4WXVA

Human cationic trypsin k97d mutant in complex with bovine pancreatic trypsin inhibitor (bpti)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
224
structure length
224
Chain Sequence
IVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRDTLNNDIMLIKLSSRAVINAHVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDAGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIAANS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Trypsin-1
publication title Mesotrypsin Has Evolved Four Unique Residues to Cleave Trypsin Inhibitors as Substrates.
pubmed doi rcsb
source organism Homo sapiens
total genus 60
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2014-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4wxvA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4wxvA02
2A7JA 3KN2A 3QWCH 4NCYA 1UVUH 1QCPA 3MFJA 2H9EH 3TNSA 1FI8A 2SGQE 4CRFA 1QB6A 4ZKNU 1O2LA 2A31A 4ZKRU 1Y8TA 1O3GA 2FOAA 4FUEA 3ZVEA 4ABHA 1MTNB 1CGHA 4ABAA 1KLIH 4O97A 1LPZB 1AVGH 4DVAU 4Y8XA 3RXUA 2AGEX 1TAWA 1XVOA 1NC6A 1LPGB 1UTOA 1TBQH 3ATIA 2CHAB 1ABIH 4YOGA 3SZNA 2G81E 1FZZA 1O2IA 1LHEH 4ABJA 1TX7A 1F2SE 1F5KU 1BCUH 1K2I1 1C2JA 2EI7A 3PWBA 4IN2A 5DPAA 3U8RH 3FANA 1V2QT 1DS2E 5IYTA 1GCTB 1EJMA 1SGNE 2QXJA 2CN0H 4ASHA 1MKXK 1ZGIA 2XCNA 2B0FA 1GHAF 3KNXA 3F9HA 4X1NU 4IGDA 9ESTA 2GZ9A 2GV6A 2PWXA 1DWDH 4TY6A 1MKXH 4X1PU 5DP6A 3RXAA 1C2HA 1ORFA 2G00A 5IDKA 1AB9B 2BQWB 1TRNA 2UWPA 1H9HE 1LHGH 1W0YH 1CBWC 3RXQA 1SLWB 2P93A 5C1XA 2BLQA 1FPHH 1O2SA 3SV9A 2ANMH 2W5EA 3HK6B 1G9IE 1VR1H 2BD8A 1C2DA 3E90B 3LGUA 3Q3XA 1Z8IB 3OSYA 4I8HA 2VWMA 1CHGA 1BTPA 2NU4E 4ABBA 2XWAA 1O3HA 1INCA 3M5OA 1WOFA 2D26C 1ACBE 2F9UA 3GICB 2FYQA 1YC0A 1AKSB 4Z0KA 1DWCH 1DT2A 2QY0B 4FVBA 4WWYA 3F9GA 3RXIA 1BQYA 1K1MA 1DPOA 2ZFPH 1RIWB 1EP6A 1TGTA 2P8OB 1C1OA 4CRDA 1ZSKA 6ESTA 1XUGA 1ELTA 3PLPA 4FUJA 1ELAA 3BG4B 4FU7A 3JZ1B 1NS3A 5DJ7A 4Y8ZA 1F0TA 3NWUA 2VINA 1QL8A 3LJOA 4D7GA 1W13U 1D6WA 4O9VA 5EGMA 4BAMB 2EI6A 3A87A 1EKBB 4R0IA 2ULLA 5HM2A 4ZROA 5C5NA 4BTTB 1MMJN 3RMMH 1L4ZA 1C5OH 1W12U 5EXNA 3MNXA 3A85A 4THNH 3ZZ7A 2ILNA 1ETTH 1A7SA 2PW8H 1JMOH 3T5FH 2ZU5A 5EQQA 5F8TA 1O2PA 2KAIA 2BX4A 1EUFA 1C5LH 3S7KB 1TX6A 2FP7B 2VVUA 4CBNA 1GBJA 1MCVA 1UCYK 3LJJA 1HIAA 9LPRA 3D49H 3K65B 1CE5A 1LTOA 3D62A 1OS8A 4B2CA 1O32A 1L1NA 1HCGA 2D8WA 1UCYH 1MKWK 1EPTC 1DSUA 1ZJKA 1MAYA 1KTSB 2PGQB 2PTNA 3TK9A 4A1TA 2BZ6H 1A0HB 2QF3A 1MKWH 1Z6EA 4CRCA 2VIQA 3SU3A 1GJBB 3TJUA 2XBVA 3JZ2B 1DXWA 2J92A 4DIHH 4X1SU 4HZHA 2AYWA 4AX9H 2A7HA 2CXVA 2PKSC 3M61U 1ZPCA 4K1EA 4Q7ZA 1G37A 1NRPH 3BG8A 2GCHF 2QIQA 1GG6B 3D23A 1GBAA 2Z94A 4U2WA 2VIPA 1C5XB 2FZZA 4NFEA 5H4IB 1O36A 4K8BA 1O2OA 3MMGA 1D6RA 3FP8E 4YLQH 3KEEA 3GDVA 1OP2A 1VCQA 1B0FA 5EG4A 2P3FH 3MTYA 3SJIA 3MU8A 2HGTH 4JYVH 4BAKB 2OCVB 3RC6A 1TQ7B 3BSQA 1EXFA 1UVTH 1HAVB 2SNWA 2BD2A 2FS9A 1VCPA 2R0KA 2BDAA 1ID5H 4J2YB 1IQNA 1YPEH 4GHQA 1VGCB 2IN2A 1GBEA 1FAXA 1BRUP 2W7UA 1UVOA 2XYAA 1C9TA 1GMCG 1NRNH 1ANBA 1QQ4A 1GI4A 2ZGXH 1XVMA 4GVUA 3FVFB 2GP9B 3A81A 1LCYA 1GI2A 1UO6A 2BM2A 1H9LB 3G01A 4OGXA 2Y5FA 1V3XA 2FWWA 3N7OA 3BV9B 2K1QA 1QRXA 1WQSA 3ZZ8A 1IQGA 3CS7A 3GY8A 1MBQA 2A4OA 4ZXYH 1B7XB 1QR3E 4WY3A 2ZDKA 2WPMS 3TJVA 2B5TB 1FXYA 1P3EA 1Z8GA 3RM0H 4D9QA 2C8XB 1ZTJA 2B7DH 3SUFA 3SNBA 3S9CA 4ABFA 4AGKA 5TCAA 4NIYA 2TGPZ 4NA7A 4YLUA 2BLWA 4IC6A 1P12E 3EE0B 4Y76A 3RMNH 3KF2A 4Y0YE 3RXHA 1S0QA 4YOJA 5EPNA 1P2OA 2VIVA 4JZ1A 3RLYH 1D3DB 3QLPH 1XUKA 4X0WU 3RLWH 2ANWA 3GOVB 1QA0A 4VGCB 2TGAA 1ARCA 3RP2A 4A92A 1IHSH 1O3JA 2ZWLH 1A4WH 1V2RT 1K1IA 2Z6BD 1QHRB 2Z9LA 4ISNA 2QXGA 1LHFH 4CRGA 2FI5E 1YLCA 5FPTA 1RRKA 1AVXA 1BMAA 1L0ZA 3LGIA 1KLTA 1UTKA 2BD7A 5C1YA 1ZSJA 1GJAB 5AHGH 1C1NA 4UD9H 1DXPA 3MH6A 1NFYA 3S9BA 5DKMA 2PV9B 1S0RA 1O2UA 1MZAA 1BTUA 1TMTH 3BTWE 1RXPA 2BDIA 3FAOA 4INKA 1ZHMA 4OS5A 1GGDC 3PMHB 3E6PH 2AFQB 4NZQA 2XRCA 3MNBA 4B2AA 2GV7A 1BHXF 2BD4A 2ZDAH 3OTJE 5EQRA 3QTOH 1S85A 1HAXB 5GDSH 1C1VH 1V2TT 1ESTA 1AZZA 1GWAA 1LVOA 5E0GA 3SV7A 1C1SA 3RXCA 2ZTXA 2IPHA 3KCGH 1AGJA 3VEQB 2F9BH 2OTVA 3SU4A 3LGVA 3OY6U 3MU0A 3RU4D 3EA7A 4LZ4B 5A2MH 1MTNC 1SQAA 1JIMA 1VJAU 7KMEH 3M3VA 2A0QB 1MU8B 1HAIH 2VGCB 5ESTE 2BDBA 1E35B 3DFLA 1PPZA 1P10A 2CHAC 4OS6A 1CQQA 4R8TB 2FM2A 1FONA 4AOQA 1PQ8A 2NU1E 2HWLB 3A89A 1WAYB 1L2EA 5JBCS 1C1RA 1GBDA 2FS8A 5EXLA 2NU2E 1O2TA 1GCTC 4XBDA 1NFWA 2BD3A 2F9NA 1V2PT 2BVRH 2YOLA 1GBKA 3UUZA 4LOYH 4NSVA 1OXGA 2ZZUH 1MTVA 3A8BA 1YPLH 3TNTA 1P9SA 4X8VH 1AB9C 1O38A 1K1LA 1KXFA 3A80A 1CHOF 1EJNA 2O8UA 1GHYH 4LK4A 1N6XA 5EW1H 3MOCA 5DP3A 3NCLA 5C5OA 1YPGH 3QGNB 5K0HA 3GY4A 2H2ZA 2O8MA 1W10U 2OC8A 1O3NA 1EX3A 5C2ZA 1SGRE 3Q00A 2BX3A 4AG2A 4FU9A 5FXLA 2ZGCA 5A8XA 2A4RA 4X8TH 2FODA 2FX4A 4NG9H 1EPTA 4AYVB 2STBE 1SLVB 1EP5A 2TBSA 4E7RG 1DE7H 1Y3YA 1ZPBA 1PPEE 1C4V2 3LH1A 1TBRH 2H5CA 2CF9H 1E0FD 3FFGA 1O37A 1ELGA 1MTUA 1RIWC 1V2UT 2P8OC 1ZR0A 1IQLA 1KLJH 5K7RA 1GI1A 1MD7A 3MU1A 3BG4C 1S84A 1GMHG 4FUHA 3URDA 3RU4E 1MD8A 2ZHDA 3SJ9A 1LPKB 3R0FA 1SLXB 1ELCA 4YESB 1V2VT 1G3BA 1GI9B 1ELEE 4WVPE 3ZZBA 1W11U 5JB9S 4QT8C 3LGYA 7LPRA 1XUJA 1O3AA 2WUBA 1FY1A 4GPGA 1IQJA 1HDTH 5JBTA 3D65E 4Y79A 4MNYA 1QB1A 2GZ8A 4RSPA 1J14A 4KTSA 3S9AA 1K1OA 4GUXA 4JZDH 1DITH 2A2XH 3DFJA 4KKDA 3KIDU 3T26A 5EOKA 1WV7H 2HLCA 3Q3YA 1THPB 2VWLA 2Z3CA 1RJXB 1TPSA 3RXOA 2A45B 2QV1A 5LPRA 1AZ8A 1AFQB 1S6HA 3RXDA 4Y6DA 1PYTD 1KXCA 3KQBA 2THFB 4AFZA 1NROH 1ZMJA 1XKBC 5EQSA 1C1QA 4LZ1H 4INLA 1VCWA 1TGCA 1O5GH 2BXTH 1HUTH 1P57B 4B73A 2FIRH 3SU6A 3GCTG 3KQEA 1BTXA 1J16A 1C5SA 1TGBA 1DFPA 2SGFE 1GBTA 2FOMB 3SUDA 4FU8A 1JXPA 1QTFA 1VITF 3GCHB 1GJ6A 4Q7XA 1C5RA 5FBEA 1TOCB 2ZFFH 1GG6C 3RDZA 1OWIA 4Q2KA 1C1UH 3TK5A 1GHBG 2C3SA 3SGQE 1O3LA 1C5VA 8KME2 2Y5GA 2ZCHP 4O3UA 3ZVBA 3M35A 2ODPA 1SFQB 1MBMA 1AFEH 1HJ9A 1TMUH 2ZHWH 2C8YB 2PR3A 3SOSA 1KDQB 1C2IA 2WINI 2ZU2A 1B5GH 4UDWH 4X6NA 1KDQA 5F03A 1A1RA 1OYQA 4UFDH 2VWNA 2XW9A 4Y7BA 2XWBI 1QURH 2RDLA 1XUFA 3BEFB 5SGAE 2FI4E 3BTDE 4X2XA 1VGCC 2Z3EA 1Y3WA 1TRMA 2GDDA 2VIOA 5F8ZA 3VXEH 5GJ4B 5HMAA 1SOZA 4ZKSU 2FOFA 5GIBA 1C5MD 3M3SA 4AGJA 1J15A 4MPWA 3BTHE 2PSXA 4XSKU 1BB0B 1GBLA 2BB4A 3W94A 3VGCB 3HGNA 1CU1A 3GY2A 2OD3B 3HPTB 4ZKOU 3QN7A 1GJ7B 1GBMA 1GVLA 3LGWA 3KHVA 1E36B 3RM2H 3PMAB 2BDHA 3EA9A 4BAHB 1EOJA 2CJIA 1Z8RA 2ZP0H 2UUYA 1DWBH 1G3EA 4U30A 3BTEE 1AIXH 2G55A 1GBFA 2ZA5A 2FXRA 4CBOA 2EC9H 1A2CH 4JZEH 2ZU4A 4CREA 1HAGE 1ELFA 1ZRKA 3MHWU 4ZHAA 5FX6A 2PKAB 3ZV8A 1YPHC 2BDCA 1NTPA 1P03A 4VGCC 1GDQA 1N1LA 1UK3A 3UIRA 1SSXA 1THRH 1LVBA 4TPYA 1WU1A 1OWHA 2EEKA 4AB8A 2ALPA 2XCFA 1RTFB 1BTWA 1XKAC 1H9IE 1LMWB 4BXWA 4X2WA 2OBQA 1P0SH 4YZUA 1O3EA 5HYOA 2W3IA 3RXTA 2EI8A 1JBUH 2PLXA 3K9XB 3M37A 1MCTA 4ABDA 1SGIB 4X8SH 1GHXH 3MNCA 3TPIZ 1ESAA 1IQIA 1GI5A 3A8DA 3U1IB 1NRSH 2AMDA 4FXGH 4D7FA 1BTYA 1E34B 1O34A 1ZRBA 4BAQB 2TGDA 3BTFE 3L33A 1YPJH 3Q3KA 4DG4A 1A5IA 2VJ1A 2A5AA 2QXHA 1BZXE 3PMBB 2B9LA 2YNBA 1GBCA 1SGCA 4HTCH 1OP8A 1Y5AT 1WTGH 1SG8B 3K2UA 5EU8A 3T62A 1Y5UT 1DWEH 1K1JA 1O2XA 1EZUC 2VVCA 2F9VA 2AGIX 5CHAB 1T32A 4GHTA 3V0XA 4OGYA 2PUXB 2ZEBA 1MQ5A 1YCPK 1XX9A 2HOBA 4OS4A 3DD2H 3QTVH 4WXVA 5BPEA 2Z7FE 1AKSA 4CR5A 2VGCC 2AH4X 1YCPH 1ZTKA 4I8JA 2WV4A 5JBAS 1OWKA 2ZPRA 3GYMA 1SGDE 1O33A 3TH4H 1ANEA 1IOEA 1O2VA 4I31A 3UNSA 4CHAB 1O5DH 1ELVA 2RG3A 3QGJA 3SORA 4A1XA 3A83A 2ZGJA 2RA0A 3E91A 1FLEE 3ZVGA 2JH5D 3W95A 1SHYA 3A88A 2PFEA 2GTBA 5DG6A 5LPEA 4BAOB 2HNTC 3HATH 3DHKH 5DP4A 3SW2B 1PQ5A 2ZGBH 1GDUA 4Y11E 2GMTB 1DOJA 1TALA 1S5SA 5T3HA 3KL6A 1AN1E 2STAE 1C4Y2 5J4SA 4GCHF 2XTTB 1V2NT 7GCHF 4K3JA 1AY6H 3A84A 3VXFH 1P2IA 4MNWA 2BD5A 2VNTA 1FUJA 1PPGE 3H5CB 4Y0ZE 2ZFQH 3V13A 2UUKB 1P11E 1HAYB 4K8YA 3RC5A 1WYKA 1BTZA 3SI3H 2ZTZA 1T8LA 1WQVH 3U69H 5JDUB 3EYDA 4TWWA 3UPEA 3QO6A 4UEHH 1THSH 1DANH 1P2KA 1TNIA 3KGPA 1G32B 2FOCA 3SU0A 2FESH 2GX4A 2QA9E 4IMQA 2ODYB 2XC4A 2ZF0H 1G3DA 3MH5A 2V6NA 1LO6A 3OY5U 1HYLA 1JWTA 2ZQ1A 1QQUA 1BIOA 3TVJB 4B75A 1W2KH 4MDSA 2QN5T 1UVSH 4XBCA 3ZVCA 2J38A 3CP7A 1SQTA 4DCDA 2ZI2H 3NKKA 3CS0A 3TLOA 2BLVA 6GCHF 1MQ6A 1W0ZU 4FUIA 1NPMA 3GYLB 3LIWA 5I25A 1TPOA 2FI3E 2SGEE 1FN6A 3V12A 3B9FH 1O2GH 4TPIZ 4FUGA 5E2OA 1IQHA 1HRTH 2EA3A 2OQUA 1W3CA 3ATKA 1P02A 1SR5C 1BT7A 1VZQH 4UFEH 1HAVA 1ZZZA 1HAOH 3ATMA 2RCEA 1CT0E 1W7GH 3PTNA 3K6ZA 1SFIA 5A0BA 1A3EH 1AFQC 1P9UA 1FIZA 3A7XA 4K69A 1KXAA 2OC1A 4KP0A 1V6DA 1SGPE 1HAPH 2A2QH 1JIRA 2BDYA 3HKJB 5LGOA 4HI3A 4AFUA 4DOQA 4D9RA 4X6MA 1UTNA 4ZAEA 1J9CH 3STJA 3TIUA 5HM9A 2JETB 1S82A 1TFXA 1YPMH 3LH3A 4U01A 1OWEA 5FHTA 4NIXA 1GJCB 2QC2A 3LT3A 4H6TA 1YLDA 1GJ4H 3P17H 2ZPQA 5E0HA 5C1UA 1Y3XA 3UNQA 2A1DB 2BQ7B 2ZDMA 3BTTE 1FY4A 1BUIA 2VVVA 7ESTE 2P95A 3SBKA 3GCHC 3H7TA 3ZYDA 2VH6A 1DM4B 1CGJE 1SMFE 1ZHRA 4B2BA 3AAVA 3SO3A 4A6LA 1EZQA 2Q6DA 1C2KA 2GT7A 2CV3A 3SV2H 1WSSH 2F83A 2H6MA 2BLOA 2WPIS 4UE7H 3T2NA 1TMBH 2BVXH 4ZMAH 1T7CA 2AIQA 4NWLA 3F9FA 4XOJA 1N8OB 1Y3UA 2BVSH 2ZFRH 1QRWA 1GVZA 1W7XH 3TGIE 4E7NA 1PPCE 5A09A 1DLEA 1Q3XA 1LHCH 1TA6A 3BTKE 2W7SA 4X2YA 2A5KA 4AZ2B 1B0EA 1HXFH 2OUAA 3M3TA 3ODFA 3PB1E 3UREA 3U1JB 3AW0A 5CE1A 1SB1H 3BTME 1FY5A 3B8JA 2WV5A 1YPKH 2BD9A 5FCKA 1IAUA 2B8OH 1GI6A 4MNVA 2ASUB 2Z9IA 1SI5H 3SJOA 1PPFE 4UFFH 2WPLS 3MNSA 4IBLH 4K1TA 3A7ZA 3ITIA 3ZVFA 2A4GA 2OC0A 1GL0E 1LVMA 1WTHD 3UNRA 2F9PA 4JZFH 1PQAA 3VGCC 2BY9X 1O5BB 4H42U 4H4FA 1ELDE 3RU4T 2QF0A 3DT0H 1FMGA 3RXVA 4CR9A 1S6FA 1OP0A 1G2LA 1P06A 4TWYA 4D8NA 1S83A 4Y10E 3P8OA 1OSSA 2WUCA 1QBVH 3RXSA 4Z6AH 1HXEH 1NY22 3V3MA 3M7QA 5DP5A 1C9PA 1TGSZ 1EB1H 4FUDA 5FX5A 2AMQA 3F9EA 3UOUA 1N6YA 5L6NH 1AWHB 4H6SB 1MAXA 1OOKB 1CHOG 3PO1B 2C4FH 1YBWA 2SFAA 4RKOB 2BOHB 1O2ZA 1KXBA 2XBWA 2F91A 1NO9H 4A5TS 3GDUA 1Z1IA 4CRAA 1GBBA 3EA8A 3MH4A 1CO7E 2XC0A 3A8CA 3ZZAA 1G30B 3ELAH 3AASA 1XM1A 1O39A 2PGBB 3DUXH 3MO9A 2GVFA 1SVPA 3U9AH 1OPHB 1XXFA 1O5EH 3U8OH 1DUAA 3MU5A 2R3UA 5G4BA 3P70B 1QIXB 1T4VH 3T28A 1TA2A 3SHAH 3A7YA 2J34A 1TWXB 1NFUA 5DP7A 1A3BH 2XNIA 1A0JA 1Z71A 2PSYA 1O2NA 5CHAC 3UY9A 1EATA 1O2MA 3RXEA 4BNRA 1GJ8B 4AFQA 2V3OH 6CHAB 3FZZA 1PFXC 1HJ8A 1P2JA 1WUNH 2SGAA 2W26A 4D76A 2O9QA 5GWZA 1P2NA 4U32A 3UOPA 1GHWH 2C8ZB 3IITA 4NWKA 4LXBH 4OS1A 2FTLE 1HB0B 3A8AA 2ALVA 3NPSA 2LPRA 1GMDF 2VIDA 1MZDA 2GKVE 1V2ST 4BTIB 5F6MA 4ABIA 4CHAC 1O5AB 1TQ0B 5TJXA 4ISIH 4NIVA 1BOQA 1AQ7A 1O30A 1O31A 2ZCKP 3M5MA 1D9IA 1WCZA 4YT6H 3PLBA 5JYIA 3GY7A 1YYY1 3LGTA 1AE5A 4BANB 4E06H 1TNGA 4K1SA 2FLBH 4UFGH 3UQVA 4CH2B 4Y8YA 4KGAA 2GMTC 3AW1A 3F6UH 2DUCA 8GCHG 4MNXA 1GHZA 4B71A 2Z3DA 1XUHA 4ABEA 3VB4A 4JZIA 2A7CA 4I8KA 1UK2A 3IWMA 3Q77A 1E38B 1Z6JH 2V0BA 2OP9A 1ELBA 3C27B 1GCDA 1QRZA 2O8TA 5BRRE 1O2WA 3I29A 2LNCA 1TRYA 4A1VA 1QL7A 5JB8S 4IW4E 3SU1A 3SNCA 2ODQA 3PYHA 2G8TA 3P8GA 4O03A 3UR9A 4MG3A 1OKXA 1GJ9B 2F3CE 4YTAA 1NESE 4AORA 1KYNA 4F4OC 4AYYB 1UTQA 3LDXH 2Y82A 1TNHA 1EAXA 4X6OA 4YM9A 1O3CA 1FV9A 4CH8B 4MTBA 2DE9A 2P94A 5E8EH 1QJ6B 3K6YA 1NRRH 3GY3A 4TYDA 3TH2H 3L6PA 4DT7B 3BEIB 3F1SB 5GCHF 1FNIA 2Q1JA 1D4PB 3MO6A 2VWOA 3ZZ3A 3ZZ4A 2GCTB 3MI4A 5GXPA 3P95A 1C5QA 4BTUB 2Z9KA 1O5FH 1CVWH 1QGFA 1XUIA 2BTCE 2FYRA 3Q76A 1O3FA 3RXJA 1J8AA 1O2YA 2M5TA 2GD4B 1GJ5H 1RFNA 2F9OA 1ZHPA 2ZO3H 4GAWA 1L1GA 4KELA 4HGCA 2P59A 4AG1A 4WMDA 5GPIB 2WYJA 5EODA 1F0RA 2ZECA 2BDGA 4F49A 1A46H 1OWDA 3BF6H 1PPHE 1QFKH 1QBNA 1GHBF 3C1KA 1P3CA 3P6ZB 4I7YH 3ZZ6A 5ETXA 3SUGA 3UQOA 1L4DA 1O3KA 2JETC 2G51A 4OS2A 2PHBA 1K21H 2H9TH 2O8LA 2C90B 5C20A 3RXMA 3SHCH 3F68H 1TIOA 4YOIA 1SBWA 1GHAG 2ZHFH 2A4QA 1O3MA 1YM0A 5HGGA 4XE4A 1UHBB 4E05H 1DDJA 1P04A 1G3CA 2ESTE 2BZAA 1UHBA 4NFFA 1P01A 2TPIZ 4NGAH 2ANYA 1SC8U 1AI8H 4K2YA 5AFYH 1XMNB 5T6GA 1IQKA 2PKAA 1DVAH 4CRBA 3T25A 2Y7XA 2OLGA 4WF8A 4BXSA 1C2MA 3UR6A 1GI3A 1ETRH 3RXGA 2CF8H 4IC5A 5A8ZA 1N8OC 3ZVAA 4X6PA 5FCRA 1D3PB 5A8YA 2GT8A 3SUEA 1O3OA 2Q6GA 1F92A 3AVZA 1TABE 1F7ZA 1RTKA 3KQDA 1GPZA 1ANCA 2UUFB 3S7HB 3RXBA 4K5ZA 2IJOB 3SNAA 1C5NH 4AFSA 1K1PA 2FOBA 1D3QB 3TITA 3ZYEA 1C2EA 2ZFTA 2QAAA 1X7AC 1KXEA 3RMOH 1HJAB 3ESTA 1C2LA 1F0UA 3TGJE 1O3BA 8ESTE 1PQ7A 2FTMA 1BBRE 3WY8A 5EPYA 1TX8A 3E1XB 3UFAA 3BEUA 4JYUH 3LU9B 1UTJA 4UONA 1BITA 1JRTA 4MPUA 3RC4A 3PM3A 5CMXH 3QX5H 2Z9JA 1AUJA 1SGFG 1BDAA 1OYTH 1SQOA 1YKTA 2D1JA 1HAHH 3HKIB 2FO9A 1Q2WA 1LKAA 1Y5BT 4IN1A 4J1YA 1YGCH 4ZHLU 3A86A 1GBHA 5B6OA 4DURA 3DA9B 1TOMH 3M5LA 5F8XA 1PJPA 4GCHG 3PO1C 7GCHG 4ZXXH 5JBBS 4B76A 3BIVH 2FMJA 1TLDA 1O35A 2FEQH 1NRQH 1GI8B 1V2JT 2G4UA 2ZG0H 4MLFB 1C5ZB 3P8FA 3T27A 2R2MB 1A5HA 1VITH 5FBIA 3ZZ9A 1O2HA 1BRCE 1QJ1B 1PPBH 4FUCA 1F5LA 1YPHE 2NU0E 1FPCH 1NZQH 2Y7ZA 2NU3E 1MTSA 3GISB 1ARBA 4BOHA 5EXMA 4MPXA 1BMLA 1Z8JB 1BA8B 2BHGA 2KAIB 1AMHA 2GCHG 1HFDA 2RA3A 2W3KA 1H1BA 3M36A 1Z7KA 1CT4E 1RTLA 2WYGA 1FIWA 1OX1A 1HIAB 1FY3A 2BY6X 4I32A 2VH0A 3V7TA 6GCHG 6CHAC 2Z9GA 2H9HA 8LPRA 1O0DH 1AVWA 4OS7A 5JPMH 1BHXB 1EZSC 1C5UA 2AIPA 1M9UA 1L1JA 1DSTA 1KIGH 1KXDA 1A0LA 4FUFA 3ZZDA 2CGAA 1LDTT 2NWNA 1IQMA 1UVPA 4JCNA 1HPGA 2XC5A 2SNVA 1TGNA 2ZU3A 2FDAA 6LPRA 1NT1A 3GCOA 3VB5A 1O2JA 2ZPSA 4ISOA 3UWJH 1HBTH 1ZMLA 5AVDA 1ESBA 3SQHE 1AO5A 1UJ1A 2QXIA 5HXFA 2R3YA 1CA0B 1V2OT 1EZXC 1K1NA 3H7OA 1V2MT 3E0PB 1NN6A 4KTUA 1CSOE 1O3DA 2WPKS 4ESTE 1WBGB 3QDZB 3T29A 4ZHMU 4DW2U 4ZUHA 4JK6A 2P16A 1KSNA 5EW2H 1O2RA 1QNJA 1AD8H 2Y6TA 3GY6A 3VB7A 1K22H 5J4QA 2FOEA 2DE8A 2HNTE 1C5YB 1C5PA 5L30H 1ANDA 2QGRA 4XDEA 2OBOA 3NXPA 1UTPA 2GZ7A 2SGPE 3HGPA 1Q31A 3RXLA 1T8NA 2G5NA 5T6DA 5LPFA 3I78A 3ZV9A 2OC7A 2BXUH 1T31A 2VU8E 3A82A 1BRBE 2J4IA 1IQFA 4JMYA 1GDNA 4X2VA 5DGJA 4DIIH 3SU2A 1O5CB 1IQEA 2OXSA 4ISHH 1EOLA 2FOHA 1A61H 2XXLA 4WH6A 4Y71A 1ZSLA 3ATWA 1UCYE 4Q7YA 5FPSA 3AAUA 3LONA 1O3IA 1AU8A 1TONA 1H4WA 4B1TA 1SGTA 5C67A 1P2MA 3SJ8A 3URCA 1C2FA 2P3UB 1GMCF 3M7TA 5LH8A 3EAJA 1KY9A 1FY8E 3RMLH 4Q80A 4DJZB 3VFEA 3P8NA 1Y3VA 4TY7A 1SOTA 1SGYE 1EASA 1TPPA 1P05A 2TIOA 2UWOA 1G2MA 5TCCA 1ETSH 1EAIA 2BOKA 2G5VA 2GCTC 4XFQA 3PWCA 1P2QA 1LVYA 1KTTB 1ABJH 5ABWA 3I77A 2FOGA 3SV6A 1EQ9A 1BRAA 1C5WB 1FN8A 2PTCE 3BIUH 3FP6E 3O8RA 1IHTH 3GDSA 3A7TA 4MQAA 4PROA 4B74A 3GCNA 3MU4A 2QCYA 2ZQ2A 5PTPA 1DY9A 1BJVA 3E0NB 2BQ6B 1GVKB 1RGQA 4NIWA 2R2WU 3RXKA 1CBWB 2AEIH 3NUMA 1LKBA 2OQ5A 1TNKA 2XBXA 3P92A 3RUOA 1C1MA 2BYAX 1XXDA 1AUTC 1ZGVA 2J9NA 4MPVA 4IS5A 2HPQH 1TPAE 3O8BA 2P3TB 1T4UH 2Y81A 3ATLA 1EAUA 2ZTYA 3M5NA 3U8TH 3VPKA 1EB2A 5DP8A 4X1QU 3SNDA 3SQEE 2ZHEH 2BY5X 1ZMNA 1O3PB 1ZYOA 3LOXA 2ZDVH 1VJ9U 2HALA 1LHDH 3LC3A 1JRSA 1TE0A 1K28D 3ZZ5A 4RKJB 5A0AE 1O2QA 4XBBA 3TJOA 3FP7E 2Q6FA 5DK1A 5AF9H 1QA7A 1SGEE 1UTMA 1V2LT 2OINA 4GSOA 1F5RA 1GJDB 2ZDLA 1HLTH 3TK6A 1ZLRA 2UWLA 4ISLA 2J2UA 1S81A 2WPHS 2AS9A 2J94A 1CGIE 4GLYA 2FPZA 1QL9A 4NSYA 1FAKH 1RS0A 1QJ7B 1LQDB 1C2GA 3LKWA 1O2KA 3OU0A 1ZOMA 2GDEH 3OX7U 2JH0D 4AB9A 1NM6A 1HJAC 2VIWA 2JH6D 1GMDG 2ZGHA 4O3TA 4WMFA 2JKHA 1NFXA 4NA9H 2R0LA 3O8CA 1UK4A 1V2KT 2D2DA 4KTCA 3KQCA 5E2PA 1FJSA 3S0NA 1HNEE 3E8LA 1NU9A 4AN7A 1SL3A 1EJAA 2AERH 1MH0A 1GI7B 3BN9A 3TJNA 3RXFA 1HGTH 2HVXA 1MTWA 3RXPA 3SJKA 4M7GA 1MUEB 1P09A 3LPRA 3BTGE 3ENSB 1C1PA 1EPTB 1DUEA 3R3GB 1A5GH 3E3TA 3BTQE 2AMPA 5T6FA 1C5TA 2I6QA 1GI0A 3SI4H 1TB6H 2G4TA 4X8UH 1W8BH 3TGKE 1NU7B 1LQEA 4JYTA 1C4U2 1GBIA 4A7IB 5FAHA 2PKSB 2C8WB 2ZNKH 4DY7B 2PUQH 2TGTA 3PLKA 4X1RU 3SU5A 1ZPZA 4SGBE 1G36A 4K60A 1Z1JA 2CMYA 1V2WT 1QBOA 1AE8H 1TBZH 1SLUB 4YO9A 5E0JA 1FQ3A 3QZRA 1HAZB 1UTLM 4ZH8A 4FVDA 3SN8A 4SGAE 3MYWA 1TNLA 1SHHB 2HRVA 5I46H 1F0SA 4WXIA 1BMNH 3UWIA 4I8GA 3A7VA 4NA8A 3PMJA 3PROA 3SV8A 3FZDA 2ZIQH 4ABGA 3QZQA 4I8LA 3O8DA 1CT2E 3HK3B 4I33A 1W14U 1VITG 1GMHF 1RD3B 2R9PA 2O8WA 1ZTLA 2A32A 3OYPA 2C93B 2AGGX 1SPJA 1DY8A 2SGDE 3QUMP 1ZJDA 1PYTC 2H5DA 3MH7A 2ZDNA 3PV4A 5DP9A 1AWFH 3SGAE 5L2ZH 3RXRA 3VB3A 1YP9A 1J17T 2H1UA 1H8IH 1TYNA 2ZU1A 3CENA 5GCHG 3NZIA 1Y59T 3B23B 3UTUH 3SNEA 2V35A 3ZZCA 1MU6B 3EGKH 5L2YH 8GCHF 2VB0A 2ZFSA 1C1WH 5FPYA 1GHVH 1YF4A 2BY7X 5C3NA 3STIA 1H8DH 1EAWA 2YNAA 1C1TA 1UMAH 5AFZH 3L3TA 1T8MA 2BY8X 2FLRH 1CA8B 3EDXB 2G52A 3MWIU 4HFPB 4Y7AA 3SGBE 1DLKB 2ZCLP 4RN6A 3E16B 2A5IA 4NZLA 2HNTF 2HPPH 4WMEA 1QB9A 1T8OA 3QK1A 1BJUA 2ANKH 2IOTA 3GY5A 1CA0C 2BMGB 1OWJA 2WPJS 3GCTF 3MO3A 4INHA 3TH3H 4IMZA 3TU7H 1K9OE 4JK5A 4DGJA 2QYIA 2ZKSA 3PTBA 3IG6B 2FX6A 1GL1A 2I6SA 3M7UA 1JOUB 2XBYA 3S69A 4WJG2 2TRMA 2Y80A 1E37B 5DO4H 3ODDA 1SGFA 3LC5A 3A7WA 1BBRK 2J95A 5A0CA 1SGQE 1BMMH 5ESBA 2UUJB 2V3HH 1BTHH 2GGVB 1AHTH 4MVNA 1YCPM 1BBRH 1TNJA 4WH8A 1FDPA 4FUBA 3U98H 1GGDB 2Y5HA 3ZVDA 1HV7A 1QY6A 1DICA 1DX5M 1U6QA 1D3TB 3NK8A 4YT7H 3VB6A 2ZHQH 1P8VC 3EQ0H 2ZC9H
chains in the Genus database with same CATH superfamily
2A7JA 3KN2A 3QWCH 4NCYA 1UVUH 1QCPA 3OAAD 3MFJA 2H9EH 3TNSA 5C17A 1FI8A 2SGQE 4CRFA 1QB6A 4ZKNU 1O2LA 2A31A 4ZKRU 1Y8TA 1O3GA 2FOAA 4FUEA 3ZVEA 4ABHA 1MTNB 1CGHA 4ABAA 1KLIH 4O97A 1LPZB 1AVGH 4DVAU 4Y8XA 3RXUA 2AGEX 1TAWA 1XVOA 3OEHD 1NC6A 1LPGB 1UTOA 1TBQH 3ATIA 2CHAB 1ABIH 4YOGA 3SZNA 2G81E 1FZZA 1O2IA 5DN6D 1LHEH 4ABJA 1TX7A 1F2SE 1F5KU 1BCUH 2QF4A 1K2I1 1C2JA 2EI7A 3PWBA 4IN2A 5DPAA 3U8RH 3FANA 1V2QT 1DS2E 5IYTA 1GCTB 1EJMA 1SGNE 2QXJA 2CN0H 4ASHA 1MKXK 1ZGIA 2XCNA 2B0FA 1GHAF 3KNXA 3F9HA 4X1NU 4IGDA 9ESTA 2GZ9A 2GV6A 2PWXA 5KECA 1DWDH 4TY6A 1MKXH 4X1PU 5DP6A 3RXAA 1C2HA 1ORFA 2G00A 5IDKA 1AB9B 2BQWB 2XNDD 1TRNA 2UWPA 1H9HE 1LHGH 4TT3D 1W0YH 1CBWC 3RXQA 1SLWB 2P93A 1NBMD 5C1XA 2BLQA 1FPHH 1O2SA 3SV9A 2ANMH 2HLDD 2W5EA 3HK6B 1G9IE 1VR1H 2BD8A 2JJ1D 1C2DA 3E90B 3LGUA 3Q3XA 1Z8IB 3OSYA 4I8HA 2VWMA 1CHGA 1BTPA 2L6OA 2NU4E 4ABBA 2XWAA 1O3HA 1INCA 3M5OA 1WOFA 2D26C 1ACBE 1E1RD 2F9UA 3GICB 2FYQA 1YC0A 1H8ED 1AKSB 4Z0KA 1DWCH 1DT2A 2QY0B 3PRBA 4FVBA 4WWYA 3CNRA 3F9GA 3RXIA 1BQYA 1K1MA 1DPOA 2ZFPH 1RIWB 1EP6A 1W0JD 1TGTA 2P8OB 1C1OA 4CRDA 1ZSKA 6ESTA 1XUGA 1ELTA 3PLPA 4FUJA 1ELAA 3BG4B 3F2FA 1WDIA 3JZ1B 4FU7A 4I86A 1NS3A 5DJ7A 4Y8ZA 1SKYE 1F0TA 3NWUA 2VINA 1QL8A 3LJOA 4D7GA 1W13U 1D6WA 4O9VA 5EGMA 4BAMB 2EI6A 3A87A 1EKBB 4R0IA 2ULLA 5HM2A 4ZROA 5C5NA 4BTTB 1MMJN 3RMMH 1L4ZA 1C5OH 1W12U 5EXNA 3MNXA 3A85A 4THNH 3ZZ7A 2ILNA 1ETTH 1A7SA 2PW8H 1JMOH 3T5FH 1WXRA 2ZU5A 5EQQA 5F8TA 1O2PA 3OE7D 2KAIA 2BX4A 1EUFA 1C5LH 2KCOA 3S7KB 1TX6A 3DSGA 2AHME 2FP7B 2VVUA 4CBNA 1GBJA 1MCVA 1UCYK 3LJJA 1HIAA 9LPRA 3D49H 3K65B 1CE5A 3N7EA 5DSFA 1LTOA 3D62A 1OS8A 4B2CA 1O32A 1L1NA 1HCGA 2D8WA 1UCYH 1MKWK 1EPTC 1DSUA 1ZJKA 1MAYA 1KTSB 2PGQB 2PTNA 4Q63A 1NBME 3TK9A 4A1TA 2BZ6H 1A0HB 2QF3A 1MKWH 1Z6EA 4CRCA 2VIQA 3SU3A 1GJBB 3TJUA 2XBVA 4YXWD 3JZ2B 1DXWA 2J92A 4DIHH 4X1SU 4HZHA 2AYWA 4AX9H 4ASUD 2A7HA 2CXVA 2PKSC 3M61U 1ZPCA 4K1EA 4Q7ZA 1G37A 1NRPH 3BG8A 2GCHF 2QIQA 1GG6B 3D23A 1GBAA 2Z94A 4U2WA 2VIPA 1C5XB 2FZZA 4NFEA 5H4IB 1O36A 4K8BA 1O2OA 3MMGA 1D6RA 3FP8E 4YLQH 3KEEA 3GDVA 3PRDA 1OP2A 1VCQA 1B0FA 5EG4A 4F55A 2P3FH 3MTYA 3SJIA 3MU8A 2HGTH 4JYVH 4BAKB 2OCVB 3RC6A 1TQ7B 3BSQA 1EXFA 1UVTH 1HAVB 2SNWA 2BD2A 2FS9A 1VCPA 2R0KA 2BDAA 1ID5H 4J2YB 1IQNA 1YPEH 4GHQA 2KZ4A 1VGCB 2IN2A 1GBEA 1FAXA 1BRUP 2W7UA 1UVOA 2XYAA 1C9TA 1GMCG 1NRNH 1ANBA 1QQ4A 1KMHB 1GI4A 2ZGXH 1XVMA 4GVUA 3FVFB 2GP9B 3A81A 1LCYA 1GI2A 1UO6A 2BM2A 1H9LB 3G01A 4OGXA 2Y5FA 1V3XA 2FWWA 3N7OA 3BV9B 2K1QA 1QRXA 1WQSA 3ZZ8A 1IQGA 3CS7A 2EY4C 3GY8A 1MBQA 2A4OA 4ZXYH 1B7XB 1QR3E 1EFRD 4WY3A 2ZDKA 2WPMS 3TJVA 2B5TB 1FXYA 1P3EA 1Z8GA 2WV9A 2WHXA 3RM0H 2C8XB 1ZTJA 4D9QA 2B7DH 4RT1A 3SUFA 3SNBA 3S9CA 4ABFA 4AGKA 5TCAA 5EJ1A 4NIYA 2TGPZ 4NA7A 4YLUA 2BLWA 4IC6A 1P12E 3EE0B 4Y76A 3RMNH 3KF2A 4Y0YE 3RXHA 1S0QA 4YOJA 5EPNA 1P2OA 2VIVA 4JZ1A 3RLYH 1D3DB 3QLPH 1XUKA 4X0WU 3RLWH 2ANWA 3GOVB 4RI0A 1QA0A 4VGCB 2TGAA 1ARCA 3RP2A 4A92A 1IHSH 1O3JA 2ZWLH 1A4WH 1V2RT 1K1IA 2Z6BD 1QHRB 2Z9LA 4ISNA 2QXGA 1LHFH 4CRGA 2FI5E 1YLCA 5FPTA 1RRKA 1AVXA 3UB0A 1BMAA 1L0ZA 3LGIA 1KLTA 1UTKA 2BD7A 5C1YA 3U28C 3W1EA 1ZSJA 1GJAB 5AHGH 1C1NA 4UD9H 1DXPA 3MH6A 1NFYA 3S9BA 5DKMA 2PV9B 1S0RA 1O2UA 1MZAA 1BTUA 1TMTH 3BTWE 1RXPA 2BDIA 3FAOA 4INKA 1YY3A 1ZHMA 2J98B 4OS5A 1GGDC 3PMHB 3E6PH 2AFQB 4NZQA 2XRCA 3MNBA 4B2AA 2J98A 3ZIAD 2GV7A 1BHXF 2BD4A 2ZDAH 3OTJE 5EQRA 3QTOH 1S85A 1HAXB 5GDSH 1C1VH 1V2TT 1ESTA 1AZZA 4Q4LA 1GWAA 1LVOA 5E0GA 2RDEA 1C1SA 3RXCA 3SV7A 2ZTXA 2IPHA 3KCGH 1AGJA 3VEQB 2F9BH 2OTVA 3SU4A 3LGVA 3OY6U 3MU0A 3RU4D 3EA7A 4LZ4B 5A2MH 1MTNC 1SQAA 1JIMA 1VJAU 3SYJA 7KMEH 3M3VA 2A0QB 1MU8B 1HAIH 2VGCB 5ESTE 2BDBA 1E35B 3DFLA 5HIZA 1PPZA 1P10A 2CHAC 4OS6A 1CQQA 4R8TB 2FM2A 1FONA 2KX4A 4AOQA 1PQ8A 2NU1E 2HWLB 3A89A 1WAYB 1L2EA 5JBCS 1C1RA 1GBDA 2FS8A 5EXLA 2NU2E 1O2TA 1GCTC 4XBDA 1NFWA 2BD3A 5FL7D 2F9NA 1V2PT 2BVRH 2YOLA 1GBKA 3UUZA 4LOYH 2V7QD 4NSVA 1OXGA 2ZZUH 1MTVA 3KYGA 3A8BA 1YPLH 3TNTA 1P9SA 4X8VH 1AB9C 1O38A 1K1LA 1KXFA 3A80A 4XD7D 1CHOF 3FN8A 2K8IA 1EJNA 2O8UA 1GHYH 4LK4A 1N6XA 5EW1H 3MOCA 5DP3A 3NCLA 5C5OA 1YPGH 2YMSD 3QGNB 5K0HA 3GY4A 2H2ZA 2O8MA 1W10U 2OC8A 1O3NA 1EX3A 5C2ZA 1SGRE 3Q00A 2BX3A 4AG2A 3OFND 4FU9A 5FXLA 2ZGCA 5A8XA 2A4RA 4X8TH 2FODA 2FX4A 4NG9H 1EPTA 4AYVB 2STBE 1SLVB 1EP5A 2TBSA 1H8HD 4E7RG 1DE7H 1Y3YA 1ZPBA 1PPEE 1C4V2 3LH1A 1TBRH 2H5CA 2CF9H 1E0FD 3FFGA 1FX0B 1O37A 1ELGA 1MTUA 1RIWC 1V2UT 2P8OC 1ZR0A 1IQLA 1KLJH 5K7RA 1GI1A 1MD7A 3MU1A 3BG4C 1S84A 1GMHG 4FUHA 3URDA 3RU4E 1MD8A 2ZHDA 3FOAA 3SJ9A 1LPKB 3R0FA 1SLXB 1ELCA 4YESB 1V2VT 1G3BA 1GI9B 1ELEE 4WVPE 3ZZBA 1W11U 5JB9S 4QT8C 3LGYA 7LPRA 1XUJA 1O3AA 2WUBA 1FY1A 4GPGA 1IQJA 1HDTH 5JBTA 3VG8A 3D65E 4Y79A 4MNYA 1QB1A 2GZ8A 1VKYA 4RSPA 1J14A 4KTSA 3S9AA 1K1OA 4GUXA 4JZDH 1DITH 2A2XH 3DFJA 4KKDA 3KIDU 3T26A 5EOKA 1WV7H 2HLCA 3Q3YA 4B6EA 1THPB 2VWLA 2Z3CA 1RJXB 1TPSA 3RXOA 2A45B 2QV1A 5LPRA 1AZ8A 1AFQB 1S6HA 3RXDA 4Y6DA 1PYTD 1KXCA 3KQBA 2THFB 4AFZA 1NROH 1ZMJA 1XKBC 5EQSA 1C1QA 4LZ1H 4OM9A 4INLA 1VCWA 1TGCA 1O5GH 2BXTH 1HUTH 1P57B 4B73A 2FIRH 3SU6A 3GCTG 3KQEA 1BTXA 1J16A 1C5SA 1TGBA 1DFPA 5GNDA 2SGFE 1GBTA 2FOMB 3SUDA 4FU8A 2W6ID 1JXPA 1QTFA 1VITF 3GCHB 1GJ6A 4Q7XA 1C5RA 5FBEA 1TOCB 2ZFFH 1GG6C 3RDZA 1OWIA 4Q2KA 1C1UH 3TK5A 1GHBG 2C3SA 3SGQE 1O3LA 1C5VA 8KME2 2Y5GA 2ZCHP 4O3UA 3ZVBA 3M35A 2ODPA 1SFQB 1MBMA 1AFEH 1HJ9A 1TMUH 2ZHWH 2C8YB 2PR3A 3SOSA 1KDQB 1C2IA 2WINI 2ZU2A 1B5GH 4UDWH 4X6NA 1KDQA 5F03A 1A1RA 1OYQA 4UFDH 2VWNA 2XW9A 4Y7BA 2XWBI 1QURH 2RDLA 1XUFA 3BEFB 5SGAE 2FI4E 3BTDE 4X2XA 1VGCC 2Z3EA 1Y3WA 1TRMA 2GDDA 2VIOA 5F8ZA 3VXEH 2KM0A 5GJ4B 5HMAA 1SOZA 4ZKSU 2FOFA 5GIBA 1C5MD 3M3SA 4AGJA 1J15A 3KQ5A 4MPWA 3BTHE 2PSXA 4XSKU 1BB0B 1GBLA 2BB4A 3W94A 3VGCB 3HGNA 1CU1A 3GY2A 2OD3B 3HPTB 4ZKOU 3QN7A 1GJ7B 1GBMA 1GVLA 3LGWA 3KHVA 1E36B 3RM2H 3PMAB 2BDHA 3EA9A 4BAHB 1EOJA 2CJIA 1Z8RA 2ZP0H 2UUYA 1DWBH 1G3EA 4U30A 3BTEE 1AIXH 2G55A 1GBFA 2ZA5A 2FXRA 4CBOA 2EC9H 1A2CH 4JZEH 2ZU4A 4CREA 1HAGE 2JDID 1ELFA 1ZRKA 3MHWU 4ZHAA 5FX6A 2PKAB 3ZV8A 1YPHC 3WWFA 2BDCA 1NTPA 1P03A 1UW7A 4VGCC 1GDQA 1N1LA 1UK3A 3UIRA 1SSXA 1THRH 1LVBA 4FETA 4TPYA 1WU1A 1OWHA 2EEKA 4AB8A 2ALPA 2XCFA 4AC9A 1RTFB 1BTWA 1XKAC 1H9IE 1LMWB 4BXWA 4X2WA 2OBQA 1P0SH 4YZUA 1O3EA 5HYOA 2W3IA 3RXTA 2EI8A 1JBUH 2PLXA 1E79D 3K9XB 3M37A 1MCTA 4ABDA 1SGIB 4X8SH 1GHXH 3MNCA 3F0OA 3PV5A 3TPIZ 1ESAA 1IQIA 1GI5A 3A8DA 3U1IB 1NRSH 2AMDA 4FXGH 4D7FA 1BTYA 1E34B 1O34A 1ZRBA 4BAQB 2TGDA 3BTFE 3L33A 1YPJH 3Q3KA 4DG4A 1A5IA 2VJ1A 2A5AA 2QXHA 1BZXE 3PMBB 2B9LA 2YNBA 1GBCA 1SGCA 4HTCH 1OP8A 1Y5AT 1WTGH 1SG8B 3K2UA 5EU8A 3T62A 1Y5UT 1DWEH 1K1JA 1O2XA 1EZUC 2VVCA 2F9VA 1W0KD 2AGIX 5CHAB 1T32A 4GHTA 3V0XA 1MABB 4OGYA 2PUXB 2ZEBA 1MQ5A 1YCPK 1XX9A 2HOBA 4OS4A 3AK5A 3DD2H 3QTVH 2RFKC 4WXVA 5BPEA 2Z7FE 1AKSA 4CR5A 2VGCC 2AH4X 1YCPH 5CDFE 1ZTKA 4I8JA 2WV4A 5JBAS 1OWKA 2ZPRA 3GYMA 1SGDE 1O33A 3TH4H 1ANEA 1IOEA 1O2VA 4I31A 3UNSA 4CHAB 1O5DH 1ELVA 2RG3A 3QGJA 3SORA 4A1XA 3A83A 2ZGJA 2RA0A 3E91A 1FLEE 3ZVGA 2JH5D 3W95A 1SHYA 3A88A 2PFEA 2GTBA 5DG6A 5LPEA 4BAOB 2HNTC 3HATH 3DHKH 5DP4A 3SW2B 1PQ5A 3F2HA 2ZGBH 1GDUA 4Y11E 2GMTB 1DOJA 1TALA 1S5SA 5T3HA 3KL6A 1AN1E 2STAE 1C4Y2 5J4SA 4GCHF 2XTTB 1V2NT 7GCHF 4K3JA 1AY6H 3A84A 3VXFH 1P2IA 3SZEA 4MNWA 2BD5A 2VNTA 1FUJA 1PPGE 3H5CB 4Y0ZE 2ZFQH 3V13A 2UUKB 1P11E 1HAYB 4K8YA 3RC5A 1SQRA 1WYKA 1BTZA 3SI3H 2ZTZA 1T8LA 1WQVH 3U69H 5JDUB 3EYDA 4TWWA 3UPEA 3QO6A 4UEHH 1THSH 1DANH 1P2KA 1TNIA 3KGPA 1G32B 2FOCA 3SU0A 2FESH 2GX4A 2QA9E 4IMQA 2ODYB 2XC4A 2ZF0H 1G3DA 3MH5A 2V6NA 1LO6A 3DSOA 3OY5U 1HYLA 1JWTA 2ZQ1A 1QQUA 1BIOA 3TVJB 4B75A 1W2KH 4MDSA 2QN5T 1UVSH 4XBCA 3ZVCA 4B6FA 2J38A 3CP7A 1SQTA 4DCDA 2ZI2H 3NKKA 3CS0A 3TLOA 2BLVA 6GCHF 1MQ6A 1W0ZU 4FUIA 1NPMA 3GYLB 3LIWA 5I25A 1TPOA 2FI3E 2SGEE 2VBCA 1FN6A 3V12A 3B9FH 1O2GH 4TPIZ 4FUGA 5E2OA 1IQHA 1HRTH 2EA3A 2OQUA 1W3CA 3ATKA 1P02A 1SR5C 1BT7A 1VZQH 4UFEH 1HAVA 1ZZZA 1HAOH 3ATMA 2RCEA 1CT0E 1W7GH 3PTNA 2LELA 3K6ZA 1SFIA 5A0BA 1A3EH 2KCYA 1AFQC 1P9UA 1FIZA 3A7XA 4K69A 1KXAA 2OC1A 4KP0A 1V6DA 1SGPE 1HAPH 2A2QH 1JIRA 2BDYA 3HKJB 5LGOA 4HI3A 4AFUA 4DOQA 4D9RA 4X6MA 1UTNA 4ZAEA 3NRLA 1J9CH 3STJA 3TIUA 5HM9A 2JETB 1S82A 5F53A 1TFXA 1YPMH 3LH3A 4U01A 1OWEA 5FHTA 4NIXA 1GJCB 2QC2A 3LT3A 4H6TA 1YLDA 1GJ4H 3P17H 2ZPQA 5E0HA 5C1UA 1Y3XA 3UNQA 2A1DB 2BQ7B 2ZDMA 3BTTE 1FY4A 1BUIA 2VVVA 7ESTE 2P95A 2J5UA 3SBKA 3GCHC 3H7TA 3ZYDA 2VH6A 1DM4B 1CGJE 1SMFE 1ZHRA 4B2BA 3AAVA 3SO3A 4A6LA 1EZQA 2Q6DA 1C2KA 2GT7A 2CV3A 3SV2H 1WSSH 2F83A 2H6MA 2BLOA 2WPIS 4UE7H 3T2NA 1TMBH 2BVXH 4ZMAH 1T7CA 2AIQA 4NWLA 3F9FA 4XOJA 1N8OB 1Y3UA 2BVSH 2ZFRH 1QRWA 1GVZA 1W7XH 3TGIE 4E7NA 1PPCE 5A09A 1DLEA 1Q3XA 4HG6A 1LHCH 1TA6A 3BTKE 2W7SA 4X2YA 2A5KA 4AZ2B 1B0EA 2K0QA 1HXFH 2OUAA 3M3TA 3ODFA 3PB1E 3UREA 3U1JB 3AW0A 5CE1A 1SB1H 3BTME 1FY5A 3B8JA 2WV5A 1YPKH 2BD9A 5FCKA 1IAUA 2B8OH 1GI6A 4MNVA 2ASUB 2Z9IA 1SI5H 3SJOA 1PPFE 4UFFH 2WPLS 3MNSA 4IBLH 4K1TA 3A7ZA 3ITIA 3ZVFA 2A4GA 2OC0A 1GL0E 1LVMA 1WTHD 3UNRA 2F9PA 4JZFH 1PQAA 3VGCC 2BY9X 1O5BB 4H42U 4H4FA 1ELDE 3RU4T 2QF0A 3DT0H 1FMGA 3RXVA 4CR9A 1S6FA 1OP0A 1G2LA 1P06A 4TWYA 4D8NA 1S83A 4Y10E 3P8OA 1OSSA 2WUCA 1QBVH 3RXSA 4Z6AH 1HXEH 1NY22 3F0PA 3V3MA 3M7QA 5DP5A 1C9PA 1TGSZ 1EB1H 4FUDA 5FX5A 2AMQA 3F9EA 3UOUA 1N6YA 5L6NH 1AWHB 4H6SB 5C94A 1MAXA 1OOKB 1CHOG 3PO1B 2C4FH 1YBWA 2SFAA 3PV2A 4RKOB 2BOHB 1O2ZA 1S6LA 1KXBA 2XBWA 2F91A 1NO9H 4A5TS 3GDUA 4ACBA 1Z1IA 4CRAA 1GBBA 3EA8A 3MH4A 1CO7E 2XC0A 3A8CA 3ZZAA 1G30B 3ELAH 3OTPA 3AASA 1XM1A 1O39A 2PGBB 3DUXH 3MO9A 2GVFA 1SVPA 3U9AH 2W6JD 5C0UA 1OPHB 1XXFA 1O5EH 3U8OH 1DUAA 3MU5A 2R3UA 5G4BA 3P70B 1QIXB 1T4VH 3T28A 1TA2A 3SHAH 2KFWA 3A7YA 2J34A 1TWXB 1NFUA 5DP7A 1A3BH 2XNIA 1A0JA 1Z71A 2PSYA 1O2NA 5CHAC 3UY9A 1EATA 1O2MA 3RXEA 4BNRA 1GJ8B 4AFQA 2V3OH 6CHAB 3FZZA 1PFXC 1HJ8A 1P2JA 1WUNH 2SGAA 2W26A 4D76A 2O9QA 5GWZA 5KEDA 1P2NA 4U32A 3UOPA 1GHWH 2C8ZB 2IPQX 3IITA 4LXBH 4NWKA 4OS1A 2FTLE 1HB0B 3A8AA 2ALVA 3NPSA 2LPRA 1GMDF 2VIDA 1MZDA 2GKVE 3N7DA 1V2ST 4BTIB 5F6MA 4ABIA 4CHAC 1O5AB 1TQ0B 5TJXA 4ISIH 4NIVA 1BOQA 1AQ7A 1O30A 1O31A 2ZCKP 3M5MA 1D9IA 1WCZA 4YT6H 3PLBA 5JYIA 3GY7A 1YYY1 3LGTA 1AE5A 4BANB 4E06H 1TNGA 4K1SA 3FO8D 2FLBH 4UFGH 3UQVA 4CH2B 4Y8YA 4KGAA 2GMTC 3AW1A 3F6UH 2DUCA 8GCHG 4MNXA 1GHZA 4B71A 2Z3DA 1XUHA 4ABEA 3VB4A 4JZIA 2A7CA 4I8KA 1UK2A 3IWMA 3Q77A 1E38B 1Z6JH 2V0BA 2OP9A 1ELBA 3C27B 1GCDA 1QRZA 2O8TA 5BRRE 1O2WA 3I29A 2LNCA 1TRYA 2QE7D 4A1VA 1QL7A 5JB8S 4IW4E 3SU1A 3SNCA 2ODQA 3PYHA 2G8TA 3P8GA 2F43B 2QF5A 4O03A 3UR9A 4MG3A 4Z1MD 1OKXA 2KCPA 3DCLA 1GJ9B 2F3CE 4YTAA 1NESE 4AORA 1KYNA 4F4OC 4AYYB 1UTQA 3LDXH 2Y82A 1TNHA 1EAXA 4X6OA 4YM9A 1O3CA 1FV9A 4CH8B 4MTBA 2DE9A 2P94A 5E8EH 1QJ6B 3K6YA 1NRRH 2L74A 3GY3A 4TYDA 2M2AA 3TH2H 3L6PA 4DT7B 3BEIB 3F1SB 5GCHF 1FNIA 2Q1JA 1D4PB 3MO6A 2VWOA 3ZZ3A 3ZZ4A 5EJZA 2GCTB 3MI4A 5GXPA 3P95A 1C5QA 4BTUB 3EE7A 2Z9KA 1O5FH 1CVWH 1QGFA 1XUIA 2BTCE 2FYRA 3Q76A 1O3FA 3RXJA 1J8AA 1O2YA 2M5TA 3H09A 2GD4B 1GJ5H 1RFNA 2F9OA 1ZHPA 2ZO3H 4GAWA 2EQNA 1L1GA 4KELA 4HGCA 2P59A 4AG1A 4WMDA 5GPIB 2WYJA 5EODA 1F0RA 5EJLA 2ZECA 2BDGA 4F49A 1A46H 1OWDA 3BF6H 1PPHE 1QFKH 1QBNA 5KGOA 1GHBF 4DT4A 3C1KA 1P3CA 3P6ZB 4I7YH 3ZZ6A 5ETXA 3SUGA 3UQOA 1L4DA 1O3KA 2JETC 2G51A 4OS2A 2PHBA 1K21H 2H9TH 2O8LA 2C90B 5C20A 3RXMA 3SHCH 3F68H 1TIOA 2WSSD 4YOIA 1YLNA 2JJ2D 1SBWA 1GHAG 2ZHFH 2A4QA 1O3MA 1YM0A 5HGGA 4XE4A 1UHBB 4E05H 2OK5A 1DDJA 1P04A 1G3CA 2ESTE 2BZAA 1UHBA 4NFFA 1P01A 2TPIZ 4NGAH 2ANYA 1SC8U 1AI8H 4K2YA 5AFYH 1XMNB 5T6GA 1IQKA 2PKAA 1DVAH 4CRBA 3T25A 2Y7XA 2OLGA 4WF8A 4BXSA 1C2MA 3UR6A 1GI3A 1ETRH 3RXGA 2CF8H 4IC5A 5A8ZA 1N8OC 3ZVAA 4X6PA 5FCRA 1D3PB 5A8YA 2GT8A 3SUEA 1O3OA 2Q6GA 1F92A 3AVZA 1TABE 1F7ZA 1RTKA 3KQDA 1GPZA 1ANCA 2UUFB 3S7HB 3RXBA 4K5ZA 2IJOB 3SNAA 1C5NH 4AFSA 3MQKC 1K1PA 2FOBA 1D3QB 3TITA 3ZYEA 1C2EA 2ZFTA 2QAAA 1X7AC 1KXEA 3RMOH 1HJAB 2KR7A 3ESTA 1C2LA 1F0UA 3TGJE 1O3BA 2F4LA 8ESTE 1PQ7A 2FTMA 1BBRE 3WY8A 5EPYA 1TX8A 3E1XB 3UFAA 3BEUA 2YMSB 5B6LA 4JYUH 3LU9B 1UTJA 4UONA 1BITA 1JRTA 4MPUA 3RC4A 3PM3A 5CMXH 3QX5H 2Z9JA 1AUJA 1SGFG 4M9FA 1BDAA 1OYTH 1SQOA 1YKTA 2D1JA 1HAHH 3HKIB 2FO9A 1Q2WA 1LKAA 1Y5BT 4IN1A 4J1YA 1YGCH 4ZHLU 3A86A 1GBHA 5B6OA 4DURA 3DA9B 1TOMH 3M5LA 5F8XA 1PJPA 4GCHG 3PO1C 3F3BA 7GCHG 4ZXXH 5JBBS 4B76A 3BIVH 2FMJA 1TLDA 1O35A 2FEQH 1NRQH 1GI8B 1V2JT 2G4UA 2ZG0H 3GS9A 4MLFB 1C5ZB 3P8FA 3T27A 2R2MB 1A5HA 1VITH 5FBIA 3ZZ9A 1O2HA 1BRCE 1QJ1B 1PPBH 4FUCA 1F5LA 1YPHE 2NU0E 1FPCH 1NZQH 2Y7ZA 2NU3E 1MTSA 3GISB 1ARBA 4BOHA 5EXMA 4MPXA 1BMLA 1Z8JB 1BA8B 2BHGA 2KAIB 1AMHA 2GCHG 1HFDA 2RA3A 2W3KA 1H1BA 3M36A 1Z7KA 1CT4E 1RTLA 2WYGA 1FIWA 1OX1A 1HIAB 1E1QD 1FY3A 2BY6X 4I32A 2VH0A 3V7TA 6GCHG 6CHAC 2Z9GA 2H9HA 8LPRA 1O0DH 1AVWA 4OS7A 5JPMH 1BHXB 1EZSC 1C5UA 2AIPA 1M9UA 1L1JA 1DSTA 1KIGH 1KXDA 1A0LA 4FUFA 3ZZDA 5HIYA 2CGAA 1LDTT 2NWNA 1IQMA 2LP6A 1UVPA 4JCNA 1HPGA 2XC5A 2SNVA 1TGNA 2ZU3A 2FDAA 6LPRA 1NT1A 3GCOA 3VB5A 1O2JA 2ZPSA 4ISOA 3UWJH 1HBTH 1ZMLA 5AVDA 1ESBA 3SQHE 1AO5A 1UJ1A 2QXIA 5HXFA 2R3YA 3N99A 1CA0B 1V2OT 1EZXC 1K1NA 3H7OA 1V2MT 3E0PB 1NN6A 4KTUA 1CSOE 1O3DA 2WPKS 4ESTE 1WBGB 3QDZB 3T29A 4ZHMU 4DW2U 4ZUHA 4JK6A 2P16A 1KSNA 5EW2H 1O2RA 1QNJA 1AD8H 2Y6TA 3GY6A 3VB7A 3FKSD 1K22H 5J4QA 2FOEA 2DE8A 2HNTE 1C5YB 1C5PA 5L30H 1ANDA 2QGRA 4XDEA 2OBOA 3NXPA 2HVYB 1UTPA 2GZ7A 2SGPE 2IJD1 1Q31A 3HGPA 4TSFD 1T8NA 3RXLA 2G5NA 4F48B 5T6DA 5LPFA 3I78A 3ZV9A 2OC7A 2BXUH 1T31A 2VU8E 3A82A 1BRBE 2J4IA 1IQFA 4JMYA 1GDNA 4X2VA 1YWUA 5DGJA 4DIIH 3SU2A 1O5CB 1IQEA 2OXSA 4ISHH 1EOLA 2FOHA 1A61H 2XXLA 4WH6A 4Y71A 1ZSLA 3ATWA 1UCYE 4Q7YA 5FPSA 3AAUA 3LONA 1O3IA 1AU8A 1TONA 1H4WA 4B1TA 1SGTA 5C67A 1P2MA 3SJ8A 3URCA 1C2FA 2P3UB 1GMCF 3M7TA 5LH8A 3EAJA 1KY9A 1FY8E 3RMLH 4Q80A 3KYFA 4DJZB 3VFEA 3P8NA 1Y3VA 4TY7A 1SOTA 1SGYE 1EASA 1TPPA 1P05A 2TIOA 2UWOA 1G2MA 5TCCA 1ETSH 1EAIA 2BOKA 2G5VA 2GCTC 4XFQA 3PWCA 1P2QA 3UAIC 1LVYA 1KTTB 1ABJH 5ABWA 3I77A 2FOGA 4P02A 3SV6A 1EQ9A 1BRAA 1C5WB 1FN8A 2PTCE 3BIUH 3FP6E 3O8RA 1IHTH 3GDSA 2GJGA 3A7TA 4MQAA 4PROA 4B74A 3GCNA 3MU4A 2QCYA 2ZQ2A 5PTPA 1DY9A 1BJVA 3E0NB 2BQ6B 1GVKB 1RGQA 4NIWA 2R2WU 3RXKA 1CBWB 2AEIH 3NUMA 1LKBA 2OQ5A 1TNKA 2XBXA 3P92A 3RUOA 1C1MA 2BYAX 1XXDA 1AUTC 1ZGVA 2J9NA 4MPVA 4XRNA 4IS5A 2HPQH 1TPAE 3O8BA 2P3TB 1T4UH 2Y81A 3ATLA 1EAUA 2ZTYA 5C0TA 3M5NA 3U8TH 3WWBA 3VPKA 1EB2A 5DP8A 4X1QU 3SNDA 3SQEE 2ZHEH 2BY5X 1ZMNA 1O3PB 2KCAA 1ZYOA 3LOXA 2ZDVH 1VJ9U 2HALA 1LHDH 3LC3A 1JRSA 1TE0A 1K28D 1K0HA 3ZZ5A 4RKJB 5A0AE 1O2QA 4XBBA 3TJOA 2JIZD 3FP7E 2Q6FA 5DK1A 5AF9H 1QA7A 1SGEE 1UTMA 1V2LT 2OINA 4GSOA 1F5RA 1GJDB 2ZDLA 1HLTH 2PP6A 2WZQA 3TK6A 1ZLRA 2UWLA 4ISLA 2J2UA 5CHBA 1S81A 2WPHS 2AS9A 2J94A 1CGIE 4GLYA 2FPZA 1QL9A 4NSYA 1FAKH 1RS0A 1QJ7B 1COWD 1LQDB 1C2GA 3LKWA 1O2KA 3OU0A 1ZOMA 2GDEH 3OX7U 2JH0D 4AB9A 1NM6A 1HJAC 3WW7A 2VIWA 2JH6D 1GMDG 2ZGHA 4O3TA 4WMFA 2JKHA 1NFXA 4NA9H 2R0LA 3O8CA 5T1VA 1UK4A 1V2KT 2D2DA 4KTCA 3KQCA 5E2PA 1FJSA 3S0NA 1HNEE 3E8LA 1NU9A 4AN7A 1SL3A 2YMSC 1EJAA 2AERH 1QZ8A 1MH0A 1GI7B 3BN9A 3TJNA 3RXFA 1HGTH 2HVXA 1MTWA 3RXPA 3SJKA 4M7GA 1MUEB 1P09A 3LPRA 3BTGE 3ENSB 1C1PA 5HKKD 1EPTB 1DUEA 3R3GB 1A5GH 3E3TA 3BTQE 2AMPA 5T6FA 1C5TA 2I6QA 1GI0A 3DSPA 1TB6H 3SI4H 2G4TA 4X8UH 1W8BH 3TGKE 1NU7B 1LQEA 4JYTA 1C4U2 1GBIA 4A7IB 5FAHA 2PKSB 2C8WB 2ZNKH 4DY7B 2PUQH 2TGTA 3PLKA 4X1RU 3SU5A 1ZPZA 4SGBE 1G36A 4K60A 1Z1JA 2CMYA 1V2WT 1QBOA 1AE8H 1TBZH 1SLUB 4YO9A 5E0JA 1FQ3A 3QZRA 1HAZB 1UTLM 4ZH8A 4FVDA 3SN8A 4SGAE 3MYWA 1TNLA 1SHHB 2J97A 2HRVA 5I46H 1F0SA 4WXIA 1BMNH 3F2GA 3UWIA 4I8GA 3A7VA 2WPDD 4NA8A 3PMJA 3PROA 3SV8A 2XOKD 3FZDA 2ZIQH 4ABGA 3QZQA 4I8LA 3O8DA 1CT2E 3HK3B 4I33A 1W14U 1VITG 1GMHF 1RD3B 2R9PA 2O8WA 1ZTLA 2A32A 3OYPA 2C93B 2AGGX 1SPJA 1DY8A 2SGDE 3QUMP 3OEED 1ZJDA 1PYTC 2H5DA 3MH7A 2ZDNA 3PV4A 5DP9A 1AWFH 3SGAE 4P00A 5L2ZH 5EIYA 3RXRA 3VB3A 1YP9A 1J17T 2H1UA 1H8IH 1TYNA 2ZU1A 3CENA 5GCHG 3NZIA 1Y59T 3B23B 3UTUH 3SNEA 2V35A 3ZZCA 1MU6B 3EGKH 5L2YH 8GCHF 2VB0A 2ZFSA 1C1WH 5FPYA 1GHVH 1YF4A 2BY7X 4ZCNA 3STIA 1H8DH 5C3NA 1EAWA 2YNAA 1C1TA 1UMAH 5AFZH 3L3TA 1T8MA 2BY8X 2FLRH 1CA8B 3EDXB 2G52A 3MWIU 4HFPB 4Y7AA 3SGBE 1DLKB 2ZCLP 4RN6A 3E16B 2A5IA 4NZLA 2HNTF 2HPPH 4WMEA 1QB9A 1T8OA 4FOUC 3QK1A 1BJUA 2ANKH 2IOTA 3GY5A 1CA0C 2BMGB 1OWJA 2WPJS 3GCTF 3MO3A 4INHA 3TH3H 4IMZA 3TU7H 1K9OE 4ACAA 4JK5A 5IK2D 4DGJA 2QYIA 2ZKSA 3PTBA 3IG6B 1OHHD 2FX6A 1GL1A 2I6SA 3M7UA 1JOUB 2XBYA 3S69A 2V3MA 4WJG2 2TRMA 2Y80A 1E37B 5DO4H 3ODDA 1SGFA 3LC5A 3A7WA 1BBRK 2J95A 1BMFD 2CK3D 5A0CA 1SGQE 1BMMH 5ESBA 4RT0A 2UUJB 2V3HH 1BTHH 2GGVB 1AHTH 4MVNA 1YCPM 1BBRH 1TNJA 4WH8A 1FDPA 4FUBA 3U98H 1GGDB 2Y5HA 3ZVDA 1HV7A 1QY6A 1DICA 1DX5M 1U6QA 1D3TB 3NK8A 4YT7H 3VB6A 2ZHQH 1P8VC 3EQ0H 2ZC9H
chains in the Genus database with same CATH topology
2A7JA 3KN2A 3QWCH 4NCYA 1UVUH 1QCPA 3MFJA 2H9EH 3TNSA 1FI8A 2SGQE 4CRFA 1QB6A 4ZKNU 1O2LA 2A31A 4ZKRU 1Y8TA 1O3GA 2FOAA 4FUEA 3ZVEA 4ABHA 1MTNB 1CGHA 4ABAA 1KLIH 4O97A 1LPZB 1AVGH 4DVAU 4Y8XA 3RXUA 2AGEX 1TAWA 1XVOA 1NC6A 1LPGB 1UTOA 1TBQH 3ATIA 2CHAB 1ABIH 4YOGA 3SZNA 2G81E 1FZZA 1O2IA 1LHEH 4ABJA 1TX7A 1F2SE 1F5KU 1BCUH 1K2I1 1C2JA 2EI7A 3PWBA 4IN2A 5DPAA 3U8RH 3FANA 1V2QT 1DS2E 5IYTA 1GCTB 1EJMA 1SGNE 2QXJA 2CN0H 4ASHA 1MKXK 1ZGIA 2XCNA 2B0FA 1GHAF 3KNXA 3F9HA 4X1NU 4IGDA 9ESTA 2GZ9A 2GV6A 2PWXA 1DWDH 4TY6A 1MKXH 4X1PU 5DP6A 3RXAA 1C2HA 1ORFA 2G00A 5IDKA 1AB9B 2BQWB 1TRNA 2UWPA 1H9HE 1LHGH 1W0YH 1CBWC 3RXQA 1SLWB 2P93A 5C1XA 2BLQA 1FPHH 1O2SA 3SV9A 2ANMH 2W5EA 3HK6B 1G9IE 1VR1H 2BD8A 1C2DA 3E90B 3LGUA 3Q3XA 1Z8IB 3OSYA 4I8HA 2VWMA 1CHGA 1BTPA 2NU4E 4ABBA 2XWAA 1O3HA 1INCA 3M5OA 1WOFA 2D26C 1ACBE 2F9UA 3GICB 2FYQA 1YC0A 1AKSB 4Z0KA 1DWCH 1DT2A 2QY0B 4FVBA 4WWYA 3F9GA 3RXIA 1BQYA 1K1MA 1DPOA 2ZFPH 1RIWB 1EP6A 1TGTA 2P8OB 1C1OA 4CRDA 1ZSKA 6ESTA 1XUGA 1ELTA 3PLPA 4FUJA 1ELAA 3BG4B 4FU7A 3JZ1B 1NS3A 5DJ7A 4Y8ZA 1F0TA 3NWUA 2VINA 1QL8A 3LJOA 4D7GA 1W13U 1D6WA 4O9VA 5EGMA 4BAMB 2EI6A 3A87A 1EKBB 4R0IA 2ULLA 5HM2A 4ZROA 5C5NA 4BTTB 1MMJN 3RMMH 1L4ZA 1C5OH 1W12U 5EXNA 3MNXA 3A85A 4THNH 3ZZ7A 2ILNA 1ETTH 1A7SA 2PW8H 1JMOH 3T5FH 2ZU5A 5EQQA 5F8TA 1O2PA 2KAIA 2BX4A 1EUFA 1C5LH 3S7KB 1TX6A 2FP7B 2VVUA 4CBNA 1GBJA 1MCVA 1UCYK 3LJJA 1HIAA 9LPRA 3D49H 3K65B 1CE5A 1LTOA 3D62A 1OS8A 4B2CA 1O32A 1L1NA 1HCGA 2D8WA 1UCYH 1MKWK 1EPTC 1DSUA 1ZJKA 1MAYA 1KTSB 2PGQB 2PTNA 3TK9A 4A1TA 2BZ6H 1A0HB 2QF3A 1MKWH 1Z6EA 4CRCA 2VIQA 3SU3A 1GJBB 3TJUA 2XBVA 3JZ2B 1DXWA 2J92A 4DIHH 4X1SU 4HZHA 2AYWA 4AX9H 2A7HA 2CXVA 2PKSC 3M61U 1ZPCA 4K1EA 4Q7ZA 1G37A 1NRPH 3BG8A 2GCHF 2QIQA 1GG6B 3D23A 1GBAA 2Z94A 4U2WA 2VIPA 1C5XB 2FZZA 4NFEA 5H4IB 1O36A 4K8BA 1O2OA 3MMGA 1D6RA 3FP8E 4YLQH 3KEEA 3GDVA 1OP2A 1VCQA 1B0FA 5EG4A 2P3FH 3MTYA 3SJIA 3MU8A 2HGTH 4JYVH 4BAKB 2OCVB 3RC6A 1TQ7B 3BSQA 1EXFA 1UVTH 1HAVB 2SNWA 2BD2A 2FS9A 1VCPA 2R0KA 2BDAA 1ID5H 4J2YB 1IQNA 1YPEH 4GHQA 1VGCB 2IN2A 1GBEA 1FAXA 1BRUP 2W7UA 1UVOA 2XYAA 1C9TA 1GMCG 1NRNH 1ANBA 1QQ4A 1GI4A 2ZGXH 1XVMA 4GVUA 3FVFB 2GP9B 3A81A 1LCYA 1GI2A 1UO6A 2BM2A 1H9LB 3G01A 4OGXA 2Y5FA 1V3XA 2FWWA 3N7OA 3BV9B 2K1QA 1QRXA 1WQSA 3ZZ8A 1IQGA 3CS7A 3GY8A 1MBQA 2A4OA 4ZXYH 1B7XB 1QR3E 4WY3A 2ZDKA 2WPMS 3TJVA 2B5TB 1FXYA 1P3EA 1Z8GA 3RM0H 4D9QA 2C8XB 1ZTJA 2B7DH 3SUFA 3SNBA 3S9CA 4ABFA 4AGKA 5TCAA 4NIYA 2TGPZ 4NA7A 4YLUA 2BLWA 4IC6A 1P12E 3EE0B 4Y76A 3RMNH 3KF2A 4Y0YE 3RXHA 1S0QA 4YOJA 5EPNA 1P2OA 2VIVA 4JZ1A 3RLYH 1D3DB 3QLPH 1XUKA 4X0WU 3RLWH 2ANWA 3GOVB 1QA0A 4VGCB 2TGAA 1ARCA 3RP2A 4A92A 1IHSH 1O3JA 2ZWLH 1A4WH 1V2RT 1K1IA 2Z6BD 1QHRB 2Z9LA 4ISNA 2QXGA 1LHFH 4CRGA 2FI5E 1YLCA 5FPTA 1RRKA 1AVXA 1BMAA 1L0ZA 3LGIA 1KLTA 1UTKA 2BD7A 5C1YA 1ZSJA 1GJAB 5AHGH 1C1NA 4UD9H 1DXPA 3MH6A 1NFYA 3S9BA 5DKMA 2PV9B 1S0RA 1O2UA 1MZAA 1BTUA 1TMTH 3BTWE 1RXPA 2BDIA 3FAOA 4INKA 1ZHMA 4OS5A 1GGDC 3PMHB 3E6PH 2AFQB 4NZQA 2XRCA 3MNBA 4B2AA 2GV7A 1BHXF 2BD4A 2ZDAH 3OTJE 5EQRA 3QTOH 1S85A 1HAXB 5GDSH 1C1VH 1V2TT 1ESTA 1AZZA 1GWAA 1LVOA 5E0GA 3SV7A 1C1SA 3RXCA 2ZTXA 2IPHA 3KCGH 1AGJA 3VEQB 2F9BH 2OTVA 3SU4A 3LGVA 3OY6U 3MU0A 3RU4D 3EA7A 4LZ4B 5A2MH 1MTNC 1SQAA 1JIMA 1VJAU 7KMEH 3M3VA 2A0QB 1MU8B 1HAIH 2VGCB 5ESTE 2BDBA 1E35B 3DFLA 1PPZA 1P10A 2CHAC 4OS6A 1CQQA 4R8TB 2FM2A 1FONA 4AOQA 1PQ8A 2NU1E 2HWLB 3A89A 1WAYB 1L2EA 5JBCS 1C1RA 1GBDA 2FS8A 5EXLA 2NU2E 1O2TA 1GCTC 4XBDA 1NFWA 2BD3A 2F9NA 1V2PT 2BVRH 2YOLA 1GBKA 3UUZA 4LOYH 4NSVA 1OXGA 2ZZUH 1MTVA 3A8BA 1YPLH 3TNTA 1P9SA 4X8VH 1AB9C 1O38A 1K1LA 1KXFA 3A80A 1CHOF 1EJNA 2O8UA 1GHYH 4LK4A 1N6XA 5EW1H 3MOCA 5DP3A 3NCLA 5C5OA 1YPGH 3QGNB 5K0HA 3GY4A 2H2ZA 2O8MA 1W10U 2OC8A 1O3NA 1EX3A 5C2ZA 1SGRE 3Q00A 2BX3A 4AG2A 4FU9A 5FXLA 2ZGCA 5A8XA 2A4RA 4X8TH 2FODA 2FX4A 4NG9H 1EPTA 4AYVB 2STBE 1SLVB 1EP5A 2TBSA 4E7RG 1DE7H 1Y3YA 1ZPBA 1PPEE 1C4V2 3LH1A 1TBRH 2H5CA 2CF9H 1E0FD 3FFGA 1O37A 1ELGA 1MTUA 1RIWC 1V2UT 2P8OC 1ZR0A 1IQLA 1KLJH 5K7RA 1GI1A 1MD7A 3MU1A 3BG4C 1S84A 1GMHG 4FUHA 3URDA 3RU4E 1MD8A 2ZHDA 3SJ9A 1LPKB 3R0FA 1SLXB 1ELCA 4YESB 1V2VT 1G3BA 1GI9B 1ELEE 4WVPE 3ZZBA 1W11U 5JB9S 4QT8C 3LGYA 7LPRA 1XUJA 1O3AA 2WUBA 1FY1A 4GPGA 1IQJA 1HDTH 5JBTA 3D65E 4Y79A 4MNYA 1QB1A 2GZ8A 4RSPA 1J14A 4KTSA 3S9AA 1K1OA 4GUXA 4JZDH 1DITH 2A2XH 3DFJA 4KKDA 3KIDU 3T26A 5EOKA 1WV7H 2HLCA 3Q3YA 1THPB 2VWLA 2Z3CA 1RJXB 1TPSA 3RXOA 2A45B 2QV1A 5LPRA 1AZ8A 1AFQB 1S6HA 3RXDA 4Y6DA 1PYTD 1KXCA 3KQBA 2THFB 4AFZA 1NROH 1ZMJA 1XKBC 5EQSA 1C1QA 4LZ1H 4INLA 1VCWA 1TGCA 1O5GH 2BXTH 1HUTH 1P57B 4B73A 2FIRH 3SU6A 3GCTG 3KQEA 1BTXA 1J16A 1C5SA 1TGBA 1DFPA 2SGFE 1GBTA 2FOMB 3SUDA 4FU8A 1JXPA 1QTFA 1VITF 3GCHB 1GJ6A 4Q7XA 1C5RA 5FBEA 1TOCB 2ZFFH 1GG6C 3RDZA 1OWIA 4Q2KA 1C1UH 3TK5A 1GHBG 2C3SA 3SGQE 1O3LA 1C5VA 8KME2 2Y5GA 2ZCHP 4O3UA 3ZVBA 3M35A 2ODPA 1SFQB 1MBMA 1AFEH 1HJ9A 1TMUH 2ZHWH 2C8YB 2PR3A 3SOSA 1KDQB 1C2IA 2WINI 2ZU2A 1B5GH 4UDWH 4X6NA 1KDQA 5F03A 1A1RA 1OYQA 4UFDH 2VWNA 2XW9A 4Y7BA 2XWBI 1QURH 2RDLA 1XUFA 3BEFB 5SGAE 2FI4E 3BTDE 4X2XA 1VGCC 2Z3EA 1Y3WA 1TRMA 2GDDA 2VIOA 5F8ZA 3VXEH 5GJ4B 5HMAA 1SOZA 4ZKSU 2FOFA 5GIBA 1C5MD 3M3SA 4AGJA 1J15A 4MPWA 3BTHE 2PSXA 4XSKU 1BB0B 1GBLA 2BB4A 3W94A 3VGCB 3HGNA 1CU1A 3GY2A 2OD3B 3HPTB 4ZKOU 3QN7A 1GJ7B 1GBMA 1GVLA 3LGWA 3KHVA 1E36B 3RM2H 3PMAB 2BDHA 3EA9A 4BAHB 1EOJA 2CJIA 1Z8RA 2ZP0H 2UUYA 1DWBH 1G3EA 4U30A 3BTEE 1AIXH 2G55A 1GBFA 2ZA5A 2FXRA 4CBOA 2EC9H 1A2CH 4JZEH 2ZU4A 4CREA 1HAGE 1ELFA 1ZRKA 3MHWU 4ZHAA 5FX6A 2PKAB 3ZV8A 1YPHC 2BDCA 1NTPA 1P03A 4VGCC 1GDQA 1N1LA 1UK3A 3UIRA 1SSXA 1THRH 1LVBA 4TPYA 1WU1A 1OWHA 2EEKA 4AB8A 2ALPA 2XCFA 1RTFB 1BTWA 1XKAC 1H9IE 1LMWB 4BXWA 4X2WA 2OBQA 1P0SH 4YZUA 1O3EA 5HYOA 2W3IA 3RXTA 2EI8A 1JBUH 2PLXA 3K9XB 3M37A 1MCTA 4ABDA 1SGIB 4X8SH 1GHXH 3MNCA 3TPIZ 1ESAA 1IQIA 1GI5A 3A8DA 3U1IB 1NRSH 2AMDA 4FXGH 4D7FA 1BTYA 1E34B 1O34A 1ZRBA 4BAQB 2TGDA 3BTFE 3L33A 1YPJH 3Q3KA 4DG4A 1A5IA 2VJ1A 2A5AA 2QXHA 1BZXE 3PMBB 2B9LA 2YNBA 1GBCA 1SGCA 4HTCH 1OP8A 1Y5AT 1WTGH 1SG8B 3K2UA 5EU8A 3T62A 1Y5UT 1DWEH 1K1JA 1O2XA 1EZUC 2VVCA 2F9VA 2AGIX 5CHAB 1T32A 4GHTA 3V0XA 4OGYA 2PUXB 2ZEBA 1MQ5A 1YCPK 1XX9A 2HOBA 4OS4A 3DD2H 3QTVH 4WXVA 5BPEA 2Z7FE 1AKSA 4CR5A 2VGCC 2AH4X 1YCPH 1ZTKA 4I8JA 2WV4A 5JBAS 1OWKA 2ZPRA 3GYMA 1SGDE 1O33A 3TH4H 1ANEA 1IOEA 1O2VA 4I31A 3UNSA 4CHAB 1O5DH 1ELVA 2RG3A 3QGJA 3SORA 4A1XA 3A83A 2ZGJA 2RA0A 3E91A 1FLEE 3ZVGA 2JH5D 3W95A 1SHYA 3A88A 2PFEA 2GTBA 5DG6A 5LPEA 4BAOB 2HNTC 3HATH 3DHKH 5DP4A 3SW2B 1PQ5A 2ZGBH 1GDUA 4Y11E 2GMTB 1DOJA 1TALA 1S5SA 5T3HA 3KL6A 1AN1E 2STAE 1C4Y2 5J4SA 4GCHF 2XTTB 1V2NT 7GCHF 4K3JA 1AY6H 3A84A 3VXFH 1P2IA 4MNWA 2BD5A 2VNTA 1FUJA 1PPGE 3H5CB 4Y0ZE 2ZFQH 3V13A 2UUKB 1P11E 1HAYB 4K8YA 3RC5A 1WYKA 1BTZA 3SI3H 2ZTZA 1T8LA 1WQVH 3U69H 5JDUB 3EYDA 4TWWA 3UPEA 3QO6A 4UEHH 1THSH 1DANH 1P2KA 1TNIA 3KGPA 1G32B 2FOCA 3SU0A 2FESH 2GX4A 2QA9E 4IMQA 2ODYB 2XC4A 2ZF0H 1G3DA 3MH5A 2V6NA 1LO6A 3OY5U 1HYLA 1JWTA 2ZQ1A 1QQUA 1BIOA 3TVJB 4B75A 1W2KH 4MDSA 2QN5T 1UVSH 4XBCA 3ZVCA 2J38A 3CP7A 1SQTA 4DCDA 2ZI2H 3NKKA 3CS0A 3TLOA 2BLVA 6GCHF 1MQ6A 1W0ZU 4FUIA 1NPMA 3GYLB 3LIWA 5I25A 1TPOA 2FI3E 2SGEE 1FN6A 3V12A 3B9FH 1O2GH 4TPIZ 4FUGA 5E2OA 1IQHA 1HRTH 2EA3A 2OQUA 1W3CA 3ATKA 1P02A 1SR5C 1BT7A 1VZQH 4UFEH 1HAVA 1ZZZA 1HAOH 3ATMA 2RCEA 1CT0E 1W7GH 3PTNA 3K6ZA 1SFIA 5A0BA 1A3EH 1AFQC 1P9UA 1FIZA 3A7XA 4K69A 1KXAA 2OC1A 4KP0A 1V6DA 1SGPE 1HAPH 2A2QH 1JIRA 2BDYA 3HKJB 5LGOA 4HI3A 4AFUA 4DOQA 4D9RA 4X6MA 1UTNA 4ZAEA 1J9CH 3STJA 3TIUA 5HM9A 2JETB 1S82A 1TFXA 1YPMH 3LH3A 4U01A 1OWEA 5FHTA 4NIXA 1GJCB 2QC2A 3LT3A 4H6TA 1YLDA 1GJ4H 3P17H 2ZPQA 5E0HA 5C1UA 1Y3XA 3UNQA 2A1DB 2BQ7B 2ZDMA 3BTTE 1FY4A 1BUIA 2VVVA 7ESTE 2P95A 3SBKA 3GCHC 3H7TA 3ZYDA 2VH6A 1DM4B 1CGJE 1SMFE 1ZHRA 4B2BA 3AAVA 3SO3A 4A6LA 1EZQA 2Q6DA 1C2KA 2GT7A 2CV3A 3SV2H 1WSSH 2F83A 2H6MA 2BLOA