3A8AA

Crystal structure of trypsin complexed with 4-formylbenzimidamide and aniline
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title In-Crystal Chemical Ligation for Drug Discovery
rcsb
molecule tags Hydrolase
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a8aA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a8aA02
1MD7A 2HGTH 1A2CH 2ZPQA 4OGXA 2B7DH 1HJ9A 3PO1B 1ELAA 4GUXA 3RXPA 5L2ZH 2EA3A 4FU8A 2BXUH 4JMYA 4R8TB 2JETC 4Q2KA 3GCNA 2ZGHA 1C1MA 3VXFH 2FEQH 3TITA 3ZVBA 1C1RA 5AVDA 1WUNH 1MTUA 7GCHF 2Q6DA 1AN1E 4K3JA 3ZYEA 1P03A 3PMBB 1CA8B 4O03A 3TIUA 4WXVA 2C8WB 5F8ZA 1C5XB 3BV9B 1O38A 1OXGA 3RMNH 3Q00A 1KSNA 3A88A 2WUBA 1YC0A 1C5NH 4D7FA 2BLOA 5F8XA 2AIQA 4BTUB 1P06A 1SGQE 3HGNA 3ZZ4A 4WMFA 1GI6A 5LGOA 1BITA 1H9HE 3M7QA 1AWHB 1UTJA 4UFFH 1EX3A 1S84A 2AFQB 1ANDA 2A4QA 1KTSB 2VWMA 4FXGH 5AFYH 2GZ9A 1IQHA 4DJZB 2JH6D 3FAOA 5JBBS 5C20A 1TNHA 2XBWA 1P01A 1SGFG 2OQUA 3RMLH 4DVAU 1MU6B 3SJ8A 1ETTH 1C2DA 2TRMA 2VJ1A 1GGDC 1PPCE 3MO9A 2VH0A 1IQEA 2A45B 1FZZA 2SNWA 1MCVA 2D2DA 3LGVA 5LH8A 1T8OA 1HRTH 3B9FH 1ANEA 2GZ7A 1QURH 2OXSA 2R2WU 2ZDLA 3RXQA 2GT7A 3TH2H 2V35A 1FQ3A 4ASHA 2J94A 1VJAU 3ZZ8A 4JZ1A 4F4OC 2G81E 4Q7ZA 1K28D 3KGPA 5K0HA 2O9QA 2ZU3A 5J4SA 2GVFA 1C5OH 4WJG2 3SNCA 1UTLM 3UWJH 2F3CE 2OC1A 3RXEA 5EPYA 2XC4A 2PUQH 1GI0A 1CU1A 2BVRH 4ISNA 2ZC9H 1UK4A 2Y80A 4ZHLU 1NU7B 1KXEA 3QX5H 2F91A 2F9PA 1BBRE 1QNJA 2OLGA 3ZVGA 1KLTA 3F1SB 4AOQA 1AKSA 3P8OA 2ANMH 2VVCA 2FLBH 3QUMP 3SGBE 3SZNA 1W13U 1BRCE 4YT7H 1V2TT 3VB5A 4TPYA 2A2XH 1ZSLA 3ZZDA 2QA9E 5C5OA 1CA0C 2BMGB 1ABJH 5E0HA 1TALA 4AG1A 2O8MA 1RD3B 2F9NA 3DFLA 1GBLA 3QLPH 1C2GA 2AGGX 1Z6JH 1PPEE 1O2OA 1W7XH 2WYJA 3TH4H 1O32A 5EW2H 1FXYA 1BRUP 3GICB 4ESTE 2UWPA 3MU8A 4KGAA 2R2MB 2J92A 1HAHH 1O3PB 4ZUHA 2ANKH 2XC0A 3QWCH 4LXBH 5T6GA 1QJ7B 1D9IA 1UTQA 1NRRH 4NGAH 1E0FD 4H4FA 1SGFA 3NKKA 1CHOF 1O2NA 2G5VA 4QT8C 1O3DA 1EUFA 3KQCA 1O2PA 2Z9IA 3A7YA 4NSYA 3A7XA 1G32B 3RUOA 1TNIA 3KEEA 1GBJA 1JWTA 1Q31A 3SV7A 4Y76A 4LOYH 4SGBE 1TRNA 3M5OA 6ESTA 1GHWH 1O3KA 1V2NT 2FOMB 1W3CA 2AEIH 1VGCB 4WH6A 1DT2A 1O30A 2O8LA 5DP5A 3RXAA 2B9LA 3P92A 1UHBA 1TBRH 1ZYOA 1GHZA 2BY9X 5AHGH 1J17T 1NRPH 1HCGA 2QXGA 1O5AB 1WOFA 4FUHA 1A5HA 2R3YA 1BIOA 3GY6A 4X6OA 4XFQA 1F5KU 1LHDH 2Q6GA 1O2KA 2HRVA 3I78A 2VWOA 2XCNA 4Z0KA 1L2EA 1QB6A 1ESTA 2FM2A 2FTMA 2WYGA 1H9IE 3R0FA 4ISOA 3UQOA 4FUJA 5E0JA 1LHFH 3MNCA 4FU7A 1SOTA 4TWYA 1NFYA 2QYIA 5TJXA 1TGNA 1DLEA 2OUAA 4O97A 2VNTA 2Y5GA 3A8AA 3EA9A 5AFZH 3VEQB 3RXIA 3AAVA 1F5RA 4F49A 1CT4E 2ODYB 1S0RA 1L4DA 3UTUH 2P8OC 3SJOA 3U8RH 1KTTB 3T25A 1QL8A 1O2VA 3M5LA 5FPSA 4CH8B 1BCUH 1RFNA 5HM2A 4AYVB 2J4IA 2TGPZ 1ELEE 1FPHH 4ABGA 1HAXB 4B73A 1P05A 1CSOE 1V2OT 1BTHH 4X8UH 1NRQH 9LPRA 2FLRH 3TGIE 1YF4A 2BOKA 3PLPA 4UONA 3JZ2B 1D6WA 1HB0B 3GOVB 1P2KA 4CR5A 2OP9A 3FP6E 3UREA 2OTVA 2UUFB 2G51A 3A89A 5L30H 1AU8A 2ALVA 1O2XA 2XBVA 2QXIA 3FP7E 2QXHA 3NK8A 1O5DH 1Z1JA 3LGUA 3RMOH 3UNSA 2H6MA 1KXDA 1G3CA 1C5RA 1MU8B 4K5ZA 3TK6A 4B71A 1QRXA 1IHTH 1HIAB 1XUFA 4YTAA 1O3GA 4AB8A 2PKAA 2FX6A 1DWEH 1NRSH 2HLCA 2UUKB 1QGFA 4A5TS 3V13A 3BIUH 4MNXA 2ZDNA 4D8NA 1NPMA 1OYTH 3BTME 3LH1A 2A5IA 3A7ZA 4WVPE 1F92A 1GBHA 1P57B 1GMDF 1TMTH 1HV7A 1Q2WA 2JH5D 1EJMA 1UTNA 2A4GA 1E38B 1IOEA 1FDPA 1YP9A 2EEKA 3BEIB 1ZHRA 1LHEH 1PPBH 1G2MA 1THPB 3SU6A 4GHTA 3SV6A 4CBOA 1C4U2 3V3MA 1F0TA 6GCHG 2ZPRA 3QDZB 1FAKH 1P9SA 2QF3A 3ZVFA 4O9VA 4DGJA 4INLA 7KMEH 2P59A 1K2I1 4X2XA 1O2LA 4JZIA 3UOUA 1ESAA 1A46H 1YPJH 1XKAC 1AZZA 1C1VH 4E7RG 2HWLB 2O8WA 4JCNA 1OP0A 1O2SA 4CRDA 1YPEH 3FP8E 2HPQH 3DFJA 2XWAA 2STAE 1QL9A 3K6YA 2FYQA 2V0BA 2BHGA 4UD9H 1O3CA 1RIWC 1JIRA 1BTUA 3BTTE 5F6MA 3TNTA 1C2EA 1V2UT 2W7UA 2BD2A 4D7GA 1LVMA 3RXHA 2VVVA 1IQIA 3FFGA 3ZZ7A 1TMBH 3GCHB 1O5EH 1GG6C 4IC6A 4HZHA 4A1VA 1MMJN 4I8JA 1C2IA 4ABBA 1S6FA 3TNSA 5DJ7A 3MU0A 1AQ7A 2FI5E 2ZU4A 2P95A 1G9IE 1O37A 5JPMH 1ELBA 3SUFA 2A5KA 1TRYA 1YBWA 5BRRE 5ABWA 4YESB 4CHAB 1C5MD 3LGTA 4OS1A 4XSKU 1HLTH 3E0NB 3U8OH 3ZVAA 1GHVH 2Z9KA 2Z9GA 2BY5X 5B6OA 1YGCH 1GVLA 2BM2A 3SNDA 2IJOB 5ETXA 5L6NH 1BBRH 1DICA 1IQFA 5GWZA 1MAXA 1G36A 5EQSA 3STIA 3RXRA 1TX8A 3HK3B 3ZZ5A 3V0XA 1ELCA 1K1PA 1EB2A 2VGCB 4TYDA 2PV9B 3KCGH 3QZRA 3KN2A 3RC4A 1FY5A 1V2JT 2A7CA 2VIDA 7LPRA 1ZJDA 2PSYA 3K9XB 1MTNB 2D1JA 2GP9B 3E6PH 4KKDA 1EAUA 1BDAA 1P2NA 3BG4B 1RRKA 2TBSA 3SV8A 1C2JA 1WYKA 1SGTA 4CRCA 1BJUA 1VR1H 9ESTA 1Y8TA 1OYQA 2Y82A 1J15A 1Z8RA 2FP7B 2C8ZB 4TPIZ 1LQDB 3LJOA 1GBTA 4GSOA 3MWIU 2AERH 3H7TA 2Z6BD 1GJAB 1LVOA 3BTHE 1HUTH 1QA7A 1HXFH 1FMGA 3E1XB 4NIWA 2Q1JA 3RXVA 1HAZB 5DP4A 5EODA 2W7SA 3MTYA 1FAXA 4K1TA 3PTBA 1MD8A 5C67A 1MBQA 1A5GH 3SNBA 3EQ0H 4E7NA 3O8CA 2D8WA 1N6YA 2CHAB 1GVKB 3SN8A 1QB9A 1AVXA 2BD9A 1G37A 3M3TA 5EOKA 4ABIA 2A31A 1UVPA 1GJ8B 1VZQH 3GY3A 1GMCF 1SPJA 4YLQH 2CN0H 1DOJA 1BMLA 4INKA 3RLWH 1EPTC 4IMQA 3EDXB 4Q80A 1S83A 1GMDG 3MH4A 2QC2A 1NROH 1C1NA 4ZXXH 2XBYA 1T7CA 2ZP0H 1GI1A 4DIHH 1MCTA 1NFUA 1C5TA 3KNXA 5GCHF 4CRGA 2WPJS 4IMZA 5A0BA 2P3TB 2WPHS 1GJ9B 1LVYA 2CV3A 5EXMA 4FUFA 3S7KB 4ZAEA 4XBBA 3RXTA 3SORA 1O5FH 3D62A 1IQLA 2ZIQH 1GL1A 1W7GH 2BDGA 5JB8S 4UFDH 4WMEA 2BDAA 2VB0A 1BTXA 2ZDAH 2ZGBH 2XW9A 1PQ5A 2P3UB 1AI8H 1T4VH 4X0WU 5PTPA 2BX3A 4FUCA 2H2ZA 1G30B 3I77A 1AFQC 1QHRB 3U69H 1TOCB 4AFZA 1DWDH 1O2WA 3GDVA 1B7XB 2Y6TA 2H9TH 4OS5A 1RTLA 1YLCA 3SJIA 4LZ1H 3BTQE 1ZSJA 1UCYK 4X1RU 3RU4T 3FZZA 2QV1A 1O2MA 3E8LA 3TVJB 1OP2A 1S0QA 2Y5HA 3A7VA 1AY6H 1C1UH 1KDQB 1IHSH 3CS0A 3MH7A 4ABAA 1P8VC 3OY5U 2R3UA 1TABE 3RXKA 2WUCA 1UTKA 2BLVA 2GMTB 1EP6A 5TCAA 5FCRA 4X1SU 5BPEA 1ABIH 1C2FA 2JETB 4NSVA 1YCPH 1D6RA 1UVTH 1QIXB 1BQYA 2GV7A 4K1SA 1FIZA 2P16A 1LCYA 1W2KH 1DDJA 4E06H 2Y5FA 1C5WB 2H9EH 3RXGA 2FTLE 3ATWA 2A7HA 3D65E 3NUMA 4YLUA 4B2BA 3A7WA 4VGCB 2FZZA 2QIQA 5JBTA 4AB9A 1P3EA 3MYWA 4MNYA 3F9FA 3URCA 2VINA 2ZQ2A 1S85A 3GCOA 3VFEA 2HNTC 2ZU2A 4A7IB 3F6UH 1W14U 1IQKA 3ITIA 4NG9H 5EW1H 1GHXH 1P3CA 4CR9A 2VVUA 1ZTLA 1EJAA 3EGKH 2B5TB 1LKAA 2NU0E 3DD2H 2F83A 3SGAE 2NWNA 1YPHC 2ZU5A 1NY22 1CGJE 3F9HA 4OGYA 3ZVCA 1FJSA 4I33A 1S82A 1ELVA 5EQQA 2XNIA 1W8BH 1Y3UA 4AFSA 2BXTH 2GDDA 3LC5A 8GCHG 2M5TA 3TJUA 1DFPA 1GDUA 2FESH 3GY2A 2ZHEH 2HVXA 1UO6A 1MQ6A 2SGPE 4NA8A 2XCFA 3SW2B 3GDSA 1T8NA 1VCPA 4DURA 2OC8A 3QTOH 2AGEX 2VWLA 4Y7AA 5FHTA 1L1GA 4AYYB 1P2JA 3ZVDA 1EZUC 3O8BA 5SGAE 5JB9S 1G2LA 1A5IA 4ZROA 2ODPA 4X6NA 1A3EH 1TNLA 3MI4A 2ZCKP 1FIWA 2RA3A 2ZF0H 2WV4A 6GCHF 1TX6A 1UJ1A 1QRWA 2PKSB 3SNEA 3UUZA 1A61H 4BNRA 1J16A 2D26C 3T2NA 3OU0A 1ELDE 2BDCA 1TOMH 2BD3A 2FO9A 2Z3CA 2V3HH 1YKTA 2G52A 1ZJKA 3TK5A 1GMCG 2QN5T 1TX7A 3VXEH 1KXCA 3ATKA 3STJA 1O36A 2ZCLP 1AE5A 3RXMA 2C8XB 2G4UA 5C2ZA 5IDKA 5HMAA 4Z6AH 1FNIA 1S5SA 1GCTB 1AB9C 1O39A 2C8YB 2F9BH 2H9HA 1QL7A 2FPZA 4Q7YA 1RXPA 1EXFA 1V3XA 1ZMJA 2SGQE 4SGAE 1J9CH 1GBMA 3ENSB 3TPIZ 1UVOA 2ZFSA 1SQAA 5GCHG 2A4RA 2IN2A 5F8TA 1IAUA 1XUJA 4IN1A 4ABFA 1GBCA 1ELFA 1O3LA 4KTCA 1GHBG 1GL0E 6CHAB 3CP7A 2CF9H 4IS5A 4ISHH 6LPRA 7ESTE 1C1OA 2AMQA 1GCDA 1QRZA 4OS6A 5FX5A 3RM2H 4NCYA 1HBTH 3Q3XA 3ZZBA 2WV5A 1HDTH 1LHCH 3MH6A 4DT7B 4TWWA 2V3OH 3RXCA 3C27B 1O35A 1PPGE 1OX1A 1VGCC 2UUJB 1CVWH 5G4BA 2EI8A 3M5MA 2ZHQH 1O2RA 1EAXA 5HM9A 1OWHA 4YOGA 1GVZA 3T29A 5EXNA 4Q7XA 2G5NA 3ZZ3A 1SSXA 2ZFTA 2G00A 1SLXB 2BDYA 5A0CA 1MKWH 4CRFA 1P10A 3BTKE 2KAIB 3PMJA 1C1TA 3MU1A 1LO6A 4U32A 5I46H 1HFDA 2EI6A 1QJ6B 3UNQA 3BEUA 1ORFA 1GBFA 5LPFA 2G55A 3OYPA 3GY7A 2TGTA 2F9OA 4E05H 1AE8H 3MNBA 2ZFRH 2ZGJA 1XKBC 1ESBA 5FX6A 1P09A 4JK5A 1FI8A 2FWWA 3V7TA 3A85A 4JYVH 5I25A 1BTPA 3PROA 1CGIE 1ID5H 2CGAA 4X1QU 1OWIA 1RGQA 2QGRA 5C1UA 2ZGXH 4AG2A 3KF2A 4H42U 2XWBI 4NFEA 5C1YA 1KYNA 1TMUH 3RXJA 8ESTE 1DUEA 2Y7ZA 4I7YH 4M7GA 3L3TA 1EQ9A 1TQ7B 1O3OA 5C3NA 1QBVH 1PPHE 1Q3XA 4MDSA 4RN6A 3VB7A 2Z3EA 3KQBA 1VCWA 3ATIA 3VB3A 1EPTA 1DWCH 1C5ZB 2AMDA 3MNSA 3NWUA 1ZTKA 1FY4A 4KELA 1AO5A 3U98H 1THRH 2BTCE 3RU4E 1TBQH 1MAYA 4HGCA 1WBGB 2BDIA 2PTNA 2FOGA 2AH4X 1XM1A 2JH0D 1A4WH 1GBAA 4I32A 1MH0A 4X6MA 2OBQA 1K9OE 3CENA 1W10U 5E0GA 4XOJA 4UE7H 4A1XA 1HXEH 2BYAX 1FY8E 1JXPA 1TA6A 2FDAA 1BB0B 4NA9H 4BAHB 2OBOA 1SC8U 4X8TH 1C5PA 2OC7A 1OWKA 4TY6A 4MPWA 1BZXE 5GXPA 1C5LH 3EE0B 4LK4A 1O3BA 2FIRH 1M9UA 1D3TB 5A8ZA 2V6NA 1BA8B 2UUYA 3MO3A 5GJ4B 1EP5A 4J2YB 3RM0H 1ZMNA 3P70B 4ZH8A 4FVBA 1SLUB 2I6QA 2FYRA 3L33A 1U6QA 4DIIH 1T8LA 4YM9A 5E2OA 3AAUA 1H8DH 4X2VA 5DP7A 2GT8A 1O2IA 1ZMLA 2AYWA 3PMAB 3F9EA 3TJOA 1V2PT 2W3KA 2WINI 2WPIS 1GBKA 1CT0E 2IOTA 4A6LA 4K60A 4U01A 1GHYH 5AF9H 1BTZA 1KDQA 2ESTE 2ZDMA 1YCPM 2UWLA 3MH5A 3SI3H 1QFKH 3KL6A 3DA9B 5CHAC 1W11U 4Y7BA 1C2MA 5LPRA 1PYTD 1C9TA 1MTVA 2FOCA 1Y3WA 4UDWH 1Z8GA 3HKIB 1K1NA 1SG8B 3A87A 4B1TA 2BX4A 2K1QA 1O2YA 1FONA 5GPIB 1YPLH 1OWDA 2PGQB 3LGIA 2STBE 5JBCS 3U1JB 1FUJA 1SFIA 2AS9A 4WY3A 3O8DA 4BAKB 3A7TA 1UTPA 3P8GA 3P6ZB 4GHQA 3ZYDA 3Q3YA 1TGBA 4NZLA 2ULLA 1HGTH 5DK1A 4DG4A 2BVXH 4JYTA 5H4IB 1GWAA 1QJ1B 1YPHE 4DY7B 1FN6A 1XXFA 2GCHG 3GCHC 4A92A 1SGYE 1Z1IA 1SQOA 3TGKE 5E2PA 3SUEA 1O3FA 1S81A 1ZR0A 5EU8A 1LPZB 2OD3B 3AW0A 1SOZA 1Z6EA 1F5LA 3H7OA 5A09A 5FXLA 3M7TA 1WV7H 2BDHA 5HXFA 1J8AA 1QQ4A 1SHYA 4I8KA 5T6FA 4RSPA 1IQMA 1O2QA 1CBWB 4CHAC 1EJNA 1PPFE 1RTFB 1AKSB 1XX9A 3A82A 4IC5A 1HAPH 3C1KA 2BVSH 4JZDH 1HAGE 4BTIB 1GBDA 2HOBA 3AVZA 2SGAA 3SJKA 1P2OA 4INHA 2Y7XA 1TNJA 3TH3H 2VIPA 2ZFQH 2P94A 1E35B 1BT7A 3K6ZA 1JRTA 1GHAG 4GPGA 3PB1E 2J38A 4MTBA 2GZ8A 5DG6A 5CMXH 2F9VA 3ODFA 2VGCC 4DOQA 1Y3YA 3A8CA 2FS9A 1ZHMA 1MTNC 3RXUA 2BOHB 4R0IA 1LDTT 1TQ0B 2QY0B 1TNKA 1FV9A 1HYLA 4FUEA 2IPHA 1SGIB 4H6SB 4NWLA 3S0NA 1T4UH 1UTOA 1GPZA 3URDA 2FS8A 2ZO3H 1ANCA 4X1PU 3SHAH 4GCHF 4TY7A 8GCHF 1F2SE 2ZFPH 1GBIA 1C5SA 4YOJA 1ZGVA 1OWEA 1GJDB 2BZ6H 2ZQ1A 2CXVA 1CE5A 1UVUH 1ZLRA 3RXLA 2RA0A 1GJ6A 1DS2E 1N1LA 2ANWA 1FY1A 1C1QA 3SU0A 1UHBB 3K2UA 3VB6A 3KHVA 1CT2E 1PQ8A 1G3EA 1HJ8A 3TU7H 3L6PA 1AVGH 4FU9A 1JOUB 2W3IA 1AUJA 1AIXH 1GBBA 1K22H 1LPKB 4Y10E 1X7AC 3SQEE 4HTCH 4D9QA 4ZXYH 1DANH 3E16B 2CHAC 1EAWA 2AIPA 4BTTB 3TLOA 1NM6A 1XUKA 3SO3A 4K8YA 1ZZZA 1Z8IB 1TE0A 3UPEA 5C1XA 1JBUH 2P3FH 4CREA 1GI4A 3M61U 4RKJB 1KLIH 5FBIA 2BD8A 2BD7A 2QF0A 4Y8XA 1O5CB 1LMWB 2NU3E 1ELGA 1XUHA 4X2WA 3RU4D 3GY5A 3OY6U 5LPEA 2Q6FA 4NWKA 2WPMS 4ZMAH 1HNEE 1B0EA 1W0YH 3G01A 3SOSA 2SFAA 3F68H 1LQEA 2J34A 1A3BH 1MBMA 1O3NA 1N8OB 3LIWA 1KXFA 3FVFB 4CRAA 5A8YA 1GHBF 1T8MA 4Y8YA 1DSUA 3LDXH 1IQJA 1A0HB 2I6SA 1NFWA 4NA7A 1ZPZA 1BRAA 1V2WT 1Y5BT 3BIVH 2BD5A 5HGGA 3V12A 5T6DA 2JKHA 2FODA 3B8JA 2J2UA 1KLJH 1O2UA 2PLXA 5C5NA 1AWFH 1EB1H 1C5YB 3GCTF 4NIXA 2GCTB 1CGHA 1WQSA 4WXIA 3UNRA 2LPRA 3MOCA 1SQTA 3VGCB 3SV9A 4BXWA 2ODQA 2SGFE 2VIWA 2BDBA 3PM3A 1DPOA 3QTVH 3PLKA 3QN7A 1GJ7B 1FY3A 1SLVB 3EAJA 3GDUA 3MMGA 2PKAB 1GI9B 3BN9A 3T5FH 3A80A 1HJAB 1INCA 1G3DA 4ZKRU 3BG8A 4ABHA 4ABJA 3RMMH 3LPRA 1GI8B 3PO1C 3VB4A 4AGJA 1HAIH 1BJVA 3T27A 4D9RA 1UCYE 3PV4A 5EG4A 1XMNB 2PR3A 1L1NA 2XBXA 4Y0ZE 5E8EH 4GAWA 4WMDA 1V2VT 1AFQB 3A81A 2PUXB 4AORA 1D3QB 1PQAA 2VIQA 3SNAA 1VITF 1O34A 3GY4A 4ISLA 2GMTC 4JK6A 1VITH 1EASA 1NFXA 1HAVB 4Y71A 3RXOA 2FMJA 1HIAA 1NN6A 3SU4A 1QA0A 4A1TA 3RP2A 2C90B 1O2ZA 1K1LA 2FOBA 1C5VA 1BHXF 3GISB 1AGJA 1RS0A 5JDUB 1K1JA 1DVAH 1MZAA 1YPMH 5DP8A 2XRCA 5J4QA 1BHXB 1P9UA 1D3PB 3HGPA 4KTSA 4UFEH 4O3TA 2HPPH 4JYUH 2WPLS 4OS2A 2W26A 4VGCC 1OS8A 4HI3A 3HKJB 2ZZUH 1IQNA 1EAIA 1Y3VA 3P95A 4K8BA 1OPHB 2ZWLH 2SNVA 3SUDA 3MFJA 2VU8E 3SGQE 1VCQA 2J9NA 2ZFFH 3OSYA 4MPXA 3B23B 4AFQA 1DSTA 3PWCA 2HNTF 5EQRA 2CMYA 3M5NA 1P02A 2AMPA 4CRBA 1T32A 2RDLA 1GJ4H 1CQQA 4GCHG 1FPCH 3SI4H 4B2AA 1SGRE 3LJJA 1O3MA 2ZTZA 1GGDB 1MZDA 4K69A 1LVBA 4NFFA 1EKBB 1TYNA 3BF6H 1MTWA 4BAQB 1JIMA 1TAWA 1V6DA 2OC0A 4JZEH 1A1RA 3OTJE 1UVSH 4GVUA 1SFQB 1ZPBA 1Y5UT 4Y11E 1O2JA 5A2MH 3E3TA 4BOHA 1C4Y2 2B0FA 1XUIA 1DM4B 1SGEE 5EXLA 3F9GA 1J14A 3M37A 4WWYA 2GGVB 2ZA5A 3LONA 4I8LA 3RC5A 1SVPA 1ZPCA 1O33A 1E37B 1O31A 3LH3A 1SB1H 1SL3A 1NTPA 4XE4A 1EOLA 4ABEA 2ZHWH 2G8TA 2PKSC 1KXAA 1O2HA 5IYTA 4ZHAA 2PSXA 3GY8A 1BOQA 1KIGH 4UFGH 4X6PA 3RXSA 2SGEE 4Y0YE 1DXWA 1Y3XA 1GJCB 2DUCA 2DE8A 1Y5AT 1AUTC 1THSH 2C4FH 1K1OA 1WCZA 1EZSC 5ESTE 1BBRK 1Z71A 4HFPB 4MPVA 4K2YA 1H1BA 4UEHH 1GCTC 3QK1A 1GI7B 2THFB 3JZ1B 5DKMA 1YYY1 1AVWA 2BY8X 3SV2H 1GMHG 3M3SA 3LU9B 1FLEE 4WH8A 3SBKA 1DE7H 1CA0B 2ILNA 4X8VH 1N6XA 1HPGA 1WAYB 3LGYA 3BTFE 3TJVA 2ZGCA 2R9PA 3A86A 3LGWA 1AB9B 6CHAC 5JBAS 2A0QB 1V2QT 5A0AE 4YZUA 2A2QH 4B75A 4AGKA 2GCHF 4B74A 3WY8A 3RXFA 4NIVA 1TONA 2TPIZ 1DLKB 3UFAA 1V2ST 1HAYB 5EGMA 1WSSH 1UTMA 1WU1A 3VPKA 1QB1A 1JMOH 2VIOA 1XXDA 3GCTG 3U1IB 1BTWA 1YM0A 2ANYA 3S7HB 1L1JA 3BTWE 3T28A 3NXPA 2TGAA 2LNCA 2NU1E 2QCYA 1XVMA 1Z7KA 1NO9H 3A83A 2EI7A 1YPGH 2Y81A 3AW1A 2ZHFH 3IWMA 3W95A 1SLWB 2DE9A 1P12E 1TNGA 1P2MA 1MQ5A 1O5GH 2XXLA 1OSSA 3M36A 1SBWA 3UY9A 1GDNA 4PROA 1LTOA 5EPNA 3LC3A 1C2KA 2HALA 1GHAF 1D3DB 2SGDE 4DCDA 4NZQA 1VITG 1ZRKA 1GI3A 1SI5H 2Z3DA 2ZEBA 2ZI2H 1DY8A 1C5UA 1OOKB 2ZCHP 2ZTYA 3D49H 3UWIA 2RCEA 2VWNA 1O3HA 1ZHPA 3TK9A 4D76A 4H6TA 5GIBA 2GV6A 3HATH 1BMMH 2ZNKH 2R0KA 1V2KT 2A7JA 4AZ2B 2BLQA 1QQUA 1EATA 3SQHE 1PQ7A 1DWBH 1TPPA 3UIRA 3QZQA 2FOAA 7GCHG 5DPAA 1TPOA 1TGSZ 5ESBA 1TGCA 3ZV8A 3Q77A 4THNH 2Z9JA 1XVOA 3SU2A 3T62A 3HPTB 2FOFA 3EA7A 2TGDA 4CBNA 4Y79A 2FX4A 1OP8A 2P8OB 1BUIA 3ATMA 3EYDA 4AX9H 1VJ9U 1QCPA 3MHWU 1PJPA 3E90B 1CO7E 3ODDA 3O8RA 1NRNH 1QY6A 1P04A 1EOJA 8KME2 1O3IA 5JYIA 3A8DA 3S9AA 1UK3A 1MKXK 1AHTH 2UWOA 2PWXA 1C5QA 3UOPA 5DO4H 4ISIH 3SU1A 2ZDVH 5FPTA 1NZQH 1PPZA 5HYOA 2A5AA 2W5EA 1C4V2 5GDSH 4FVDA 1QBOA 1NC6A 1QR3E 2O8UA 3BTDE 3ZVEA 3CS7A 1Z8JB 1ZSKA 5L2YH 4Y8ZA 3QGNB 3UR9A 4X2YA 2XYAA 1O0DH 2GD4B 3SHCH 1NESE 1UCYH 1GBEA 3FANA 4CH2B 1T31A 4BXSA 3S9BA 4GLYA 1C1PA 1ANBA 1EZQA 3QO6A 3LKWA 5T3HA 2BY7X 2ZDKA 3S69A 2RG3A 4B76A 4JZFH 4MG3A 2WPKS 2FXRA 1TPAE 1DXPA 3PTNA 3PLBA 1MTSA 2H1UA 4IW4E 5FAHA 2BY6X 3E91A 2CJIA 4U2WA 1YLDA 1YCPK 3RDZA 1GI5A 1DY9A 1Y59T 1P11E 1O3EA 4FUGA 1LPGB 2VH6A 2FOHA 1HAVA 1MUEB 1QBNA 1ACBE 4MPUA 1HAOH 1DITH 1AZ8A 1AMHA 2ALPA 1G3BA 5DP3A 1B0FA 2FOEA 1W12U 5CHAB 4KTUA 1K1IA 2QAAA 4KP0A 1C1WH 5FCKA 2CF8H 2VIVA 1O2TA 1P2QA 2B8OH 2HNTE 1P0SH 1SMFE 4B2CA 2Z7FE 3DHKH 4I8GA 2EC9H 4XBDA 1D4PB 1GJ5H 1TLDA 1C2HA 2BZAA 1H8IH 1ZGIA 3HK6B 3P8NA 3SJ9A 3A84A 1A0LA 1OWJA 2G4TA 3U9AH 2BQ7B 1JRSA 3M7UA 3DUXH 3M35A 1SHHB 1PYTC 5DP9A 2H5CA 3BEFB 3LT3A 1RIWB 3RXDA 3SUGA 4YO9A 2AGIX 5K7RA 3FZDA 1CHOG 3RXBA 3PWBA 4X1NU 3UR6A 1C1SA 3T26A 4MNWA 2XTTB 3PYHA 3BTGE 1GG6B 1CBWC 3S9CA 2ASUB 3TGJE 4FUIA 1SGDE 3SU3A 1NS3A 1A7SA 5DGJA 1TGTA 1V2RT 4ZHMU 4O3UA 2Z94A 2NU4E 4MLFB 1AD8H 3E0PB 2ZU1A 4IN2A 3ZZCA 1ARCA 2GDEH 1GDQA 3PMHB 2J95A 1KXBA 1O3AA 1DX5M 1ELTA 3EA8A 1K21H 1SR5C 3RLYH 2PGBB 4YT6H 3BSQA 1SGPE 2BD4A 3AASA 4X8SH 3ELAH 3U8TH 4LZ4B 3BG4C 2XC5A 2PFEA 2GKVE 2NU2E 2OINA 2R0LA 5CE1A 4YOIA 2O8TA 4MQAA 1E36B 1GJBB 2C3SA 1ETRH 2BB4A 2TIOA 2OQ5A 2C93B 1F0UA 2GTBA 3I29A 3TJNA 1O3JA 1OKXA 1TBZH 1RTKA 1LHGH 2ZECA 1ARBA 1NT1A 3ZZAA 4ZKOU 3H5CB 1L0ZA 4BAMB 1C2LA 5DP6A 4RKOB 2FI4E 3QGJA 3RC6A 4XBCA 2YNBA 3NPSA 2PHBA 1BRBE 1QTFA 1WTGH 3GYMA 4K1EA 3IITA 1DUAA 1V2LT 3ZV9A 1UK2A 1ZRBA 1S6HA 3A8BA 1CHGA 1K1MA 1AFEH 3ESTA 4WF8A 1F0RA 2BLWA 1PFXC 1TA2A 2YOLA 1O5BB 2BQWB 1TFXA 3D23A 4ZKNU 1FN8A 3ZZ6A 1F7ZA 1F0SA 4BAOB 1O2GH 1P2IA 1ZTJA 3NZIA 4U30A 1YPKH 5TCCA 3P17H 3ZZ9A 4AFUA 1TB6H 4I31A 1SGNE 1MKWK 4NIYA 1BMNH 3KQEA 1C9PA 5FBEA 2OCVB 1BMAA 3IG6B 1ZOMA 3R3GB 2A1DB 2PTCE 4AN7A 2A4OA 4BANB 1XUGA 5FPYA 1TWXB 3N7OA 1ETSH 1GMHF 2KAIA 2F9UA 1L4ZA 4ABDA 1N8OC 3GYLB 3K65B 1SGCA 1B5GH 4MNVA 1EPTB 3KIDU 4Y6DA 3P8FA 2QXJA 1H9LB 1KY9A 2YNAA 4I8HA 1E34B 8LPRA 2Z9LA 1NU9A 2GX4A 1A0JA 3LOXA 2ZKSA 2A32A 3KQDA 3MU4A 4FUBA 1TPSA 2ZHDA 4OS4A 3UQVA 5F03A 1W0ZU 1UMAH 4DW2U 1TIOA 1H4WA 2GCTC 3NCLA 2PW8H 1V2MT 1GI2A 3W94A 1TRMA 1BTYA 4MVNA 2ZPSA 3VGCC 4ZKSU 4XDEA 4IBLH 3MU5A 4J1YA 1WQVH 2ZTXA 5A8XA 3Q76A 1RJXB 2P93A 1EZXC 4IGDA 1MKXH 2BQ6B 3M3VA 1IQGA 1HJAC 3OX7U 3Q3KA 2ZG0H 3MO6A 1LKBA 3ATLA 1WTHD 2H5DA 4OS7A 3MNXA 2FI3E 3DT0H 3BTEE 4FUDA 3SU5A
chains in the Genus database with same CATH superfamily
1MD7A 2HGTH 1A2CH 2ZPQA 4OGXA 2B7DH 1HJ9A 3PO1B 1ELAA 4GUXA 3RXPA 5L2ZH 2EA3A 4FU8A 2BXUH 4JMYA 4R8TB 2JETC 4Q2KA 3GCNA 2ZGHA 1C1MA 3VXFH 2FEQH 3TITA 3ZVBA 1C1RA 5AVDA 1WUNH 1MTUA 7GCHF 2Q6DA 1AN1E 4K3JA 3ZYEA 1P03A 3PMBB 1CA8B 4O03A 3TIUA 4WXVA 2C8WB 5F8ZA 1C5XB 2JIZD 4Q63A 3BV9B 1O38A 1OXGA 3RMNH 3Q00A 1KSNA 3A88A 2WUBA 1YC0A 1C5NH 4D7FA 2BLOA 5F8XA 2AIQA 4BTUB 1P06A 1SGQE 3HGNA 3ZZ4A 4WMFA 1GI6A 5LGOA 1BITA 1H9HE 2KCYA 3M7QA 1AWHB 1UTJA 4UFFH 1EX3A 1S84A 2AFQB 1ANDA 2A4QA 1KTSB 2VWMA 4FXGH 5AFYH 2GZ9A 1IQHA 4DJZB 2JH6D 3FAOA 5JBBS 5C20A 1TNHA 2XBWA 1P01A 1SGFG 2OQUA 3RMLH 4DVAU 1MU6B 3SJ8A 1ETTH 1C2DA 2TRMA 2VJ1A 1GGDC 1PPCE 3MO9A 2VH0A 1IQEA 1W0JD 2A45B 1FZZA 2SNWA 1MCVA 2D2DA 3LGVA 5LH8A 1T8OA 1HRTH 3B9FH 3OE7D 1ANEA 2GZ7A 1QURH 2OXSA 2R2WU 2ZDLA 3RXQA 2GT7A 3TH2H 2V35A 1FQ3A 4ASHA 2J94A 1VJAU 3ZZ8A 4JZ1A 4F4OC 2G81E 4Q7ZA 1K28D 3KGPA 5K0HA 2O9QA 2WPDD 4B6EA 2ZU3A 5J4SA 2GVFA 1C5OH 2L74A 4WJG2 3SNCA 1UTLM 5GNDA 3UWJH 2F3CE 2OC1A 3RXEA 5EPYA 2XC4A 4RI0A 2PUQH 1GI0A 1CU1A 2BVRH 4ISNA 2ZC9H 1UK4A 2Y80A 4ZHLU 1NU7B 1KXEA 3QX5H 2F91A 2F9PA 1BBRE 1QNJA 2OLGA 5T1VA 3ZVGA 1KLTA 3F1SB 5HIZA 4AOQA 1AKSA 3P8OA 2ANMH 2VVCA 2FLBH 3QUMP 3SGBE 2EY4C 3SZNA 1W13U 1BRCE 4YT7H 1V2TT 4AC9A 3VB5A 4TPYA 2A2XH 1ZSLA 3ZZDA 2QA9E 5C5OA 1CA0C 2BMGB 1ABJH 5E0HA 1TALA 4AG1A 2O8MA 1RD3B 2F9NA 3DFLA 1GBLA 3QLPH 1C2GA 2AGGX 1Z6JH 1PPEE 1O2OA 1W7XH 2WYJA 3TH4H 1O32A 5EW2H 5DN6D 1FXYA 1BRUP 3GICB 4ESTE 2UWPA 3MU8A 4KGAA 2R2MB 2J92A 1HAHH 1O3PB 4ZUHA 2ANKH 2XC0A 3QWCH 4LXBH 5T6GA 1QJ7B 1D9IA 1UTQA 1NRRH 4NGAH 1E0FD 4H4FA 1SGFA 3NKKA 1CHOF 1O2NA 5FL7D 2G5VA 2QF5A 1O3DA 1EUFA 3KQCA 4QT8C 1O2PA 2Z9IA 3A7YA 4NSYA 3A7XA 1G32B 3RUOA 1TNIA 3KEEA 1GBJA 1JWTA 2GJGA 1Q31A 3SV7A 4Y76A 4LOYH 4SGBE 1TRNA 3M5OA 6ESTA 1GHWH 1O3KA 1V2NT 2FOMB 1W3CA 2AEIH 1VGCB 4WH6A 1DT2A 1O30A 4RT0A 2O8LA 5DP5A 3RXAA 2B9LA 3P92A 1UHBA 1TBRH 1ZYOA 1GHZA 2BY9X 5AHGH 1J17T 1NRPH 1HCGA 2QXGA 1O5AB 1WOFA 4FUHA 4DT4A 1A5HA 2R3YA 1BIOA 3GY6A 4X6OA 4XFQA 1F5KU 1LHDH 2Q6GA 1O2KA 2HRVA 3I78A 2VWOA 2XCNA 4Z0KA 1L2EA 5CDFE 1QB6A 1ESTA 2FM2A 2FTMA 2WYGA 1H9IE 3R0FA 4ISOA 3UQOA 3NRLA 4FUJA 5E0JA 2K0QA 1LHFH 3MNCA 4FU7A 1SOTA 3OEED 4TWYA 1NFYA 2QYIA 5TJXA 1TGNA 1DLEA 2OUAA 4O97A 2VNTA 2Y5GA 3A8AA 3EA9A 4P00A 5AFZH 3VEQB 3RXIA 3AAVA 1F5RA 4F49A 1CT4E 2ODYB 1S0RA 1L4DA 3UTUH 2YMSD 2P8OC 3SJOA 3U8RH 1KTTB 3T25A 1QL8A 1O2VA 3M5LA 5FPSA 4CH8B 3VG8A 1BCUH 1RFNA 5HM2A 4AYVB 2J4IA 2TGPZ 1ELEE 1FPHH 4ABGA 1HAXB 4B73A 5EIYA 1P05A 1CSOE 1V2OT 1BTHH 4X8UH 1NRQH 9LPRA 2FLRH 3TGIE 1YF4A 2BOKA 2V3MA 3PLPA 4UONA 3JZ2B 1D6WA 1HB0B 3GOVB 1P2KA 4CR5A 2OP9A 3FP6E 3UREA 2OTVA 2UUFB 2G51A 3A89A 5L30H 1AU8A 2ALVA 1O2XA 2XBVA 2QXIA 3FP7E 2QXHA 3NK8A 1O5DH 1Z1JA 3LGUA 3RMOH 3UNSA 2H6MA 1KXDA 1G3CA 3KYGA 1C5RA 1MU8B 4K5ZA 3TK6A 2WV9A 4B71A 1QRXA 1IHTH 1HIAB 2YMSB 1XUFA 4YTAA 1O3GA 2KCPA 4AB8A 2PKAA 2FX6A 1DWEH 1NRSH 2HLCA 2UUKB 4M9FA 1QGFA 4A5TS 3V13A 3BIUH 4MNXA 2ZDNA 4D8NA 1NPMA 1OYTH 3BTME 3LH1A 2A5IA 3A7ZA 4WVPE 1F92A 1GBHA 1P57B 1GMDF 1TMTH 1HV7A 1Q2WA 2JH5D 3ZIAD 1EJMA 1UTNA 2A4GA 1E38B 1IOEA 1FDPA 1YP9A 2EEKA 3BEIB 1ZHRA 1LHEH 1PPBH 1G2MA 1THPB 3SU6A 4GHTA 3SV6A 4CBOA 1C4U2 3V3MA 1F0TA 6GCHG 2ZPRA 3QDZB 1FAKH 1P9SA 2QF3A 3ZVFA 4O9VA 4DGJA 4INLA 7KMEH 3DSPA 2P59A 1K2I1 4X2XA 1O2LA 4JZIA 3UOUA 1ESAA 1A46H 1YPJH 1XKAC 1AZZA 1C1VH 4E7RG 2HWLB 2O8WA 4JCNA 1OP0A 1O2SA 4CRDA 1YPEH 3FP8E 2HPQH 3DFJA 2XWAA 2STAE 4B6FA 4RT1A 1QL9A 3K6YA 1SKYE 2FYQA 2V0BA 2BHGA 3F2FA 4UD9H 1EFRD 1O3CA 1RIWC 1JIRA 1BTUA 3BTTE 5F6MA 3TNTA 5EJ1A 1C2EA 1V2UT 2W7UA 2BD2A 4D7GA 1LVMA 3RXHA 2VVVA 1IQIA 3FFGA 3ZZ7A 1TMBH 3GCHB 1O5EH 1GG6C 4IC6A 4ACAA 4HZHA 4A1VA 1MMJN 4I8JA 1C2IA 4ABBA 2J97A 1S6FA 3TNSA 5DJ7A 3MU0A 1AQ7A 3PRDA 2FI5E 2ZU4A 2P95A 1G9IE 1O37A 3FN8A 5JPMH 1ELBA 3SUFA 2A5KA 1TRYA 1YBWA 5BRRE 5ABWA 4YESB 4CHAB 1C5MD 3LGTA 4OS1A 4XSKU 1HLTH 3E0NB 3U8OH 3ZVAA 1GHVH 2Z9KA 2Z9GA 2BY5X 5B6OA 1YGCH 1GVLA 2BM2A 3SNDA 2IJOB 5ETXA 1YY3A 5L6NH 1BBRH 1DICA 1IQFA 5GWZA 1MAXA 1G36A 5EQSA 3STIA 3RXRA 1TX8A 3HK3B 3ZZ5A 3V0XA 1ELCA 1K1PA 5KGOA 1EB2A 2VGCB 4TYDA 2PV9B 3KCGH 3QZRA 3KN2A 3RC4A 1FY5A 1V2JT 2A7CA 2VIDA 7LPRA 1ZJDA 3OTPA 2PSYA 3K9XB 1MTNB 2D1JA 2GP9B 3E6PH 4KKDA 1EAUA 1BDAA 1P2NA 3BG4B 1RRKA 2TBSA 3SV8A 1C2JA 1WYKA 1SGTA 4CRCA 3SYJA 1BJUA 1VR1H 9ESTA 1Y8TA 1OYQA 2Y82A 1J15A 1Z8RA 2FP7B 2C8ZB 4TPIZ 1LQDB 3LJOA 1GBTA 4GSOA 3MWIU 2AERH 3H7TA 2Z6BD 1GJAB 1LVOA 3PV2A 3BTHE 1HUTH 1QA7A 1HXFH 1FMGA 3E1XB 4NIWA 2Q1JA 3RXVA 1HAZB 5DP4A 5EODA 2W7SA 3MTYA 1FAXA 4K1TA 3PTBA 1MD8A 5C67A 1MBQA 1A5GH 3SNBA 3EQ0H 4E7NA 2AHME 3O8CA 2D8WA 1N6YA 1H8HD 2CHAB 1GVKB 3SN8A 1QB9A 1AVXA 2BD9A 1G37A 1YLNA 3M3TA 5EOKA 2K8IA 4ABIA 5IK2D 2A31A 1UVPA 1GJ8B 1VZQH 3OEHD 3GY3A 1GMCF 1SPJA 4YLQH 2CN0H 1DOJA 1BMLA 4INKA 3RLWH 1EPTC 4IMQA 3EDXB 4Q80A 1S83A 1GMDG 3MH4A 2QC2A 1NROH 1C1NA 4ZXXH 2XBYA 1T7CA 2ZP0H 1GI1A 4DIHH 1MCTA 1NFUA 1C5TA 3KNXA 5GCHF 4CRGA 2WPJS 4IMZA 5A0BA 2P3TB 2WPHS 1GJ9B 3DSGA 1LVYA 2CV3A 5EXMA 4FUFA 3S7KB 4ZAEA 4XBBA 3RXTA 3SORA 1O5FH 3D62A 1IQLA 2ZIQH 1GL1A 1W7GH 2BDGA 5JB8S 4UFDH 4WMEA 2BDAA 2VB0A 1BTXA 2ZDAH 2ZGBH 1FX0B 2XW9A 1PQ5A 4P02A 2P3UB 1NBME 1AI8H 3N7DA 2PP6A 1T4VH 4X0WU 5PTPA 2BX3A 4FUCA 2H2ZA 1G30B 3I77A 1AFQC 1QHRB 3U69H 1TOCB 4AFZA 1DWDH 1O2WA 3GDVA 1B7XB 2Y6TA 2H9TH 4OS5A 1RTLA 1YLCA 3SJIA 4LZ1H 3BTQE 1ZSJA 1UCYK 4X1RU 3RU4T 3FZZA 2QV1A 1O2MA 3E8LA 3TVJB 1OP2A 1S0QA 3WWFA 2Y5HA 3A7VA 1AY6H 1C1UH 1KDQB 1IHSH 3CS0A 3MH7A 2WSSD 4ABAA 1P8VC 3OY5U 2R3UA 2WHXA 1TABE 3RXKA 2WUCA 1UTKA 2BLVA 2GMTB 1EP6A 5TCAA 3W1EA 5FCRA 4X1SU 5BPEA 1ABIH 1C2FA 2JETB 4NSVA 1YCPH 1D6RA 1UVTH 1QIXB 1BQYA 5C0UA 2GV7A 4K1SA 1FIZA 2JJ2D 2P16A 1LCYA 1W2KH 1DDJA 4E06H 3KYFA 2RDEA 2Y5FA 3OAAD 1C5WB 2H9EH 3RXGA 2FTLE 3ATWA 2A7HA 3D65E 3NUMA 4YLUA 4B2BA 3A7WA 4VGCB 2FZZA 2QIQA 5JBTA 2J98B 4AB9A 1P3EA 3MYWA 4MNYA 3F9FA 3URCA 2VINA 2ZQ2A 1S85A 3GCOA 3VFEA 2HNTC 2ZU2A 4A7IB 3F6UH 1W14U 1IQKA 1MABB 2IJD1 3ITIA 4NG9H 5EW1H 1GHXH 1P3CA 4CR9A 2VVUA 1ZTLA 1EJAA 3EGKH 2B5TB 1LKAA 2NU0E 3DD2H 2F83A 1E79D 3SGAE 2NWNA 1YPHC 2ZU5A 1NY22 1CGJE 3F9HA 4OGYA 3ZVCA 1FJSA 4I33A 3MQKC 4Z1MD 2W6JD 1S82A 1ELVA 5EQQA 2XNIA 1W8BH 1Y3UA 4AFSA 2BXTH 2GDDA 3LC5A 4HG6A 2M5TA 8GCHG 2XOKD 3TJUA 1DFPA 1GDUA 2FESH 3GY2A 2ZHEH 2HVXA 1UO6A 1MQ6A 2SGPE 4NA8A 2XCFA 3SW2B 3GDSA 2WZQA 1T8NA 1VCPA 4DURA 2OC8A 3QTOH 2AGEX 2VWLA 4Y7AA 5FHTA 1L1GA 4AYYB 1P2JA 3ZVDA 1EZUC 3O8BA 5SGAE 5JB9S 1G2LA 1A5IA 4ZROA 2ODPA 4X6NA 1A3EH 1TNLA 2IPQX 3MI4A 2ZCKP 1FIWA 2RA3A 2ZF0H 2WV4A 6GCHF 1TX6A 1UJ1A 1QRWA 2PKSB 3SNEA 3UUZA 1A61H 4BNRA 1J16A 2D26C 3T2NA 3OU0A 1ELDE 2BDCA 1TOMH 2BD3A 2OK5A 2FO9A 2Z3CA 2V3HH 1YKTA 2G52A 1ZJKA 3TK5A 1GMCG 2QN5T 1TX7A 3VXEH 1KXCA 3ATKA 3STJA 1O36A 2ZCLP 1AE5A 3RXMA 2C8XB 2G4UA 5C2ZA 5IDKA 5HMAA 4Z6AH 1FNIA 1S5SA 1GCTB 1AB9C 1O39A 2C8YB 2F9BH 2H9HA 1QL7A 2FPZA 4Q7YA 1RXPA 1EXFA 1V3XA 1ZMJA 2SGQE 4SGAE 1J9CH 1GBMA 3ENSB 3TPIZ 1UVOA 2ZFSA 1SQAA 5GCHG 2A4RA 2IN2A 5F8TA 1IAUA 1XUJA 4IN1A 4ABFA 1GBCA 1ELFA 1O3LA 4KTCA 1GHBG 1GL0E 6CHAB 3CP7A 2CF9H 4IS5A 4ISHH 6LPRA 7ESTE 1C1OA 2AMQA 1GCDA 1QRZA 4OS6A 5FX5A 3RM2H 4NCYA 1HBTH 3Q3XA 3ZZBA 2WV5A 1HDTH 1LHCH 3MH6A 4DT7B 4TWWA 2V3OH 3RXCA 3C27B 1O35A 1PPGE 1COWD 1OX1A 1VGCC 2UUJB 1CVWH 4TSFD 5G4BA 2EI8A 3M5MA 2ZHQH 1O2RA 1EAXA 5HM9A 1OWHA 4YOGA 1GVZA 3T29A 5EXNA 4Q7XA 2G5NA 3ZZ3A 3DCLA 1SSXA 2ZFTA 2G00A 1SLXB 2BDYA 5A0CA 1MKWH 4CRFA 1P10A 3BTKE 2KAIB 3PMJA 1C1TA 3MU1A 1LO6A 3N99A 4U32A 5I46H 1HFDA 2EI6A 1QJ6B 3UNQA 3BEUA 1ORFA 1GBFA 5LPFA 2G55A 3OYPA 3GY7A 2TGTA 2F9OA 4E05H 1AE8H 3MNBA 2ZFRH 2ZGJA 1XKBC 1ESBA 5FX6A 1KMHB 1P09A 4JK5A 1FI8A 2FWWA 3V7TA 3A85A 4JYVH 5I25A 1BTPA 3PROA 1CGIE 1ID5H 2CGAA 4X1QU 1OWIA 1RGQA 2QGRA 5C1UA 2ZGXH 4AG2A 3KF2A 4H42U 2XWBI 2JJ1D 4NFEA 5C1YA 1KYNA 1TMUH 3RXJA 8ESTE 1DUEA 2Y7ZA 4I7YH 4M7GA 3L3TA 1EQ9A 1TQ7B 1O3OA 5C3NA 1QBVH 1PPHE 1Q3XA 4MDSA 4RN6A 3VB7A 2Z3EA 3KQBA 1VCWA 3ATIA 3VB3A 1EPTA 3U28C 3H09A 1DWCH 1C5ZB 2AMDA 3MNSA 2QF4A 3NWUA 1ZTKA 1FY4A 4KELA 1AO5A 1E1RD 3U98H 1THRH 2BTCE 3RU4E 1TBQH 1MAYA 1E1QD 4HGCA 1WBGB 2BDIA 2PTNA 2FOGA 2AH4X 5DSFA 1XM1A 2JH0D 1A4WH 1GBAA 4I32A 1MH0A 1UW7A 4X6MA 2OBQA 1K9OE 2JDID 3CENA 1W10U 5E0GA 4XOJA 4UE7H 4A1XA 1HXEH 2QE7D 2BYAX 1FY8E 1JXPA 1TA6A 2FDAA 1BB0B 4NA9H 4BAHB 2OBOA 1SC8U 2YMSC 4F55A 4X8TH 1C5PA 2OC7A 1OWKA 2F43B 4TY6A 4MPWA 1BZXE 5GXPA 1C5LH 3EE0B 4LK4A 1O3BA 2FIRH 1M9UA 1D3TB 5A8ZA 2V6NA 1BA8B 2UUYA 3MO3A 5GJ4B 1EP5A 4J2YB 3RM0H 1ZMNA 3P70B 4ZH8A 4FVBA 1SLUB 2I6QA 2FYRA 1YWUA 3L33A 1U6QA 4DIIH 1T8LA 4YM9A 5E2OA 3AAUA 1H8DH 4X2VA 5DP7A 2GT8A 1O2IA 1ZMLA 2AYWA 3PMAB 3F9EA 3TJOA 1V2PT 2W3KA 2WINI 2WPIS 1GBKA 1CT0E 2IOTA 4A6LA 4K60A 4U01A 1GHYH 5AF9H 1BTZA 1KDQA 2ESTE 2ZDMA 1YCPM 2UWLA 3MH5A 3SI3H 1QFKH 3KL6A 3DA9B 5CHAC 1W11U 4Y7BA 1C2MA 5LPRA 1PYTD 1C9TA 1MTVA 3F2HA 2FOCA 1Y3WA 3DSOA 4UDWH 1Z8GA 3HKIB 1K1NA 1SG8B 3A87A 4B1TA 2BX4A 2K1QA 1O2YA 1FONA 5GPIB 1YPLH 1OWDA 2PGQB 3LGIA 2STBE 5JBCS 3U1JB 1FUJA 1SFIA 2AS9A 4WY3A 3O8DA 4BAKB 3A7TA 1UTPA 3P8GA 3P6ZB 4GHQA 3ZYDA 3CNRA 3Q3YA 3WW7A 1TGBA 4NZLA 2ULLA 1HGTH 5DK1A 4DG4A 2BVXH 4JYTA 5H4IB 1GWAA 2J5UA 3SZEA 1QJ1B 1YPHE 4DY7B 1FN6A 2XNDD 1XXFA 2GCHG 3GCHC 4A92A 1SGYE 1Z1IA 1SQOA 3TGKE 5E2PA 3SUEA 1O3FA 1S81A 1ZR0A 5EU8A 1LPZB 1W0KD 2OD3B 3AW0A 1SOZA 1Z6EA 1F5LA 3H7OA 5A09A 5FXLA 3M7TA 1WV7H 2BDHA 5HXFA 1J8AA 1QQ4A 1SHYA 4I8KA 5T6FA 4RSPA 1IQMA 1O2QA 1CBWB 4CHAC 1EJNA 1PPFE 1RTFB 1AKSB 1XX9A 3A82A 4IC5A 1HAPH 3C1KA 2BVSH 4JZDH 3EE7A 1HAGE 4OM9A 1QZ8A 4BTIB 1GBDA 2HOBA 3AVZA 2SGAA 3SJKA 1P2OA 4INHA 2Y7XA 1TNJA 3TH3H 2VIPA 2ZFQH 2P94A 1E35B 1BT7A 3K6ZA 1JRTA 1GHAG 4GPGA 3PB1E 2J38A 4MTBA 2GZ8A 5DG6A 5CMXH 2F9VA 5F53A 3ODFA 2VGCC 4DOQA 1Y3YA 3A8CA 2FS9A 1ZHMA 1MTNC 3RXUA 2BOHB 4R0IA 1LDTT 1TQ0B 2QY0B 1TNKA 1FV9A 1HYLA 2CK3D 4FUEA 2IPHA 1SGIB 4H6SB 4NWLA 3S0NA 1T4UH 1UTOA 1GPZA 3URDA 2FS8A 2ZO3H 1ANCA 4X1PU 3UB0A 1BMFD 3SHAH 4GCHF 4TY7A 8GCHF 1F2SE 2ZFPH 1GBIA 1C5SA 4YOJA 1ZGVA 1OWEA 1GJDB 2KCAA 2BZ6H 2ZQ1A 2CXVA 1CE5A 1UVUH 1ZLRA 3RXLA 2RA0A 1GJ6A 1DS2E 1N1LA 2ANWA 1FY1A 1WXRA 1C1QA 3SU0A 1UHBB 3K2UA 3VB6A 3KHVA 1CT2E 1PQ8A 5HIYA 1G3EA 1HJ8A 3TU7H 3L6PA 1AVGH 4FU9A 1JOUB 2W3IA 1AUJA 1AIXH 1GBBA 1K22H 1LPKB 3FO8D 1X7AC 4Y10E 3SQEE 4HTCH 4D9QA 4ZXYH 1DANH 3E16B 2CHAC 1EAWA 2AIPA 4BTTB 3TLOA 1NM6A 1XUKA 3SO3A 4K8YA 1ZZZA 1Z8IB 1TE0A 3UPEA 5C1XA 1JBUH 2P3FH 4CREA 1GI4A 3M61U 4RKJB 1KLIH 5FBIA 2BD8A 2BD7A 2QF0A 4Y8XA 1O5CB 1LMWB 2NU3E 1ELGA 1XUHA 4X2WA 3RU4D 3GY5A 3OY6U 5LPEA 2Q6FA 4NWKA 2WPMS 4ZMAH 1HNEE 1B0EA 1W0YH 3G01A 3SOSA 2SFAA 3F68H 1LQEA 2J34A 1A3BH 1MBMA 1O3NA 1N8OB 3LIWA 2KCOA 1KXFA 3FVFB 4CRAA 5A8YA 1GHBF 1T8MA 4Y8YA 1DSUA 3LDXH 1IQJA 1A0HB 2I6SA 1NFWA 4NA7A 1ZPZA 4ACBA 1BRAA 1V2WT 1Y5BT 3BIVH 2BD5A 5HGGA 3V12A 5T6DA 2JKHA 2FODA 3B8JA 2J2UA 1KLJH 1O2UA 2PLXA 5C5NA 1AWFH 1EB1H 4XRNA 1C5YB 1S6LA 3GCTF 4NIXA 2GCTB 1CGHA 1WQSA 4WXIA 3UNRA 2LPRA 3MOCA 1SQTA 3VGCB 3SV9A 4BXWA 2ODQA 2SGFE 2VIWA 2BDBA 3PM3A 1DPOA 3QTVH 3PLKA 3QN7A 1GJ7B 1FY3A 1SLVB 3EAJA 3GDUA 3MMGA 5C94A 2PKAB 1GI9B 3BN9A 3T5FH 3A80A 1HJAB 1INCA 2KX4A 4I86A 1G3DA 4ZKRU 3BG8A 4ABHA 4ABJA 3RMMH 3LPRA 1GI8B 1VKYA 3PO1C 3VB4A 4AGJA 1HAIH 1BJVA 3T27A 4D9RA 1UCYE 5HKKD 3PV4A 5EG4A 1XMNB 2PR3A 2M2AA 1L1NA 2XBXA 4Y0ZE 5E8EH 4GAWA 4WMDA 1V2VT 1AFQB 3A81A 2PUXB 4AORA 1D3QB 2RFKC 1PQAA 2VIQA 3SNAA 1VITF 1O34A 3GY4A 4ISLA 2GMTC 4JK6A 1VITH 1EASA 1NFXA 1HAVB 4Y71A 3RXOA 2FMJA 1HIAA 1NN6A 3SU4A 1QA0A 4A1TA 3RP2A 2C90B 1O2ZA 1K1LA 2FOBA 1C5VA 1BHXF 1SQRA 3GISB 1AGJA 1RS0A 5JDUB 1K1JA 1DVAH 1MZAA 1YPMH 5DP8A 2XRCA 5J4QA 1BHXB 1P9UA 1D3PB 3HGPA 4KTSA 4UFEH 4O3TA 2HPPH 4JYUH 2WPLS 4OS2A 2W26A 4VGCC 1OS8A 4HI3A 3HKJB 2ZZUH 1IQNA 1EAIA 1Y3VA 3P95A 4K8BA 1OPHB 2ZWLH 2SNVA 3SUDA 3MFJA 2VU8E 3SGQE 1VCQA 2J9NA 2ZFFH 3OSYA 4MPXA 3B23B 4AFQA 1DSTA 3PWCA 2HNTF 2W6ID 5EQRA 2CMYA 3M5NA 1P02A 4TT3D 2AMPA 4CRBA 1T32A 3KQ5A 2RDLA 1GJ4H 1CQQA 4GCHG 1FPCH 3SI4H 4B2AA 1SGRE 3LJJA 1O3MA 2ZTZA 1GGDB 1MZDA 4K69A 1LVBA 4NFFA 1EKBB 1TYNA 3BF6H 1MTWA 4BAQB 1JIMA 1TAWA 1V6DA 2OC0A 4JZEH 4F48B 1A1RA 3OTJE 1UVSH 4GVUA 1SFQB 1ZPBA 1Y5UT 4Y11E 5KEDA 1O2JA 5A2MH 3E3TA 4BOHA 1C4Y2 2B0FA 1XUIA 1DM4B 1SGEE 5EXLA 3F9GA 1J14A 3M37A 4WWYA 2GGVB 2ZA5A 3LONA 4I8LA 3RC5A 1SVPA 4XD7D 1ZPCA 1O33A 1E37B 1O31A 3FOAA 1SB1H 3LH3A 1SL3A 1NTPA 4XE4A 1EOLA 4ABEA 2ZHWH 2G8TA 2PKSC 1KXAA 1O2HA 5IYTA 4ZHAA 2HLDD 2LP6A 2PSXA 1BOQA 1KIGH 3GY8A 4UFGH 4X6PA 3RXSA 2SGEE 4Y0YE 1DXWA 1Y3XA 1GJCB 2DUCA 2DE8A 1Y5AT 1AUTC 1THSH 2C4FH 1K1OA 1WCZA 1EZSC 5ESTE 1BBRK 1Z71A 4HFPB 4MPVA 4K2YA 1H1BA 4UEHH 1GCTC 3QK1A 1GI7B 2THFB 3JZ1B 5DKMA 1YYY1 1AVWA 2BY8X 3SV2H 1GMHG 3M3SA 3LU9B 1FLEE 4WH8A 3SBKA 1DE7H 1CA0B 2L6OA 2ILNA 4X8VH 1N6XA 1HPGA 1WAYB 3LGYA 3BTFE 3TJVA 2ZGCA 2R9PA 3A86A 3LGWA 1AB9B 6CHAC 5JBAS 2A0QB 1V2QT 5A0AE 3GS9A 4YZUA 2A2QH 4B75A 4AGKA 2GCHF 4B74A 3WY8A 3RXFA 4NIVA 1TONA 2TPIZ 1DLKB 3UFAA 1V2ST 1HAYB 5EGMA 1WSSH 1UTMA 1WU1A 3VPKA 1QB1A 3OFND 1JMOH 2VIOA 1XXDA 3GCTG 3U1IB 1BTWA 1YM0A 2ANYA 3S7HB 1L1JA 3BTWE 3T28A 3NXPA 2TGAA 2LNCA 2NU1E 2QCYA 1XVMA 1Z7KA 1NO9H 3A83A 2EI7A 1YPGH 2Y81A 3AW1A 2ZHFH 3IWMA 3W95A 1SLWB 2DE9A 1P12E 1TNGA 1P2MA 1MQ5A 1O5GH 2XXLA 1OSSA 3M36A 1SBWA 3UY9A 1GDNA 4PROA 1LTOA 5EPNA 3LC3A 1C2KA 2HALA 1GHAF 1D3DB 4ASUD 2SGDE 4DCDA 4NZQA 1VITG 1ZRKA 1GI3A 1SI5H 2Z3DA 2ZEBA 2ZI2H 1DY8A 1C5UA 1OOKB 2ZCHP 3F3BA 4FETA 2ZTYA 3D49H 3UWIA 2RCEA 1NBMD 2VWNA 1O3HA 1ZHPA 5B6LA 3TK9A 4D76A 4H6TA 5GIBA 2GV6A 3HATH 3F0PA 1BMMH 2ZNKH 2R0KA 1V2KT 2A7JA 4Q4LA 4AZ2B 2BLQA 1QQUA 1EATA 3SQHE 1PQ7A 1DWBH 1TPPA 3UIRA 3QZQA 2FOAA 7GCHG 5DPAA 1TPOA 1TGSZ 5ESBA 1TGCA 3ZV8A 3Q77A 4THNH 2F4LA 1XVOA 2Z9JA 3SU2A 3T62A 3HPTB 2FOFA 3EA7A 2TGDA 4CBNA 3FKSD 4Y79A 2FX4A 1OP8A 2P8OB 3WWBA 1BUIA 1K0HA 3ATMA 3EYDA 4AX9H 1VJ9U 1QCPA 3MHWU 1PJPA 3E90B 1CO7E 3ODDA 3O8RA 1NRNH 1QY6A 5CHBA 1P04A 1EOJA 8KME2 1O3IA 5JYIA 5C0TA 3A8DA 3S9AA 1UK3A 2KR7A 1MKXK 1AHTH 2HVYB 2UWOA 2PWXA 1C5QA 3UOPA 5DO4H 4ISIH 3SU1A 2ZDVH 5FPTA 1NZQH 1PPZA 5HYOA 2A5AA 2W5EA 5EJLA 1C4V2 5GDSH 4FVDA 1QBOA 1NC6A 1QR3E 2O8UA 3BTDE 2LELA 3ZVEA 3CS7A 1Z8JB 1ZSKA 5L2YH 4Y8ZA 3QGNB 3UR9A 4X2YA 2XYAA 1O0DH 2GD4B 3SHCH 1NESE 1UCYH 1GBEA 3FANA 4CH2B 1T31A 4BXSA 3S9BA 4GLYA 3F2GA 1C1PA 1ANBA 1EZQA 3QO6A 3LKWA 1WDIA 5T3HA 2BY7X 2ZDKA 3S69A 2RG3A 4B76A 4JZFH 4MG3A 2WPKS 2FXRA 1TPAE 1DXPA 3PTNA 3PLBA 1MTSA 2H1UA 4IW4E 5FAHA 2BY6X 5EJZA 3E91A 2CJIA 4U2WA 1YLDA 1YCPK 2VBCA 3RDZA 1GI5A 1DY9A 1Y59T 1P11E 1O3EA 2KM0A 4FUGA 1LPGB 2VH6A 2FOHA 1HAVA 1MUEB 1QBNA 1ACBE 4MPUA 1HAOH 1DITH 1AZ8A 1AMHA 2ALPA 1G3BA 5DP3A 1B0FA 2FOEA 1W12U 5CHAB 4KTUA 1K1IA 2QAAA 4KP0A 1C1WH 5FCKA 2CF8H 2VIVA 1O2TA 1P2QA 2B8OH 2HNTE 1P0SH 1SMFE 4B2CA 2Z7FE 3DHKH 4I8GA 2EC9H 4XBDA 1D4PB 1GJ5H 1TLDA 1C2HA 2BZAA 1H8IH 1ZGIA 2J98A 3HK6B 3P8NA 3SJ9A 3A84A 1A0LA 1OWJA 2G4TA 3U9AH 2BQ7B 1JRSA 3M7UA 3DUXH 3M35A 1SHHB 1PYTC 5DP9A 2H5CA 3BEFB 3LT3A 1RIWB 3RXDA 3SUGA 4YO9A 2AGIX 5K7RA 3FZDA 1CHOG 3RXBA 3PWBA 4X1NU 3UR6A 1C1SA 3T26A 4MNWA 2XTTB 3PYHA 3BTGE 1GG6B 1CBWC 3S9CA 2ASUB 3TGJE 4FUIA 1SGDE 3SU3A 1NS3A 1A7SA 3UAIC 5DGJA 1TGTA 1V2RT 4ZHMU 5KECA 4O3UA 2Z94A 2NU4E 4MLFB 2KZ4A 1AD8H 3AK5A 3E0PB 2ZU1A 4IN2A 3ZZCA 1ARCA 2GDEH 1GDQA 3PMHB 2J95A 1KXBA 1O3AA 1DX5M 1ELTA 3EA8A 1K21H 1SR5C 3RLYH 2PGBB 4YT6H 3BSQA 1SGPE 2BD4A 3AASA 4X8SH 3ELAH 3U8TH 4LZ4B 3BG4C 2XC5A 2PFEA 2GKVE 2NU2E 2OINA 2R0LA 5CE1A 4YOIA 2O8TA 4MQAA 1E36B 1GJBB 2C3SA 1ETRH 2BB4A 2TIOA 4FOUC 2OQ5A 2C93B 1F0UA 2GTBA 3I29A 3TJNA 1O3JA 1OKXA 1TBZH 1RTKA 1LHGH 2ZECA 1ARBA 1NT1A 3ZZAA 4ZKOU 3H5CB 1L0ZA 4BAMB 1C2LA 5DP6A 4RKOB 2FI4E 3QGJA 3RC6A 4XBCA 2YNBA 3NPSA 2PHBA 4ZCNA 1BRBE 1QTFA 1WTGH 3GYMA 4K1EA 3IITA 1DUAA 1V2LT 3ZV9A 1UK2A 1ZRBA 1S6HA 3A8BA 1CHGA 1K1MA 1AFEH 3ESTA 4WF8A 1F0RA 2BLWA 1PFXC 1TA2A 2YOLA 1O5BB 2BQWB 1TFXA 3D23A 4ZKNU 1FN8A 3ZZ6A 1F7ZA 4YXWD 1F0SA 4BAOB 1O2GH 1P2IA 1ZTJA 3NZIA 4U30A 1YPKH 1H8ED 3P17H 5TCCA 3ZZ9A 4AFUA 1TB6H 4I31A 1SGNE 1MKWK 4NIYA 1BMNH 3KQEA 1C9PA 5FBEA 2OCVB 5C17A 2V7QD 1BMAA 3IG6B 1ZOMA 3PV5A 3R3GB 2A1DB 2PTCE 4AN7A 2A4OA 4BANB 1XUGA 5FPYA 1TWXB 3N7OA 1ETSH 1GMHF 2KAIA 2F9UA 1L4ZA 4ABDA 1N8OC 3GYLB 3K65B 1SGCA 1B5GH 4MNVA 1EPTB 3KIDU 4Y6DA 3P8FA 2QXJA 1H9LB 1KY9A 2YNAA 4I8HA 3F0OA 1E34B 8LPRA 2EQNA 2Z9LA 1NU9A 1OHHD 2GX4A 1A0JA 3LOXA 2ZKSA 2A32A 2KFWA 3KQDA 3MU4A 4FUBA 1TPSA 2ZHDA 4OS4A 3UQVA 5F03A 1W0ZU 1UMAH 4DW2U 1TIOA 1H4WA 2GCTC 3NCLA 2PW8H 1V2MT 1GI2A 3W94A 1TRMA 1BTYA 3N7EA 4MVNA 2ZPSA 3VGCC 4ZKSU 4XDEA 4IBLH 3MU5A 4J1YA 1WQVH 2ZTXA 5A8XA 3Q76A 1RJXB 2P93A 1EZXC 4IGDA 3PRBA 1MKXH 2BQ6B 3M3VA 1IQGA 1HJAC 3OX7U 3Q3KA 2ZG0H 3MO6A 1LKBA 3ATLA 1WTHD 2H5DA 4OS7A 3MNXA 2FI3E 3DT0H 3BTEE 4FUDA 3SU5A
chains in the Genus database with same CATH topology
1MD7A 2HGTH 1A2CH 2ZPQA 4OGXA 2B7DH 1HJ9A 3PO1B 1ELAA 4GUXA 3RXPA 5L2ZH 2EA3A 4FU8A 2BXUH 4JMYA 4R8TB 2JETC 4Q2KA 3GCNA 2ZGHA 1C1MA 3VXFH 2FEQH 3TITA 3ZVBA 1C1RA 5AVDA 1WUNH 1MTUA 7GCHF 2Q6DA 1AN1E 4K3JA 3ZYEA 1P03A 3PMBB 1CA8B 4O03A 3TIUA 4WXVA 2C8WB 5F8ZA 1C5XB 3BV9B 1O38A 1OXGA 3RMNH 3Q00A 1KSNA 3A88A 2WUBA 1YC0A 1C5NH 4D7FA 2BLOA 5F8XA 2AIQA 4BTUB 1P06A 1SGQE 3HGNA 3ZZ4A 4WMFA 1GI6A 5LGOA 1BITA 1H9HE 3M7QA 1AWHB 1UTJA 4UFFH 1EX3A 1S84A 2AFQB 1ANDA 2A4QA 1KTSB 2VWMA 4FXGH 5AFYH 2GZ9A 1IQHA 4DJZB 2JH6D 3FAOA 5JBBS 5C20A 1TNHA 2XBWA 1P01A 1SGFG 2OQUA 3RMLH 4DVAU 1MU6B 3SJ8A 1ETTH 1C2DA 2TRMA 2VJ1A 1GGDC 1PPCE 3MO9A 2VH0A 1IQEA 2A45B 1FZZA 2SNWA 1MCVA 2D2DA 3LGVA 5LH8A 1T8OA 1HRTH 3B9FH 1ANEA 2GZ7A 1QURH 2OXSA 2R2WU 2ZDLA 3RXQA 2GT7A 3TH2H 2V35A 1FQ3A 4ASHA 2J94A 1VJAU 3ZZ8A 4JZ1A 4F4OC 2G81E 4Q7ZA 1K28D 3KGPA 5K0HA 2O9QA 2ZU3A 5J4SA 2GVFA 1C5OH 4WJG2 3SNCA 1UTLM 3UWJH 2F3CE 2OC1A 3RXEA 5EPYA 2XC4A 2PUQH 1GI0A 1CU1A 2BVRH 4ISNA 2ZC9H 1UK4A 2Y80A 4ZHLU 1NU7B 1KXEA 3QX5H 2F91A 2F9PA 1BBRE 1QNJA 2OLGA 3ZVGA 1KLTA 3F1SB 4AOQA 1AKSA 3P8OA 2ANMH 2VVCA 2FLBH 3QUMP 3SGBE 3SZNA 1W13U 1BRCE 4YT7H 1V2TT 3VB5A 4TPYA 2A2XH 1ZSLA 3ZZDA 2QA9E 5C5OA 1CA0C 2BMGB 1ABJH 5E0HA 1TALA 4AG1A 2O8MA 1RD3B 2F9NA 3DFLA 1GBLA 3QLPH 1C2GA 2AGGX 1Z6JH 1PPEE 1O2OA 1W7XH 2WYJA 3TH4H 1O32A 5EW2H 1FXYA 1BRUP 3GICB 4ESTE 2UWPA 3MU8A 4KGAA 2R2MB 2J92A 1HAHH 1O3PB 4ZUHA 2ANKH 2XC0A 3QWCH 4LXBH 5T6GA 1QJ7B 1D9IA 1UTQA 1NRRH 4NGAH 1E0FD 4H4FA 1SGFA 3NKKA 1CHOF 1O2NA 2G5VA 4QT8C 1O3DA 1EUFA 3KQCA 1O2PA 2Z9IA 3A7YA 4NSYA 3A7XA 1G32B 3RUOA 1TNIA 3KEEA 1GBJA 1JWTA 1Q31A 3SV7A 4Y76A 4LOYH 4SGBE 1TRNA 3M5OA 6ESTA 1GHWH 1O3KA 1V2NT 2FOMB 1W3CA 2AEIH 1VGCB 4WH6A 1DT2A 1O30A 2O8LA 5DP5A 3RXAA 2B9LA 3P92A 1UHBA 1TBRH 1ZYOA 1GHZA 2BY9X 5AHGH 1J17T 1NRPH 1HCGA 2QXGA 1O5AB 1WOFA 4FUHA 1A5HA 2R3YA 1BIOA 3GY6A 4X6OA 4XFQA 1F5KU 1LHDH 2Q6GA 1O2KA 2HRVA 3I78A 2VWOA 2XCNA 4Z0KA 1L2EA 1QB6A 1ESTA 2FM2A 2FTMA 2WYGA 1H9IE 3R0FA 4ISOA 3UQOA 4FUJA 5E0JA 1LHFH 3MNCA 4FU7A 1SOTA 4TWYA 1NFYA 2QYIA 5TJXA 1TGNA 1DLEA 2OUAA 4O97A 2VNTA 2Y5GA 3A8AA 3EA9A 5AFZH 3VEQB 3RXIA 3AAVA 1F5RA 4F49A 1CT4E 2ODYB 1S0RA 1L4DA 3UTUH 2P8OC 3SJOA 3U8RH 1KTTB 3T25A 1QL8A 1O2VA 3M5LA 5FPSA 4CH8B 1BCUH 1RFNA 5HM2A 4AYVB 2J4IA 2TGPZ 1ELEE 1FPHH 4ABGA 1HAXB 4B73A 1P05A 1CSOE 1V2OT 1BTHH 4X8UH 1NRQH 9LPRA 2FLRH 3TGIE 1YF4A 2BOKA 3PLPA 4UONA 3JZ2B 1D6WA 1HB0B 3GOVB 1P2KA 4CR5A 2OP9A 3FP6E 3UREA 2OTVA 2UUFB 2G51A 3A89A 5L30H 1AU8A 2ALVA 1O2XA 2XBVA 2QXIA 3FP7E 2QXHA 3NK8A 1O5DH 1Z1JA 3LGUA 3RMOH 3UNSA 2H6MA 1KXDA 1G3CA 1C5RA 1MU8B 4K5ZA 3TK6A 4B71A 1QRXA 1IHTH 1HIAB 1XUFA 4YTAA 1O3GA 4AB8A 2PKAA 2FX6A 1DWEH 1NRSH 2HLCA 2UUKB 1QGFA 4A5TS 3V13A 3BIUH 4MNXA 2ZDNA 4D8NA 1NPMA 1OYTH 3BTME 3LH1A 2A5IA 3A7ZA 4WVPE 1F92A 1GBHA 1P57B 1GMDF 1TMTH 1HV7A 1Q2WA 2JH5D 1EJMA 1UTNA 2A4GA 1E38B 1IOEA 1FDPA 1YP9A 2EEKA 3BEIB 1ZHRA 1LHEH 1PPBH 1G2MA 1THPB 3SU6A 4GHTA 3SV6A 4CBOA 1C4U2 3V3MA 1F0TA 6GCHG 2ZPRA 3QDZB 1FAKH 1P9SA 2QF3A 3ZVFA 4O9VA 4DGJA 4INLA 7KMEH 2P59A 1K2I1 4X2XA 1O2LA 4JZIA 3UOUA 1ESAA 1A46H 1YPJH 1XKAC 1AZZA 1C1VH 4E7RG 2HWLB 2O8WA 4JCNA 1OP0A 1O2SA 4CRDA 1YPEH 3FP8E 2HPQH 3DFJA 2XWAA 2STAE 1QL9A 3K6YA 2FYQA 2V0BA 2BHGA 4UD9H 1O3CA 1RIWC 1JIRA 1BTUA 3BTTE 5F6MA 3TNTA 1C2EA 1V2UT 2W7UA 2BD2A 4D7GA 1LVMA 3RXHA 2VVVA 1IQIA 3FFGA 3ZZ7A 1TMBH 3GCHB 1O5EH 1GG6C 4IC6A 4HZHA 4A1VA 1MMJN 4I8JA 1C2IA 4ABBA 1S6FA 3TNSA 5DJ7A 3MU0A 1AQ7A 2FI5E 2ZU4A 2P95A 1G9IE 1O37A 5JPMH 1ELBA 3SUFA 2A5KA 1TRYA 1YBWA 5BRRE 5ABWA 4YESB 4CHAB 1C5MD 3LGTA 4OS1A 4XSKU 1HLTH 3E0NB 3U8OH 3ZVAA 1GHVH 2Z9KA 2Z9GA 2BY5X 5B6OA 1YGCH 1GVLA 2BM2A 3SNDA 2IJOB 5ETXA 5L6NH 1BBRH 1DICA 1IQFA 5GWZA 1MAXA 1G36A 5EQSA 3STIA 3RXRA 1TX8A 3HK3B 3ZZ5A 3V0XA 1ELCA 1K1PA 1EB2A 2VGCB 4TYDA 2PV9B 3KCGH 3QZRA 3KN2A 3RC4A 1FY5A 1V2JT 2A7CA 2VIDA 7LPRA 1ZJDA 2PSYA 3K9XB 1MTNB 2D1JA 2GP9B 3E6PH 4KKDA 1EAUA 1BDAA 1P2NA 3BG4B 1RRKA 2TBSA 3SV8A 1C2JA 1WYKA 1SGTA 4CRCA 1BJUA 1VR1H 9ESTA 1Y8TA 1OYQA 2Y82A 1J15A 1Z8RA 2FP7B 2C8ZB 4TPIZ 1LQDB 3LJOA 1GBTA 4GSOA 3MWIU 2AERH 3H7TA 2Z6BD 1GJAB 1LVOA 3BTHE 1HUTH 1QA7A 1HXFH 1FMGA 3E1XB 4NIWA 2Q1JA 3RXVA 1HAZB 5DP4A 5EODA 2W7SA 3MTYA 1FAXA 4K1TA 3PTBA 1MD8A 5C67A 1MBQA 1A5GH 3SNBA 3EQ0H 4E7NA 3O8CA 2D8WA 1N6YA 2CHAB 1GVKB 3SN8A 1QB9A 1AVXA 2BD9A 1G37A 3M3TA 5EOKA 4ABIA 2A31A 1UVPA 1GJ8B 1VZQH 3GY3A 1GMCF 1SPJA 4YLQH 2CN0H 1DOJA 1BMLA 4INKA 3RLWH 1EPTC 4IMQA 3EDXB 4Q80A 1S83A 1GMDG 3MH4A 2QC2A 1NROH 1C1NA 4ZXXH 2XBYA 1T7CA 2ZP0H 1GI1A 4DIHH 1MCTA 1NFUA 1C5TA 3KNXA 5GCHF 4CRGA 2WPJS 4IMZA 5A0BA 2P3TB 2WPHS 1GJ9B 1LVYA 2CV3A 5EXMA 4FUFA 3S7KB 4ZAEA 4XBBA 3RXTA 3SORA 1O5FH 3D62A 1IQLA 2ZIQH 1GL1A 1W7GH 2BDGA 5JB8S 4UFDH 4WMEA 2BDAA 2VB0A 1BTXA 2ZDAH 2ZGBH 2XW9A 1PQ5A 2P3UB 1AI8H 1T4VH 4X0WU 5PTPA 2BX3A 4FUCA 2H2ZA 1G30B 3I77A 1AFQC 1QHRB 3U69H 1TOCB 4AFZA 1DWDH 1O2WA 3GDVA 1B7XB 2Y6TA 2H9TH 4OS5A 1RTLA 1YLCA 3SJIA 4LZ1H 3BTQE 1ZSJA 1UCYK 4X1RU 3RU4T 3FZZA 2QV1A 1O2MA 3E8LA 3TVJB 1OP2A 1S0QA 2Y5HA 3A7VA 1AY6H 1C1UH 1KDQB 1IHSH 3CS0A 3MH7A 4ABAA 1P8VC 3OY5U 2R3UA 1TABE 3RXKA 2WUCA 1UTKA 2BLVA 2GMTB 1EP6A 5TCAA 5FCRA 4X1SU 5BPEA 1ABIH 1C2FA 2JETB 4NSVA 1YCPH 1D6RA 1UVTH 1QIXB 1BQYA 2GV7A 4K1SA 1FIZA 2P16A 1LCYA 1W2KH 1DDJA 4E06H 2Y5FA 1C5WB 2H9EH 3RXGA 2FTLE 3ATWA 2A7HA 3D65E 3NUMA 4YLUA 4B2BA 3A7WA 4VGCB 2FZZA 2QIQA 5JBTA 4AB9A 1P3EA 3MYWA 4MNYA 3F9FA 3URCA 2VINA 2ZQ2A 1S85A 3GCOA 3VFEA 2HNTC 2ZU2A 4A7IB 3F6UH 1W14U 1IQKA 3ITIA 4NG9H 5EW1H 1GHXH 1P3CA 4CR9A 2VVUA 1ZTLA 1EJAA 3EGKH 2B5TB 1LKAA 2NU0E 3DD2H 2F83A 3SGAE 2NWNA 1YPHC 2ZU5A 1NY22 1CGJE 3F9HA 4OGYA 3ZVCA 1FJSA 4I33A 1S82A 1ELVA 5EQQA 2XNIA 1W8BH 1Y3UA 4AFSA 2BXTH 2GDDA 3LC5A 8GCHG 2M5TA 3TJUA 1DFPA 1GDUA 2FESH 3GY2A 2ZHEH 2HVXA 1UO6A 1MQ6A 2SGPE 4NA8A 2XCFA 3SW2B 3GDSA 1T8NA 1VCPA 4DURA 2OC8A 3QTOH 2AGEX 2VWLA 4Y7AA 5FHTA 1L1GA 4AYYB 1P2JA 3ZVDA 1EZUC 3O8BA 5SGAE 5JB9S 1G2LA 1A5IA 4ZROA 2ODPA 4X6NA 1A3EH 1TNLA 3MI4A 2ZCKP 1FIWA 2RA3A 2ZF0H 2WV4A 6GCHF 1TX6A 1UJ1A 1QRWA 2PKSB 3SNEA 3UUZA 1A61H 4BNRA 1J16A 2D26C 3T2NA 3OU0A 1ELDE 2BDCA 1TOMH 2BD3A 2FO9A 2Z3CA 2V3HH 1YKTA 2G52A 1ZJKA 3TK5A 1GMCG 2QN5T 1TX7A 3VXEH 1KXCA 3ATKA 3STJA 1O36A 2ZCLP 1AE5A 3RXMA 2C8XB 2G4UA 5C2ZA 5IDKA 5HMAA 4Z6AH 1FNIA 1S5SA 1GCTB 1AB9C 1O39A 2C8YB 2F9BH 2H9HA 1QL7A 2FPZA 4Q7YA 1RXPA 1EXFA 1V3XA 1ZMJA 2SGQE 4SGAE 1J9CH 1GBMA 3ENSB 3TPIZ 1UVOA 2ZFSA 1SQAA 5GCHG 2A4RA 2IN2A 5F8TA 1IAUA 1XUJA 4IN1A 4ABFA 1GBCA 1ELFA 1O3LA 4KTCA 1GHBG 1GL0E 6CHAB 3CP7A 2CF9H 4IS5A 4ISHH 6LPRA 7ESTE 1C1OA 2AMQA 1GCDA 1QRZA 4OS6A 5FX5A 3RM2H 4NCYA 1HBTH 3Q3XA 3ZZBA 2WV5A 1HDTH 1LHCH 3MH6A 4DT7B 4TWWA 2V3OH 3RXCA 3C27B 1O35A 1PPGE 1OX1A 1VGCC 2UUJB 1CVWH 5G4BA 2EI8A 3M5MA 2ZHQH 1O2RA 1EAXA 5HM9A 1OWHA 4YOGA 1GVZA 3T29A 5EXNA 4Q7XA 2G5NA 3ZZ3A 1SSXA 2ZFTA 2G00A 1SLXB 2BDYA 5A0CA 1MKWH 4CRFA 1P10A 3BTKE 2KAIB 3PMJA 1C1TA 3MU1A 1LO6A 4U32A 5I46H 1HFDA 2EI6A 1QJ6B 3UNQA 3BEUA 1ORFA 1GBFA 5LPFA 2G55A 3OYPA 3GY7A 2TGTA 2F9OA 4E05H 1AE8H 3MNBA 2ZFRH 2ZGJA 1XKBC 1ESBA 5FX6A 1P09A 4JK5A 1FI8A 2FWWA 3V7TA 3A85A 4JYVH 5I25A 1BTPA 3PROA 1CGIE 1ID5H 2CGAA 4X1QU 1OWIA 1RGQA 2QGRA 5C1UA 2ZGXH 4AG2A 3KF2A 4H42U 2XWBI 4NFEA 5C1YA 1KYNA 1TMUH 3RXJA 8ESTE 1DUEA 2Y7ZA 4I7YH 4M7GA 3L3TA 1EQ9A 1TQ7B 1O3OA 5C3NA 1QBVH 1PPHE 1Q3XA 4MDSA 4RN6A 3VB7A 2Z3EA 3KQBA 1VCWA 3ATIA 3VB3A 1EPTA 1DWCH 1C5ZB 2AMDA 3MNSA 3NWUA 1ZTKA 1FY4A 4KELA 1AO5A 3U98H 1THRH 2BTCE 3RU4E 1TBQH 1MAYA 4HGCA 1WBGB 2BDIA 2PTNA 2FOGA 2AH4X 1XM1A 2JH0D 1A4WH 1GBAA 4I32A 1MH0A 4X6MA 2OBQA 1K9OE 3CENA 1W10U 5E0GA 4XOJA 4UE7H 4A1XA 1HXEH 2BYAX 1FY8E 1JXPA 1TA6A 2FDAA 1BB0B 4NA9H 4BAHB 2OBOA 1SC8U 4X8TH 1C5PA 2OC7A 1OWKA 4TY6A 4MPWA 1BZXE 5GXPA 1C5LH 3EE0B 4LK4A 1O3BA 2FIRH 1M9UA 1D3TB 5A8ZA 2V6NA 1BA8B 2UUYA 3MO3A 5GJ4B 1EP5A 4J2YB 3RM0H 1ZMNA 3P70B 4ZH8A 4FVBA 1SLUB 2I6QA 2FYRA 3L33A 1U6QA 4DIIH 1T8LA 4YM9A 5E2OA 3AAUA 1H8DH 4X2VA 5DP7A 2GT8A 1O2IA <