3A8AA

Crystal structure of trypsin complexed with 4-formylbenzimidamide and aniline
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title In-Crystal Chemical Ligation for Drug Discovery
rcsb
molecule tags Hydrolase
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a8aA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a8aA02
2ZHWH 3LT3A 3ATWA 2ZGCA 1YBWA 4CRFA 1XX9A 2RA3A 4X2VA 2BD4A 1ZYOA 3G01A 2TIOA 5T3HA 3SGAE 3SNDA 1PQ5A 2TGDA 3I78A 1GBIA 2K1QA 1FPCH 3DFLA 4MVNA 2ZHEH 2QYIA 2OBOA 2CJIA 2PHBA 5DP4A 4D9RA 1WTGH 1XUJA 1SG8B 1P8VC 2GV7A 3VGCC 1HJ9A 3ZZ9A 4GCHG 1XXFA 1V2VT 1SGYE 3BG4C 2BQWB 3A89A 1HYLA 3RXKA 1D9IA 3HGNA 1SGTA 1V2KT 2EI8A 2AH4X 2EI6A 4X6MA 3KQBA 1NC6A 4GHQA 1QJ6B 3RXGA 2D1JA 1O3MA 1E35B 1JIRA 4ABJA 4XFQA 1ZJDA 1P2NA 4KKDA 4CBNA 1SGFA 4NSVA 1TABE 1AKSB 5EOKA 1HUTH 1SGFG 1C5NH 2ZQ1A 7ESTE 2HOBA 1Q31A 3S9CA 2J94A 2V0BA 1ABIH 5FPSA 2FESH 3EA8A 1Z1JA 4DW2U 2VNTA 1GI4A 1EB2A 1GBCA 2XRCA 3KCGH 3LGVA 1CT2E 2A4QA 4ABFA 2AGGX 3RXOA 5LGOA 5JB9S 1UTOA 3GDUA 1SLXB 1F5KU 2J4IA 2TGAA 1TA6A 1FAKH 3URDA 3R0FA 3T28A 1C5WB 1ELGA 5DPAA 3A85A 1C2MA 1W13U 5I46H 1S5SA 3P92A 2O8WA 1CU1A 4K60A 1N1LA 4LXBH 1BQYA 4NIVA 3FP6E 2EC9H 2W7SA 3QX5H 2Z9LA 3TJOA 1G36A 1B0FA 4ISLA 3RLWH 3LPRA 3CENA 2AGIX 5AFYH 4BAQB 2FO9A 2HLCA 1TRNA 1EOLA 2BD5A 4AORA 3MO9A 1CA0C 1C1OA 1VCQA 2Q1JA 4BXSA 1F7ZA 1IQEA 4BAKB 5F8TA 1SFQB 4D7FA 3VXFH 3O8CA 1XKAC 3RUOA 4MNVA 3LOXA 3QZRA 1N6XA 1ESTA 2G4UA 2WYJA 2RCEA 4ISIH 4K5ZA 3RLYH 1K1MA 2D26C 1NU9A 2RA0A 4SGBE 2FP7B 5TCAA 1YPEH 2IPHA 4ZHMU 2C8YB 3SGBE 1O2JA 1ANEA 4JK5A 2ZQ2A 2GD4B 1EJAA 4FVDA 4B75A 1VZQH 1QB1A 2BD9A 2R0LA 3MHWU 4BTTB 3SW2B 1AKSA 3U8OH 4B76A 1QL9A 5GPIB 5ESTE 2FODA 3PROA 1SGDE 2KAIB 2ZC9H 4NZQA 1RIWB 1NFXA 5L6NH 1MD7A 2BD3A 3T29A 2ZU1A 1O3EA 4Q7ZA 2WPIS 3LGWA 1O3IA 3UR9A 1O34A 1GL1A 2RDLA 1O32A 1EOJA 5C1XA 3SJIA 2J34A 2OQ5A 1MTSA 2SNWA 2Y5HA 4R0IA 1BTXA 2SGPE 3LKWA 1IQMA 2ZDMA 1XKBC 3GOVB 4Y79A 2FZZA 1EAWA 1SMFE 5FBIA 1MU6B 1ZMLA 4UFFH 1VITG 1PPHE 3RXLA 3TU7H 9LPRA 1FN8A 1DS2E 2GV6A 1MCTA 3P8GA 4D7GA 1DE7H 1C4V2 1BT7A 1YCPK 2D8WA 1JMOH 3BSQA 1NS3A 2GDEH 1C1QA 2AYWA 2O8MA 1P2QA 2BDBA 2BDIA 3OTJE 3RP2A 1H9LB 3UY9A 1INCA 2BLQA 4TPYA 2BY6X 1M9UA 2BX3A 1K21H 5G4BA 3KQDA 1WQSA 1MTNB 1KXDA 3MU0A 4K2YA 1GHAG 5EGMA 4YESB 1D3QB 5JBBS 2XWBI 1WSSH 3JZ2B 1RIWC 2FLBH 1Y3YA 4WF8A 1G30B 3PM3A 3HGPA 2HGTH 2A32A 1OWDA 1CGHA 2TPIZ 3LDXH 1KTSB 2AEIH 2NU2E 1FLEE 2DUCA 5C20A 2OC1A 2VWOA 1H9HE 2UUYA 1TOCB 2Y6TA 2KAIA 1MZAA 3ZVEA 1NROH 1ELBA 2TGPZ 1OWHA 4Q80A 4KP0A 4QT8C 4B2CA 2BOHB 4INLA 5GDSH 5LPRA 4ISOA 1WU1A 1LPKB 4X1RU 1O3AA 2A5IA 4Y0ZE 1Q3XA 3EE0B 1K1PA 1SB1H 2ZFQH 1IHTH 3NWUA 1Y8TA 3PMAB 1GI2A 1LQEA 1O2IA 1PQ8A 3TGKE 1SPJA 1QA0A 1DXWA 1N6YA 2Z3DA 2ULLA 5CHAB 1GBLA 4XBCA 1IQFA 1GBDA 4NCYA 2XC5A 3B23B 1YPGH 1GJ4H 1PPEE 1UTJA 3B8JA 3SGQE 5C5NA 3PMJA 1MKXK 3I77A 4VGCB 3U1IB 1C4U2 2G4TA 2AIPA 3BN9A 1Z1IA 1LPZB 2I6QA 2OBQA 2V35A 2NU4E 1LHCH 3FVFB 3K2UA 2SGEE 4GVUA 2SNVA 4ASHA 3VB3A 1C5RA 1BTHH 1UTLM 4AFZA 1H8IH 3VEQB 2GCTB 4UFGH 1O35A 1QJ7B 4X2XA 1O3PB 4AB9A 1GDNA 2BXTH 1O5EH 1ETSH 3QGNB 3IWMA 2FOMB 2ZHFH 3P8OA 2FOAA 3RXTA 1GBTA 1BIOA 4UEHH 1VCWA 2GP9B 1LO6A 1TQ0B 3A8DA 3PO1C 3TJVA 1W10U 4A7IB 1THSH 2PTNA 1MBQA 1FPHH 1DDJA 3ZVFA 1MTWA 3S7HB 1DXPA 5DG6A 1MQ5A 5EXMA 3ZV8A 2H2ZA 2Z3EA 3V12A 2G5VA 5IDKA 5CHAC 4B71A 1IQJA 4E05H 1LPGB 1V2QT 2FX6A 4H6TA 1SQAA 1AFEH 1MKWH 1K2I1 1UTPA 2NU0E 1BMLA 2VIPA 1BJVA 1ZZZA 2ZU3A 6GCHF 4TY6A 2ANYA 2WPHS 1YYY1 1W7XH 1C2KA 1GI3A 1O2HA 1ELTA 1QQ4A 4YLQH 1C5VA 1BRUP 1NTPA 3EGKH 3A88A 4X2YA 1T7CA 1L1JA 1C5MD 2GCTC 3UOPA 5C3NA 1AU8A 1C5TA 1A3BH 3LONA 1K22H 1TALA 1SOZA 3DFJA 3MTYA 4FUDA 3S0NA 2G00A 2WPLS 2FS8A 4I8HA 2PGBB 1TAWA 5GXPA 1CHGA 2P59A 4Y0YE 4M7GA 2R2WU 1AWFH 1NN6A 3KQEA 3AAVA 3RXRA 1ZJKA 4ZAEA 1MBMA 2VWLA 4Q7XA 1B5GH 3AASA 3BTDE 2XBXA 1GMHF 1ZTJA 2A7HA 2OC7A 4AG1A 2VINA 2F3CE 1WOFA 1EASA 1OP0A 2P93A 1AE8H 3EYDA 1SFIA 4HFPB 3NCLA 3RXVA 4WMEA 1L1GA 2QXGA 3FZZA 1W0ZU 1BDAA 2GCHG 2XYAA 3NUMA 4Q2KA 2ASUB 3ENSB 5HM2A 1JRTA 2F9VA 3PLPA 5A0BA 4WXIA 5E8EH 2QCYA 3LH3A 1DX5M 1FDPA 2CHAB 1O2ZA 3FAOA 5EW1H 5F6MA 2AMQA 1YLDA 2HNTE 2IJOB 1SGIB 4OS5A 1EP5A 1XUKA 1KDQA 1B0EA 3TH3H 4IMZA 1PYTC 3MH4A 1PYTD 1Z6JH 3MNSA 1TGBA 2A45B 2PKSB 5DO4H 3UWIA 1SQTA 1O3OA 1ZSJA 1GI9B 1C5SA 3U98H 2BVSH 2Q6GA 5FCKA 4IN2A 1EB1H 3MNBA 1BTYA 4ZXYH 4KTUA 4U01A 1EAUA 5FAHA 3WY8A 1QL8A 3SJKA 3MFJA 3TH2H 1O3NA 1T4UH 3LJJA 3A8BA 1HAHH 5I25A 1C2EA 4Z6AH 1D3DB 3TK9A 4YOIA 5EXNA 1GGDB 2B5TB 1GBEA 1GVLA 1C2LA 1A0LA 4FVBA 1UTKA 1H9IE 3ZZ8A 2F9NA 1SC8U 3F9FA 2ZPSA 3GCTG 3LGTA 8KME2 1JWTA 1OYQA 3M5LA 1A3EH 3NZIA 2FOHA 2STAE 4IMQA 4CHAC 2OP9A 3BTQE 5GWZA 4X6OA 2Y5GA 4TWWA 2XTTB 1YPMH 2FI3E 1YC0A 4CRBA 3D65E 1TB6H 1EZXC 3ATKA 1FY3A 1J9CH 2PKSC 4I8GA 4I8KA 3SU5A 4IN1A 1AQ7A 2HNTC 1G3CA 1IQNA 3L33A 2VWNA 1LMWB 2EI7A 3SBKA 3A83A 1DY8A 1L4ZA 1O3FA 5ESBA 2BYAX 1GI6A 1O2NA 1VGCB 1GBHA 3DD2H 3SV2H 1LHDH 2F9BH 1NZQH 1V2UT 3D62A 1TMTH 3EQ0H 1RS0A 2GGVB 4MG3A 2TBSA 2WPMS 1OWIA 1UVOA 1GGDC 2OLGA 2ANWA 1LVYA 4I8LA 4O9VA 4O03A 1J8AA 1V2ST 1QRZA 4XBDA 1OP8A 1G9IE 5A8ZA 1P2MA 4MQAA 2BDCA 2ZFPH 3UR6A 1DITH 2FOBA 3A86A 1ZLRA 3M35A 2BM2A 1ABJH 1GJ5H 5JDUB 5DP9A 2ZZUH 4ZROA 4OS2A 4CRDA 1HAVB 2Z9JA 1W14U 1NRPH 2OINA 1DPOA 3T26A 3TLOA 1ZRKA 3S9AA 1HJ8A 2BTCE 1IQLA 3BF6H 2Z9GA 1TMBH 1DVAH 1ANCA 3GY5A 2FEQH 1TFXA 1DLEA 2OC8A 1UCYH 1VGCC 2VB0A 2R9PA 1ZTKA 2WINI 1YKTA 3TPIZ 3MI4A 3HKJB 1NT1A 1P2JA 4J1YA 2ZFTA 1S83A 1P09A 1MQ6A 3SJ8A 5DP7A 2YOLA 2HALA 2A0QB 1KXAA 2BB4A 1P3CA 3RMMH 1GVKB 4LOYH 1KLTA 2FDAA 1Z8GA 3I29A 1P01A 1YPLH 4WXVA 1DWDH 1BZXE 1JOUB 3PLKA 3SNCA 5CE1A 1FXYA 1P2KA 5BRRE 2AMPA 2C8ZB 1CT0E 1CA0B 3LC3A 4XSKU 2BZ6H 1AD8H 1G2MA 2OXSA 2CF8H 1P04A 1KIGH 1ZRBA 3DUXH 1EZQA 1O3LA 1DSUA 4X8TH 5JPMH 1TGSZ 4H42U 1ESAA 4HZHA 1DT2A 3H5CB 2ZEBA 1TQ7B 1JRSA 4RKOB 3E3TA 5GCHF 2BY7X 1BUIA 3TITA 4JCNA 1K28D 1ANDA 1NRRH 1O0DH 5DP8A 1C9PA 2ZTYA 5LPFA 2A7CA 4LK4A 1C2GA 1LDTT 5AFZH 3MNXA 1AN1E 4WJG2 2V3HH 1TPSA 2ALPA 3KNXA 7GCHF 2W3IA 1C2HA 1FZZA 4OGXA 1EZUC 1UTMA 1PQAA 2H9HA 3RC5A 4BANB 2HRVA 1SSXA 2PWXA 2ZCLP 4X8VH 1KSNA 1O37A 4NFFA 1TGNA 5FCRA 1E36B 1AE5A 1SGEE 1UTNA 2I6SA 2A2XH 2GVFA 5BPEA 3BEUA 1IQHA 3RXJA 1T8MA 1HB0B 1ZPCA 1V2LT 1AY6H 4OGYA 2JKHA 4BAOB 1ELCA 5HM9A 1LKBA 1DICA 3RU4E 4NZLA 1ID5H 6ESTA 1BBRK 1ZHRA 1H8DH 4MNYA 3MMGA 2NU1E 1XVOA 3TIUA 3HKIB 1ESBA 4K1TA 3O8BA 4ISHH 3RC6A 1PPBH 3RXPA 4BOHA 1THRH 1AWHB 1GMCF 1TX6A 2F9OA 4DJZB 2CF9H 1OKXA 3U69H 1OPHB 4NA8A 3H7TA 2H9EH 4U32A 3BTFE 1UO6A 2PGQB 5T6FA 2J9NA 3BTHE 4IGDA 1FY5A 3GCHC 2GKVE 1CHOF 5FPTA 1T8NA 3SQHE 4GPGA 3BIUH 1BTUA 1AI8H 1KYNA 3VPKA 4KTCA 1JBUH 1TPAE 1QB9A 5F8XA 3ZVBA 1GDQA 2PUQH 3H7OA 2GT7A 2HVXA 2XBWA 4R8TB 3QWCH 4BTIB 1OSSA 3KHVA 1F0TA 3ZV9A 4DGJA 1CGJE 3BEIB 4YT6H 1OOKB 2FM2A 1O31A 3RXDA 2BQ6B 3P17H 4AX9H 2ALVA 3GY4A 3LJOA 2QXIA 1OWJA 1YM0A 1TBZH 1PJPA 1S6FA 1TE0A 4TPIZ 3PMHB 1KY9A 2VU8E 1W0YH 3QO6A 5DP5A 1CO7E 1BBRE 2BX4A 3MO6A 1SLVB 1FNIA 2ZGBH 1TX8A 5A0AE 3SQEE 2ZU5A 1MAYA 5EPYA 5A2MH 1GI0A 3DT0H 3ZZ7A 1MKWK 2SGQE 1YPHE 3TVJB 1BOQA 1V2RT 2ODPA 3SU3A 5GJ4B 3RU4D 2A4RA 1AHTH 3EDXB 3ZYEA 4ABGA 1P02A 1OXGA 1HBTH 1L4DA 2J38A 2ZGJA 4OS6A 1A46H 8LPRA 4CR5A 2Y5FA 2VVCA 4YOGA 1DSTA 1TNJA 1O3DA 1SI5H 1VR1H 1HXFH 1VJAU 4K3JA 2ZA5A 1SGQE 3TK6A 4E7RG 1QFKH 1T31A 1FN6A 2FMJA 3K9XB 4I8JA 2PTCE 3Q3XA 1RJXB 1V3XA 4AFQA 4GSOA 3M7UA 2QF3A 1W12U 1TNHA 2W5EA 3PYHA 5T6GA 3BEFB 4GUXA 1ARBA 1VITF 1S0QA 1TNGA 1C5QA 1BMNH 1KXFA 1GMDF 2BY5X 2B9LA 4TY7A 4AGJA 4BXWA 2R3UA 1Z8RA 2XBVA 1W2KH 4X8UH 5HMAA 1ZPZA 1FY4A 1LKAA 4CR9A 2LPRA 7KMEH 1V2JT 2B7DH 2FX4A 4U2WA 1S6HA 2QN5T 3SUDA 1PPFE 3KEEA 1ELVA 1QTFA 1F5LA 3PO1B 1GHBF 1NFUA 2A1DB 2UUJB 1DOJA 4YTAA 1FUJA 1P2IA 2Y80A 1AFQB 2ZFSA 1TONA 4F4OC 1F5RA 5H4IB 1GBBA 4NG9H 1O2LA 5C1UA 3TNSA 1SLWB 2BLVA 2AS9A 1C9TA 3UNSA 3AVZA 3T25A 1UMAH 5TJXA 2YNBA 1O3KA 2DE8A 2FOCA 1C4Y2 4UFDH 5FHTA 2FYRA 3MYWA 1WAYB 3M7QA 4JZDH 2GZ7A 2PR3A 1AUJA 4MNWA 4OS4A 1C5ZB 1O2SA 3P70B 2OTVA 3ATMA 1CA8B 5JBAS 4X1SU 1O2RA 1UVUH 1QJ1B 4I33A 5E0GA 5FPYA 3SU6A 2BY9X 2PLXA 3RXAA 1HAOH 2PV9B 1O3GA 5CMXH 1P3EA 1O2WA 2ZECA 2ZNKH 3BTTE 1TA2A 4ZH8A 4OS7A 3A7YA 1C1UH 3E6PH 1QR3E 3SZNA 1OP2A 2AMDA 2FOFA 3IITA 5EXLA 1N8OB 4FUIA 1GBAA 1EX3A 1UK3A 4JK6A 3F9GA 4X6NA 3ZZ6A 3F68H 1HGTH 3RXEA 1DLKB 1ELEE 1F0SA 1AFQC 2CV3A 4FUGA 1XUHA 3F9HA 3TK5A 1CT4E 2ZHDA 4IBLH 3A87A 4AN7A 1S84A 3RXMA 1AMHA 1GPZA 1CBWB 2ZDLA 6GCHG 3OU0A 4NSYA 4YLUA 5K0HA 1O3BA 2CXVA 3ESTA 3M37A 1K1IA 2O9QA 2WUBA 3MU8A 1YGCH 1ZGVA 1XVMA 2VIVA 1GJ8B 3SU2A 1QL7A 2H1UA 3QZQA 3U9AH 4Y10E 1YPJH 3KN2A 1O5GH 1AZZA 2ZGHA 2A2QH 1AVWA 2G51A 2O8UA 4O3TA 5C2ZA 1WUNH 1O2VA 5EPNA 3SJ9A 3BTEE 2UUFB 2C4FH 1HV7A 5E0JA 4A6LA 1K1JA 2UWLA 5HYOA 1YCPH 4NA9H 5DKMA 4MNXA 4A1TA 1N8OC 3QDZB 1HIAB 1P11E 3UIRA 5HGGA 1GMHG 1H1BA 1SOTA 2G8TA 3RMLH 1JXPA 3ELAH 3LU9B 4K8BA 2ANMH 2FOGA 4Y11E 2ZIQH 4INKA 5A8YA 1FIZA 3HK6B 1EZSC 1V2TT 5EQSA 3Q3YA 1TWXB 1A7SA 2ZP0H 1CBWC 3BIVH 4ZHAA 4UE7H 1OX1A 7LPRA 2P94A 3M5MA 1GJBB 1FY1A 2PUXB 1D6RA 1TNKA 3NXPA 1C5LH 2CN0H 3RXFA 4ABIA 3GICB 1NESE 2BLWA 2BHGA 1O5AB 1EAXA 1C5UA 5LPEA 1J17T 2Z7FE 1BRAA 4MPUA 3ODDA 1TIOA 2ZO3H 2Y7ZA 3GY8A 4CHAB 1OS8A 1OYTH 4A92A 1GI1A 3M3TA 4GAWA 3TGJE 1WTHD 1KLJH 5A09A 3ATIA 3NPSA 1LHGH 4I7YH 5C67A 2VIDA 3HATH 1C5XB 2ZF0H 5DGJA 1UCYK 4IC5A 1FAXA 1C5YB 5C1YA 2SGFE 4AB8A 1ZPBA 3A8CA 3CP7A 1DWBH 4IW4E 1Y3UA 3GDSA 5J4QA 1MH0A 5DK1A 1OWKA 1C1WH 3D23A 4O97A 2GCHF 5TCCA 3T5FH 4MPXA 3TJNA 2BXUH 1RXPA 4XBBA 4ABHA 1H4WA 4A1XA 1Y5BT 1KXBA 3D49H 1FIWA 1TGCA 3W95A 5C5OA 3P8NA 1ORFA 4NIYA 1E34B 1AIXH 3E90B 5LH8A 1SGPE 2JH5D 4IC6A 1UHBB 1C2DA 1O5FH 3A7ZA 4JZEH 3O8RA 3A81A 1Z6EA 1A61H 2BDAA 3ITIA 3P6ZB 8GCHF 3C1KA 5EQRA 2P3FH 4Z0KA 1P06A 1T32A 2TRMA 1O2OA 1QBVH 4Y76A 3PMBB 1O30A 4IS5A 1GI8B 3AW0A 1EPTB 2W26A 4AZ2B 1C1TA 4JZ1A 1Q2WA 2BD7A 1Y59T 2C93B 1WV7H 5DP6A 1A0JA 1D3TB 3FZDA 1THPB 3UNQA 2ZWLH 3KQCA 4FUEA 4ABDA 1NFYA 1UCYE 1UK4A 4YM9A 3VFEA 4RN6A 4NFEA 1QHRB 2FPZA 2QF0A 1SQOA 1AB9C 3M3VA 3KL6A 1X7AC 3SJOA 2UUKB 3SNEA 4Q7YA 4ZMAH 1UJ1A 4ZUHA 2TGTA 2Z9KA 2VWMA 1XUIA 2VJ1A 2Z6BD 3QUMP 3MU4A 3VB4A 1GCTB 2H5DA 3GCTF 2WV4A 1G37A 1E38B 1TRYA 1P9UA 2QGRA 3A7VA 1C1RA 4THNH 3SUEA 1DY9A 2GDDA 1G32B 3QTOH 1O2TA 1NO9H 1PPZA 1A2CH 1F92A 1SGRE 6LPRA 1EATA 1XM1A 3PB1E 4Y7AA 2GTBA 3RC4A 3VB7A 1HNEE 4BAHB 1FMGA 2DE9A 1ZMJA 3KGPA 4JYVH 3RDZA 1EPTC 1QCPA 4WH8A 1EJMA 2EEKA 1TNIA 2ZKSA 1BITA 2ZTXA 3LGYA 1P57B 1O2MA 4WH6A 4NWLA 3OY6U 1BHXB 2HNTF 2BLOA 1NRQH 2QIQA 1K9OE 3LC5A 4X0WU 4UD9H 3LGUA 3ZZCA 4ABBA 4BAMB 1FONA 2FS9A 1EXFA 3F6UH 1NRNH 3SV7A 2BQ7B 2F83A 3U8TH 1YP9A 1ELDE 3N7OA 1QRXA 1WCZA 1TRMA 1ANBA 4X8SH 3UWJH 1QBNA 4DURA 5B6OA 1SGCA 3BV9B 5JBTA 1LVBA 1O36A 1ZR0A 2XNIA 4ZXXH 1ACBE 2HPQH 1YLCA 3TGIE 3NKKA 2VVVA 1GCTC 2R3YA 1ZHPA 1SBWA 1J16A 1SHYA 1L0ZA 1ZSKA 2Z9IA 3VB6A 3SI3H 4E06H 1BJUA 1CVWH 1C2JA 2F9UA 4FUCA 3ZVGA 3PWBA 1EUFA 4XDEA 1TYNA 3ZZ4A 2SGDE 1HRTH 3GCNA 1EP6A 4MPWA 2Y82A 1GL0E 1A5IA 2AERH 4CRCA 2VVUA 2A5KA 2CGAA 4DG4A 2FWWA 4DIIH 3Q76A 4NIXA 3ODFA 3RXSA 3PWCA 5JB8S 1V2NT 2ZG0H 2BDGA 2VIOA 4HTCH 3STIA 4ABAA 4FUBA 2XWAA 4BTUB 1ARCA 5GCHG 2XC4A 1B7XB 2VIWA 3MO3A 1O33A 2OUAA 3QGJA 3SI4H 3OYPA 1AO5A 1MU8B 1T8OA 3SUGA 3SV8A 2D2DA 1QNJA 5F8ZA 4GCHF 2Y7XA 4FU8A 7GCHG 5FX5A 2ZI2H 2ZFRH 5E2OA 1IQGA 4XE4A 3FFGA 3LH1A 1DANH 1C1MA 3RXUA 1HAVA 1O2KA 3BG8A 1QGFA 3GCHB 4I32A 1ZTLA 4K1EA 3P95A 3GY2A 1KLIH 1VJ9U 2THFB 1A4WH 3HPTB 1O2PA 4CH2B 2WPKS 2QXHA 1QIXB 2FIRH 3EA7A 3S9BA 3QTVH 1BHXF 4WMFA 1FQ3A 1QQUA 1GHYH 2W3KA 1QRWA 3HK3B 3DA9B 2P16A 4Y8XA 5AF9H 1V2OT 4RKJB 1GBMA 9ESTA 1XUFA 4X1QU 3T2NA 2Q6DA 4WY3A 2F91A 1TMUH 1C5OH 1GHWH 1E0FD 2ANKH 3SNBA 1HXEH 1HJAB 1GMCG 3SU0A 1TBRH 3FANA 3M5NA 3ZZAA 1F0RA 1Y3VA 1A5GH 2V3OH 1Y3XA 3T62A 1TNLA 3SU4A 2A4GA 3GY3A 3QN7A 4KTSA 4GHTA 2QY0B 4B2BA 1GJ6A 3SUFA 2J2UA 3OSYA 1CHOG 3V3MA 5EG4A 2RG3A 1SL3A 3P8FA 1P10A 3GDVA 4PROA 3NK8A 1GHVH 2XC0A 2FXRA 3Q3KA 2R2MB 1DWCH 2ZCHP 2XXLA 2GT8A 2QC2A 1BRCE 1P12E 2BVXH 2ZDAH 6CHAB 1Y5AT 3UOUA 5IYTA 4ZKNU 4TWYA 3UQVA 5JBCS 2Q6FA 2W7UA 1O2UA 1BCUH 3QK1A 4JMYA 5F03A 1GJAB 3V0XA 1O2YA 2G5NA 1E37B 2LNCA 1LHEH 2P3UB 4NIWA 2FTLE 1RTFB 2P8OB 3RXCA 4BNRA 1W3CA 1HJAC 1KXEA 1TGTA 4CH8B 3U1JB 1S0RA 5AVDA 3ZZBA 2HWLB 4MLFB 3E91A 1F0UA 1HAZB 2QA9E 4Y8ZA 2FLRH 1HCGA 2VH6A 5EW2H 4TYDA 1O5BB 2VIQA 1RRKA 1GBKA 3M3SA 1DWEH 3B9FH 1NRSH 4AOQA 4AYVB 1VCPA 1D3PB 4NWKA 2G55A 1BTPA 1Z8IB 3BTWE 4ZKRU 4UONA 5GIBA 5L2YH 2HPPH 1P9SA 5E0HA 1GBJA 1VITH 3S69A 1ZGIA 4HGCA 2BDYA 3IG6B 3ATLA 1GMDG 4FUFA 4JZFH 6CHAC 1GDUA 4UDWH 5FX6A 1MCVA 1QY6A 1ETTH 4AYYB 3SHAH 2BD8A 3RXHA 3ZZ5A 3AAUA 3A7XA 1GVZA 2ZTZA 1GJ9B 3URCA 1XUGA 1HPGA 1NU7B 1PPGE 1O2QA 1G3EA 4UFEH 1KTTB 1QB6A 3RM2H 4JYUH 1T4VH 3GYMA 2P8OC 1GHBG 1U6QA 3L6PA 1SR5C 1S85A 3BTME 1P05A 2A4OA 2A31A 1GBFA 1Z71A 1C5PA 2B0FA 1C1NA 1V2PT 2OQUA 1SHHB 4CREA 1P0SH 1A5HA 4SGAE 4DT7B 3QLPH 1GHAF 1SVPA 3ZVAA 4ZKOU 4Y7BA 3ZYDA 3M5OA 1WBGB 2G81E 1GJDB 2BY8X 2ZCKP 1HAGE 2H5CA 4Y71A 3RXQA 3UUZA 4XOJA 1A0HB 1YCPM 2IN2A 3GISB 3PTNA 4WWYA 1YPHC 3E8LA 1GI7B 1NM6A 2JETB 4Y6DA 1OWEA 1LHFH 1XMNB 1ELAA 3SV9A 3DHKH 1UVSH 2BD2A 1L2EA 1V2MT 3UREA 3UFAA 1CQQA 1BBRH 1ELFA 1RFNA 1MUEB 1DUEA 1FI8A 5PTPA 1LTOA 1W11U 1MTNC 2A7JA 2ZDNA 1D4PB 1GJ7B 3PLBA 2UWOA 1O2GH 4I31A 2AFQB 1CE5A 4K1SA 4WVPE 2R0KA 3CS0A 2BZAA 1O3HA 3U8RH 2ZPQA 4A5TS 3AW1A 3A82A 2SGAA 2FI4E 1O5CB 1HAPH 2FI5E 2Y81A 1MZDA 3BTKE 3W94A 4D76A 1MTUA 1UVTH 3UPEA 3SU1A 2H6MA 2VH0A 1MD8A 5DJ7A 1K1LA 3Q77A 2PFEA 4X2WA 2OC0A 3PTBA 1WYKA 3EA9A 2AGEX 3A8AA 2JETC 2ZDKA 2XBYA 4FUJA 3GY6A 5JYIA 2M5TA 1DM4B 1O38A 2JH0D 3TH4H 1XXDA 1DUAA 1NY22 3UTUH 1K1NA 2C3SA 4NGAH 1DFPA 5T6DA 1EQ9A 1PFXC 1AZ8A 1HAXB 4HI3A 1BA8B 1J14A 3CS7A 3MU5A 3Q00A 4DIHH 1HDTH 1RGQA 1QBOA 4YT7H 3RU4T 2ZDVH 1TLDA 4VGCC 3M36A 4MTBA 1O39A 3UNRA 3E16B 2C90B 1HAYB 1HLTH 2ZFFH 1KXCA 4RSPA 3MH7A 1KDQB 2SFAA 3JZ1B 4MDSA 4E7NA 4ISNA 1GCDA 5FXLA 2WYGA 3R3GB 4B2AA 4DOQA 1Z7KA 4OS1A 4DY7B 3BTGE 4K69A 2CMYA 5HXFA 4H6SB 2G52A 3MH6A 3A7TA 1SLUB 2WPJS 4U30A 2WV5A 1IAUA 1V2WT 4X6PA 4B1TA 1S81A 1TPOA 1IQKA 3TJUA 1BMMH 1C1SA 1RD3B 2O8TA 1P03A 2Z94A 3SO3A 1MAXA 5A0CA 2OD3B 3OX7U 4DVAU 3UQOA 5EU8A 1NFWA 1EKBB 2FTMA 3RXIA 3SNAA 1UVPA 1F2SE 1WQVH 2YNAA 4NA7A 3GYLB 2OCVB 4LZ1H 1T8LA 4INHA 1GI5A 5L30H 4ESTE 3TNTA 4F49A 1JIMA 1GG6B 3V7TA 4J2YB 1C2IA 2B8OH 1BTWA 1HFDA 1BB0B 3ZZDA 1RTLA 1CSOE 3M7TA 1IQIA 4CRAA 3RM0H 2IOTA 4KGAA 3MWIU 4MPVA 3SHCH 1AB9B 3K65B 2GMTB 4JYTA 1TPPA 1Z8JB 1ZMNA 2EA3A 1C1PA 3VB5A 1MKXH 1PPCE 1P2OA 4KELA 1O3JA 1HIAA 2PSYA 4AGKA 2GZ9A 2ZU2A 1GHZA 8GCHG 2J92A 2XW9A 2A5AA 1AVXA 1W8BH 2AIQA 3A80A 1TOMH 3S7KB 1GHXH 2ODQA 4B74A 2NU3E 1V6DA 4X1PU 1YPKH 5AHGH 4CBOA 4D8NA 2JH6D 2ZU4A 1Y3WA 3LGIA 1AGJA 3PV4A 4FXGH 2WUCA 3E1XB 1EJNA 3EAJA 4AFSA 1GWAA 4X1NU 1SGNE 1FJSA 1O5DH 5DP3A 4ZKSU 1G3BA 4YOJA 1G3DA 4D9QA 1TX7A 5A8XA 2C8XB 2J95A 3K6ZA 2F9PA 1TBQH 1O2XA 3F9EA 5L2ZH 4H4FA 1D6WA 1GG6C 2NWNA 3E0NB 2ZGXH 3FP7E 4B73A 3SV6A 1BTZA 1ZHMA 2PKAB 3OY5U 1MMJN 1S82A 2ZHQH 1A1RA 1O3CA 2QV1A 2BMGB 3KF2A 2ESTE 3RXBA 2UWPA 2P3TB 3GCOA 4K8YA 2GMTC 2QAAA 3GY7A 2CHAC 1LVOA 1G2LA 1LQDB 4O3UA 1BRBE 2VGCB 1MTVA 1LCYA 1YF4A 4FU9A 4JZIA 4WMDA 1L1NA 4FU7A 5EODA 3SN8A 1FV9A 1ZSLA 2QXJA 2ZPRA 2XCNA 1CGIE 1NPMA 1LVMA 1PQ7A 1W7GH 3STJA 1EAIA 3RMNH 1ZOMA 2ODYB 3V13A 1C1VH 5ABWA 2GX4A 1IHSH 2PW8H 4ABEA 2FOEA 3E0PB 8ESTE 3FP8E 1J15A 1ETRH 4GLYA 2FYQA 3ZZ3A 3ZVCA 5FBEA 3F1SB 1C2FA 3M61U 4A1VA 4Y8YA 1FY8E 1BMAA 3O8DA 1HAIH 1AUTC 1IOEA 3C27B 5ETXA 3RMOH 1QA7A 2PSXA 2O8LA 3SOSA 1GJCB 3KIDU 3VGCB 1UHBA 4CRGA 4AG2A 1AVGH 5K7RA 5SGAE 2C8WB 1QURH 2XCFA 2ILNA 3T27A 3BG4B 4ZHLU 4LZ4B 2BDHA 3A7WA 1UK2A 4DCDA 2H9TH 3SORA 3L3TA 1EPTA 4YZUA 2STBE 2BVRH 1K1OA 3MH5A 2V6NA 3LIWA 4YO9A 2VGCC 3MU1A 4FUHA 2Z3CA 5E2PA 5EQQA 3MNCA 3VXEH 3A84A 1UTQA 1Y5UT 2P95A 2PKAA 3K6YA 3ZVDA 1RTKA 5J4SA 4AFUA 2GZ8A 3MOCA 2BOKA
chains in the Genus database with same CATH superfamily
2ZHWH 3LT3A 3ATWA 2ZGCA 1YBWA 4CRFA 1XX9A 3F0OA 2RA3A 4HG6A 4X2VA 2LP6A 2BD4A 1ZYOA 3G01A 2TIOA 5T3HA 3SGAE 3SNDA 1PQ5A 2TGDA 3I78A 1GBIA 2K1QA 1FPCH 3DFLA 4MVNA 2ZHEH 2QYIA 2OBOA 1E1RD 2CJIA 2PHBA 5DP4A 4D9RA 1WTGH 1XUJA 2JDID 1SG8B 1P8VC 2GV7A 3VGCC 3OTPA 1HJ9A 3ZZ9A 4GCHG 1XXFA 1V2VT 1SGYE 3BG4C 2BQWB 3A89A 1HYLA 3RXKA 1D9IA 3HGNA 1SGTA 1V2KT 2EI8A 2AH4X 2EI6A 4X6MA 3KQBA 1NC6A 4GHQA 1QJ6B 3RXGA 2D1JA 1O3MA 1E35B 1JIRA 4ABJA 4XFQA 1ZJDA 1P2NA 4KKDA 3AK5A 4CBNA 1SGFA 4NSVA 3OEHD 1TABE 1AKSB 5EOKA 1HUTH 1SGFG 1C5NH 2ZQ1A 7ESTE 2KZ4A 2HOBA 1Q31A 3S9CA 2J94A 2V0BA 1ABIH 5FPSA 2FESH 3EA8A 1Z1JA 2WPDD 4DW2U 2VNTA 1GI4A 1EB2A 1GBCA 2XRCA 3KCGH 3LGVA 1CT2E 2A4QA 4ABFA 2AGGX 3RXOA 5LGOA 5JB9S 1UTOA 3GDUA 1SLXB 1F5KU 2J4IA 2TGAA 1TA6A 1FAKH 3URDA 3R0FA 3T28A 1C5WB 1ELGA 5DPAA 3A85A 1C2MA 1W13U 5I46H 1S5SA 3N99A 3P92A 2O8WA 2PP6A 1CU1A 4K60A 1N1LA 4LXBH 1BQYA 4NIVA 3FP6E 4RI0A 2EC9H 2W7SA 3QX5H 2Z9LA 3TJOA 1G36A 1B0FA 4ISLA 3RLWH 3LPRA 3CENA 2AGIX 5AFYH 4BAQB 2FO9A 2HLCA 1TRNA 1EOLA 2BD5A 4AORA 3MO9A 1CA0C 1C1OA 1VCQA 2Q1JA 4BXSA 1F7ZA 1IQEA 4BAKB 5F8TA 1SFQB 4D7FA 3VXFH 3O8CA 3F0PA 1XKAC 3RUOA 4MNVA 3LOXA 3QZRA 1N6XA 1ESTA 1WDIA 2G4UA 2WYJA 2RCEA 4ISIH 4K5ZA 3RLYH 1K1MA 2D26C 1NU9A 2RA0A 4SGBE 2FP7B 5TCAA 1YPEH 2IPHA 4ZHMU 2C8YB 3SGBE 1O2JA 3ZIAD 4Z1MD 1ANEA 4JK5A 2ZQ2A 2GD4B 1EJAA 4FVDA 4B75A 1VZQH 1QB1A 2BD9A 2R0LA 3MHWU 4BTTB 3SW2B 1AKSA 3U8OH 4B76A 1QL9A 5GPIB 5ESTE 2FODA 3PROA 5C94A 1SGDE 2KAIB 2ZC9H 4NZQA 1RIWB 1NFXA 5L6NH 1MD7A 2BD3A 3T29A 2ZU1A 1O3EA 4Q7ZA 2WPIS 3LGWA 1O3IA 3UR9A 1O34A 1GL1A 2RDLA 1O32A 1EOJA 5C1XA 3SJIA 2J34A 2OQ5A 1MTSA 2SNWA 2Y5HA 4R0IA 1BTXA 2SGPE 3LKWA 1IQMA 2ZDMA 1XKBC 3GOVB 4Y79A 2FZZA 1EAWA 1SMFE 5FBIA 1MU6B 1ZMLA 4UFFH 1VITG 1PPHE 2L74A 3RXLA 2QF5A 3TU7H 9LPRA 1FN8A 1DS2E 2GV6A 1MCTA 3P8GA 4D7GA 2JJ2D 1DE7H 1C4V2 4OM9A 1BT7A 1YCPK 2D8WA 1JMOH 3BSQA 1NS3A 2GDEH 1C1QA 2AYWA 2O8MA 1P2QA 2BDBA 2BDIA 3OTJE 3RP2A 1H9LB 3UY9A 1INCA 2BLQA 4TPYA 2BY6X 1M9UA 2BX3A 1K21H 5G4BA 3KQDA 1WQSA 1MTNB 1KXDA 3MU0A 4K2YA 1GHAG 5EGMA 4YESB 1D3QB 5JBBS 2XWBI 1WSSH 3JZ2B 1RIWC 2FLBH 2KCPA 1Y3YA 4WF8A 1G30B 3PM3A 3HGPA 2HGTH 4DT4A 2A32A 1OWDA 1CGHA 2TPIZ 3LDXH 5FL7D 1KTSB 2AEIH 3WW7A 2NU2E 1FLEE 2DUCA 5C20A 2OC1A 2VWOA 1H9HE 2UUYA 1TOCB 2Y6TA 2KAIA 1MZAA 3ZVEA 1NROH 1ELBA 2TGPZ 1OWHA 4Q80A 4KP0A 4QT8C 4B2CA 2BOHB 4INLA 5GDSH 5LPRA 4ISOA 1WU1A 1LPKB 4X1RU 1O3AA 2A5IA 4Y0ZE 1Q3XA 3EE0B 1K1PA 1SB1H 2ZFQH 1IHTH 3NWUA 1Y8TA 3PMAB 1GI2A 1LQEA 1O2IA 1PQ8A 3TGKE 1SPJA 1QA0A 1DXWA 1N6YA 2Z3DA 2ULLA 5CHAB 3UB0A 1GBLA 4XBCA 1IQFA 1GBDA 4NCYA 2XC5A 3B23B 1YPGH 1GJ4H 1PPEE 1UTJA 3B8JA 3SGQE 5C5NA 3PMJA 1MKXK 3I77A 4VGCB 3U1IB 1C4U2 2G4TA 2KR7A 2AIPA 3BN9A 1Z1IA 1SKYE 1LPZB 2I6QA 2OBQA 2V35A 2NU4E 1LHCH 3FVFB 3K2UA 2SGEE 4GVUA 2SNVA 4ASHA 2YMSB 3VB3A 1C5RA 1BTHH 1UTLM 4AFZA 1H8IH 3VEQB 2GCTB 4UFGH 2HLDD 1O35A 1QJ7B 4X2XA 1O3PB 4AB9A 1GDNA 2BXTH 1O5EH 1ETSH 3QGNB 3IWMA 2FOMB 2ZHFH 3P8OA 2FOAA 3RXTA 2W6JD 1GBTA 1BIOA 4UEHH 1VCWA 2GP9B 1LO6A 1TQ0B 3A8DA 3PO1C 3TJVA 1W10U 4A7IB 1THSH 2PTNA 1MBQA 1FPHH 1DDJA 3ZVFA 1MTWA 3S7HB 1DXPA 5DG6A 1MQ5A 5EXMA 3ZV8A 2H2ZA 2Z3EA 3V12A 2G5VA 5IDKA 5CHAC 4B71A 1IQJA 4E05H 1LPGB 1V2QT 2FX6A 4H6TA 1SQAA 1AFEH 1MKWH 1K2I1 1UTPA 1BMLA 2NU0E 2VIPA 1BJVA 1ZZZA 2ZU3A 6GCHF 4TY6A 2ANYA 2WPHS 1YYY1 1W7XH 1C2KA 1GI3A 1O2HA 1ELTA 1QQ4A 1VKYA 4YLQH 1C5VA 1BRUP 1NTPA 3EGKH 3A88A 4X2YA 1T7CA 1L1JA 1C5MD 2YMSD 2GCTC 3UOPA 5C3NA 1AU8A 1C5TA 1A3BH 3LONA 1K22H 1TALA 1SOZA 3DFJA 3MTYA 4FUDA 3S0NA 2G00A 2WPLS 2FS8A 4I8HA 2PGBB 1TAWA 5GXPA 1CHGA 2P59A 4Y0YE 4M7GA 2R2WU 1AWFH 1NN6A 3KQEA 3AAVA 3RXRA 1ZJKA 2WHXA 4ZAEA 1MBMA 2VWLA 4Q7XA 1B5GH 3AASA 3BTDE 2XBXA 1GMHF 1ZTJA 2A7HA 2GJGA 2OC7A 2F43B 4AG1A 2VINA 2F3CE 1WOFA 1EASA 1OP0A 2P93A 2J5UA 1AE8H 3EYDA 1SFIA 4HFPB 3NCLA 3RXVA 4WMEA 1L1GA 2QXGA 3FZZA 1W0ZU 1BDAA 2GCHG 2XYAA 3NUMA 4Q2KA 2ASUB 3ENSB 5HM2A 1JRTA 2KX4A 2F9VA 3PLPA 5A0BA 4WXIA 5E8EH 2QCYA 3LH3A 1DX5M 1FDPA 2CHAB 1O2ZA 3FAOA 5EW1H 5F6MA 2AMQA 1YLDA 2HNTE 2IJOB 1SGIB 4OS5A 1EP5A 1XUKA 1KDQA 1B0EA 3TH3H 4IMZA 1PYTC 3MH4A 1PYTD 1Z6JH 3MNSA 1TGBA 2A45B 2PKSB 2KM0A 3UWIA 5DO4H 1SQTA 1O3OA 1ZSJA 1GI9B 1C5SA 3U98H 2BVSH 2Q6GA 5FCKA 4IN2A 1EB1H 3MNBA 1BTYA 4ZXYH 4KTUA 4U01A 1EAUA 3N7EA 5FAHA 3WY8A 1YLNA 1QL8A 3SJKA 3MFJA 4RT0A 3TH2H 3FOAA 1O3NA 1T4UH 3LJJA 3A8BA 1HAHH 2JIZD 5I25A 1C2EA 4Z6AH 1D3DB 3FO8D 3TK9A 4YOIA 5EXNA 1GGDB 2B5TB 1GBEA 1GVLA 1C2LA 1A0LA 4FVBA 1UTKA 3OE7D 1H9IE 3ZZ8A 2F9NA 1SC8U 3F9FA 2ZPSA 3GCTG 3LGTA 8KME2 1JWTA 1OYQA 3M5LA 1A3EH 3NZIA 2FOHA 2STAE 4IMQA 4CHAC 2OP9A 3BTQE 2OK5A 5GWZA 4X6OA 2Y5GA 4TWWA 2XTTB 1YPMH 2FI3E 1YC0A 2K0QA 4CRBA 3D65E 1TB6H 1EZXC 3ATKA 1FY3A 1J9CH 2PKSC 4I8GA 4I8KA 3SU5A 4IN1A 1AQ7A 2HNTC 1G3CA 1IQNA 3L33A 4P02A 2VWNA 1LMWB 2EI7A 3SBKA 3A83A 1DY8A 1L4ZA 1O3FA 5ESBA 2BYAX 1GI6A 1O2NA 1VGCB 1GBHA 3DD2H 3SV2H 1LHDH 2F9BH 1NZQH 1V2UT 3D62A 1TMTH 3EQ0H 1RS0A 2GGVB 4MG3A 2TBSA 2WPMS 1OWIA 1UVOA 1GGDC 2OLGA 2ANWA 1LVYA 4I8LA 5C0UA 2WSSD 4O9VA 4O03A 1J8AA 1V2ST 1QRZA 4XBDA 1OP8A 1OHHD 1G9IE 2F4LA 5A8ZA 1P2MA 4MQAA 3N7DA 2BDCA 2ZFPH 3UR6A 1DITH 2FOBA 3A86A 1ZLRA 3M35A 2BM2A 1ABJH 1GJ5H 5JDUB 5DP9A 3PRBA 2ZZUH 4ZROA 4OS2A 4CRDA 1HAVB 2Z9JA 1W14U 1NRPH 2OINA 1DPOA 3T26A 3TLOA 1ZRKA 3S9AA 1HJ8A 2BTCE 1IQLA 3BF6H 2Z9GA 1TMBH 2M2AA 1DVAH 1ANCA 3GY5A 2FEQH 1TFXA 1DLEA 2OC8A 1UCYH 1VGCC 2VB0A 2R9PA 1ZTKA 2WINI 1YKTA 3TPIZ 3MI4A 1W0KD 3HKJB 1NT1A 1P2JA 3DSPA 4J1YA 2ZFTA 1S83A 1P09A 1MQ6A 3SJ8A 5DP7A 2YOLA 2HALA 5EIYA 2A0QB 1KXAA 2BB4A 1P3CA 3RMMH 1GVKB 4LOYH 1KLTA 2FDAA 1Z8GA 3I29A 1P01A 1YPLH 2VBCA 4WXVA 1DWDH 1BZXE 1JOUB 3PLKA 3SNCA 5CE1A 1FXYA 1P2KA 5BRRE 2AMPA 5CDFE 2C8ZB 1CT0E 5HIYA 1CA0B 3LC3A 4XSKU 2BZ6H 1AD8H 1G2MA 2OXSA 2CF8H 1P04A 1KIGH 1ZRBA 3DUXH 4M9FA 1EZQA 1O3LA 1DSUA 4X8TH 3U28C 5JPMH 1TGSZ 2KCYA 4H42U 1ESAA 4HZHA 1DT2A 3H5CB 2ZEBA 1TQ7B 1JRSA 4RKOB 1FX0B 3E3TA 5GCHF 2BY7X 1BUIA 3TITA 4JCNA 1K28D 1ANDA 1NRRH 1O0DH 5DP8A 1C9PA 2ZTYA 5LPFA 2A7CA 4LK4A 1C2GA 1LDTT 5AFZH 3MNXA 1AN1E 4WJG2 2V3HH 1TPSA 2ALPA 3KNXA 7GCHF 2W3IA 1C2HA 1FZZA 4OGXA 1EZUC 1UTMA 1PQAA 2H9HA 3RC5A 4BANB 4XD7D 2HRVA 1SSXA 2PWXA 1UW7A 2ZCLP 4X8VH 1KSNA 1O37A 4NFFA 1TGNA 5FCRA 1E36B 1AE5A 1SGEE 1UTNA 2I6SA 2A2XH 2GVFA 5BPEA 3BEUA 1IQHA 3RXJA 1T8MA 1HB0B 1ZPCA 1V2LT 1AY6H 4OGYA 2IPQX 2JKHA 4BAOB 1ELCA 5HM9A 1LKBA 1DICA 3RU4E 4NZLA 1ID5H 6ESTA 1BBRK 3PV2A 1ZHRA 2RFKC 1H8DH 4MNYA 3MMGA 2NU1E 1XVOA 3TIUA 3HKIB 1ESBA 4K1TA 3O8BA 4ISHH 3RC6A 1PPBH 3RXPA 4BOHA 1THRH 1AWHB 1GMCF 1TX6A 2F9OA 4DJZB 2CF9H 1OKXA 3U69H 1OPHB 4NA8A 3H7TA 2H9EH 4U32A 3BTFE 1UO6A 2PGQB 5T6FA 2J9NA 2L6OA 3BTHE 4IGDA 3SZEA 1FY5A 3GCHC 2GKVE 1CHOF 5FPTA 1T8NA 3SQHE 4GPGA 3BIUH 1BTUA 1AI8H 1KYNA 3VPKA 4KTCA 1JBUH 1TPAE 1QB9A 2J97A 5F8XA 3ZVBA 1GDQA 2PUQH 3H7OA 2GT7A 2HVXA 2XBWA 4R8TB 3QWCH 4BTIB 1OSSA 3KHVA 1F0TA 3ZV9A 4DGJA 1CGJE 3BEIB 4YT6H 1OOKB 2FM2A 4Q63A 1O31A 3RXDA 2BQ6B 3P17H 4AX9H 2ALVA 3GY4A 3LJOA 2QXIA 1OWJA 3H09A 1YM0A 4RT1A 1TBZH 1PJPA 1W0JD 1S6FA 1TE0A 4TPIZ 3PMHB 1KY9A 2VU8E 1W0YH 3QO6A 5DP5A 1CO7E 4TT3D 1BBRE 2BX4A 3MO6A 2XOKD 1SLVB 1FNIA 2ZGBH 1TX8A 5A0AE 3SQEE 2ZU5A 1MAYA 5EPYA 5A2MH 1GI0A 3DT0H 3ZZ7A 1MKWK 2SGQE 1YPHE 3TVJB 1BOQA 1V2RT 2ODPA 3SU3A 5GJ4B 3EE7A 3RU4D 3MQKC 2A4RA 1AHTH 3EDXB 3ZYEA 4ABGA 1P02A 1OXGA 1HBTH 1L4DA 2J38A 2ZGJA 4OS6A 1A46H 8LPRA 4CR5A 2Y5FA 5B6LA 2VVCA 4YOGA 1DSTA 3DSGA 1TNJA 1O3DA 1SI5H 1VR1H 2KCAA 2XNDD 1HXFH 1VJAU 4K3JA 2ZA5A 1SGQE 3TK6A 4E7RG 1QFKH 1T31A 1FN6A 2FMJA 3K9XB 4I8JA 2PTCE 3Q3XA 1RJXB 1V3XA 4AFQA 4GSOA 3M7UA 2QF3A 1W12U 1TNHA 2W5EA 3PYHA 5T6GA 3BEFB 4GUXA 1ARBA 1VITF 1S0QA 1TNGA 1C5QA 1BMNH 1KXFA 1GMDF 2BY5X 2B9LA 4TY7A 4AGJA 4BXWA 2R3UA 2KFWA 1Z8RA 2XBVA 1W2KH 4X8UH 5HMAA 1ZPZA 1FY4A 1LKAA 4CR9A 2LPRA 4P00A 7KMEH 3OFND 1V2JT 2B7DH 2FX4A 4U2WA 1S6HA 2QN5T 3SUDA 1PPFE 5EJ1A 3KEEA 1ELVA 1QTFA 1F5LA 3PO1B 1GHBF 1NFUA 2A1DB 2UUJB 1DOJA 4YTAA 1FUJA 1P2IA 2Y80A 1AFQB 2ZFSA 1TONA 4F4OC 1F5RA 5H4IB 1GBBA 4NG9H 1O2LA 5C1UA 3TNSA 1SLWB 2BLVA 2AS9A 1C9TA 3UNSA 3AVZA 3T25A 1UMAH 5TJXA 2YNBA 1O3KA 2DE8A 2FOCA 1WXRA 1C4Y2 4UFDH 5FHTA 2FYRA 3MYWA 1WAYB 3M7QA 4JZDH 2GZ7A 1BMFD 2PR3A 1AUJA 4MNWA 4OS4A 1C5ZB 1O2SA 3P70B 2OTVA 3ATMA 1CA8B 5JBAS 2V3MA 4X1SU 1O2RA 1UVUH 1QJ1B 4I33A 5E0GA 5FPYA 3SU6A 2BY9X 2PLXA 3RXAA 1HAOH 2PV9B 1O3GA 4TSFD 5CMXH 1P3EA 1O2WA 2ZECA 2ZNKH 3BTTE 1TA2A 4ZH8A 4OS7A 3A7YA 1C1UH 3SYJA 3E6PH 1QR3E 3SZNA 1OP2A 2AMDA 2FOFA 3IITA 5EXLA 1N8OB 4FUIA 1GBAA 1EX3A 1UK3A 4JK6A 3F9GA 4X6NA 3ZZ6A 3F68H 1HGTH 3RXEA 1DLKB 1ELEE 1F0SA 5KGOA 1AFQC 2CV3A 4FUGA 1XUHA 3F9HA 3TK5A 1CT4E 2ZHDA 4IBLH 3A87A 4AN7A 1S84A 3RXMA 1AMHA 1GPZA 1CBWB 2ZDLA 6GCHG 2QF4A 3OU0A 4NSYA 4YLUA 5K0HA 1O3BA 2CXVA 3ESTA 3M37A 1K1IA 2O9QA 4AC9A 2WUBA 3MU8A 1YGCH 1ZGVA 1XVMA 2VIVA 1GJ8B 3SU2A 5DN6D 1QL7A 2H1UA 3QZQA 3U9AH 4Y10E 1YPJH 3KN2A 4ACBA 1O5GH 1AZZA 2ZGHA 2A2QH 1AVWA 2G51A 2O8UA 4O3TA 4B6FA 5C2ZA 5C17A 1WUNH 1O2VA 5EPNA 3SJ9A 3BTEE 2J98B 2UUFB 2C4FH 1HV7A 5E0JA 4A6LA 1K1JA 2UWLA 5HYOA 1YCPH 4NA9H 5DKMA 4MNXA 4A1TA 1N8OC 3QDZB 1HIAB 4FETA 1P11E 3UIRA 5HGGA 1GMHG 1H1BA 1SOTA 2G8TA 3RMLH 1JXPA 3ELAH 3LU9B 4K8BA 2ANMH 2FOGA 4B6EA 4Y11E 2ZIQH 4INKA 5A8YA 1FIZA 3HK6B 1EZSC 5KEDA 1V2TT 5EQSA 3Q3YA 1TWXB 1A7SA 2ZP0H 1CBWC 3BIVH 4ZHAA 4UE7H 1OX1A 7LPRA 2P94A 3M5MA 1GJBB 1FY1A 2PUXB 1D6RA 1TNKA 3NXPA 1C5LH 2CN0H 3RXFA 4ABIA 3GICB 1NESE 2BLWA 2BHGA 1O5AB 1EAXA 1C5UA 5LPEA 1J17T 2Z7FE 1BRAA 4MPUA 3ODDA 1TIOA 2ZO3H 2Y7ZA 3GY8A 4CHAB 1OS8A 1OYTH 4A92A 5EJLA 1GI1A 2KCOA 3M3TA 4GAWA 3TGJE 1WTHD 1KLJH 5A09A 3ATIA 3NPSA 4I86A 1LHGH 4I7YH 5C67A 2VIDA 3HATH 1C5XB 2ZF0H 5DGJA 1UCYK 4IC5A 1FAXA 1C5YB 5C1YA 2SGFE 4AB8A 1ZPBA 3A8CA 3CP7A 1DWBH 4IW4E 1Y3UA 3GDSA 4Q4LA 5J4QA 1MH0A 5DK1A 1OWKA 1C1WH 3D23A 4O97A 2GCHF 5TCCA 3PV5A 3T5FH 4MPXA 5T1VA 3TJNA 2BXUH 1RXPA 4XBBA 4ABHA 1H4WA 4A1XA 1Y5BT 1KXBA 3D49H 2IJD1 1FIWA 1TGCA 3W95A 5C5OA 3P8NA 1ORFA 4NIYA 1E34B 1AIXH 3E90B 5LH8A 1SGPE 2JH5D 4IC6A 1UHBB 1C2DA 1O5FH 3A7ZA 4JZEH 3O8RA 3A81A 1Z6EA 1A61H 2BDAA 3ITIA 3P6ZB 8GCHF 3C1KA 5EQRA 2P3FH 4Z0KA 1P06A 1T32A 2TRMA 1O2OA 3F2GA 1QBVH 4Y76A 3PMBB 1O30A 4IS5A 1GI8B 3AW0A 1EPTB 2W26A 4AZ2B 1C1TA 4JZ1A 1Q2WA 2BD7A 1Y59T 2C93B 1WV7H 5DP6A 1A0JA 1D3TB 3FZDA 1THPB 3UNQA 2ZWLH 5C0TA 1YY3A 3KQCA 4FUEA 4ABDA 1NFYA 1UCYE 4ZCNA 1UK4A 4YM9A 3VFEA 4RN6A 4NFEA 1QHRB 3OAAD 2FPZA 2QF0A 1SQOA 1AB9C 3M3VA 3KL6A 1X7AC 2AHME 3SJOA 2UUKB 3SNEA 4Q7YA 4ZMAH 1UJ1A 4ZUHA 1K0HA 2TGTA 2Z9KA 2VWMA 1XUIA 2VJ1A 2Z6BD 3QUMP 3MU4A 3VB4A 1GCTB 2H5DA 3GCTF 2W6ID 2WV4A 1G37A 1E38B 1TRYA 1P9UA 2QGRA 3A7VA 1C1RA 3WWFA 4THNH 3SUEA 1DY9A 2GDDA 1G32B 3W1EA 3QTOH 1O2TA 1NO9H 1PPZA 1A2CH 1F92A 1SGRE 6LPRA 1EATA 1XM1A 3PB1E 4Y7AA 2GTBA 3RC4A 3VB7A 1HNEE 4BAHB 1FMGA 2DE9A 1ZMJA 3KGPA 4JYVH 3RDZA 1EPTC 1QCPA 4WH8A 1EJMA 2EEKA 1TNIA 2ZKSA 1BITA 2ZTXA 3LGYA 1P57B 1O2MA 4WH6A 4NWLA 3OY6U 1BHXB 2HNTF 2BLOA 1NRQH 2QIQA 1K9OE 3LC5A 4X0WU 4UD9H 3LGUA 3ZZCA 4ABBA 4BAMB 1FONA 2FS9A 1EXFA 3F6UH 1NRNH 3SV7A 2BQ7B 2F83A 3U8TH 1YP9A 1ELDE 1KMHB 3N7OA 2JJ1D 1QRXA 1WCZA 1TRMA 1ANBA 4X8SH 3UWJH 1QBNA 4DURA 5B6OA 1SGCA 3BV9B 5JBTA 1LVBA 1O36A 1ZR0A 2XNIA 4ZXXH 1ACBE 1SQRA 2HPQH 1YLCA 3TGIE 3NKKA 2VVVA 1GCTC 2R3YA 1ZHPA 1SBWA 1J16A 1SHYA 1L0ZA 1ZSKA 2Z9IA 3VB6A 3SI3H 4E06H 3GS9A 1BJUA 1CVWH 5GNDA 1C2JA 2F9UA 4FUCA 3ZVGA 5EJZA 3PWBA 1EUFA 4XDEA 1TYNA 3ZZ4A 2SGDE 1HRTH 3GCNA 1EP6A 4MPWA 2Y82A 1GL0E 1A5IA 2AERH 4CRCA 2VVUA 2A5KA 2CGAA 4DG4A 2FWWA 4DIIH 3Q76A 4NIXA 3ODFA 3VG8A 3RXSA 3PWCA 5JB8S 1V2NT 2ZG0H 2BDGA 2VIOA 4HTCH 3STIA 4ABAA 4FUBA 2XWAA 4BTUB 1ARCA 5GCHG 2XC4A 1B7XB 2VIWA 3MO3A 1O33A 2OUAA 3QGJA 3SI4H 3OYPA 1AO5A 1MU8B 1T8OA 3SUGA 3SV8A 2D2DA 1QNJA 5F8ZA 4GCHF 2Y7XA 4FU8A 7GCHG 5FX5A 2ZI2H 2ZFRH 5E2OA 1IQGA 4XE4A 3FFGA 3LH1A 1DANH 1C1MA 3RXUA 1HAVA 1O2KA 3BG8A 1QGFA 3GCHB 4I32A 3CNRA 1ZTLA 4K1EA 3P95A 3GY2A 1KLIH 1VJ9U 2THFB 1A4WH 3HPTB 1O2PA 4CH2B 2WPKS 2QXHA 1QIXB 2FIRH 3EA7A 3S9BA 3QTVH 1BHXF 4WMFA 1FQ3A 1QQUA 1GHYH 2W3KA 1QRWA 3HK3B 3DA9B 2P16A 4Y8XA 5AF9H 1V2OT 4RKJB 1GBMA 9ESTA 1XUFA 4X1QU 3T2NA 1H8ED 2Q6DA 4WY3A 2F91A 1TMUH 1C5OH 1GHWH 1E0FD 2ANKH 3SNBA 1HXEH 1HJAB 1GMCG 3SU0A 2QE7D 1TBRH 3FANA 3M5NA 3ZZAA 1F0RA 1Y3VA 1A5GH 2V3OH 1Y3XA 3T62A 1TNLA 3SU4A 2A4GA 3GY3A 3QN7A 4KTSA 4GHTA 2QY0B 4B2BA 1GJ6A 3SUFA 2J2UA 3OSYA 1CHOG 3V3MA 5EG4A 2RG3A 1E79D 1SL3A 3P8FA 1P10A 3GDVA 4PROA 3NK8A 1GHVH 2XC0A 2FXRA 3Q3KA 2R2MB 1DWCH 3FN8A 2ZCHP 2XXLA 2GT8A 2QC2A 1BRCE 1P12E 2BVXH 2ZDAH 6CHAB 1Y5AT 3UOUA 5IYTA 4ZKNU 4TWYA 3UQVA 5JBCS 2Q6FA 2W7UA 1O2UA 1BCUH 3QK1A 4JMYA 5F03A 1GJAB 3V0XA 1O2YA 3WWBA 2G5NA 1E37B 2LNCA 1LHEH 2P3UB 4NIWA 2FTLE 5KECA 1RTFB 2P8OB 3RXCA 4BNRA 1W3CA 1HJAC 1KXEA 1TGTA 4CH8B 3U1JB 2HVYB 1S0RA 5AVDA 3ZZBA 2HWLB 4MLFB 3E91A 1F0UA 1HAZB 2QA9E 4Y8ZA 2FLRH 1HCGA 2VH6A 5EW2H 4TYDA 1O5BB 2VIQA 1RRKA 1GBKA 3M3SA 1DWEH 3B9FH 1NRSH 4AOQA 4AYVB 1VCPA 1D3PB 4NWKA 2G55A 1BTPA 1Z8IB 3BTWE 4ZKRU 4UONA 5GIBA 3OEED 5L2YH 2HPPH 1P9SA 3F2FA 5E0HA 1GBJA 1VITH 3PRDA 3S69A 1ZGIA 4HGCA 2BDYA 3IG6B 3ATLA 1GMDG 4FUFA 4JZFH 6CHAC 1GDUA 4UDWH 5FX6A 1MCVA 1QY6A 1ETTH 4AYYB 3SHAH 2BD8A 3RXHA 3ZZ5A 3AAUA 3A7XA 1GVZA 1NBME 2ZTZA 1GJ9B 3URCA 1XUGA 1HPGA 1NU7B 1PPGE 1O2QA 1G3EA 4UFEH 1KTTB 1QB6A 3RM2H 4JYUH 1T4VH 3GYMA 2P8OC 1GHBG 3KYGA 1U6QA 3L6PA 1SR5C 1S85A 3BTME 1P05A 2A4OA 2A31A 1GBFA 1Z71A 1C5PA 2B0FA 1C1NA 1V2PT 2OQUA 1SHHB 4CREA 1P0SH 1A5HA 4SGAE 4DT7B 3QLPH 1GHAF 1SVPA 3ZVAA 4ZKOU 4Y7BA 3ZYDA 3M5OA 1WBGB 2G81E 1GJDB 2BY8X 2ZCKP 1HAGE 2H5CA 4Y71A 2CK3D 3RXQA 3UUZA 4XOJA 1A0HB 1E1QD 1YCPM 2IN2A 3GISB 3PTNA 4WWYA 1YPHC 3E8LA 1GI7B 1NM6A 2JETB 3DSOA 1OWEA 4Y6DA 1LHFH 1XMNB 1ELAA 3SV9A 3DHKH 1UVSH 2BD2A 1L2EA 1V2MT 3UREA 3UFAA 1CQQA 1BBRH 1ELFA 4F48B 1RFNA 3UAIC 1MUEB 1DUEA 1FI8A 5PTPA 1LTOA 1W11U 1MTNC 2A7JA 2ZDNA 1D4PB 1GJ7B 3PLBA 2UWOA 1O2GH 1NBMD 4I31A 2AFQB 1CE5A 4K1SA 4WVPE 2R0KA 3CS0A 2BZAA 4XRNA 1O3HA 3U8RH 2ZPQA 4A5TS 3AW1A 3A82A 2SGAA 2FI4E 1O5CB 1HAPH 2FI5E 2Y81A 1MZDA 3BTKE 3W94A 4D76A 1MTUA 1UVTH 3UPEA 3SU1A 2H6MA 2VH0A 1MD8A 5DJ7A 1K1LA 3Q77A 2PFEA 4X2WA 2OC0A 3PTBA 1WYKA 3EA9A 2AGEX 3A8AA 2JETC 2ZDKA 2XBYA 4FUJA 3GY6A 5JYIA 1O38A 1DM4B 2JH0D 2M5TA 3TH4H 1XXDA 1DUAA 1NY22 3UTUH 5F53A 1K1NA 2C3SA 3KQ5A 4NGAH 1DFPA 5T6DA 1EQ9A 1PFXC 1AZ8A 1HAXB 4HI3A 1BA8B 1J14A 3CS7A 3MU5A 3Q00A 4DIHH 1HDTH 1RGQA 1QBOA 4YT7H 3RU4T 2ZDVH 1TLDA 4VGCC 3M36A 4MTBA 1O39A 3UNRA 3E16B 2C90B 1HAYB 1HLTH 2ZFFH 1KXCA 4RSPA 2LELA 3MH7A 1KDQB 2EQNA 2SFAA 3JZ1B 4MDSA 4E7NA 4ISNA 1GCDA 5FXLA 2WYGA 3R3GB 2YMSC 4B2AA 4DOQA 1Z7KA 4OS1A 4DY7B 3BTGE 4K69A 2CMYA 5HXFA 4H6SB 2G52A 3MH6A 3A7TA 1SLUB 2WPJS 4U30A 2WV5A 1IAUA 1V2WT 4X6PA 4B1TA 1S81A 1TPOA 1IQKA 1COWD 3TJUA 1BMMH 1C1SA 1RD3B 2O8TA 1P03A 2Z94A 3SO3A 4YXWD 1MAXA 5A0CA 2OD3B 3OX7U 5HKKD 4DVAU 3UQOA 5EU8A 3NRLA 1NFWA 1EKBB 2FTMA 3RXIA 3SNAA 1UVPA 1F2SE 1WQVH 2YNAA 5DSFA 4NA7A 5HIZA 3GYLB 2OCVB 4LZ1H 2V7QD 1T8LA 4INHA 1GI5A 5L30H 4ESTE 3TNTA 4F49A 3FKSD 1JIMA 1GG6B 3V7TA 4J2YB 1C2IA 2B8OH 1BTWA 1HFDA 1BB0B 3ZZDA 1RTLA 1S6LA 1CSOE 3M7TA 2J98A 1IQIA 4CRAA 3RM0H 2IOTA 4KGAA 3MWIU 4MPVA 3SHCH 1AB9B 3K65B 2GMTB 4JYTA 1TPPA 1Z8JB 1ZMNA 2EA3A 1C1PA 3VB5A 1MKXH 1PPCE 1P2OA 4KELA 1O3JA 1HIAA 2PSYA 4AGKA 2GZ9A 2ZU2A 1GHZA 8GCHG 2J92A 2XW9A 2A5AA 1AVXA 1W8BH 2AIQA 3A80A 1TOMH 3S7KB 1GHXH 2ODQA 4B74A 2NU3E 1V6DA 4X1PU 1YPKH 5AHGH 4CBOA 4D8NA 2JH6D 2ZU4A 1Y3WA 3LGIA 2RDEA 1AGJA 3PV4A 4FXGH 2WUCA 3E1XB 1EJNA 3EAJA 1QZ8A 4AFSA 1GWAA 4X1NU 1SGNE 1FJSA 1O5DH 5DP3A 4ZKSU 1G3BA 4YOJA 1H8HD 1G3DA 4D9QA 1TX7A 5A8XA 2C8XB 2J95A 3K6ZA 2F9PA 1TBQH 1O2XA 3F9EA 4ACAA 5L2ZH 4H4FA 4FOUC 1D6WA 1GG6C 2NWNA 3E0NB 2ZGXH 3FP7E 5IK2D 4B73A 3SV6A 1BTZA 1ZHMA 2PKAB 3F3BA 3OY5U 1MMJN 1S82A 2ZHQH 2EY4C 1A1RA 1O3CA 2QV1A 2BMGB 3KF2A 2ESTE 3RXBA 1MABB 2UWPA 2P3TB 3GCOA 4K8YA 2GMTC 2QAAA 3GY7A 2CHAC 1LVOA 1G2LA 1LQDB 4O3UA 1BRBE 2VGCB 1MTVA 1LCYA 1YF4A 4F55A 4FU9A 1YWUA 4JZIA 4WMDA 1L1NA 4FU7A 5EODA 3SN8A 1FV9A 3KYFA 1ZSLA 2QXJA 2ZPRA 2WV9A 2XCNA 1CGIE 1NPMA 1LVMA 1PQ7A 1W7GH 3STJA 1EAIA 3RMNH 1ZOMA 2ODYB 3V13A 1C1VH 5ABWA 2GX4A 1IHSH 2PW8H 4ABEA 2FOEA 3E0PB 8ESTE 3FP8E 1J15A 1ETRH 2WZQA 3F2HA 2K8IA 4GLYA 2FYQA 3ZZ3A 3ZVCA 5FBEA 3F1SB 1C2FA 3M61U 4A1VA 4Y8YA 1FY8E 1BMAA 3O8DA 1HAIH 1AUTC 1IOEA 3C27B 5ETXA 3RMOH 1QA7A 2PSXA 2O8LA 3SOSA 1GJCB 3KIDU 3VGCB 1UHBA 4CRGA 4AG2A 1AVGH 5K7RA 5SGAE 2C8WB 1QURH 2XCFA 2ILNA 3T27A 3BG4B 4ZHLU 4LZ4B 2BDHA 3A7WA 3DCLA 1UK2A 4DCDA 2H9TH 3SORA 3L3TA 1EPTA 4YZUA 2STBE 2BVRH 1K1OA 1EFRD 3MH5A 4ASUD 2V6NA 3LIWA 4YO9A 2VGCC 3MU1A 4FUHA 2Z3CA 5E2PA 5EQQA 3MNCA 3VXEH 3A84A 1UTQA 1Y5UT 2P95A 2PKAA 3K6YA 3ZVDA 1RTKA 5J4SA 4AFUA 5CHBA 2GZ8A 3MOCA 2BOKA
chains in the Genus database with same CATH topology
2ZHWH 3LT3A 3ATWA 2ZGCA 1YBWA 4CRFA 1XX9A 2RA3A 4X2VA 2BD4A 1ZYOA 3G01A 2TIOA 5T3HA 3SGAE 3SNDA 1PQ5A 2TGDA 3I78A 1GBIA 2K1QA 1FPCH 3DFLA 4MVNA 2ZHEH 2QYIA 2OBOA 2CJIA 2PHBA 5DP4A 4D9RA 1WTGH 1XUJA 1SG8B 1P8VC 2GV7A 3VGCC 1HJ9A 3ZZ9A 4GCHG 1XXFA 1V2VT 1SGYE 3BG4C 2BQWB 3A89A 1HYLA 3RXKA 1D9IA 3HGNA 1SGTA 1V2KT 2EI8A 2AH4X 2EI6A 4X6MA 3KQBA 1NC6A 4GHQA 1QJ6B 3RXGA 2D1JA 1O3MA 1E35B 1JIRA 4ABJA 4XFQA 1ZJDA 1P2NA 4KKDA 4CBNA 1SGFA 4NSVA 1TABE 1AKSB 5EOKA 1HUTH 1SGFG 1C5NH 2ZQ1A 7ESTE 2HOBA 1Q31A 3S9CA 2J94A 2V0BA 1ABIH 5FPSA 2FESH 3EA8A 1Z1JA 4DW2U 2VNTA 1GI4A 1EB2A 1GBCA 2XRCA 3KCGH 3LGVA 1CT2E 2A4QA 4ABFA 2AGGX 3RXOA 5LGOA 5JB9S 1UTOA 3GDUA 1SLXB 1F5KU 2J4IA 2TGAA 1TA6A 1FAKH 3URDA 3R0FA 3T28A 1C5WB 1ELGA 5DPAA 3A85A 1C2MA 1W13U 5I46H 1S5SA 3P92A 2O8WA 1CU1A 4K60A 1N1LA 4LXBH 1BQYA 4NIVA 3FP6E 2EC9H 2W7SA 3QX5H 2Z9LA 3TJOA 1G36A 1B0FA 4ISLA 3RLWH 3LPRA 3CENA 2AGIX 5AFYH 4BAQB 2FO9A 2HLCA 1TRNA 1EOLA 2BD5A 4AORA 3MO9A 1CA0C 1C1OA 1VCQA 2Q1JA 4BXSA 1F7ZA 1IQEA 4BAKB 5F8TA 1SFQB 4D7FA 3VXFH 3O8CA 1XKAC 3RUOA 4MNVA 3LOXA 3QZRA 1N6XA 1ESTA 2G4UA 2WYJA 2RCEA 4ISIH 4K5ZA 3RLYH 1K1MA 2D26C 1NU9A 2RA0A 4SGBE 2FP7B 5TCAA 1YPEH 2IPHA 4ZHMU 2C8YB 3SGBE 1O2JA 1ANEA 4JK5A 2ZQ2A 2GD4B 1EJAA 4FVDA 4B75A 1VZQH 1QB1A 2BD9A 2R0LA 3MHWU 4BTTB 3SW2B 1AKSA 3U8OH 4B76A 1QL9A 5GPIB 5ESTE 2FODA 3PROA 1SGDE 2KAIB 2ZC9H 4NZQA 1RIWB 1NFXA 5L6NH 1MD7A 2BD3A 3T29A 2ZU1A 1O3EA 4Q7ZA 2WPIS 3LGWA 1O3IA 3UR9A 1O34A 1GL1A 2RDLA 1O32A 1EOJA 5C1XA 3SJIA 2J34A 2OQ5A 1MTSA 2SNWA 2Y5HA 4R0IA 1BTXA 2SGPE 3LKWA 1IQMA 2ZDMA 1XKBC 3GOVB 4Y79A 2FZZA 1EAWA 1SMFE 5FBIA 1MU6B 1ZMLA 4UFFH 1VITG 1PPHE 3RXLA 3TU7H 9LPRA 1FN8A 1DS2E 2GV6A 1MCTA 3P8GA 4D7GA 1DE7H 1C4V2 1BT7A 1YCPK 2D8WA 1JMOH 3BSQA 1NS3A 2GDEH 1C1QA 2AYWA 2O8MA 1P2QA 2BDBA 2BDIA 3OTJE 3RP2A 1H9LB 3UY9A 1INCA 2BLQA 4TPYA 2BY6X 1M9UA 2BX3A 1K21H 5G4BA 3KQDA 1WQSA 1MTNB 1KXDA 3MU0A 4K2YA 1GHAG 5EGMA 4YESB 1D3QB 5JBBS 2XWBI 1WSSH 3JZ2B 1RIWC 2FLBH 1Y3YA 4WF8A 1G30B 3PM3A 3HGPA 2HGTH 2A32A 1OWDA 1CGHA 2TPIZ 3LDXH 1KTSB 2AEIH 2NU2E 1FLEE 2DUCA 5C20A 2OC1A 2VWOA 1H9HE 2UUYA 1TOCB 2Y6TA 2KAIA 1MZAA 3ZVEA 1NROH 1ELBA 2TGPZ 1OWHA 4Q80A 4KP0A 4QT8C 4B2CA 2BOHB 4INLA 5GDSH 5LPRA 4ISOA 1WU1A 1LPKB 4X1RU 1O3AA 2A5IA 4Y0ZE 1Q3XA 3EE0B 1K1PA 1SB1H 2ZFQH 1IHTH 3NWUA 1Y8TA 3PMAB 1GI2A 1LQEA 1O2IA 1PQ8A 3TGKE 1SPJA 1QA0A 1DXWA 1N6YA 2Z3DA 2ULLA 5CHAB 1GBLA 4XBCA 1IQFA 1GBDA 4NCYA 2XC5A 3B23B 1YPGH 1GJ4H 1PPEE 1UTJA 3B8JA 3SGQE 5C5NA 3PMJA 1MKXK 3I77A 4VGCB 3U1IB 1C4U2 2G4TA 2AIPA 3BN9A 1Z1IA 1LPZB 2I6QA 2OBQA 2V35A 2NU4E 1LHCH 3FVFB 3K2UA 2SGEE 4GVUA 2SNVA 4ASHA 3VB3A 1C5RA 1BTHH 1UTLM 4AFZA 1H8IH 3VEQB 2GCTB 4UFGH 1O35A 1QJ7B 4X2XA 1O3PB 4AB9A 1GDNA 2BXTH 1O5EH 1ETSH 3QGNB 3IWMA 2FOMB 2ZHFH 3P8OA 2FOAA 3RXTA 1GBTA 1BIOA 4UEHH 1VCWA 2GP9B 1LO6A 1TQ0B 3A8DA 3PO1C 3TJVA 1W10U 4A7IB 1THSH 2PTNA 1MBQA 1FPHH 1DDJA 3ZVFA 1MTWA 3S7HB 1DXPA 5DG6A 1MQ5A 5EXMA 3ZV8A 2H2ZA 2Z3EA 3V12A 2G5VA 5IDKA 5CHAC 4B71A 1IQJA 4E05H 1LPGB 1V2QT 2FX6A 4H6TA 1SQAA 1AFEH 1MKWH 1K2I1 1UTPA 2NU0E 1BMLA 2VIPA 1BJVA 1ZZZA 2ZU3A 6GCHF 4TY6A 2ANYA 2WPHS 1YYY1 1W7XH 1C2KA 1GI3A 1O2HA 1ELTA 1QQ4A 4YLQH 1C5VA 1BRUP 1NTPA 3EGKH 3A88A 4X2YA 1T7CA 1L1JA 1C5MD 2GCTC 3UOPA 5C3NA 1AU8A 1C5TA 1A3BH 3LONA 1K22H 1TALA 1SOZA 3DFJA 3MTYA 4FUDA 3S0NA 2G00A 2WPLS 2FS8A 4I8HA 2PGBB 1TAWA 5GXPA 1CHGA 2P59A 4Y0YE 4M7GA 2R2WU 1AWFH 1NN6A 3KQEA 3AAVA 3RXRA 1ZJKA 4ZAEA 1MBMA 2VWLA 4Q7XA 1B5GH 3AASA 3BTDE 2XBXA 1GMHF 1ZTJA 2A7HA 2OC7A 4AG1A 2VINA 2F3CE 1WOFA 1EASA 1OP0A 2P93A 1AE8H 3EYDA 1SFIA 4HFPB 3NCLA 3RXVA 4WMEA 1L1GA 2QXGA 3FZZA 1W0ZU 1BDAA 2GCHG 2XYAA 3NUMA 4Q2KA 2ASUB 3ENSB 5HM2A 1JRTA 2F9VA 3PLPA 5A0BA 4WXIA 5E8EH 2QCYA 3LH3A 1DX5M 1FDPA 2CHAB 1O2ZA 3FAOA 5EW1H 5F6MA 2AMQA 1YLDA 2HNTE 2IJOB 1SGIB 4OS5A 1EP5A 1XUKA 1KDQA 1B0EA 3TH3H 4IMZA 1PYTC 3MH4A 1PYTD 1Z6JH 3MNSA 1TGBA 2A45B 2PKSB 5DO4H 3UWIA 1SQTA 1O3OA 1ZSJA 1GI9B 1C5SA 3U98H 2BVSH 2Q6GA 5FCKA 4IN2A 1EB1H 3MNBA 1BTYA 4ZXYH 4KTUA 4U01A 1EAUA 5FAHA 3WY8A 1QL8A 3SJKA 3MFJA 3TH2H 1O3NA 1T4UH 3LJJA 3A8BA 1HAHH 5I25A 1C2EA 4Z6AH 1D3DB 3TK9A 4YOIA 5EXNA 1GGDB 2B5TB 1GBEA 1GVLA 1C2LA 1A0LA 4FVBA 1UTKA 1H9IE 3ZZ8A 2F9NA 1SC8U 3F9FA 2ZPSA 3GCTG 3LGTA 8KME2 1JWTA 1OYQA 3M5LA 1A3EH 3NZIA 2FOHA 2STAE 4IMQA 4CHAC 2OP9A 3BTQE 5GWZA 4X6OA 2Y5GA 4TWWA 2XTTB 1YPMH 2FI3E 1YC0A 4CRBA 3D65E 1TB6H 1EZXC 3ATKA 1FY3A 1J9CH 2PKSC 4I8GA 4I8KA 3SU5A 4IN1A 1AQ7A 2HNTC 1G3CA 1IQNA 3L33A 2VWNA 1LMWB 2EI7A 3SBKA 3A83A 1DY8A 1L4ZA 1O3FA 5ESBA 2BYAX 1GI6A 1O2NA 1VGCB 1GBHA 3DD2H 3SV2H 1LHDH 2F9BH 1NZQH 1V2UT 3D62A 1TMTH 3EQ0H 1RS0A 2GGVB 4MG3A 2TBSA 2WPMS 1OWIA 1UVOA 1GGDC 2OLGA 2ANWA 1LVYA 4I8LA 4O9VA 4O03A 1J8AA 1V2ST 1QRZA 4XBDA 1OP8A 1G9IE 5A8ZA 1P2MA 4MQAA 2BDCA 2ZFPH 3UR6A 1DITH 2FOBA 3A86A 1ZLRA 3M35A 2BM2A 1ABJH 1GJ5H 5JDUB 5DP9A 2ZZUH 4ZROA 4OS2A 4CRDA 1HAVB 2Z9JA 1W14U 1NRPH 2OINA 1DPOA 3T26A 3TLOA 1ZRKA 3S9AA 1HJ8A 2BTCE 1IQLA 3BF6H 2Z9GA 1TMBH 1DVAH 1ANCA 3GY5A 2FEQH 1TFXA 1DLEA 2OC8A 1UCYH 1VGCC 2VB0A 2R9PA 1ZTKA 2WINI 1YKTA 3TPIZ 3MI4A 3HKJB 1NT1A 1P2JA 4J1YA 2ZFTA 1S83A 1P09A 1MQ6A 3SJ8A 5DP7A 2YOLA 2HALA 2A0QB 1KXAA 2BB4A 1P3CA 3RMMH 1GVKB 4LOYH 1KLTA 2FDAA 1Z8GA 3I29A 1P01A 1YPLH 4WXVA 1DWDH 1BZXE 1JOUB 3PLKA 3SNCA 5CE1A 1FXYA 1P2KA 5BRRE 2AMPA 2C8ZB 1CT0E 1CA0B 3LC3A 4XSKU 2BZ6H 1AD8H 1G2MA 2OXSA 2CF8H 1P04A 1KIGH 1ZRBA 3DUXH 1EZQA 1O3LA 1DSUA 4X8TH 5JPMH 1TGSZ 4H42U 1ESAA 4HZHA 1DT2A 3H5CB 2ZEBA 1TQ7B 1JRSA 4RKOB 3E3TA 5GCHF 2BY7X 1BUIA 3TITA 4JCNA 1K28D 1ANDA 1NRRH 1O0DH 5DP8A 1C9PA 2ZTYA 5LPFA 2A7CA 4LK4A 1C2GA 1LDTT 5AFZH 3MNXA 1AN1E 4WJG2 2V3HH 1TPSA 2ALPA 3KNXA 7GCHF 2W3IA 1C2HA 1FZZA 4OGXA 1EZUC 1UTMA 1PQAA 2H9HA 3RC5A 4BANB 2HRVA 1SSXA 2PWXA 2ZCLP 4X8VH 1KSNA 1O37A 4NFFA 1TGNA 5FCRA 1E36B 1AE5A 1SGEE 1UTNA 2I6SA 2A2XH 2GVFA 5BPEA 3BEUA 1IQHA 3RXJA 1T8MA 1HB0B 1ZPCA 1V2LT 1AY6H 4OGYA 2JKHA 4BAOB 1ELCA 5HM9A 1LKBA 1DICA 3RU4E 4NZLA 1ID5H 6ESTA 1BBRK 1ZHRA 1H8DH 4MNYA 3MMGA 2NU1E 1XVOA 3TIUA 3HKIB 1ESBA 4K1TA 3O8BA 4ISHH 3RC6A 1PPBH 3RXPA 4BOHA 1THRH 1AWHB 1GMCF 1TX6A 2F9OA 4DJZB 2CF9H 1OKXA 3U69H 1OPHB 4NA8A 3H7TA 2H9EH 4U32A 3BTFE 1UO6A 2PGQB 5T6FA 2J9NA 3BTHE 4IGDA 1FY5A 3GCHC 2GKVE 1CHOF 5FPTA 1T8NA 3SQHE 4GPGA 3BIUH 1BTUA 1AI8H 1KYNA 3VPKA 4KTCA 1JBUH 1TPAE 1QB9A 5F8XA 3ZVBA 1GDQA 2PUQH 3H7OA 2GT7A 2HVXA 2XBWA 4R8TB 3QWCH 4BTIB 1OSSA 3KHVA 1F0TA 3ZV9A 4DGJA 1CGJE 3BEIB 4YT6H 1OOKB 2FM2A 1O31A 3RXDA 2BQ6B 3P17H 4AX9H 2ALVA 3GY4A 3LJOA 2QXIA 1OWJA 1YM0A 1TBZH 1PJPA 1S6FA 1TE0A 4TPIZ 3PMHB 1KY9A 2VU8E 1W0YH 3QO6A 5DP5A 1CO7E 1BBRE 2BX4A 3MO6A 1SLVB 1FNIA 2ZGBH 1TX8A 5A0AE 3SQEE 2ZU5A 1MAYA 5EPYA 5A2MH 1GI0A 3DT0H 3ZZ7A 1MKWK 2SGQE 1YPHE 3TVJB 1BOQA 1V2RT 2ODPA 3SU3A 5GJ4B 3RU4D 2A4RA 1AHTH 3EDXB 3ZYEA 4ABGA 1P02A 1OXGA 1HBTH 1L4DA 2J38A 2ZGJA 4OS6A 1A46H 8LPRA 4CR5A 2Y5FA 2VVCA 4YOGA 1DSTA 1TNJA 1O3DA 1SI5H 1VR1H 1HXFH 1VJAU 4K3JA 2ZA5A 1SGQE 3TK6A 4E7RG 1QFKH 1T31A 1FN6A 2FMJA 3K9XB 4I8JA 2PTCE 3Q3XA 1RJXB 1V3XA 4AFQA 4GSOA 3M7UA 2QF3A 1W12U 1TNHA 2W5EA 3PYHA 5T6GA 3BEFB 4GUXA 1ARBA 1VITF 1S0QA 1TNGA 1C5QA 1BMNH 1KXFA 1GMDF 2BY5X 2B9LA 4TY7A 4AGJA 4BXWA 2R3UA 1Z8RA 2XBVA 1W2KH 4X8UH 5HMAA 1ZPZA 1FY4A 1LKAA 4CR9A 2LPRA 7KMEH 1V2JT 2B7DH 2FX4A 4U2WA 1S6HA 2QN5T 3SUDA 1PPFE 3KEEA 1ELVA 1QTFA 1F5LA 3PO1B 1GHBF 1NFUA 2A1DB 2UUJB 1DOJA 4YTAA 1FUJA 1P2IA 2Y80A 1AFQB 2ZFSA 1TONA 4F4OC 1F5RA 5H4IB 1GBBA 4NG9H 1O2LA 5C1UA 3TNSA 1SLWB 2BLVA 2AS9A 1C9TA 3UNSA 3AVZA 3T25A 1UMAH 5TJXA 2YNBA 1O3KA 2DE8A 2FOCA 1C4Y2 4UFDH 5FHTA 2FYRA 3MYWA 1WAYB 3M7QA 4JZDH 2GZ7A 2PR3A 1AUJA 4MNWA 4OS4A 1C5ZB 1O2SA 3P70B 2OTVA 3ATMA 1CA8B 5JBAS 4X1SU 1O2RA 1UVUH 1QJ1B 4I33A 5E0GA 5FPYA 3SU6A 2BY9X 2PLXA 3RXAA 1HAOH 2PV9B 1O3GA 5CMXH 1P3EA 1O2WA 2ZECA 2ZNKH 3BTTE 1TA2A 4ZH8A 4OS7A 3A7YA 1C1UH 3E6PH 1QR3E 3SZNA 1OP2A 2AMDA 2FOFA 3IITA 5EXLA 1N8OB 4FUIA 1GBAA 1EX3A 1UK3A 4JK6A 3F9GA 4X6NA 3ZZ6A 3F68H 1HGTH 3RXEA 1DLKB <