AU8A 3PV2A 1AD8H 3NK8A 3HKJB 4Y76A 3ZZ7A 1NPMA 1QTFA 1DM4B 1GI4A 4ESTE 3MHWU 5JB8S 3OAAD 2BZ6H 3ITIA 1VKYA 1RIWB 4YXWD 1BBRE 2OC8A 1E1QD 3NUMA 2Y80A 2UWLA 1AZ8A 3RXIA 4X2YA 1OS8A 4FETA 1SGTA 3RDZA 2W3KA 1GJBB 2XC0A 1P2OA 1SGFA 2P3TB 1W0ZU 1AKSB 1IQGA 4BAHB 5HM2A 1NFYA 5CMXH 1DLKB 3K6ZA 1OP0A 1BRCE 4XFQA 1O39A 2ZFPH 3T2NA 1UTLM 4ZUHA 1TOMH 2PSXA 2VVUA 3L6PA 2TIOA 3PROA 5KGOA 2PTNA 2VWMA 3GY5A 5A0AE 5EGMA 1QY6A 4HFPB 1YC0A 2XWAA 1XKAC 4Y7BA 1UTNA 2UUKB 3MI4A 3TIUA 2Z6BD 5E0JA 1CU1A 1EOJA 3P70B 2KZ4A 3TJOA 2O9QA 4D76A 5JB9S 1O5FH 1DUAA 1YPJH 1TX6A 1HYLA 4K1EA 1FI8A 1GHYH 4Q80A 4UONA 4Q63A 4SGAE 1WYKA 1DOJA 1V2NT 3FVFB 1O3LA 2XCFA 1FN8A 1MZDA 1TPSA 5DP5A 5A09A 1ZPZA 3RU4D 1ZRBA 3LC3A 1SGDE 1TNLA 4KP0A 1LMWB 2XNIA 1SGEE 2J38A 4DIIH 1GI5A 1AE5A 6GCHG 1S81A 2ZDKA 4BAQB 1GBMA 1YPKH 3U98H 2FOMB 1G3CA 4CRCA 1V3XA 2P93A 1DICA 2ZEBA 4CBOA 3RXOA 3NKKA 3AK5A 1PQ7A 1PPFE 1SHHB 2OLGA 1K1NA 2YNBA 2QF5A 2WYJA 1CHOF 3IITA 3LGTA 4WY3A 1TOCB 1GHZA 2TGTA 4KTUA 2FOCA 1AB9B 1D9IA 1GBTA 1O36A 4OGYA 2FI5E 1QNJA 3RXUA 3B9FH 1BTZA 3RXRA 3GCHB 1TRNA 3GY2A 1QQUA 1O2LA 1FV9A 1NU9A 4I8JA 3VGCB 3FP6E 1WBGB 4X1RU 2JJ1D 1WCZA 3Q00A 3S7HB 3MU4A 1K1MA 5C2ZA 2EI6A 1P05A 3MFJA 3RM2H 1ZGIA 2XTTB 2BVRH 2XXLA 2BD3A 2A32A 2ODPA 2V0BA 1GBEA 2GCHG 1IAUA 2XYAA 3WWFA 2XOKD 4JZEH 4Y0YE 1GMDF 5HM9A 8GCHG 4LZ1H 4NA7A 2PGBB 1P10A 2FI4E 4NSVA 4YM9A 2QIQA 1S84A 1QJ1B 2V7QD 2HPQH 2W7SA 2ZQ2A 1INCA 2BDYA 1VCQA 4X8VH 2W6ID 1C2EA 1AIXH 1DANH 2ZDMA 3F9FA 4DT7B 3DSGA 1EJAA 1ZRKA 4MG3A 2Y5FA 1QQ4A 1O3GA 3RXDA 1KLIH 4ISIH 2SGEE 3AASA 2V3MA 1C2HA 2ALVA 1CT0E 2ZPSA 1A5IA 4PROA 3PLKA 4XOJA 5T6GA 3SQHE 3LPRA 1OKXA 1OWJA 1ZMJA 3I29A 5C3NA 3NCLA 1F0RA 2F9UA 1TLDA 4GCHF 1C1MA 3Q3YA 3BTDE 2ZC9H 3D65E 3TVJB 4O97A 2HGTH 1TRMA 2F9VA 1ZYOA 4I32A 4TPYA 3T5FH 1AZZA 3DFLA 4ACBA 3KL6A 4I31A 3E90B 1EFRD 2STAE 4BXSA 1QL7A 3ODFA 2J92A 1C5MD 1GBDA 1A3EH 4SGBE 2ANYA 1TGCA 5CHAB 1DWEH 4I7YH 3LJOA 1SQTA 1YPLH 1UVPA 2CF9H 1LPGB 5E0GA 4K2YA 1P06A 1BHXF 1O2KA 6CHAC 4AFQA 4FU9A 2TGPZ 3LONA 4H4FA 2ZKSA 4FUEA 4WXVA 3TNTA 3SUGA 3A8DA 1GMHF 1F5RA 1C1OA 1HDTH 2GVFA 2ZU1A 3KF2A 4D9RA 2G4UA 1MU6B 4CRAA 1NRQH 4I8HA 3ELAH 5L6NH 3P8GA 1H8DH 2IJD1 1Z1IA 1AWHB 3OY5U 1WTGH 1B7XB 1TB6H 4Q7ZA 1DE7H 3F9EA 4NCYA 4B6FA 4HZHA 1XXFA 1OHHD 4CR5A 2H5CA 1FAXA 3UR6A 1QFKH 1HAPH 4NWLA 1F0TA 1E36B 4GUXA 1GPZA 1SOZA 4ACAA 1FLEE 1OWKA 2ZDVH 2QGRA 4BAOB 2VH6A 1Y3VA 4KTSA 2FESH 2HVYB 1ELEE 3RXCA 2NU1E 1MZAA 1V2OT 3HPTB 1UW7A 2VIWA 1UHBA 1YLCA 1C1QA 2BOHB 3A87A 4OS2A 2FS9A 1YPHE 1OYTH 1LVYA 2ZA5A 2TGDA 1NROH 2CV3A 2Q1JA 1BTXA 1GJ9B 4Y8XA 1SGCA 1IQEA 1L1NA 1GBCA 3ZVEA 2A0QB 3F0OA 3PO1B 2GCTB 3S7KB 1Y3WA 2ZF0H 2IPHA 2GV7A 1NBME 2OBOA 2I6QA 1H1BA 3SV2H 1TGBA 1ABJH 2ZI2H 1PYTD 2ZDLA 1MABB 1RFNA 4M7GA 4FU7A 2PLXA 1O2VA 1G32B 4GAWA 4UE7H 1T8MA 1HJ9A 2QXGA 1EB1H 1LHFH 2F4LA 3WWBA 1C5WB 1GWAA 5ESBA 2BQWB 1MBQA 4NA8A 4B2AA 1D6RA 4NA9H 2BY7X 3TLOA 1GCTC 1A0LA 1GHAG 1T32A 2EEKA 3PMJA 1GBFA 2KCOA 3ZZ9A 4YOJA 4INKA 1SGYE 2XWBI 3CP7A 3SNEA 4Y8YA 2BY5X 1ID5H 1E1RD 4ZAEA 1TGNA 3KCGH 1QA7A 3QZQA 4GHTA 1O2IA 1FPHH 2PWXA 1K1IA 1ANBA 1C1PA 3GY8A 1GI3A 2XC4A 1CBWC 2GT7A 1G9IE 2ZU2A 3VXFH 1GHWH 3W1EA 3T27A 3NRLA 2IOTA 2HNTE 2CHAC 2JIZD 3QDZB 3KEEA 2FIRH 3NXPA 2VIPA 1P0SH 5F8ZA 3EA7A 1C4V2 1A0JA 2FYQA 3QO6A 3W95A 3ZYDA 2JKHA 1L0ZA 1S6FA 3RC6A 1EB2A 2BD4A 2C90B 3HATH 5EOKA 3STIA 2D2DA 3AW1A 3OX7U 1FJSA 3WY8A 2ZGBH 1PPZA 1ELTA 2ODYB 2GT8A 3BG4B 1P3CA 1GBAA 3SU5A 1C5NH 3SNAA 2ZGHA 1YLDA 3PMAB 1W14U 2M5TA 3UOUA 3F2GA 1M9UA 2CK3D 3CS0A 1C4Y2 1A7SA 2FX6A 1O34A 1P01A 1BMMH 1F92A 3BN9A 1AFQC 4BAMB 3C1KA 1SLXB 1BMFD 3CNRA 4NG9H 3GISB 1SKYE 3T62A 2J98A 1VJAU 1BTUA 4K5ZA 5LGOA 3SNCA 3VB4A 3F9GA 5TCAA 2PKSC 4BTTB 4LK4A 1F0UA 1P12E 2W26A 1DLEA 5FCKA 1ZLRA 5K0HA 2BD9A 2FOBA 3ZVAA 1SLUB 5DP7A 4RSPA 4CHAC 2DE9A 3V3MA 6GCHF 2ZO3H 1MKXH 4TT3D 1S85A 1UTQA 1YCPM 4AC9A 5J4SA 2LPRA 3LJJA 3MNXA 3OU0A 1O2GH 1GBIA 1S83A 3JZ1B 4FUDA 4X1NU 1AVGH 3SV7A 1IQNA 4YOGA 5EQRA 5LH8A 1A1RA 1AN1E 4U32A 1FY4A 1RTKA 3M5LA 4CREA 1C5ZB 1E0FD 2ZQ1A 3AVZA 2AERH 2VINA 4NWKA 1P2NA 3IWMA 1G37A 2OP9A 1CT4E 5AHGH 3W94A 4AG2A 1TGSZ 1CA8B 5HYOA 2QYIA 1MH0A 1MTWA 1BQYA 3DD2H 1DSUA 1O33A 3V7TA 1EKBB 2G52A 2G81E 2XCNA 1ANEA 1ZSJA 3URDA 1TNKA 1YPEH 1DVAH 2WPIS 1KY9A 2VH0A 3SJOA 1CQQA 3F9HA 2GCHF 1EAWA 5DP8A 2RCEA 3UWJH 8GCHF 7KMEH 1QJ6B 1FN6A 3PV5A 3MU0A 1QRWA 3KGPA 2CGAA 4WXIA 3ZZBA 3SHCH 5HGGA 3FP8E 1THPB 3QWCH 1TMBH 3TGJE 1EAIA 4WH6A 2J94A 2WPHS 3N99A 4AG1A 2FOFA 3QZRA 2BDAA 4FUBA 5GCHG 1O3FA 1WV7H 2O8WA 2KX4A 3Q3XA 2H5DA 4XDEA 3SNBA 4ISHH 4IS5A 1TNJA 4XBDA 2YMSC 1PPEE 1UCYK 2WPKS 3HK3B 3BTWE 1FMGA 2QY0B 1DX5M 2P95A 1C5LH 2KAIA 3MNCA 3PWCA 2HLDD 2O8UA 1C5TA 3ATLA 3BG8A 3F1SB 1HUTH 2GGVB 1UO6A 4XRNA 7ESTE 3U1JB 2CF8H 2F9PA 4BXWA 3Q77A 5DP9A 1BIOA 3PLPA 1P2KA 3FZZA 4FUHA 4RKOB 1V2VT 1EZSC 5GWZA 1EXFA 1OPHB 1Z8RA 2LELA 3G01A 1TMUH 5AF9H 3FFGA 2GZ8A 1YKTA 1TABE 4ZMAH 3B8JA 1BB0B 1GJ7B 1N1LA 1SMFE 2B7DH 3GCOA 3M5OA 3M3TA 4X2XA 4O3UA 1RTLA 2PW8H 5F6MA 2G51A 1DSTA 2Q6FA 1TNGA 1CT2E 2ZFTA 2BY6X 2AMPA 4MDSA 2ZG0H 3ZVFA 1NT1A 1KXFA 2V3OH 2YOLA 3SU0A 1G36A 1SGRE 3GS9A 2C8WB 2WPMS 2XC5A 3K9XB 4DY7B 1GHBG 2FTMA 5H4IB 5EJLA 2OQUA 4X8UH 2H9TH 2ZFQH 2A4RA 2WPDD 2ZFRH 1Y3YA 4ZHAA 3RXTA 3U1IB 3UR9A 5I46H 1MTNC 1FPCH 1O32A 1C5UA 1C5RA 3M61U 1C2FA 1HCGA 4WH8A 4Y11E 2BD2A 5DPAA 3H7OA 1HV7A 3CENA 2BDGA 3F2FA 1ACBE 1VITH 3GCNA 4MNWA 1K1OA 4ABHA 2RFKC 1Z8GA 1UTKA 4FXGH 1Y59T 1IHTH 3MO3A 1O2QA 3A7WA 5DSFA 3PWBA 2Z7FE 2PV9B 3EE7A 4FU8A 1HGTH 1UVSH 1A4WH 1DITH 6LPRA 4RI0A 1V2RT 1GBKA 3RXMA 1Y3XA 1WTHD 1XUFA 4Y7AA 4H6TA 2EQNA 2V3HH 3MMGA 2QA9E 1TONA 4OGXA 1NFWA 3BTFE 3UWIA 2R0KA 1UK3A 1G3BA 3M7QA 1LVOA 1ARCA 1XM1A 2GMTC 1J17T 3FKSD 1ESBA 1DXPA 1GVZA 3DCLA 3ZVDA 4AB8A 1O5DH 1BBRK 1KLTA 1UCYH 3RXAA 4K69A 1EAXA 1P2IA 1UTJA 3N7OA 3GCTG 2I6SA 1YP9A 4TY7A 1HAYB 4D8NA 3RMNH 1N8OB 3SJKA 1XMNB 4NFEA 4ZHLU 7LPRA 3UY9A 1OXGA 1DY8A 1GHAF 2ODQA 3M7UA 2TRMA 1Z6EA 4ABGA 4IC5A 1UJ1A 1KYNA 1T8NA 2FOAA 1BZXE 3M5NA 6CHAB 2IN2A 1W7GH 4TY6A 3M35A 1GHXH
chains in the Genus database with same CATH topology
3F68H 3SOSA 1G2LA 1Q2WA 2FP7B 3SJ9A 2ANKH 2BDCA 5DJ7A 1O3OA 3VFEA 5ABWA 2GV6A 4WWYA 2A7CA 1MU8B 1WU1A 5DG6A 1Z6JH 1GBBA 2FOHA 1ZTJA 4IGDA 2BQ7B 1OWEA 5FPTA 2BVXH 3FP7E 5A0BA 5JBTA 1TNIA 2TPIZ 1NFXA 3KN2A 3E8LA 1SC8U 1ORFA 2ASUB 1SLWB 1O2UA 1AMHA 4Y10E 1S5SA 3GYMA 8KME2 3ZZ6A 1IQIA 2XBXA 1FXYA 2ZHQH 3LGWA 5FXLA 1KTTB 2JH0D 2R3UA 2BLOA 1JOUB 2ZCKP 1RS0A 5SGAE 4CRGA 1C2JA 1P2MA 5FAHA 4IW4E 1LHDH 2NU3E 3ZZ8A 1ELVA 3RXEA 2UUYA 3SGBE 3ENSB 3HGNA 5E0HA 1PFXC 1O38A 2P3FH 4WF8A 2PR3A 2JETC 4VGCC 8ESTE 1CA0C 5GJ4B 4KELA 3K65B 3RLWH 4E05H 3LGVA 4DIHH 1GG6C 2FODA 1UVOA 1C2GA 5GDSH 1C2MA 1P8VC 2AMQA 1DS2E 1NU7B 1O5EH 1CGHA 1P11E 3UNQA 3UQOA 5JYIA 1ARBA 4I8LA 1XKBC 1HIAB 1V2WT 1D6WA 1HPGA 2D8WA 1A3BH 1GGDC 4RN6A 4U2WA 3GY4A 2ZGCA 4B75A 5EPNA 1HAVA 2Y5GA 1AVXA 1C1SA 1L1GA 6ESTA 4MLFB 1L4ZA 2THFB 1TBZH 2QXJA 1BBRH 1LPZB 2VNTA 3QUMP 1UK2A 3GICB 3SUDA 7GCHG 4H6SB 4B2BA 1ZZZA 1GMCG 3SW2B 3A83A 1FONA 3BIUH 1VGCC 2OINA 1GI1A 2FZZA 1TYNA 1TA2A 1TMTH 2G55A 3RXLA 3C27B 1V2KT 1LKAA 4YOIA 2Z94A 4ABBA 1K28D 5L2YH 2VB0A 2WV4A 4BTIB 3NZIA 2BQ6B 1GJCB 1WAYB 3T29A 3TITA 1DWCH 1C1WH 2BD7A 1KIGH 3KIDU 1RD3B 3RXVA 5FCRA 4JYUH 3RMMH 1W0YH 3KNXA 1THRH 3P6ZB 3QN7A 1EJMA 3S69A 3U8OH 1IQMA 4YT7H 1BTWA 4AYVB 1RXPA 1HB0B 1SVPA 1ZMLA 5EQQA 1S82A 1NRPH 1FAKH 3KQCA 1FNIA 1MD8A 4NIXA 1TIOA 1L1JA 3R0FA 2J95A 4KKDA 4B73A 2G5NA 4D7FA 5GCHF 3LU9B 1TX8A 3E3TA 1O37A 2PKAB 5C1XA 1BTPA 2UWPA 1G3EA 5DK1A 3A86A 3ZZ5A 3A85A 1ELGA 3BTQE 1AO5A 1W7XH 4Y0ZE 1JIRA 1P9UA 4ABEA 2A45B 2VGCB 4DURA 1QURH 2Z3EA 1SG8B 1O3KA 2FS8A 1AFEH 1ELAA 1O2MA 4A5TS 1D4PB 4GHQA 4YESB 1UVTH 3ODDA 1ZHRA 2LNCA 2ZHFH 3VXEH 3PM3A 1HBTH 1Z71A 5L2ZH 1C1TA 4UFEH 2Y7ZA 1EPTA 4IN1A 3TK6A 1EZUC 2UWOA 4CRFA 2ZP0H 2A7JA 2D26C 1O31A 1GBJA 1K21H 4X8TH 2R0LA 2PHBA 1KDQB 2ZPQA 4A7IB 1G3DA 3ZYEA 2FLRH 2SGQE 1MAXA 2RA3A 4HGCA 2O8MA 3A82A 3U8TH 3E0NB 5ETXA 5C1YA 3TGIE 1O5BB 1W3CA 1MBMA 3M7TA 4ABIA 3U9AH 1LVMA 1MCVA 2FI3E 1P2JA 2VVCA 5FPSA 1G30B 2W3IA 4INLA 1VJ9U 1C5OH 1C1UH 1GHBF 3BTHE 3K6YA 1E37B 1VCPA 1LQDB 5FHTA 3RC4A 5EW1H 3RXSA 2C93B 5IDKA 2RDLA 1T8LA 3V12A 2V6NA 1DUEA 1G2MA 4ASHA 1JMOH 3DFJA 1Y8TA 2AS9A 1CE5A 4FUGA 1OSSA 1MTSA 4BANB 1O30A 4WJG2 1GI9B 4U30A 4OS5A 1YPGH 3SV6A 3LGUA 1S0QA 4FUFA 1S6HA 1RTFB 1EX3A 1K1PA 2ZPRA 2O8LA 1FQ3A 1W12U 2WPJS 3QGJA 1MCTA 1MKWK 2STBE 4ZXYH 1FY1A 1AKSA 2P8OB 2AYWA 2F9NA 4NZLA 1J14A 1DT2A 1N6YA 5F8XA 3GDUA 4AORA 4B74A 2F3CE 1EASA 2FO9A 3RUOA 5T6DA 2FOGA 1TFXA 1TQ0B 4Y71A 1V2JT 4J1YA 2NU2E 2G8TA 5GIBA 1C9PA 1HNEE 4AGKA 1AQ7A 2C4FH 1SBWA 1S0RA 1ZJDA 2JH6D 2P3UB 4AX9H 1H9HE 1NN6A 3AAUA 1ZHMA 2VWNA 4XBBA 1AVWA 1O2HA 2B0FA 1QR3E 1TNHA 4AFSA 3GCTF 1NY22 1IQHA 5T6FA 1RJXB 4AFZA 2BXTH 5C67A 4DOQA 1NM6A 1HAIH 2PGQB 2BD8A 3TGKE 1ZTKA 3BTTE 5GPIB 1GCDA 1C5XB 3BIVH 1NFUA 3KQBA 3M3VA 5A0CA 5CHAC 4I8KA 1TX7A 2SGAA 1ELDE 2H1UA 3SJ8A 1UVUH 1C2IA 3SHAH 1QBVH 2DUCA 1GI6A 1H9LB 1HJAB 1WQSA 2H9HA 1IOEA 1V2QT 3V13A 1IHSH 4ZROA 4ABAA 1A5HA 5A8YA 1KXCA 3M5MA 1XUIA 4K1SA 4IBLH 1B5GH 3A88A 3BEUA 4X6MA 2ZFFH 1O3JA 1P02A 2Y7XA 4IN2A 3O8CA 1L2EA 1HXEH 4E7RG 5F03A 2VIOA 3TH3H 1JRSA 1MTNB 3EDXB 1ABIH 1W11U 2XW9A 5T3HA 1P3EA 1FIZA 1QL9A 2C8ZB 1LDTT 1IQFA 3A7TA 4QT8C 1BRUP 4A1TA 4BTUB 1LTOA 2WV5A 3URCA 1BHXB 4JCNA 2V35A 3TK9A 2P16A 2NWNA 2BD5A 2QXHA 4UEHH 3SZNA 1T31A 5TJXA 2BX4A 2Z9JA 1GDUA 3TH2H 2XRCA 1O3PB 2FWWA 3TK5A 1QCPA 1SPJA 1Y5BT 4KTCA 1CSOE 1JIMA 2HVXA 1ESTA 1MKWH 3T26A 1V2LT 1ZPBA 3SQEE 4X6OA 1NC6A 1XUKA 2C3SA 3EQ0H 1HFDA 1LHCH 1XX9A 2G00A 4HTCH 1GI0A 1LVBA 1ELCA 2J2UA 2VIQA 3EA8A 1O2WA 3PO1C 3EYDA 3S0NA 4INHA 3TH4H 1O2OA 1O2RA 1LHGH 1BT7A 1NRSH 1ZHPA 2Z3DA 2B8OH 1SQOA 1C5PA 2BM2A 1OP2A 5HMAA 4LXBH 5F8TA 1CHGA 2D1JA 3RP2A 3VB6A 4K1TA 2AGEX 4HI3A 5EODA 1HXFH 3GOVB 4JYVH 1ANCA 3A7XA 4NIYA 2ZZUH 2ZWLH 3NPSA 2A31A 4OS1A 1TQ7B 4CBNA 5J4QA 2P94A 1SGPE 2QV1A 3BTEE 3DA9B 1GMCF 1O3HA 1F5KU 1LPKB 1N6XA 1W2KH 3A8BA 3S9BA 1ZMNA 4U01A 9LPRA 1CGIE 5JBCS 4X0WU 3S9CA 1AWFH 1HAZB 3SUFA 3SBKA 1FY8E 4A1VA 1QB6A 4MPWA 1SSXA 2BY8X 2VIDA 5AFZH 2ZCHP 1NS3A 3SU2A 4R8TB 3H7TA 3GYLB 3Q76A 1GI2A 1GBHA 1CGJE 3O8BA 2OC1A 4BOHA 1Q3XA 3LT3A 4R0IA 3LC5A 2QF3A 4UFDH 1ELFA 2SFAA 2HALA 3UFAA 1O3EA 1KXEA 4IMQA 1JBUH 3UPEA 2GZ7A 1SGNE 2NU0E 3MH4A 2OC7A 5JBAS 3RXQA 5ESTE 2H2ZA 1TRYA 1ETTH 1XVMA 2FDAA 2SGPE 1J9CH 3SI3H 1VITG 1GI7B 5B6OA 4ISNA 1GI8B 3TPIZ 2GKVE 2GTBA 3ZV8A 4K3JA 1HAOH 3DHKH 4X2WA 1QJ7B 1FUJA 1SGIB 3PV4A 3OY6U 2OBQA 2FMJA 5HXFA 4ISOA 1BJVA 2TGAA 1PQAA 4DCDA 5IYTA 1Z8JB 2A4GA 1AY6H 4AB9A 1OX1A 2AH4X 4VGCB 1IQKA 4MPVA 3A80A 1B0EA 2OXSA 2AFQB 3SGQE 1E38B 2ULLA 2GZ9A 3MWIU 1O3MA 2FYRA 4DW2U 1O0DH 2HRVA 4AN7A 4NIWA 1OP8A 1O5GH 3B23B 1QRXA 1EP5A 4X1PU 1UHBB 3SV8A 1OWIA 1O2SA 3GY3A 1NRNH 2BVSH 1D3TB 1BJUA 4NIVA 1E35B 1H4WA 1K2I1 4K8YA 3T28A 4ABJA 3EGKH 1ANDA 3P8OA 3TJUA 1BMNH 1LCYA 2A5IA 3SO3A 1GJ6A 3UNSA 2GDDA 3E0PB 5EXNA 1BITA 2ZHEH 2ALPA 2O8TA 2FXRA 1T8OA 3LDXH 4O3TA 1SLVB 2Z3CA 1HAGE 1PJPA 1AI8H 2OC0A 1TWXB 2CJIA 2WINI 3RXKA 2R9PA 3A8AA 1GVLA 1AE8H 1DY9A 3OYPA 2QAAA 3E91A 4LOYH 4X2VA 1QGFA 3SGAE 4Z6AH 4MTBA 1WSSH 3PTBA 5AVDA 4NFFA 2ZTXA 1BA8B 1GL0E 2H6MA 4A6LA 2AGIX 5JPMH 1TBQH 2ZGJA 3MOCA 1J15A 4JZFH 3SUEA 2J34A 4MPUA 2JH5D 1KXAA 4Q7XA 3A8CA 1C5QA 2QC2A 1GDQA 1PPHE 2Y82A 1C2KA 4FVBA 5FPYA 1BUIA 5LPFA 4X6NA 5FBEA 1MQ5A 1FY3A 4TWYA 1MQ6A 4YTAA 2Z9LA 3RU4E 1NRRH 1TPOA 4ZH8A 1D3DB 5AFYH 3L33A 2ZTZA 4DGJA 2A5KA 4I33A 4IC6A 5FX5A 3T25A 1BTYA 4CH2B 3MYWA 1UK4A 4AOQA 1D3QB 3MNSA 3A7YA 5JBBS 1Z7KA 4KGAA 1MAYA 1EAUA 2Y5HA 1UMAH 1ETSH 1PQ8A 1V6DA 4K60A 5E8EH 1RRKA 1FIWA 2YNAA 2G5VA 1SHYA 1NZQH 4CR9A 3RXGA 1GJAB 2F9BH 2A5AA 2FTLE 1KTSB 1YF4A 1LHEH 1H8IH 5BPEA 1EZQA 4YLUA 4JYTA 3SU3A 3UIRA 1ZPCA 1E34B 3BSQA 4X1SU 1C2DA 2F91A 2WYGA 3FZDA 5K7RA 3SN8A 5E2PA 5EQSA 1TBRH 3RC5A 1X7AC 4X1QU 4D9QA 2OUAA 3LIWA 1EPTC 1UTPA 2R2MB 1QBNA 1QBOA 2HWLB 1DDJA 3BTGE 2ZCLP 1GBLA 1GVKB 2QXIA 3IG6B 1O3NA 4H42U 1V2ST 3ZZAA 3QLPH 1TAWA 3HKIB 2BTCE 1F0SA 3E6PH 3SJIA 1KXDA 4JZIA 1U6QA 4NZQA 3DUXH 3AAVA 3I77A 1EJNA 1HAXB 1O3IA 2Y6TA 2BLVA 1GCTB 2OCVB 1IQJA 2ZTYA 2SNVA 3BEIB 3ZVGA 1KSNA 1A61H 3LH1A 2A7HA 1P2QA 3I78A 1ESAA 3P92A 1AUJA 1VR1H 3BEFB 2TBSA 4MNVA 4WVPE 4MNXA 4ABDA 4AYYB 2AEIH 3D49H 2BXUH 2HNTF 4GVUA 5A8ZA 1CBWB 2K1QA 5CE1A 3LH3A 2H9EH 4WMDA 1LKBA 1RIWC 2VVVA 3KQEA 3M3SA 1HAHH 2RG3A 1C4U2 4J2YB 1MTUA 2CHAB 1W10U 2ESTE 4MPXA 1NESE 2WPLS 2QN5T 4ZKRU 2ZGXH 3FANA 4OS6A 3ZVBA 1YGCH 1GJ5H 1P04A 2J4IA 4JK5A 3TJVA 5LPEA 1ETRH 3U8RH 2SNWA 1V2TT 5FBIA 1O3CA 2R3YA 5FX6A 3E16B 4ZXXH 1W8BH 1DFPA 4RKJB 1DPOA 1N8OC 3A7VA 4FUCA 1B0FA 3JZ2B 3STJA 4ZHMU 4Y8ZA 2A2XH 2HPPH 1DXWA 4UFGH 2KAIB 1WQVH 4WMFA 1AFQB 1MD7A 4AFUA 1AHTH 2OQ5A 5A8XA 3KHVA 1J8AA 1JRTA 2OD3B 3Q3KA 3MNBA 2BHGA 3UTUH 2J9NA 4XSKU 2AIPA 3VEQB 3VB3A 3SU4A 4DG4A 1DWDH 1QB1A 2BOKA 1SL3A 2PKSB 3NWUA 1KXBA 1SI5H 1Y5AT 2W7UA 4CRBA 1WOFA 1ZTLA 1MUEB 4CHAB 1O5AB 2ZNKH 3U69H 4AZ2B 3TNSA 2VJ1A 3SI4H 2ZHDA 2XBYA 5I25A 4B76A 2BYAX 3RXPA 1VITF 1DWBH 2GDEH 4OS4A 2GX4A 1V2PT 1A46H 2SGFE 2ZECA 2QCYA 1A0HB 3DT0H 1UTOA 3RMOH 1ZSLA 4O9VA 3ZZCA 1C5YB 1YYY1 3OTJE 3GY6A 4Y6DA 1V2MT 2PTCE 1ZR0A 4YLQH 3EAJA 4K8BA 1O35A 3ATKA 3MO9A 3TJNA 1EP6A 4MNYA 5LPRA 4OS7A 4XBCA 3ZZ3A 1AB9C 1WUNH 2C8YB 2HOBA 3GCHC 1GHVH 1JXPA 1PPGE 3VGCC 2AIQA 1SFQB 1YCPK 3D23A 3MTYA 4MQAA 1MKXK 4LZ4B 4B71A 1JWTA 1EQ9A 2Y81A 3ATMA 1CO7E 2BDHA 1P09A 3VPKA 2P59A 2ZIQH 3LGYA 4E7NA 4TPIZ 3ZZ4A 2BB4A 3HGPA 5DP3A 3P8FA 4F4OC 1T4VH 2EI8A 5EPYA 1ZGVA 3QX5H 5E2OA 1O2ZA 3SV9A 1BMLA 5EW2H 4YT6H 2Q6DA 2NU4E 1ZSKA 1PPBH 1EUFA 3UOPA 2FLBH 2A2QH 1O3AA 2FX4A 2Z9IA 4Y79A 1GJDB 1SB1H 1TGTA 3GY7A 4FUJA 4YZUA 4A92A 1AUTC 1FY5A 3OSYA 1L4DA 1BMAA 4JZDH 5BRRE 4B2CA 2XBWA 5DO4H 1F2SE 3TU7H 2BMGB 1O5CB 2AGGX 1YPMH 2BX3A 1TE0A 3RXFA 2BLQA 5EXMA 1OWHA 2FM2A 3PTNA 2C8XB 4A1XA 4XE4A 1HLTH 1F5LA 4ABFA 1Q31A 1LQEA 1C5VA 1YBWA 1SGQE 2A4OA 4Q7YA 1THSH 2VWLA 5L30H 2UUFB 2B5TB 1GDNA 3A7ZA 3PMBB 1FZZA 1SOTA 1BRAA 1C5SA 1O3DA