4WXVA

Human cationic trypsin k97d mutant in complex with bovine pancreatic trypsin inhibitor (bpti)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
224
structure length
224
Chain Sequence
IVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRDTLNNDIMLIKLSSRAVINAHVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDAGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIAANS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mesotrypsin Has Evolved Four Unique Residues to Cleave Trypsin Inhibitors as Substrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Trypsin-1
total genus 60
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2014-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4wxvA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4wxvA02
1YGCH 2CF8H 3MU1A 1A1RA 3RM2H 6ESTA 2ZDVH 2DUCA 3RU4E 6GCHG 5L6NH 4WXVA 1KXEA 1HIAA 2FO9A 2J34A 7GCHF 1AWFH 5EW2H 3M5LA 4UFGH 3SO3A 3RXEA 4NSVA 3ZZAA 1HV7A 1TPAE 3RMLH 3SI3H 1GMDG 3U98H 4JYVH 3SJ9A 2ODYB 2I6SA 4DG4A 1C5VA 1SQTA 1UK3A 3FP7E 1SG8B 2R2MB 2TGPZ 2FM2A 1FDPA 1UVSH 4LOYH 1VZQH 4LK4A 2FS9A 1K1LA 1O33A 1RJXB 3MWIU 3OY6U 3PTBA 1FPHH 1H8DH 4JZIA 4GAWA 4J2YB 3AASA 4WVPE 1XUHA 1EATA 4AGJA 1ANEA 1T32A 3SGAE 4OS7A 1YC0A 2WYJA 1GJBB 1C2FA 2FP7B 1J14A 4FUCA 1KXFA 2QAAA 2YNBA 2XYAA 2PLXA 1PQ5A 3SU4A 1GDQA 5L2ZH 1G30B 3MMGA 1LVMA 4IW4E 1D6WA 5EQRA 3RLWH 1Z71A 2ZFTA 2Z9GA 5ESBA 2UWOA 1C1MA 1DXPA 4ISNA 2F9PA 4NIXA 3KQCA 1IQEA 3SW2B 4GHTA 2VNTA 1V2OT 2ZDAH 3M35A 3ZYDA 1J8AA 1SHHB 2FTLE 3UTUH 5DP9A 4CRGA 1VCWA 3Q3KA 1O38A 1GWAA 3GYMA 1XUFA 2ZPSA 1AN1E 1BT7A 4O3UA 1TMBH 1F5KU 1K1JA 3KNXA 1C5YB 1MKXK 1SVPA 3A7XA 1OKXA 1SFQB 1XUGA 1Z7KA 3GY7A 1Y8TA 1GHYH 4IC5A 1GJ9B 3MHWU 3MO6A 4F49A 2C4FH 4D7FA 1CT0E 1HIAB 1LHFH 4CRDA 5GXPA 1BJUA 3A7WA 1JXPA 3A85A 1QL7A 1GBEA 2BZAA 3AVZA 1SGNE 1KDQB 3O8RA 3KIDU 1ANDA 1CU1A 1ELDE 2WUCA 1KLJH 4NGAH 4D7GA 3M7QA 1BTPA 3VGCC 1SGIB 2OTVA 4GVUA 1JBUH 3SNBA 5A8YA 2A5AA 2QC2A 3R0FA 4I31A 1YLCA 2STAE 5JBCS 3ODDA 3PMJA 1E37B 1XVMA 1OWKA 1HJAC 1SGRE 2SGAA 4IMZA 3GCTF 2R3UA 4U2WA 1AKSA 5EOKA 2G5NA 2VB0A 4O03A 4HTCH 3MFJA 3MH4A 2TGTA 1KTSB 1V2QT 4WMEA 2Q1JA 3OYPA 2Q6FA 5L2YH 3RC6A 2H1UA 2ZGHA 3RXRA 1JIRA 5T6FA 4I8JA 1GVLA 4INKA 1P05A 2WYGA 1SFIA 1DFPA 3RXHA 4XBDA 1RS0A 2RG3A 2FS8A 1GBTA 1WCZA 1KXCA 4B76A 2NU1E 4NZLA 1C5RA 2BD9A 3AAUA 1DICA 1ZPZA 2VWLA 2QF0A 3NUMA 1SSXA 1P03A 1PJPA 3H7OA 1MH0A 2ZIQH 1YPHC 1P8VC 5DK1A 2OCVB 1GGDC 4JZ1A 3NCLA 3T5FH 1GL0E 1OOKB 4AORA 1BIOA 1O2GH 2PW8H 4ZMAH 3KCGH 3RXUA 3W94A 5FBEA 2CHAB 1C5XB 4B2AA 4Q7XA 1G2MA 2UUFB 2XBXA 2P8OC 2FESH 3QO6A 1TABE 3V12A 3SV9A 3B8JA 1DUAA 1HAPH 2ILNA 5HM9A 1TOCB 2OC1A 1ZOMA 4A1VA 2R0KA 3MU0A 2OC0A 1Z8GA 1OPHB 1QJ7B 4MNXA 2WV5A 4KTSA 1MKWH 3P8OA 1H9IE 4K60A 2ESTE 2BDYA 1HYLA 3LJJA 1QFKH 3BTTE 1MTUA 1GHAF 1NFXA 1A0JA 1C1VH 2PKAA 2Y5GA 3UOUA 4RKJB 4DGJA 1P2NA 3VB6A 1EPTB 1O3BA 4YO9A 4IMQA 4NIYA 4BAOB 1OXGA 1W12U 1OWJA 1AVXA 3TJVA 1YF4A 5HGGA 4Q80A 4A92A 2SGFE 4H6TA 1V2WT 1PPGE 2A32A 4U32A 3SQEE 2GCHF 1O2ZA 5E0GA 1L2EA 2JH5D 8GCHF 3SUEA 5I46H 1XMNB 3SN8A 1K1NA 2BDHA 3E8LA 1C1RA 3L6PA 4NA9H 3TH3H 4HGCA 2FLRH 2PFEA 1EOLA 4DJZB 2ZFQH 2HRVA 2BDBA 1FN6A 3E3TA 4NG9H 3SI4H 4BNRA 1MZDA 4AFSA 4GUXA 4YOJA 4MVNA 1H9LB 4OGXA 3TNSA 1Q3XA 3QTVH 1XUJA 4XBBA 1CA8B 3DFJA 5HXFA 1AE5A 1GBLA 1PPEE 1RIWC 1A3EH 3SOSA 3GCHB 1UVTH 1NROH 1C2DA 2UWPA 4K69A 3P8FA 4BOHA 1EASA 3TJUA 1DT2A 1HGTH 3PLBA 2BD8A 2NU0E 5EXNA 3UWJH 1T4UH 5K7RA 4X1NU 1GJDB 1C2GA 5FXLA 2CJIA 1NN6A 1UCYH 3DD2H 1AZZA 8GCHG 1JMOH 4FU9A 4Y79A 1W0YH 4X8SH 3OTJE 4Y11E 3K6ZA 3RXIA 3A86A 5JDUB 3B9FH 3QLPH 1IOEA 3M36A 3MNCA 1QJ1B 1SGFG 2G00A 3BIVH 2A1DB 1TIOA 4ABIA 1ANBA 2PSYA 1L0ZA 1BB0B 1S5SA 2ZTXA 1V2RT 3DUXH 5DG6A 1Y5BT 5DGJA 2F9OA 1FIZA 2ANMH 5EG4A 1TA6A 1DANH 2ZPRA 1EXFA 3RXVA 2ZPQA 1G3BA 1S6FA 3BTWE 3ZZ4A 3LGTA 4CRFA 1ZPCA 4ZUHA 1BCUH 2HGTH 1MU6B 2GKVE 1HPGA 4FUEA 4FUDA 4WWYA 2BVSH 3MU8A 1O3GA 4UEHH 3T29A 5J4SA 1WBGB 1GJ8B 4X0WU 4AG2A 1HJAB 1OP8A 3P8NA 4H6SB 1GVZA 2AEIH 1GVKB 3ZZ8A 3GY8A 2XW9A 2IJOB 1PQ7A 1AVWA 3RXLA 5A0CA 2GCTB 1DVAH 1LKAA 3M3SA 2Q6DA 3CS0A 5ESTE 1LVBA 1P2JA 2F91A 4B74A 3VB5A 3A82A 4DY7B 1WTHD 3M37A 5FAHA 2GZ7A 4YLQH 2VIPA 1XKBC 5FPTA 4AG1A 1UVOA 1YLDA 2XXLA 2CXVA 4DW2U 4FUBA 4UFFH 3BEIB 3NXPA 1O3MA 1NM6A 2GGVB 4O97A 2NU3E 2CF9H 1V2VT 2B0FA 1BTXA 1GMHF 2P3TB 4FUFA 2TGDA 2ZFFH 3TIUA 1IQFA 1FPCH 1LPGB 1RXPA 3LC3A 1ETSH 3TGKE 5A09A 4SGAE 3ZZDA 1JWTA 1C2KA 1P3CA 1FQ3A 3GY4A 1CGJE 2A31A 3Q00A 2H2ZA 2FIRH 1C5MD 2QIQA 1DPOA 1Z8JB 1GG6B 5A8ZA 3ZV8A 4YLUA 3M5NA 2AGEX 3L33A 1P0SH 2BX3A 1TNGA 1P2OA 2AYWA 3SU2A 1FNIA 1BMMH 3GYLB 3UREA 2GVFA 3A8DA 4MNVA 4INLA 3S9CA 4NZQA 2C3SA 3AAVA 3SUGA 3GY2A 1LHCH 2BD5A 2YNAA 5FX6A 1S83A 1TGCA 4BAHB 4NSYA 2XNIA 4WF8A 3IG6B 4ZHMU 3RXTA 5F6MA 6GCHF 1OS8A 1TYNA 1C5NH 2R9PA 3QGJA 1HNEE 3D62A 3VB4A 3I29A 3ENSB 4MTBA 1F0RA 3SJIA 2BZ6H 3RXFA 2Y6TA 3UPEA 3S0NA 1SBWA 4X2YA 2ZDMA 5G4BA 3RU4T 1JOUB 3S7HB 2NU4E 1GBKA 2ZHQH 4Y7AA 1V2MT 2GTBA 5BRRE 3EA9A 1SGCA 1C2IA 1QR3E 1O30A 2WUBA 4AFUA 5EQQA 1BMNH 2W3IA 3VXEH 1C9TA 4ABJA 3PO1B 1J17T 1V2TT 3BG4B 3ZVDA 1E36B 3KL6A 2ASUB 3T25A 5JBAS 1GI1A 2FX4A 4XFQA 4CHAB 4MPXA 2ANWA 3A89A 2QGRA 5A8XA 1N6XA 3GDVA 1PPFE 5F8XA 1M9UA 3ITIA 2ZU5A 2BTCE 1O3JA 1E35B 1BA8B 1SGDE 2QCYA 3T27A 3A88A 1GBIA 2G4UA 4YTAA 1TPOA 1O3HA 1WQVH 4AB9A 1GHXH 2IPHA 3T62A 1N8OB 2JH0D 2QV1A 2FI3E 4TPIZ 1K2I1 3Q3XA 4GSOA 3D49H 2ZHWH 4X8UH 1GHZA 1YCPM 5DP5A 3IWMA 1FAKH 4DIIH 5I25A 1AFQB 1P9SA 4ZAEA 1C5PA 1W2KH 4X2XA 1ZMLA 2ZU4A 2I6QA 1O5EH 2B5TB 1EAXA 1L4DA 1HB0B 1LKBA 2A7CA 2Y80A 2SNVA 1QNJA 2BLOA 2J9NA 1W11U 1IQJA 2F9NA 2FWWA 3QZQA 5C1XA 2XCFA 2XTTB 1MUEB 1DS2E 1QBVH 2ODQA 4FUHA 3K6YA 3B23B 4D9QA 2D26C 3A80A 1SLXB 3RXAA 1UTQA 1GHBF 3RXSA 3Q3YA 2QN5T 1SOTA 5LH8A 2CGAA 3RXGA 3I78A 1OWHA 5A0BA 4LZ1H 1XVOA 1C4V2 3GY5A 5TCCA 5DKMA 2PR3A 3DFLA 2OD3B 2AMPA 3ESTA 1NS3A 4CR9A 1O2HA 4AZ2B 3UOPA 1THPB 3E0PB 2CMYA 1ID5H 4AYYB 2H9TH 1T8MA 1AB9B 2ZTZA 2H9EH 5C67A 4U01A 3P92A 3U8RH 1ZTJA 1PPZA 4X6MA 3RXQA 1FAXA 1ZMJA 2VWNA 3F9GA 2Y81A 2AIQA 2Z3DA 4D76A 1BTYA 1GI8B 1PYTD 2AIPA 1AB9C 1LHDH 4FVDA 1EAWA 1P9UA 1QB9A 3RLYH 4X1PU 1A7SA 1NRPH 3SGQE 1F92A 3M5OA 4MG3A 5F03A 1D3TB 1ETRH 3IITA 1BHXB 1O3AA 3MU5A 1K1IA 1VITH 2P94A 2HPQH 1OWEA 3MU4A 1O5GH 2SGDE 2ZHDA 1GHVH 2XCNA 1O2QA 2PUQH 2V0BA 3LONA 4B2CA 1TALA 1QQ4A 1KDQA 3RXKA 3U69H 2BD3A 1QL8A 1FUJA 2WPIS 1A0LA 2PHBA 4DIHH 3E90B 3ATWA 1BOQA 1THSH 3VPKA 2H6MA 2GP9B 2G51A 1V2PT 1NRQH 2BQ7B 1GJ4H 1ZHRA 2BLQA 5FX5A 2AMQA 1HAXB 2GDDA 5LGOA 5GPIB 2XWAA 1SGQE 1HCGA 2WINI 4O9VA 1HJ8A 1L4ZA 3F6UH 4Y6DA 3ZVBA 2IOTA 1LQEA 2GT7A 1FZZA 3A81A 1ELEE 2O8LA 1X7AC 1C1QA 2XWBI 5JB9S 3MNBA 5H4IB 4X8VH 1UO6A 2HPPH 2PTCE 5GJ4B 1YPKH 9LPRA 4KTUA 3OY5U 3URCA 3S69A 3MNXA 3LOXA 3UNSA 1OYTH 1UHBB 1YPEH 1ZSLA 1ABIH 4AYVB 2BVXH 4MLFB 1TRNA 4BXSA 3VEQB 5EW1H 5JPMH 1AI8H 1GG6C 4GCHF 2A4OA 4E05H 1K28D 4DOQA 1GCDA 2QXIA 4ABHA 4IN2A 4Q7ZA 3RC5A 1DSTA 4HFPB 3ZZ7A 2C93B 4ABEA 1O3FA 5L30H 3A7TA 1V2JT 1ZPBA 2Z7FE 4MPVA 3GISB 5T6DA 2ZHEH 4YM9A 1P09A 5E2PA 4BXWA 4NWKA 2GZ9A 5K0HA 3S7KB 1GBJA 3ELAH 4JCNA 4X2VA 4SGBE 2W7SA 5BPEA 1B7XB 2FI5E 1YPMH 1GI2A 2C90B 2TGAA 1ZR0A 1NO9H 2ZZUH 3SJKA 3T26A 1MZAA 2ZG0H 1EB1H 1TNJA 1S85A 2GD4B 4AFZA 1HUTH 4ZXYH 1BTHH 1AD8H 3PLKA 1TGBA 2ZP0H 7KMEH 2CN0H 2ZNKH 2C8WB 3L3TA 5HM2A 3ZVFA 4QT8C 1P01A 4ZKNU 4K3JA 4CREA 2OBQA 1SLWB 5FCRA 1ZTLA 1ESTA 3RU4D 1EP5A 5IYTA 2A4RA 4VGCB 1C9PA 1O2YA 8KME2 2FOAA 1IQMA 3UR6A 2Y5HA 4X1SU 1S82A 5LPEA 1EJNA 2IN2A 3SNAA 3GCNA 1FY4A 4I8HA 1NRSH 3OU0A 1O2VA 1CBWB 4HI3A 5AF9H 3AW1A 2J38A 2TRMA 1EUFA 1VCPA 5GWZA 5ETXA 2SGQE 5C5OA 1FY5A 3HPTB 1EZSC 2R3YA 1EAUA 1UTNA 1BRUP 4NIVA 1RGQA 3OX7U 1N1LA 1JRTA 2BOKA 4PROA 2F9BH 1HDTH 1H4WA 4YZUA 2GZ8A 1QRZA 1NFUA 3SU5A 1L1GA 3PYHA 4TPYA 3KHVA 3TH2H 1UTPA 1LTOA 3P8GA 1DLEA 4WY3A 1MTSA 3ATKA 1TGSZ 1LHGH 1O39A 1AU8A 3PB1E 3QZRA 4ISLA 1GI5A 1HAHH 1O0DH 4Y8ZA 4FU8A 1W13U 2BVRH 3RXPA 2JKHA 1O2OA 3S9AA 2P93A 1TNIA 4MQAA 4FUIA 1A5IA 1F5RA 3TLOA 3P17H 1S84A 3D65E 3QTOH 4FU7A 2ZCHP 1U6QA 2WPLS 1OWIA 3C27B 1T8OA 3KF2A 1TRYA 1CGHA 4CRCA 4Z0KA 2A5KA 4WJG2 2BY6X 1A5GH 2Z9LA 2EC9H 3HGPA 5EGMA 1A3BH 1C2LA 1EP6A 2WPJS 2C8ZB 4TY6A 2AGIX 4IGDA 3RP2A 4OS2A 1O3IA 1Y5AT 1S81A 1QURH 1O5CB 4K1SA 4M7GA 1C5UA 1CBWC 1ZJDA 1RTLA 3U1JB 4NCYA 3U8TH 3EYDA 3ZVEA 1C5TA 2UUJB 5CMXH 1HAZB 1H1BA 3MH7A 1YCPK 1PFXC 2FDAA 2FOEA 1BBRH 3FZZA 4UFDH 2NWNA 1O37A 2EI7A 1SB1H 1FMGA 1IQHA 2BY8X 1Z8IB 2Y82A 2P3UB 4OS4A 3N7OA 5HMAA 3TJOA 4K2YA 1BZXE 4Y10E 1GJ5H 1BJVA 3RMNH 3RC4A 1HXEH 1TNLA 4CR5A 1UCYE 4D8NA 1DOJA 1G36A 3UQVA 3CS7A 4BTTB 1O3CA 1Y3VA 4JK5A 3PMHB 3VGCB 4XOJA 1LHEH 2TBSA 2A0QB 2FYQA 1MU8B 4B71A 1TBRH 1GJ6A 2STBE 2HNTC 1GMDF 1IHSH 2FYRA 1CA0C 2KAIB 1AY6H 2AH4X 5T3HA 4FUGA 4AFQA 5JYIA 1C4U2 4OS1A 1W14U 1SQOA 4Y0YE 1AUTC 2QY0B 3ZZCA 2VH0A 3TU7H 1EAIA 1MAXA 4XDEA 1HBTH 1BRCE 2P8OB 4MNWA 1MMJN 3U1IB 1A2CH 1KSNA 1TA2A 1G3CA 1HRTH 1MKXH 1W7GH 2FOGA 1C1OA 4NA8A 3PWBA 4Q2KA 1WAYB 1D3DB 2OXSA 1O5FH 2LPRA 1XM1A 2BXUH 5FPSA 1DE7H 1DWEH 1ESAA 2VWOA 2SNWA 6CHAC 4I8GA 1K22H 1AMHA 2VH6A 1EKBB 1O36A 1V2KT 3M7UA 1AUJA 2A2QH 1Z6EA 1GDUA 1MTNB 4K1EA 4ABBA 2DE9A 1WU1A 1E0FD 2VWMA 2F83A 3ZVCA 3MYWA 1ABJH 1C1TA 2OLGA 1B0EA 3ATIA 1UVUH 2BLWA 1O2IA 1C5OH 4GHQA 1GI3A 3VFEA 1BTUA 5CHAC 3SNDA 3O8CA 1UK4A 1CQQA 1S6HA 3F1SB 2ZA5A 1HFDA 1W10U 4U30A 1AWHB 1BRBE 1V2UT 1BMAA 3LGUA 2ZGJA 3KEEA 4UE7H 1C5LH 2H5CA 1N6YA 1SGPE 3M7TA 4WXIA 3PM3A 2Z94A 1MD7A 2KAIA 4ZHLU 3P70B 1GMCF 1DLKB 2P59A 1CA0B 3HK3B 1ELBA 1QL9A 2Z9KA 1QB1A 1KYNA 1UVPA 1WTGH 2XC4A 4CH8B 4D9RA 5DP7A 3QK1A 1F0SA 2EEKA 2A45B 1T7CA 2D1JA 6CHAB 2BHGA 4Q7YA 7GCHG 1MAYA 1ELFA 1TBQH 2K1QA 1UTLM 2V35A 1W3CA 1K21H 2JETB 5EU8A 2AMDA 4AB8A 1TLDA 1BDAA 2WPMS 1D3QB 1Y3WA 2FODA 4JZDH 1GJ7B 1YPHE 1G3DA 3UY9A 1DX5M 5AFYH 3RXCA 2QA9E 3LJOA 1Y3XA 4AOQA 4BAQB 5C1UA 2BYAX 1YYY1 3GY3A 5C3NA 1UTJA 3LGYA 2PUXB 1KIGH 3ZVGA 1O34A 1LPKB 4BAKB 3CENA 1OWDA 5FCKA 1T8NA 1KLTA 1V2ST 1YPLH 1DWCH 3V7TA 2BM2A 2ZGBH 3EA7A 2Z9JA 2BQ6B 3EAJA 1SLVB 2DE8A 1GGDB 3TJNA 1ACBE 1TE0A 2A4GA 2ZO3H 3D23A 3RM0H 1RRKA 1C2HA 1CT2E 1K9OE 2HNTF 5EODA 3GDUA 3QUMP 2HALA 1PQAA 3UNRA 1Y5UT 3KQBA 5EXMA 1GI6A 1EB2A 2P95A 5DPAA 1C5WB 1GBCA 1BUIA 1ELVA 1O3DA 1EOJA 3F9HA 1C1NA 3SU6A 2FTMA 1AFQC 3MH6A 2ZTYA 1IQLA 1MKWK 1TOMH 2ZFRH 1UJ1A 2FLBH 3TH4H 2HLCA 5GIBA 1H8IH 1HAYB 1PYTC 5AFZH 1P3EA 1NZQH 3TK5A 2ZKSA 2GCHG 3KQDA 1SPJA 1NRNH 1ZYOA 3BN9A 5DP4A 4BTUB 3LIWA 3SBKA 1C1UH 2ZCKP 1MCTA 4OS5A 2A5IA 4RKOB 1HAGE 1ANCA 1ZGVA 1QB6A 2ALPA 1HLTH 2ZI2H 4X8TH 1CHOF 5EPYA 1C1SA 3GDSA 1SL3A 2GT8A 1O3PB 5LPRA 1Q31A 2ZDLA 4TWWA 2O8WA 2ZFSA 1ZLRA 4DT7B 3A84A 1FV9A 1NFWA 1ESBA 2Y7XA 1QY6A 3FFGA 1FIWA 1D4PB 2XRCA 3GOVB 2G81E 3JZ2B 1ZZZA 3H5CB 3O8BA 1QQUA 1WV7H 3TK6A 2HWLB 4ZXXH 1INCA 3GICB 2JH6D 3FVFB 1F5LA 1QA7A 3DHKH 2PKSB 1WUNH 3STIA 4TYDA 4F4OC 7ESTE 2GV7A 4VGCC 2SFAA 4K1TA 1SGTA 1QTFA 5F8ZA 2R2WU 2B7DH 3NWUA 2G55A 1HAVA 1Q2WA 1DUEA 3BEUA 1A4WH 2VIWA 4X1QU 3NZIA 2BY9X 1Z6JH 5LPFA 1UMAH 1LDTT 1BQYA 3RXDA 5E2OA 2OQ5A 3C1KA 1O2WA 1CHGA 3URDA 1LMWB 2A2XH 1UK2A 2VVUA 1W0ZU 2XBYA 2ZQ2A 4BTIB 3MO9A 2ULLA 1MTVA 1UTMA 1FONA 1NPMA 4J1YA 1MBQA 1NY22 1RTKA 2ZU1A 1AO5A 2Z6BD 4IN1A 1DM4B 3LGVA 1S0QA 1C2JA 3F68H 4DVAU 2O9QA 4A7IB 3TITA 2ZGCA 1LPZB 1ZRKA 3M5MA 3ODFA 2H9HA 1XXDA 2RCEA 1C5QA 2VINA 1YPGH 1BMLA 2BMGB 1HAIH 1HAVB 4ZKOU 1LQDB 4IC6A 1S0RA 1BBRK 1SQAA 2JETC 3A83A 1TMTH 1ZRBA 2XC5A 2F3CE 3BG4C 2FOHA 1ELTA 3PO1C 1ELGA 1ZMNA 2J4IA 5TCAA 4Y0ZE 2Y7ZA 3SORA 1TFXA 3SGBE 2YOLA 3LC5A 3LPRA 1P2QA 1DITH 1O2RA 1AZ8A 1YP9A 4JYTA 2QXGA 1GBFA 2UWLA 1O2JA 3BG8A 4OS6A 1FY3A 2BDAA 1AGJA 1O2TA 3F9EA 4LXBH 3RXMA 2CV3A 2C8XB 2VGCB 2SGPE 2GX4A 2FPZA 2QYIA 3ATMA 1QHRB 1NTPA 3LKWA 3WY8A 2BDCA 1TGNA 1YPJH 2QXHA 4KTCA 4ESTE 3SU1A 1TGTA 2Y5FA 1QIXB 4BANB 3BSQA 1O2XA 1TX8A 4FXGH 1BTWA 5C20A 4B75A 2W5EA 1NESE 5DO4H 2FMJA 4ABAA 2FOBA 4WMDA 1FY8E 1KTTB 1KY9A 3M61U 1Y59T 2ZF0H 1O3NA 1CHOG 1QGFA 1J9CH 4Y8XA 3NK8A 4INHA 1BHXF 4K5ZA 2Q6GA 2BLVA 1BRAA 1SLUB 1T8LA 1IAUA 1GHBG 2RA0A 1NC6A 4ZKRU 1NU9A 3GCTG 3LT3A 2RA3A 1A0HB 2VIDA 1NT1A 1O32A 1CSOE 1HXFH 2ZQ1A 1GL1A 5IDKA 1MTWA 3RUOA 4I7YH 1DWDH 1LVYA 1DWBH 2ODPA 3UR9A 4JMYA 3SU0A 3NPSA 1VJAU 1OP2A 2PSXA 1D6RA 1KXDA 7LPRA 1PPCE 1QJ6B 2QF3A 1O35A 4K8YA 2ZGXH 4ABFA 1WYKA 1XXFA 3VXFH 1AIXH 1JRSA 1Y3YA 2BXTH 2ZDKA 1N8OC 3TGJE 5EQSA 3PWCA 3BIUH 3ZZ9A 2UUYA 1PPHE 3EE0B 5DJ7A 1GI0A 1AQ7A 1Z1IA 3KN2A 3ZZ5A 2UUKB 3BV9B 1QRWA 3K2UA 4XBCA 4E7RG 3QWCH 1O2UA 5CE1A 4NWLA 2ZCLP 1ZGIA 2A7HA 1W7XH 2J94A 5E0JA 4E06H 3SUFA 1C1PA 3QN7A 2TIOA 3E6PH 4MPWA 3LH3A 3SZNA 2FEQH 3TVJB 2PTNA 1QA0A 1TQ7B 2BY7X 4MPUA 1GCTB 1WOFA 2AERH 3SJ8A 1ARBA 4KKDA 2V3OH 1TBZH 4A1TA 4Y7BA 3SJOA 3TK9A 1OSSA 2O8MA 2ANKH 3NKKA 2XBWA 4GPGA 2OC8A 1YM0A 3U8OH 1YKTA 3HGNA 3MTYA 4IBLH 2EA3A 2ZC9H 2VIOA 4CHAC 1UCYK 4UFEH 1TQ0B 1ARCA 1IHTH 3E91A 3GY6A 1C5SA 4Z6AH 2BD4A 2O8UA 3HKJB 5B6OA 2RDLA 1O2MA 1QRXA 4K8BA 2H5DA 4ZHAA 5JBTA 1RIWB 2D8WA 2ZU3A 3KQEA 1F0UA 4X6OA 1QCPA 4B1TA 3R3GB 1GBMA 4XE4A 3LH1A 1IQIA 4H42U 4KELA 5DP3A 3PV4A 5AVDA 1WSSH 3BTHE 1TONA 3ZZBA 4IS5A 1GJCB 1TMUH 2TPIZ 1W8BH 1RFNA 3SV6A 1ETTH 1TWXB 1DDJA 2A7JA 5J4QA 2PGBB 3F9FA 3EA8A 2R0LA 3H7TA 1FLEE 1VGCC 2P16A 1SMFE 4RN6A 4Y76A 5AHGH 1O3OA 2AS9A 3PMBB 4AGKA 1SGFA 1FXYA 1IQKA 1KXAA 2A4QA 2J95A 4KP0A 1Z1JA 2D2DA 3ZVAA 1GDNA 2QXJA 1A46H 2FOCA 2ZFPH 1J16A 5C1YA 1TPPA 1G2LA 4YT6H 1DY9A 3SU3A 1K1MA 2BY5X 1CO7E 3BTKE 4DCDA 1UTOA 3S9BA 3SV8A 2BQWB 1IQNA 3VB3A 1F7ZA 1AFEH 1QBOA 2Z3EA 4OGYA 5C5NA 1LCYA 1OX1A 1ZSJA 4AN7A 4YT7H 1O2SA 3RMOH 3QGNB 2OC7A 4RSPA 2SGEE 3SNEA 1GI7B 1EPTC 2EI6A 3A7VA 2Z3CA 3BTFE 3TPIZ 3BTGE 1ZJKA 3CP7A 1TAWA 3BTME 1AE8H 1KLIH 1OP0A 1C4Y2 1KXBA 1EJAA 4KGAA 3LGWA 3V3MA 5A0AE 2F9UA 2VGCC 3UWIA 3BEFB 2HVXA 2NU2E 4JK6A 3O8DA 4WH6A 3UFAA 2GCTC 2GV6A 1G9IE 4I33A 2BX4A 1MQ6A 2J92A 1C2MA 1ZHMA 3E1XB 2VIVA 3M3VA 1A5HA 5EXLA 2WPHS 2G8TA 1G37A 1XUIA 2XBVA 3EGKH 1BITA 2F9VA 1D3PB 2OINA 5DP6A 1L1NA 2M5TA 1CGIE 2C8YB 4TY7A 1O3LA 4ISOA 1UHBA 1P10A 2ZEBA 3E0NB 1BTZA 2LNCA 1EZQA 1XUKA 1NFYA 1C1WH 4AX9H 1SI5H 1GCTC 1F2SE 5HYOA 1EZXC 3PROA 1TPSA 4JZEH 1LO6A 1Z8RA 3MO3A 4MNYA 1GBBA 1NRRH 1P57B 3M3TA 1SHYA 2BD7A 2FXRA 3QDZB 1HJ9A 2PKAB 9ESTA 1H9HE 1TNKA 1EJMA 3U9AH 2Z9IA 3HATH 3ZYEA 1O2LA 1YCPH 1GPZA 1SR5C 2BDGA 2OP9A 3RXOA 4CBOA 2PGQB 8ESTE 4ASHA 1P11E 3UUZA 1TX7A 1O2NA 3K65B 1CE5A 1GI9B 4LZ4B 2PV9B 3MNSA 3PLPA 2AFQB 2J2UA 3FANA 1IQGA 5E8EH 1F0TA 4GCHG 1GBAA 2OBOA 1RTFB 1P12E 1V2LT 1SGYE 2GDEH 4JZFH 2VIQA 4YOIA 1O2PA 1XX9A 1MQ5A 2FOMB 4X6PA 1GI4A 1CT4E 1SOZA 1DY8A 3BTQE 1FJSA 4A5TS 4NFFA 1O5AB 3DA9B 2W7UA 5ABWA 3AW0A 1MCVA 4UONA 4TWYA 2PKSC 3T28A 1GBDA 3UNQA 1GHWH 2G4TA 4I8KA 3P6ZB 1P2MA 2FOFA 1E38B 4CBNA 1O2KA 4NFEA 4UD9H 4ZROA 3TNTA 3E16B 1C5ZB 3DT0H 2V3HH 1V6DA 3RXBA 1PQ8A 3T2NA 4E7NA 1ELCA 3SV2H 1ELAA 1LVOA 3I77A 1GMHG 4B73A 1VJ9U 1ZSKA 4WMFA 1O5BB 4R0IA 1GJAB 1FI8A 2P3FH 4CRBA 4ZKSU 1A61H 1J15A 5DP8A 4Y8YA 4O3TA 3MH5A 5JB8S 1MD8A 3RMMH 1D9IA 3Q77A 3Q76A 2G52A 2GMTB 4X6NA 5GCHG 1Y3UA 2ZWLH 2VVCA 4ISHH 3P95A 1VR1H 1E34B 1VCQA 4B2BA 3BTEE 1V2NT 2O8TA 3K9XB 2WV4A 1VITG 2ZHFH 3SQHE 3HK6B 4UDWH 3ZZ3A 3TGIE 2VJ1A 5GCHF 4H4FA 3A8BA 1O3EA 3RXJA 4I8LA 4X2WA 2THFB 3MOCA 4NA7A 1AHTH 1P2KA 3RDZA 3A7YA 3JZ1B 1V3XA 1P2IA 3A8AA 3HKIB 1TB6H 3UIRA 3UQOA 5TJXA 3GCOA 1FY1A 1MBMA 2CHAC 2G5VA 1AVGH 1TX6A 2BB4A 1GMCG 3SNCA 5PTPA 3FAOA 2EI8A 4X1RU 3LGIA 1T4VH 1GHAG 3A87A 4Y71A 1JIMA 1GBHA 5GDSH 4YOGA 1AKSB 1TRMA 5F8TA 2XC0A 5E0HA 1EZUC 1EQ9A 2HOBA 1C2EA 2ZDNA 3ZV9A 2B8OH 1DXWA 1K1PA 5FPYA 3LU9B 1P02A 3EDXB 4HZHA 2BOHB 1O3KA 3QX5H 3BF6H 4A1XA 3SUDA 3KGPA 2ANYA 3FP8E 1CVWH 1B5GH 3ATLA 5JBBS 1VITF 1QBNA 4NIWA 2OQUA 3PTNA 2WPKS 1THRH 2B9LA 3VB7A 4GLYA 5A2MH 1K1OA 1YBWA 3V0XA 3STJA 2VVVA 4ABGA 1XKAC 1ORFA 1L1JA 1B0FA 1UTKA 5EPNA 1EX3A 1ZHPA 3SHAH 5FHTA 1O5DH 3W95A 2AGGX 2ZU2A 1P06A 1NU7B 2PWXA 3A8CA 2BDIA 4XSKU 1O31A 4BAMB 3FZDA 4WH8A 1BBRE 1EPTA 1TNHA 2BD2A 8LPRA 4JYUH 1DSUA 1T31A 4THNH 6LPRA 2ZECA 3SV7A 2W26A 1SGEE 2W3KA 4ZH8A 4CH2B 1OYQA 3EQ0H 4ABDA 5SGAE 3SHCH 3V13A 2FI4E 3A7ZA 4A6LA 1G32B 2V6NA 4DURA 4I32A 1PPBH 4R8TB 1HAOH 5FBIA 3GCHC 3BTDE 4FVBA 4YESB 5C2ZA 3MI4A 4CRAA 2FZZA 3ZZ6A 1SC8U 1FN8A 1VGCB 4FUJA 2VU8E 1RD3B 1P04A 1WQSA 4ISIH 2HNTE 2OUAA 1G3EA 1MTNC 1ZTKA 3PMAB 5T6GA 2FX6A 4MDSA 2GMTC 3LDXH 5CHAB 3G01A 3OSYA 3FP6E 2ALVA
chains in the Genus database with same CATH superfamily
1YGCH 2CF8H 3MU1A 1A1RA 3RM2H 6ESTA 2ZDVH 2DUCA 3RU4E 6GCHG 5L6NH 4WXVA 3W1EA 1KXEA 1HIAA 2FO9A 2J34A 7GCHF 1AWFH 5EW2H 3M5LA 4UFGH 3SO3A 3RXEA 4NSVA 3ZZAA 1HV7A 1TPAE 3RMLH 3SI3H 1GMDG 3U98H 4JYVH 5EJLA 3SJ9A 2ODYB 2I6SA 4DG4A 1C5VA 1SQTA 1UK3A 3FP7E 1SG8B 2R2MB 3AK5A 2TGPZ 2FM2A 1FDPA 1UVSH 4LOYH 1VZQH 4LK4A 2FS9A 1K1LA 1O33A 1RJXB 3MWIU 3OY6U 3PTBA 1FPHH 1H8DH 4JZIA 4GAWA 4J2YB 3AASA 4WVPE 1XUHA 1EATA 4AGJA 1ANEA 1T32A 3SGAE 4OS7A 1YC0A 2WYJA 1GJBB 1C2FA 2FP7B 1J14A 4FUCA 1KXFA 2QAAA 2YNBA 2XYAA 2PLXA 1PQ5A 3SU4A 1GDQA 5L2ZH 1G30B 3MMGA 1UW7A 1LVMA 4IW4E 1D6WA 5EQRA 3RLWH 1Z71A 2ZFTA 3MQKC 2Z9GA 5ESBA 2UWOA 1C1MA 1DXPA 4ISNA 2F9PA 4NIXA 3KQCA 1IQEA 1YLNA 3SW2B 4GHTA 2VNTA 1V2OT 2ZDAH 3M35A 3ZYDA 1J8AA 1SHHB 2FTLE 3UTUH 5DP9A 4CRGA 1VCWA 3Q3KA 1O38A 1GWAA 3GYMA 3WW7A 1XUFA 2ZPSA 1AN1E 1BT7A 4O3UA 1TMBH 1F5KU 1K1JA 3KNXA 1C5YB 1MKXK 1SVPA 3A7XA 1OKXA 1SFQB 1XUGA 1Z7KA 3GY7A 1Y8TA 1GHYH 4IC5A 1GJ9B 3MHWU 3MO6A 4F49A 2C4FH 4D7FA 1CT0E 1E1QD 1HIAB 1LHFH 4CRDA 5GXPA 1BJUA 3A7WA 1JXPA 3A85A 1QL7A 1GBEA 2BZAA 3AVZA 4OM9A 1SGNE 1KDQB 3O8RA 3KIDU 1ANDA 1CU1A 1ELDE 2WUCA 1KLJH 4NGAH 4D7GA 3M7QA 1BTPA 3VGCC 1E1RD 1SGIB 2OTVA 4GVUA 1JBUH 3SNBA 5A8YA 2A5AA 2QC2A 3R0FA 4I31A 1YLCA 2STAE 5JBCS 3ODDA 3PMJA 1E37B 1XVMA 1OWKA 1HJAC 1SGRE 2SGAA 3KYFA 4IMZA 3GCTF 2R3UA 4U2WA 1AKSA 5EOKA 2G5NA 2VB0A 4O03A 4HTCH 3MFJA 3MH4A 2TGTA 1KTSB 2QF4A 1V2QT 4WMEA 2Q1JA 3OEHD 3OYPA 2Q6FA 5L2YH 3RC6A 2H1UA 2ZGHA 3RXRA 1JIRA 5T6FA 4I8JA 1GVLA 4INKA 1P05A 1H8HD 2WYGA 1SFIA 3PV2A 1DFPA 3RXHA 4XBDA 1RS0A 2RG3A 2FS8A 1GBTA 1WCZA 1KXCA 2JDID 4B76A 2NU1E 4NZLA 1C5RA 2BD9A 3AAUA 1DICA 1S6LA 1ZPZA 2VWLA 2QF0A 3NUMA 1SSXA 1P03A 1PJPA 3H7OA 1MH0A 2ZIQH 1YPHC 1P8VC 5DK1A 2OCVB 1GGDC 4JZ1A 3NCLA 1NBMD 3T5FH 1GL0E 1OOKB 4AORA 1BIOA 1O2GH 2PW8H 4ZMAH 3KCGH 3RXUA 3W94A 5FBEA 2CHAB 1C5XB 4B2AA 4Q7XA 1G2MA 2UUFB 2XBXA 2P8OC 2FESH 3QO6A 1TABE 3V12A 3SV9A 3B8JA 1DUAA 1HAPH 2ILNA 5HM9A 1TOCB 2OC1A 1ZOMA 2EY4C 4A1VA 2R0KA 3MU0A 2OC0A 1Z8GA 1OPHB 1QJ7B 4MNXA 2WV5A 4KTSA 4P00A 1MKWH 3P8OA 1H9IE 4K60A 2ESTE 2BDYA 1HYLA 3LJJA 1QFKH 3BTTE 1MTUA 1GHAF 1NFXA 1A0JA 1C1VH 2PKAA 2Y5GA 3UOUA 4RKJB 4DGJA 2IJD1 1P2NA 3VB6A 1EPTB 3FO8D 1O3BA 4YO9A 4IMQA 4NIYA 4BAOB 4Z1MD 1OXGA 1W12U 1OWJA 1AVXA 3TJVA 1YF4A 5HGGA 4Q80A 4A92A 2SGFE 4H6TA 1V2WT 1PPGE 2A32A 4U32A 3SQEE 2GCHF 1O2ZA 5E0GA 1L2EA 2JH5D 8GCHF 3SUEA 5I46H 1XMNB 1W0KD 3SN8A 1K1NA 2BDHA 3E8LA 1C1RA 3L6PA 5GNDA 1OHHD 4NA9H 3TH3H 4HGCA 2FLRH 2PFEA 1EOLA 4DJZB 2ZFQH 2HRVA 2BDBA 1FN6A 3E3TA 4NG9H 3SI4H 4BNRA 1MZDA 4AFSA 4GUXA 4YOJA 4MVNA 1H9LB 4OGXA 3TNSA 1Q3XA 3QTVH 1XUJA 4XBBA 1CA8B 3DFJA 5HXFA 1AE5A 1GBLA 1PPEE 1RIWC 1A3EH 3SOSA 3GCHB 1UVTH 1NROH 1C2DA 2UWPA 4K69A 3P8FA 4P02A 4BOHA 1EASA 3TJUA 1DT2A 5F53A 4B6FA 1HGTH 3PLBA 2BD8A 2NU0E 5EXNA 3UWJH 1T4UH 5K7RA 4X1NU 1GJDB 1C2GA 5FXLA 2CJIA 1NN6A 1UCYH 3DD2H 1AZZA 8GCHG 1JMOH 4FU9A 4Y79A 1W0YH 4X8SH 3OTJE 4Y11E 3K6ZA 3RXIA 3A86A 5JDUB 3B9FH 3QLPH 1IOEA 3M36A 3MNCA 1QJ1B 1SGFG 2G00A 3BIVH 2A1DB 1TIOA 3F3BA 1ANBA 2PSYA 1L0ZA 4ABIA 1BB0B 1S5SA 2ZTXA 1V2RT 3DUXH 5DG6A 1Y5BT 5DGJA 2F9OA 1FIZA 2ANMH 5EG4A 1TA6A 1DANH 2ZPRA 1EXFA 3RXVA 2ZPQA 1G3BA 1S6FA 3BTWE 3ZZ4A 3LGTA 4CRFA 1ZPCA 4ZUHA 1BCUH 2HGTH 1MU6B 2GKVE 1HPGA 4FUEA 4FUDA 4WWYA 2BVSH 3MU8A 1O3GA 4UEHH 3T29A 5J4SA 1WBGB 1GJ8B 4X0WU 4AG2A 1HJAB 1OP8A 3P8NA 4H6SB 1GVZA 2AEIH 1GVKB 3ZZ8A 3GY8A 2XW9A 2IJOB 1PQ7A 1AVWA 3RXLA 5A0CA 2GCTB 1DVAH 1LKAA 3M3SA 3F2HA 2Q6DA 3CS0A 5ESTE 1LVBA 1P2JA 2F91A 2YMSB 4B74A 3VB5A 3A82A 4DY7B 1WTHD 3M37A 5FAHA 2GZ7A 4YLQH 2VIPA 1XKBC 5FPTA 4AG1A 1UVOA 1YLDA 2J98B 2XXLA 2CXVA 4DW2U 4FUBA 4UFFH 3BEIB 3NXPA 1O3MA 1NM6A 2GGVB 4O97A 2NU3E 2CF9H 1V2VT 2B0FA 1BTXA 1GMHF 2P3TB 4FUFA 2TGDA 2ZFFH 3TIUA 1IQFA 3NRLA 1FPCH 1LPGB 1RXPA 3LC3A 1ETSH 3TGKE 3OE7D 5A09A 4SGAE 3ZZDA 1JWTA 1C2KA 1P3CA 1FQ3A 3GY4A 1CGJE 2A31A 3Q00A 2H2ZA 2FIRH 1C5MD 5DSFA 2QIQA 1DPOA 1Z8JB 1GG6B 5A8ZA 3ZV8A 4YLUA 3M5NA 2AGEX 3L33A 1P0SH 2BX3A 1TNGA 1P2OA 2AYWA 3SU2A 1FNIA 1BMMH 3GYLB 3UREA 2GVFA 3A8DA 4MNVA 4INLA 3S9CA 4NZQA 2C3SA 3AAVA 3SUGA 3GY2A 1LHCH 2BD5A 2YNAA 5FX6A 1S83A 1TGCA 4BAHB 4ACAA 4NSYA 2XNIA 4WF8A 3IG6B 4ZHMU 3RXTA 5F6MA 6GCHF 1OS8A 1TYNA 1C5NH 2R9PA 3QGJA 1HNEE 3D62A 1VKYA 3VB4A 3I29A 3ENSB 4MTBA 3PRDA 1F0RA 3DCLA 3SJIA 1FX0B 2BZ6H 3RXFA 2Y6TA 3UPEA 3S0NA 1SBWA 4X2YA 2ZDMA 5G4BA 3RU4T 1JOUB 3S7HB 2NU4E 1GBKA 2ZHQH 4Y7AA 1V2MT 2GTBA 5BRRE 3EA9A 1SGCA 1C2IA 1QR3E 1O30A 2WUBA 4AFUA 5EQQA 1BMNH 2W3IA 3VXEH 1C9TA 5CHBA 4ABJA 3PO1B 1J17T 1V2TT 3BG4B 3ZVDA 1E36B 3KL6A 2ASUB 3T25A 5JBAS 1GI1A 2FX4A 4XFQA 4CHAB 4MPXA 2ANWA 3A89A 2QGRA 5A8XA 1N6XA 3GDVA 1PPFE 5F8XA 1M9UA 2KR7A 3ITIA 2EQNA 2ZU5A 2BTCE 1O3JA 1E35B 1BA8B 1SGDE 2QCYA 3T27A 3A88A 1GBIA 2G4UA 4YTAA 1TPOA 1O3HA 1WQVH 4AB9A 1GHXH 2IPHA 3T62A 1WXRA 1N8OB 2JH0D 2QV1A 2FI3E 4TPIZ 1K2I1 3Q3XA 4GSOA 3D49H 2ZHWH 4X8UH 1GHZA 1YCPM 5DP5A 3IWMA 1FAKH 4DIIH 5I25A 4XRNA 1AFQB 1P9SA 4YXWD 2RFKC 4ZAEA 1C5PA 1W2KH 1NBME 4X2XA 1ZMLA 2ZU4A 2I6QA 1O5EH 2B5TB 1EAXA 1L4DA 1HB0B 1LKBA 2A7CA 2Y80A 2SNVA 1QNJA 2BLOA 2J9NA 1W11U 1IQJA 2F9NA 2FWWA 3QZQA 5C1XA 2XCFA 2XTTB 1MUEB 1DS2E 1QBVH 2ODQA 4FUHA 3K6YA 3B23B 3VG8A 4D9QA 2KFWA 2D26C 3A80A 1SLXB 3RXAA 1UTQA 3FKSD 1GHBF 3RXSA 3Q3YA 2QN5T 1SOTA 5LH8A 2CGAA 3RXGA 3I78A 1OWHA 5A0BA 4LZ1H 1XVOA 1C4V2 2K0QA 3GY5A 5TCCA 5DKMA 2PR3A 3DFLA 2OD3B 2AMPA 3ESTA 4ACBA 1NS3A 1KMHB 4CR9A 1O2HA 4AZ2B 3UOPA 1THPB 3E0PB 2CMYA 1ID5H 4AYYB 1YY3A 2H9TH 1T8MA 1AB9B 2ZTZA 2H9EH 5C67A 4U01A 3P92A 3U8RH 1ZTJA 3FN8A 1PPZA 4X6MA 3RXQA 1FAXA 1ZMJA 2VWNA 3F9GA 2Y81A 2AIQA 2Z3DA 1H8ED 4D76A 1BTYA 1EFRD 1GI8B 1PYTD 2AIPA 1AB9C 1LHDH 4FVDA 1EAWA 1P9UA 1QB9A 3RLYH 4X1PU 1A7SA 1NRPH 3SGQE 1F92A 3M5OA 4MG3A 4Q4LA 5F03A 1D3TB 1ETRH 5HIYA 3IITA 1BHXB 1O3AA 3MU5A 1K1IA 1VITH 2P94A 2HPQH 1OWEA 3MU4A 1O5GH 2SGDE 2ZHDA 1GHVH 2XCNA 1O2QA 2PUQH 2V0BA 3LONA 4B2CA 1TALA 1QQ4A 1KDQA 3RXKA 3U69H 2BD3A 1QL8A 1FUJA 2WPIS 1A0LA 2PHBA 4DIHH 3E90B 3ATWA 1BOQA 1THSH 3VPKA 2H6MA 2GP9B 2G51A 1V2PT 1NRQH 2BQ7B 1GJ4H 1ZHRA 2BLQA 5FX5A 2AMQA 1HAXB 2GDDA 5LGOA 3N7EA 5GPIB 5KGOA 2XWAA 1SGQE 1HCGA 2WINI 4O9VA 1HJ8A 1L4ZA 3F6UH 4Y6DA 3ZVBA 2IOTA 1LQEA 2GT7A 1FZZA 3A81A 1ELEE 2O8LA 1X7AC 1C1QA 2XWBI 5JB9S 3MNBA 5H4IB 4X8VH 1UO6A 2HPPH 2PTCE 5GJ4B 1YPKH 9LPRA 4KTUA 3OY5U 3URCA 3S69A 3MNXA 3LOXA 3UNSA 1OYTH 1UHBB 1YPEH 1ZSLA 1ABIH 4AYVB 2BVXH 4MLFB 1TRNA 4BXSA 3VEQB 5EW1H 5JPMH 1AI8H 1GG6C 4GCHF 2A4OA 4E05H 1K28D 4DOQA 1GCDA 2QXIA 4ABHA 4IN2A 4Q7ZA 3RC5A 5EJZA 1DSTA 4HFPB 3ZZ7A 2C93B 4ABEA 1O3FA 5L30H 3A7TA 4ZCNA 1V2JT 1ZPBA 2JJ2D 2Z7FE 3GISB 4MPVA 2ZHEH 5T6DA 4YM9A 1P09A 5E2PA 3H09A 4BXWA 4NWKA 2GZ9A 5K0HA 3S7KB 4F55A 1GBJA 3ELAH 4JCNA 4X2VA 4SGBE 2W7SA 5BPEA 1B7XB 2FI5E 1YPMH 1GI2A 2C90B 2TGAA 1ZR0A 1NO9H 2ZZUH 3SJKA 3T26A 1MZAA 2ZG0H 1EB1H 1TNJA 1S85A 2GD4B 4AFZA 1HUTH 4ZXYH 1BTHH 1AD8H 3PLKA 1TGBA 2ZP0H 7KMEH 2RDEA 2CN0H 2ZNKH 2C8WB 5C0TA 3L3TA 5HM2A 2W6ID 3ZVFA 4QT8C 1P01A 4ZKNU 4K3JA 4CREA 2OBQA 1SLWB 5FCRA 1ZTLA 1ESTA 3RU4D 1EP5A 5IYTA 2A4RA 4VGCB 1C9PA 1O2YA 8KME2 2FOAA 1IQMA 3UR6A 2Y5HA 4X1SU 1S82A 5LPEA 1EJNA 2IN2A 3SNAA 3GCNA 1FY4A 4I8HA 1NRSH 3OU0A 1O2VA 1CBWB 4HI3A 5AF9H 3AW1A 2J38A 2TRMA 1EUFA 1VCPA 5EIYA 5ETXA 5GWZA 5DN6D 2SGQE 5C5OA 1FY5A 3HPTB 1EZSC 2R3YA 1EAUA 1UTNA 1BRUP 4NIVA 1RGQA 3OX7U 1N1LA 1JRTA 2JIZD 2BOKA 4PROA 2F9BH 1HDTH 1H4WA 4YZUA 2GZ8A 1QRZA 1NFUA 3SU5A 1L1GA 3PYHA 4TPYA 3KHVA 2AHME 3TH2H 3WWBA 1UTPA 1LTOA 3P8GA 1DLEA 4WY3A 1MTSA 3ATKA 1TGSZ 1LHGH 1O39A 1AU8A 3PB1E 3QZRA 4ISLA 1GI5A 5T1VA 1HAHH 1O0DH 4Y8ZA 4FU8A 1W13U 2BVRH 3RXPA 2JKHA 1O2OA 3S9AA 2P93A 1TNIA 4MQAA 4FUIA 1A5IA 1F5RA 3TLOA 3P17H 1S84A 3D65E 3QTOH 4FU7A 2ZCHP 1U6QA 2WPLS 1OWIA 3C27B 1T8OA 3KF2A 1TRYA 1CGHA 4CRCA 2HVYB 4Z0KA 2A5KA 4WJG2 2BY6X 1A5GH 2Z9LA 2EC9H 3HGPA 5EGMA 1A3BH 1C2LA 1EP6A 2WPJS 2C8ZB 4TY6A 2AGIX 4IGDA 3RP2A 4OS2A 1O3IA 1Y5AT 1S81A 1QURH 1O5CB 4K1SA 4M7GA 1C5UA 1CBWC 1ZJDA 1RTLA 3U1JB 4NCYA 3EE7A 3U8TH 3EYDA 3ZVEA 1C5TA 2UUJB 5CMXH 1HAZB 1H1BA 3MH7A 1YCPK 1PFXC 2FDAA 2FOEA 1BBRH 3FZZA 4UFDH 3DSPA 2NWNA 1O37A 2EI7A 1SB1H 1FMGA 1IQHA 2BY8X 2YMSC 1Z8IB 2Y82A 2P3UB 4OS4A 3N7OA 5HMAA 3TJOA 4K2YA 1BZXE 4Y10E 1GJ5H 1BJVA 3RMNH 3RC4A 1HXEH 1TNLA 4CR5A 1UCYE 4D8NA 1DOJA 1G36A 3UQVA 3CS7A 4BTTB 1O3CA 1Y3VA 4JK5A 3PMHB 3VGCB 4XOJA 1LHEH 2TBSA 2A0QB 2FYQA 1MU8B 4B71A 1TBRH 1GJ6A 2STBE 2HNTC 1GMDF 1IHSH 2FYRA 1CA0C 2KAIB 1AY6H 2AH4X 5T3HA 2HLDD 4FUGA 4AFQA 5JYIA 1C4U2 4OS1A 1W14U 1SQOA 4Y0YE 1AUTC 2QY0B 3ZZCA 2VH0A 3TU7H 5B6LA 1EAIA 1MAXA 4XDEA 1HBTH 1BRCE 2P8OB 4MNWA 1MMJN 3U1IB 2LELA 1A2CH 1KSNA 1TA2A 1G3CA 1HRTH 1MKXH 1W7GH 2FOGA 1C1OA 4NA8A 3PWBA 4Q2KA 1WAYB 1D3DB 2OXSA 1O5FH 5C94A 2LPRA 1XM1A 2BXUH 5FPSA 1DE7H 1DWEH 1ESAA 2VWOA 2SNWA 6CHAC 4I8GA 1K22H 1AMHA 2VH6A 1EKBB 1O36A 1V2KT 3M7UA 1AUJA 2A2QH 1Z6EA 1GDUA 1MTNB 4K1EA 4ABBA 2DE9A 1WU1A 1E0FD 2VWMA 5FL7D 2KCAA 2F83A 3ZVCA 3MYWA 1ABJH 1C1TA 2OLGA 1B0EA 3ATIA 1UVUH 2BLWA 1O2IA 1C5OH 4GHQA 1GI3A 3VFEA 1BTUA 5CHAC 3SNDA 3O8CA 1UK4A 1CQQA 1S6HA 3F1SB 2ZA5A 1HFDA 1W10U 4U30A 1AWHB 1BRBE 1V2UT 1BMAA 3LGUA 2ZGJA 3KEEA 4UE7H 1C5LH 2H5CA 1N6YA 1SGPE 3M7TA 4WXIA 3PM3A 2Z94A 1MD7A 2KAIA 4ZHLU 3P70B 1GMCF 1DLKB 2P59A 1CA0B 2LP6A 3HK3B 1ELBA 1QL9A 2Z9KA 1QB1A 1KYNA 1UVPA 1WTGH 2XC4A 4CH8B 4D9RA 5DP7A 5HKKD 3QK1A 1F0SA 2EEKA 2A45B 1T7CA 2D1JA 2WHXA 6CHAB 2BHGA 2CK3D 4Q7YA 7GCHG 1MAYA 3FOAA 1ELFA 1TBQH 2K1QA 1UTLM 2XOKD 2V35A 1W3CA 1K21H 2JETB 5EU8A 2AMDA 4AB8A 1TLDA 1BDAA 2WPMS 1D3QB 1Y3WA 2FODA 4JZDH 1GJ7B 1YPHE 1G3DA 3UY9A 1DX5M 5AFYH 3OEED 3RXCA 2QA9E 3LJOA 1Y3XA 4AOQA 4BAQB 5C1UA 2BYAX 1YYY1 2J98A 3GY3A 5C3NA 1UTJA 3LGYA 2PUXB 1KIGH 3ZVGA 1O34A 1LPKB 4BAKB 3CENA 1OWDA 5FCKA 1T8NA 1KLTA 1V2ST 1YPLH 1DWCH 3V7TA 2BM2A 2ZGBH 3SYJA 3EA7A 2Z9JA 2BQ6B 3EAJA 1SLVB 2DE8A 1GGDB 3TJNA 1ACBE 2A4GA 1TE0A 2ZO3H 3D23A 3RM0H 1RRKA 1C2HA 1CT2E 1K9OE 2HNTF 2KCPA 5EODA 3GDUA 3QUMP 2HALA 1PQAA 3UNRA 2K8IA 1Y5UT 3KQBA 5EXMA 1GI6A 1EB2A 2P95A 5DPAA 1C5WB 1GBCA 1BUIA 1ELVA 1O3DA 1EOJA 3F9HA 1C1NA 1K0HA 3SU6A 2FTMA 1AFQC 3MH6A 2ZTYA 1IQLA 1MKWK 1TOMH 2ZFRH 1UJ1A 2FLBH 3GS9A 4HG6A 3TH4H 2HLCA 5GIBA 1H8IH 1HAYB 1PYTC 5AFZH 1P3EA 1NZQH 3TK5A 2ZKSA 2GCHG 3KQDA 1SPJA 1NRNH 4Q63A 1ZYOA 3BN9A 5DP4A 4BTUB 3LIWA 3SBKA 1C1UH 2ZCKP 1MCTA 1QZ8A 4OS5A 2A5IA 4RKOB 1HAGE 1ANCA 1ZGVA 1QB6A 4ASUD 2ALPA 1HLTH 2ZI2H 4X8TH 1CHOF 5EPYA 1C1SA 3GDSA 1SL3A 2GT8A 1O3PB 2L74A 5LPRA 1Q31A 2ZDLA 4TWWA 2O8WA 2ZFSA 1ZLRA 4DT7B 3A84A 1FV9A 1NFWA 1ESBA 2Y7XA 1QY6A 3FFGA 1FIWA 1D4PB 2XRCA 3GOVB 2G81E 3JZ2B 4FOUC 1ZZZA 3H5CB 3O8BA 1QQUA 1WV7H 3TK6A 2HWLB 4ZXXH 1INCA 3GICB 2JH6D 3FVFB 1F5LA 1QA7A 2V7QD 3DHKH 2PKSB 1WUNH 3STIA 4TYDA 4F4OC 7ESTE 2GV7A 4VGCC 2SFAA 4K1TA 1SGTA 1QTFA 5F8ZA 4TSFD 2R2WU 2B7DH 3NWUA 2G55A 1HAVA 1Q2WA 1DUEA 3BEUA 1A4WH 2VIWA 4X1QU 3NZIA 2BY9X 1Z6JH 5LPFA 1UMAH 1LDTT 1BQYA 3RXDA 5E2OA 2OQ5A 3C1KA 1O2WA 1CHGA 3URDA 1LMWB 2A2XH 1UK2A 2VVUA 1W0ZU 2XBYA 2ZQ2A 4BTIB 3MO9A 2ULLA 1MTVA 1UTMA 1FONA 1NPMA 4J1YA 1MBQA 1NY22 1RTKA 2ZU1A 1AO5A 2Z6BD 4IN1A 1DM4B 3SZEA 3OAAD 3LGVA 1S0QA 1C2JA 3F68H 4DVAU 2O9QA 4A7IB 3TITA 2ZGCA 1LPZB 1ZRKA 3M5MA 3ODFA 2H9HA 1XXDA 2RCEA 1C5QA 2VINA 1YPGH 1BMLA 2BMGB 1HAIH 1HAVB 4ZKOU 1LQDB 4IC6A 1S0RA 1BBRK 1SQAA 2JETC 1BMFD 3A83A 1TMTH 1ZRBA 2XC5A 2F3CE 3BG4C 2FOHA 1ELTA 3PO1C 1ELGA 1ZMNA 2J4IA 5TCAA 4Y0ZE 2Y7ZA 3SORA 1TFXA 3SGBE 2YOLA 3LC5A 3LPRA 1P2QA 1DITH 1O2RA 2KX4A 1AZ8A 1YP9A 4JYTA 2QXGA 3WWFA 1GBFA 2UWLA 1O2JA 3BG8A 4OS6A 4RT0A 2QE7D 1FY3A 2BDAA 1AGJA 1O2TA 3F9EA 4LXBH 3RXMA 2CV3A 2L6OA 2C8XB 2VGCB 2SGPE 2GX4A 2FPZA 2QYIA 2QF5A 3ATMA 1QHRB 1NTPA 3LKWA 3WY8A 2BDCA 1TGNA 1YPJH 2QXHA 4KTCA 4ESTE 3SU1A 1TGTA 2Y5FA 1QIXB 4BANB 3BSQA 1O2XA 1TX8A 4FXGH 1BTWA 5C20A 4B75A 2W5EA 4F48B 1NESE 5DO4H 2FMJA 4ABAA 2FOBA 4WMDA 1FY8E 1KTTB 1KY9A 3M61U 1Y59T 2ZF0H 1O3NA 1CHOG 1QGFA 1J9CH 4Y8XA 3NK8A 4INHA 1BHXF 4K5ZA 2Q6GA 2BLVA 1BRAA 1SLUB 1T8LA 2KCOA 1IAUA 1GHBG 2RA0A 1NC6A 2VBCA 4ZKRU 1NU9A 3F2GA 3GCTG 3LT3A 2RA3A 2KCYA 1A0HB 2VIDA 1NT1A 1O32A 1CSOE 1HXFH 3DSOA 2ZQ1A 1GL1A 5IDKA 1MTWA 3RUOA 2W6JD 5HIZA 4I7YH 1DWDH 1LVYA 1DWBH 2ODPA 3UR9A 4JMYA 3SU0A 3NPSA 1VJAU 1OP2A 2PSXA 1D6RA 1KXDA 7LPRA 1PPCE 1QJ6B 2QF3A 1O35A 4AC9A 4K8YA 2ZGXH 4XD7D 3U28C 1WYKA 4ABFA 1XXFA 3VXFH 1AIXH 1JRSA 1SQRA 1Y3YA 2BXTH 1N8OC 2ZDKA 3TGJE 5EQSA 3PWCA 3BIUH 3ZZ9A 2UUYA 1PPHE 3EE0B 5DJ7A 1GI0A 1AQ7A 1Z1IA 3KN2A 3ZZ5A 2UUKB 3BV9B 1QRWA 3K2UA 4XBCA 2YMSD 4E7RG 3QWCH 1O2UA 5CE1A 4NWLA 2ZCLP 1ZGIA 2A7HA 1W7XH 2J94A 5E0JA 4E06H 3SUFA 1C1PA 3QN7A 2TIOA 3E6PH 3PRBA 4MPWA 3LH3A 3SZNA 5EJ1A 2FEQH 3UB0A 3TVJB 2PTNA 1QA0A 1TQ7B 2BY7X 4MPUA 2PP6A 1GCTB 1WOFA 2AERH 3SJ8A 1ARBA 4KKDA 2V3OH 1TBZH 1E79D 4A1TA 4Y7BA 3SJOA 3TK9A 1OSSA 2O8MA 2ANKH 3NKKA 2XBWA 2KZ4A 4GPGA 2OC8A 1W0JD 1YM0A 3U8OH 1YKTA 3HGNA 3MTYA 4IBLH 2EA3A 2ZC9H 1COWD 2VIOA 4CHAC 1UCYK 4UFEH 1TQ0B 3N7DA 1ARCA 1IHTH 2XNDD 3E91A 3GY6A 1C5SA 3PV5A 4Z6AH 2IPQX 3F0OA 2BD4A 2O8UA 3HKJB 1WDIA 5B6OA 2RDLA 1O2MA 1QRXA 4K8BA 2H5DA 4ZHAA 5JBTA 1RIWB 2D8WA 2ZU3A 3KQEA 1F0UA 4X6OA 1QCPA 4B1TA 3R3GB 1GBMA 4XE4A 3LH1A 1IQIA 4H42U 3F2FA 4KELA 5DP3A 3PV4A 5AVDA 1WSSH 3OTPA 3BTHE 1TONA 3ZZBA 4IS5A 1GJCB 1TMUH 2TPIZ 1W8BH 1RFNA 3SV6A 1ETTH 1TWXB 1DDJA 2A7JA 5J4QA 1SKYE 2PGBB 3F9FA 3EA8A 2R0LA 3H7TA 2JJ1D 1FLEE 1VGCC 2P16A 1SMFE 4RN6A 4Y76A 5AHGH 5KECA 1O3OA 2AS9A 2KM0A 3PMBB 4AGKA 1SGFA 5IK2D 1FXYA 1IQKA 1KXAA 2A4QA 2J95A 4FETA 4KP0A 1Z1JA 2D2DA 3KQ5A 3ZVAA 1GDNA 2QXJA 1A46H 2FOCA 2ZFPH 1J16A 5C1YA 1TPPA 1G2LA 4YT6H 1DY9A 3SU3A 1K1MA 2BY5X 1CO7E 3BTKE 4DCDA 3UAIC 1UTOA 3S9BA 3SV8A 2BQWB 1IQNA 3VB3A 1F7ZA 1AFEH 1QBOA 2Z3EA 4OGYA 5C5NA 1LCYA 1OX1A 1ZSJA 4AN7A 4YT7H 1O2SA 3RMOH 3QGNB 2OC7A 4RSPA 2SGEE 3SNEA 1GI7B 1EPTC 2EI6A 3A7VA 2Z3CA 3BTFE 3TPIZ 3BTGE 1ZJKA 3CP7A 1TAWA 3BTME 5C0UA 1AE8H 1KLIH 5KEDA 1OP0A 1C4Y2 1KXBA 1EJAA 4KGAA 3LGWA 3V3MA 5A0AE 2F9UA 2VGCC 3UWIA 3BEFB 2HVXA 2NU2E 4JK6A 3O8DA 4WH6A 3UFAA 2GCTC 2GV6A 1G9IE 4I33A 2BX4A 4M9FA 1MQ6A 2J92A 1C2MA 1ZHMA 3E1XB 2VIVA 3M3VA 1A5HA 2F43B 5EXLA 2WPHS 2G8TA 1G37A 1XUIA 4RT1A 2XBVA 3EGKH 1BITA 2F9VA 1D3PB 2OINA 5DP6A 1L1NA 2M5TA 1CGIE 2C8YB 4TY7A 1O3LA 4ISOA 1UHBA 1P10A 2ZEBA 3E0NB 1BTZA 2LNCA 1EZQA 4DT4A 2WSSD 1XUKA 1NFYA 1C1WH 4AX9H 1SI5H 2V3MA 1GCTC 1F2SE 5HYOA 1EZXC 3PROA 1TPSA 4JZEH 1LO6A 1Z8RA 3MO3A 4MNYA 1GBBA 1NRRH 1P57B 3M3TA 1SHYA 2BD7A 2FXRA 3QDZB 1HJ9A 2PKAB 9ESTA 1H9HE 1TNKA 1EJMA 3U9AH 2Z9IA 3HATH 3ZYEA 4TT3D 1O2LA 1YCPH 1GPZA 1SR5C 2BDGA 2OP9A 3RXOA 4CBOA 4I86A 2PGQB 8ESTE 4ASHA 1P11E 3UUZA 1TX7A 1O2NA 3K65B 1CE5A 2GJGA 1GI9B 4LZ4B 2PV9B 3MNSA 3PLPA 2AFQB 2J2UA 3FANA 1IQGA 5E8EH 1F0TA 4GCHG 1GBAA 2OBOA 1RTFB 1P12E 1V2LT 1SGYE 2GDEH 4JZFH 2VIQA 4YOIA 1O2PA 1XX9A 1MQ5A 2F4LA 2FOMB 4X6PA 1GI4A 1CT4E 2WZQA 1SOZA 1DY8A 3BTQE 1FJSA 3N99A 4A5TS 4NFFA 3OFND 1O5AB 3DA9B 2W7UA 5ABWA 3AW0A 1MCVA 4UONA 4TWYA 2PKSC 3T28A 1GBDA 3UNQA 1GHWH 2G4TA 4I8KA 3P6ZB 1P2MA 2FOFA 1E38B 4CBNA 1O2KA 4NFEA 4UD9H 4ZROA 3TNTA 3E16B 1C5ZB 3DT0H 2V3HH 1V6DA 3RXBA 1PQ8A 3T2NA 4E7NA 1ELCA 4RI0A 3SV2H 1ELAA 1LVOA 3I77A 1GMHG 4B73A 1VJ9U 1ZSKA 4WMFA 1O5BB 4R0IA 1GJAB 1FI8A 2P3FH 4CRBA 4ZKSU 1A61H 1J15A 5DP8A 4Y8YA 4O3TA 3MH5A 2WV9A 5JB8S 1MD8A 3KYGA 3RMMH 1D9IA 3Q77A 3Q76A 2G52A 2GMTB 4X6NA 5GCHG 1Y3UA 2ZWLH 2VVCA 4ISHH 3P95A 1VR1H 1E34B 1VCQA 4B2BA 3BTEE 1V2NT 2O8TA 3K9XB 2WV4A 1VITG 2ZHFH 3SQHE 3HK6B 2J5UA 4UDWH 3ZZ3A 3TGIE 2VJ1A 5GCHF 4H4FA 3A8BA 1O3EA 3RXJA 4I8LA 4X2WA 2THFB 3MOCA 3DSGA 4NA7A 1AHTH 1P2KA 3RDZA 3A7YA 3JZ1B 1V3XA 1P2IA 5C17A 3A8AA 3HKIB 1TB6H 3UIRA 1YWUA 3UQOA 5TJXA 3GCOA 1FY1A 1MBMA 2CHAC 2G5VA 1AVGH 1TX6A 2BB4A 1GMCG 3SNCA 5PTPA 3FAOA 2EI8A 4X1RU 3LGIA 1T4VH 1GHAG 3A87A 4Y71A 1JIMA 1GBHA 5GDSH 4YOGA 1AKSB 1TRMA 5CDFE 5F8TA 1MABB 2XC0A 5E0HA 1EZUC 1EQ9A 2HOBA 1C2EA 2ZDNA 3ZV9A 2B8OH 1DXWA 1K1PA 5FPYA 3LU9B 1P02A 3EDXB 4HZHA 2BOHB 1O3KA 3QX5H 3BF6H 4A1XA 3SUDA 3KGPA 2ANYA 3FP8E 1CVWH 1B5GH 3ATLA 5JBBS 1VITF 1QBNA 4NIWA 2OQUA 2OK5A 3PTNA 2WPKS 1THRH 2B9LA 3VB7A 4GLYA 5A2MH 1K1OA 1YBWA 3V0XA 3STJA 2VVVA 4ABGA 1XKAC 1ORFA 1L1JA 1B0FA 1UTKA 2M2AA 5EPNA 1EX3A 1ZHPA 3SHAH 5FHTA 1O5DH 3W95A 2WPDD 3ZIAD 2AGGX 2ZU2A 1P06A 1NU7B 2PWXA 3A8CA 2BDIA 4XSKU 1O31A 4BAMB 3FZDA 4WH8A 1BBRE 1EPTA 1TNHA 2BD2A 8LPRA 4JYUH 1DSUA 1T31A 4THNH 6LPRA 2ZECA 3SV7A 2W26A 1SGEE 2W3KA 4ZH8A 4CH2B 1OYQA 3EQ0H 4ABDA 5SGAE 3SHCH 3CNRA 3V13A 4B6EA 2FI4E 3A7ZA 4A6LA 1G32B 2V6NA 4DURA 4I32A 1PPBH 4R8TB 1HAOH 5FBIA 3GCHC 3BTDE 4FVBA 4YESB 5C2ZA 2J97A 3MI4A 4CRAA 2FZZA 3ZZ6A 1SC8U 1FN8A 1VGCB 4FUJA 2VU8E 1RD3B 3F0PA 1P04A 1WQSA 4ISIH 2HNTE 2OUAA 1G3EA 1MTNC 1ZTKA 3PMAB 5T6GA 2FX6A 4MDSA 2GMTC 3LDXH 5CHAB 3G01A 3OSYA 3FP6E 2ALVA
chains in the Genus database with same CATH topology
1YGCH 2CF8H 3MU1A 1A1RA 3RM2H 6ESTA 2ZDVH 2DUCA 3RU4E 6GCHG 5L6NH 4WXVA 1KXEA 1HIAA 2FO9A 2J34A 7GCHF 1AWFH 5EW2H 3M5LA 4UFGH 3SO3A 3RXEA 4NSVA 3ZZAA 1HV7A 1TPAE 3RMLH 3SI3H 1GMDG 3U98H 4JYVH 3SJ9A 2ODYB 2I6SA 4DG4A 1C5VA 1SQTA 1UK3A 3FP7E 1SG8B 2R2MB 2TGPZ 2FM2A 1FDPA 1UVSH 4LOYH 1VZQH 4LK4A 2FS9A 1K1LA 1O33A 1RJXB 3MWIU 3OY6U 3PTBA 1FPHH 1H8DH 4JZIA 4GAWA 4J2YB 3AASA 4WVPE 1XUHA 1EATA 4AGJA 1ANEA 1T32A 3SGAE 4OS7A 1YC0A 2WYJA 1GJBB 1C2FA 2FP7B 1J14A 4FUCA 1KXFA 2QAAA 2YNBA 2XYAA 2PLXA 1PQ5A 3SU4A 1GDQA 5L2ZH 1G30B 3MMGA 1LVMA 4IW4E 1D6WA 5EQRA 3RLWH 1Z71A 2ZFTA 2Z9GA 5ESBA 2UWOA 1C1MA 1DXPA 4ISNA 2F9PA 4NIXA 3KQCA 1IQEA 3SW2B 4GHTA 2VNTA 1V2OT 2ZDAH 3M35A 3ZYDA 1J8AA 1SHHB 2FTLE 3UTUH 5DP9A 4CRGA 1VCWA 3Q3KA 1O38A 1GWAA 3GYMA 1XUFA 2ZPSA 1AN1E 1BT7A 4O3UA 1TMBH 1F5KU 1K1JA 3KNXA 1C5YB 1MKXK 1SVPA 3A7XA 1OKXA 1SFQB 1XUGA 1Z7KA 3GY7A 1Y8TA 1GHYH 4IC5A 1GJ9B 3MHWU 3MO6A 4F49A 2C4FH 4D7FA 1CT0E 1HIAB 1LHFH 4CRDA 5GXPA 1BJUA 3A7WA 1JXPA 3A85A 1QL7A 1GBEA 2BZAA 3AVZA 1SGNE 1KDQB 3O8RA 3KIDU 1ANDA 1CU1A 1ELDE 2WUCA 1KLJH 4NGAH 4D7GA 3M7QA 1BTPA 3VGCC 1SGIB 2OTVA 4GVUA 1JBUH 3SNBA 5A8YA 2A5AA 2QC2A 3R0FA 4I31A 1YLCA 2STAE 5JBCS 3ODDA 3PMJA 1E37B 1XVMA 1OWKA 1HJAC 1SGRE 2SGAA 4IMZA 3GCTF 2R3UA 4U2WA 1AKSA 5EOKA 2G5NA 2VB0A 4O03A 4HTCH 3MFJA 3MH4A 2TGTA 1KTSB 1V2QT 4WMEA 2Q1JA 3OYPA 2Q6FA 5L2YH 3RC6A 2H1UA 2ZGHA 3RXRA 1JIRA 5T6FA 4I8JA 1GVLA 4INKA 1P05A 2WYGA 1SFIA 1DFPA 3RXHA 4XBDA 1RS0A 2RG3A 2FS8A 1GBTA 1WCZA 1KXCA 4B76A 2NU1E 4NZLA 1C5RA 2BD9A 3AAUA 1DICA 1ZPZA 2VWLA 2QF0A 3NUMA 1SSXA 1P03A 1PJPA 3H7OA 1MH0A 2ZIQH 1YPHC 1P8VC 5DK1A 2OCVB 1GGDC 4JZ1A 3NCLA 3T5FH 1GL0E 1OOKB 4AORA 1BIOA 1O2GH 2PW8H 4ZMAH 3KCGH 3RXUA 3W94A 5FBEA 2CHAB 1C5XB 4B2AA 4Q7XA 1G2MA 2UUFB 2XBXA 2P8OC 2FESH 3QO6A 1TABE 3V12A 3SV9A 3B8JA 1DUAA 1HAPH 2ILNA 5HM9A 1TOCB 2OC1A 1ZOMA 4A1VA 2R0KA 3MU0A 2OC0A 1Z8GA 1OPHB 1QJ7B 4MNXA 2WV5A 4KTSA 1MKWH 3P8OA 1H9IE 4K60A 2ESTE 2BDYA 1HYLA 3LJJA 1QFKH 3BTTE 1MTUA 1GHAF 1NFXA 1A0JA 1C1VH 2PKAA 2Y5GA 3UOUA 4RKJB 4DGJA 1P2NA 3VB6A 1EPTB 1O3BA 4YO9A 4IMQA 4NIYA 4BAOB 1OXGA 1W12U 1OWJA 1AVXA 3TJVA 1YF4A 5HGGA 4Q80A 4A92A 2SGFE 4H6TA 1V2WT 1PPGE 2A32A 4U32A 3SQEE 2GCHF 1O2ZA 5E0GA 1L2EA 2JH5D 8GCHF 3SUEA 5I46H 1XMNB 3SN8A 1K1NA 2BDHA 3E8LA 1C1RA 3L6PA 4NA9H 3TH3H 4HGCA 2FLRH 2PFEA 1EOLA 4DJZB 2ZFQH 2HRVA 2BDBA 1FN6A 3E3TA 4NG9H 3SI4H 4BNRA 1MZDA 4AFSA 4GUXA 4YOJA 4MVNA 1H9LB 4OGXA 3TNSA 1Q3XA 3QTVH 1XUJA 4XBBA 1CA8B 3DFJA 5HXFA 1AE5A 1GBLA 1PPEE 1RIWC 1A3EH 3SOSA 3GCHB 1UVTH 1NROH 1C2DA 2UWPA 4K69A 3P8FA 4BOHA 1EASA 3TJUA 1DT2A 1HGTH 3PLBA 2BD8A 2NU0E 5EXNA 3UWJH 1T4UH 5K7RA 4X1NU 1GJDB 1C2GA 5FXLA 2CJIA 1NN6A 1UCYH 3DD2H 1AZZA 8GCHG 1JMOH 4FU9A 4Y79A 1W0YH 4X8SH 3OTJE 4Y11E 3K6ZA 3RXIA 3A86A 5JDUB 3B9FH 3QLPH 1IOEA 3M36A 3MNCA 1QJ1B 1SGFG 2G00A 3BIVH 2A1DB 1TIOA 4ABIA 1ANBA 2PSYA 1L0ZA 1BB0B 1S5SA 2ZTXA 1V2RT 3DUXH 5DG6A 1Y5BT 5DGJA 2F9OA 1FIZA 2ANMH 5EG4A 1TA6A 1DANH 2ZPRA 1EXFA 3RXVA 2ZPQA 1G3BA 1S6FA 3BTWE 3ZZ4A 3LGTA 4CRFA 1ZPCA 4ZUHA 1BCUH 2HGTH 1MU6B 2GKVE 1HPGA 4FUEA 4FUDA 4WWYA 2BVSH 3MU8A 1O3GA 4UEHH 3T29A 5J4SA 1WBGB 1GJ8B 4X0WU 4AG2A 1HJAB 1OP8A 3P8NA 4H6SB 1GVZA 2AEIH 1GVKB 3ZZ8A 3GY8A 2XW9A 2IJOB 1PQ7A 1AVWA 3RXLA 5A0CA 2GCTB 1DVAH 1LKAA 3M3SA 2Q6DA 3CS0A 5ESTE 1LVBA 1P2JA 2F91A 4B74A 3VB5A 3A82A 4DY7B 1WTHD 3M37A 5FAHA 2GZ7A 4YLQH 2VIPA 1XKBC 5FPTA 4AG1A 1UVOA 1YLDA 2XXLA 2CXVA 4DW2U 4FUBA 4UFFH 3BEIB 3NXPA 1O3MA 1NM6A 2GGVB 4O97A 2NU3E 2CF9H 1V2VT 2B0FA 1BTXA 1GMHF 2P3TB 4FUFA 2TGDA 2ZFFH 3TIUA 1IQFA 1FPCH 1LPGB 1RXPA 3LC3A 1ETSH 3TGKE 5A09A 4SGAE 3ZZDA 1JWTA 1C2KA 1P3CA 1FQ3A 3GY4A 1CGJE 2A31A 3Q00A 2H2ZA 2FIRH 1C5MD 2QIQA 1DPOA 1Z8JB 1GG6B 5A8ZA 3ZV8A 4YLUA 3M5NA 2AGEX 3L33A 1P0SH 2BX3A 1TNGA 1P2OA 2AYWA 3SU2A 1FNIA 1BMMH 3GYLB 3UREA 2GVFA 3A8DA 4MNVA 4INLA 3S9CA 4NZQA 2C3SA 3AAVA 3SUGA 3GY2A 1LHCH 2BD5A 2YNAA 5FX6A 1S83A 1TGCA 4BAHB 4NSYA 2XNIA 4WF8A 3IG6B 4ZHMU 3RXTA 5F6MA 6GCHF 1OS8A 1TYNA 1C5NH 2R9PA 3QGJA 1HNEE 3D62A 3VB4A 3I29A 3ENSB 4MTBA 1F0RA 3SJIA 2BZ6H 3RXFA 2Y6TA 3UPEA 3S0NA 1SBWA 4X2YA 2ZDMA 5G4BA 3RU4T 1JOUB 3S7HB 2NU4E 1GBKA 2ZHQH 4Y7AA 1V2MT 2GTBA 5BRRE 3EA9A 1SGCA 1C2IA 1QR3E 1O30A 2WUBA 4AFUA 5EQQA 1BMNH 2W3IA 3VXEH 1C9TA 4ABJA 3PO1B 1J17T 1V2TT 3BG4B 3ZVDA 1E36B 3KL6A 2ASUB 3T25A 5JBAS 1GI1A 2FX4A 4XFQA 4CHAB 4MPXA 2ANWA 3A89A 2QGRA 5A8XA 1N6XA 3GDVA 1PPFE 5F8XA 1M9UA 3ITIA 2ZU5A 2BTCE 1O3JA 1E35B 1BA8B 1SGDE 2QCYA 3T27A 3A88A 1GBIA 2G4UA 4YTAA 1TPOA 1O3HA 1WQVH 4AB9A 1GHXH 2IPHA 3T62A 1N8OB 2JH0D 2QV1A 2FI3E 4TPIZ 1K2I1 3Q3XA 4GSOA 3D49H 2ZHWH 4X8UH 1GHZA 1YCPM 5DP5A 3IWMA 1FAKH 4DIIH 5I25A 1AFQB 1P9SA 4ZAEA 1C5PA 1W2KH 4X2XA 1ZMLA 2ZU4A 2I6QA 1O5EH 2B5TB 1EAXA 1L4DA 1HB0B 1LKBA 2A7CA 2Y80A 2SNVA 1QNJA 2BLOA 2J9NA 1W11U 1IQJA 2F9NA 2FWWA 3QZQA 5C1XA 2XCFA 2XTTB 1MUEB 1DS2E 1QBVH 2ODQA 4FUHA 3K6YA 3B23B 4D9QA 2D26C 3A80A 1SLXB 3RXAA 1UTQA 1GHBF 3RXSA 3Q3YA 2QN5T 1SOTA 5LH8A 2CGAA 3RXGA 3I78A 1OWHA 5A0BA 4LZ1H 1XVOA 1C4V2 3GY5A 5TCCA 5DKMA 2PR3A 3DFLA 2OD3B 2AMPA 3ESTA 1NS3A 4CR9A 1O2HA 4AZ2B 3UOPA 1THPB 3E0PB 2CMYA 1ID5H 4AYYB 2H9TH 1T8MA 1AB9B 2ZTZA 2H9EH 5C67A 4U01A 3P92A 3U8RH 1ZTJA 1PPZA 4X6MA 3RXQA 1FAXA 1ZMJA 2VWNA 3F9GA 2Y81A 2AIQA 2Z3DA 4D76A 1BTYA 1GI8B 1PYTD 2AIPA 1AB9C 1LHDH 4FVDA 1EAWA 1P9UA 1QB9A 3RLYH 4X1PU 1A7SA 1NRPH 3SGQE 1F92A 3M5OA 4MG3A 5F03A 1D3TB 1ETRH 3IITA 1BHXB 1O3AA 3MU5A 1K1IA 1VITH 2P94A 2HPQH 1OWEA 3MU4A 1O5GH 2SGDE 2ZHDA 1GHVH 2XCNA 1O2QA 2PUQH 2V0BA 3LONA 4B2CA 1TALA 1QQ4A 1KDQA 3RXKA 3U69H 2BD3A 1QL8A 1FUJA 2WPIS 1A0LA 2PHBA 4DIHH 3E90B 3ATWA 1BOQA 1THSH 3VPKA 2H6MA 2GP9B 2G51A 1V2PT 1NRQH 2BQ7B 1GJ4H 1ZHRA 2BLQA 5FX5A 2AMQA 1HAXB 2GDDA 5LGOA 5GPIB 2XWAA 1SGQE 1HCGA 2WINI 4O9VA 1HJ8A 1L4ZA 3F6UH 4Y6DA 3ZVBA 2IOTA 1LQEA 2GT7A 1FZZA 3A81A 1ELEE 2O8LA 1X7AC 1C1QA 2XWBI 5JB9S 3MNBA 5H4IB 4X8VH 1UO6A 2HPPH 2PTCE 5GJ4B 1YPKH 9LPRA 4KTUA 3OY5U 3URCA 3S69A 3MNXA 3LOXA 3UNSA 1OYTH 1UHBB 1YPEH 1ZSLA 1ABIH 4AYVB 2BVXH 4MLFB 1TRNA 4BXSA 3VEQB 5EW1H 5JPMH 1AI8H 1GG6C 4GCHF 2A4OA 4E05H 1K28D 4DOQA 1GCDA 2QXIA 4ABHA 4IN2A 4Q7ZA 3RC5A 1DSTA 4HFPB 3ZZ7A 2C93B 4ABEA 1O3FA 5L30H 3A7TA 1V2JT 1ZPBA 2Z7FE 4MPVA 3GISB 5T6DA 2ZHEH 4YM9A 1P09A 5E2PA 4BXWA 4NWKA 2GZ9A 5K0HA 3S7KB 1GBJA 3ELAH 4JCNA 4X2VA 4SGBE 2W7SA 5BPEA 1B7XB 2FI5E 1YPMH 1GI2A 2C90B 2TGAA 1ZR0A 1NO9H 2ZZUH 3SJKA 3T26A 1MZAA 2ZG0H 1EB1H 1TNJA 1S85A 2GD4B 4AFZA 1HUTH 4ZXYH 1BTHH 1AD8H 3PLKA 1TGBA 2ZP0H 7KMEH 2CN0H 2ZNKH 2C8WB 3L3TA 5HM2A 3ZVFA 4QT8C 1P01A 4ZKNU 4K3JA 4CREA 2OBQA 1SLWB 5FCRA 1ZTLA 1ESTA 3RU4D 1EP5A 5IYTA 2A4RA 4VGCB 1C9PA 1O2YA 8KME2 2FOAA 1IQMA 3UR6A 2Y5HA 4X1SU 1S82A 5LPEA 1EJNA 2IN2A 3SNAA 3GCNA 1FY4A 4I8HA 1NRSH 3OU0A 1O2VA 1CBWB 4HI3A 5AF9H 3AW1A 2J38A 2TRMA 1EUFA 1VCPA 5GWZA 5ETXA 2SGQE 5C5OA 1FY5A 3HPTB 1EZSC 2R3YA 1EAUA 1UTNA 1BRUP 4NIVA 1RGQA 3OX7U 1N1LA 1JRTA 2BOKA 4PROA 2F9BH 1HDTH 1H4WA 4YZUA 2GZ8A 1QRZA 1NFUA 3SU5A 1L1GA 3PYHA 4TPYA 3KHVA 3TH2H 1UTPA 1LTOA 3P8GA 1DLEA 4WY3A 1MTSA 3ATKA 1TGSZ 1LHGH 1O39A 1AU8A 3PB1E 3QZRA 4ISLA 1GI5A 1HAHH 1O0DH 4Y8ZA 4FU8A 1W13U 2BVRH 3RXPA 2JKHA 1O2OA 3S9AA 2P93A 1TNIA 4MQAA 4FUIA 1A5IA 1F5RA 3TLOA 3P17H 1S84A 3D65E 3QTOH 4FU7A 2ZCHP 1U6QA 2WPLS 1OWIA 3C27B 1T8OA 3KF2A 1TRYA 1CGHA 4CRCA 4Z0KA 2A5KA 4WJG2 2BY6X 1A5GH 2Z9LA 2EC9H 3HGPA 5EGMA 1A3BH 1C2LA 1EP6A 2WPJS 2C8ZB 4TY6A 2AGIX 4IGDA 3RP2A 4OS2A 1O3IA 1Y5AT 1S81A 1QURH 1O5CB 4K1SA 4M7GA 1C5UA 1CBWC 1ZJDA 1RTLA 3U1JB 4NCYA 3U8TH 3EYDA 3ZVEA 1C5TA 2UUJB 5CMXH 1HAZB 1H1BA 3MH7A 1YCPK 1PFXC 2FDAA 2FOEA 1BBRH 3FZZA 4UFDH 2NWNA 1O37A 2EI7A 1SB1H 1FMGA 1IQHA 2BY8X 1Z8IB 2Y82A 2P3UB 4OS4A 3N7OA 5HMAA 3TJOA 4K2YA 1BZXE 4Y10E 1GJ5H 1BJVA 3RMNH 3RC4A 1HXEH 1TNLA 4CR5A 1UCYE 4D8NA 1DOJA 1G36A 3UQVA 3CS7A 4BTTB 1O3CA 1Y3VA 4JK5A 3PMHB 3VGCB 4XOJA 1LHEH 2TBSA 2A0QB 2FYQA 1MU8B 4B71A 1TBRH 1GJ6A 2STBE 2HNTC 1GMDF 1IHSH 2FYRA