4WXVA

Human cationic trypsin k97d mutant in complex with bovine pancreatic trypsin inhibitor (bpti)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
224
structure length
224
Chain Sequence
IVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRDTLNNDIMLIKLSSRAVINAHVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDAGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIAANS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin-1
publication title Mesotrypsin Has Evolved Four Unique Residues to Cleave Trypsin Inhibitors as Substrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 60
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2014-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4wxvA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4wxvA02
2DE9A 3E3TA 4NCYA 4B2AA 1FY8E 1EB1H 3MNSA 3QZQA 3VPKA 1V2WT 1ELTA 1PPEE 1GG6C 1K1MA 5GWZA 4Q7ZA 2GV7A 3GCHC 4Y8ZA 1KSNA 1C1WH 1DANH 1KDQB 1PQ8A 2Z3CA 5T6DA 1TBZH 1BTHH 1MQ5A 1C5RA 2ZPRA 4H6TA 4AFZA 1G36A 1O35A 1UTPA 3PROA 3TH3H 5EG4A 1T8LA 2PTNA 2TGDA 2VIQA 2AGEX 4X2WA 5HMAA 1NN6A 2A7CA 1ARBA 1H9IE 1TNJA 2CXVA 4ZKOU 4I8KA 1WCZA 2ZHWH 1GMDF 1YYY1 4UFGH 2OCVB 4NG9H 4K1SA 1HAVB 1IQIA 1GGDC 1Y5BT 1BBRH 4JZIA 1GDNA 1IAUA 4FVDA 1MTNB 1V2QT 2J38A 3UQOA 1MUEB 1DM4B 1C5SA 1O2KA 3LPRA 3UNSA 1ZTLA 1DLKB 2Z3DA 3TGKE 1TA2A 3LGUA 3SQEE 1NZQH 3VB5A 3F68H 3LT3A 1FN6A 1UHBB 3ZZAA 2UUJB 4XBBA 4R8TB 3D62A 3UIRA 1TMTH 4FVBA 1GCTC 2IN2A 1V2KT 1RJXB 3NXPA 2A7HA 4NFEA 4OGXA 1EJNA 5FXLA 3DFJA 3RLWH 4CBNA 3ZVAA 2I6SA 1AUTC 1SVPA 2V35A 4GHTA 1THPB 5DP9A 1IQHA 3HGNA 1VJAU 2ZU3A 1O2MA 2P3TB 2Y5GA 3SU4A 2Y6TA 3M3SA 1C2EA 2P8OC 1D6WA 2FOCA 2BD7A 4CRGA 2BDYA 1ELAA 2ZTZA 1O30A 9ESTA 5ESTE 4ISHH 2AEIH 4KP0A 1HJAC 2ZWLH 4WY3A 2OUAA 3E6PH 4LK4A 2BB4A 5DPAA 1Y3VA 2BDHA 3TJUA 2VIWA 1N6XA 1ZPZA 4MNYA 3OU0A 1ZHPA 1LHGH 1DXWA 5LGOA 3BEIB 1YCPH 3EA7A 3PLKA 3O8DA 4I8LA 1ESTA 1PJPA 3MOCA 1NC6A 1GHBG 1O2GH 1N6YA 5PTPA 1W3CA 1BMNH 3M7TA 2NU2E 3UREA 1V2PT 4NWLA 2XW9A 3M36A 3K6ZA 1Y3XA 1HAPH 4XOJA 1KY9A 1J17T 3RXUA 1C2JA 1UTMA 1SGPE 2VIDA 2Q1JA 3K9XB 2SFAA 3ITIA 1Q31A 4CRBA 1TGCA 2AYWA 2HVXA 3LDXH 1P3EA 3Q3YA 2BVSH 6CHAC 1C2HA 1SLVB 2DE8A 1F0RA 1EASA 5AHGH 3KEEA 2XBXA 3H7OA 5EXNA 5JB9S 2P3FH 1C5TA 1Y8TA 2CMYA 1EJAA 1MAYA 1P12E 2BXTH 1CO7E 3M3TA 8LPRA 2ZGXH 1T32A 2ALPA 1NFUA 3DD2H 3SNBA 3HGPA 4DOQA 1QHRB 1RIWC 1GMDG 1HPGA 2UUKB 1RXPA 2XC5A 3AASA 1GJBB 4D7FA 3PWBA 3IG6B 2GZ7A 3F9EA 5CHAB 1O5DH 3TK6A 1L2EA 1B7XB 4Y10E 2VINA 1TNIA 4O97A 5A09A 2GT7A 2QC2A 1SLWB 1LPGB 3MU4A 1E38B 2B7DH 4JYVH 2A45B 3LJOA 4UFDH 4Q2KA 4AN7A 1THRH 1Y3WA 3TVJB 1L4ZA 1SQTA 5L6NH 1WUNH 3P8FA 1ID5H 1DOJA 1B0EA 1SSXA 4MPWA 1WU1A 3A80A 5DP6A 2R2MB 2BD2A 2HNTF 1SPJA 2A0QB 5ESBA 3Q3XA 3CS7A 1X7AC 2ZA5A 1EZXC 2A7JA 1ANBA 1TQ7B 1A0HB 1O3KA 2ANKH 2ODQA 3SN8A 1FIZA 3QTOH 1UVSH 3K2UA 1SGEE 1TIOA 2CF9H 5T6FA 4YOIA 3F9GA 1IHTH 2NWNA 1TPPA 3SV7A 1OSSA 1IQMA 4X1PU 1GHZA 1Z8IB 1KXDA 2ANYA 5HGGA 2GGVB 1Q3XA 1GBDA 3E90B 1HNEE 2OC7A 3A8BA 3URDA 1BMAA 1C4Y2 2Z7FE 2ZDKA 2BZAA 4SGBE 2A4RA 1EPTA 2J9NA 1HLTH 4Z0KA 2ZCKP 3H7TA 5TCCA 5F6MA 5E2OA 2FESH 1FDPA 3SQHE 3M37A 1O3BA 3A87A 2BMGB 2THFB 2XCFA 2QF0A 3BTGE 2F83A 1D6RA 3GY5A 3KHVA 3TPIZ 1NU7B 5T3HA 1IQNA 1FAKH 3T29A 4YT6H 3S69A 1C1SA 3TH2H 3RMLH 4CRDA 1BOQA 4XBDA 1C4U2 1GJ7B 4Y8YA 4I33A 3RXBA 3MTYA 1YCPM 3EA9A 3W95A 3BEUA 1C9TA 1OWDA 1QRWA 3SU3A 1QR3E 2ZHEH 4QT8C 3RXHA 1MTSA 2G5NA 1C5WB 1G37A 1NTPA 3GISB 1EAIA 3KN2A 5F8XA 2VWOA 3M7UA 3ZVGA 2J4IA 3GDUA 3EQ0H 1L1GA 1JMOH 3L6PA 5K7RA 4A1TA 1O3OA 1GMHF 2O8LA 1CE5A 1NROH 5CE1A 1L4DA 3CP7A 2VWNA 4X1QU 1G3BA 2BLOA 1P9SA 2I6QA 2Y5FA 2ZFPH 4KKDA 4FUFA 3MO3A 5JB8S 2A31A 1GBHA 2P3UB 1J9CH 2GMTC 2M5TA 5EU8A 1BMLA 2ZI2H 5I25A 4TY6A 1C5OH 2GCTB 1A5GH 1XUGA 2C8ZB 5A8XA 4MPXA 1GMCG 1O3JA 1KXFA 1BUIA 2F9OA 4MNVA 2YOLA 4AZ2B 2B0FA 1GBAA 1P02A 2A1DB 2G4UA 2QGRA 2V3HH 4H4FA 4BOHA 3T62A 1A7SA 2BQWB 1HIAA 3F9HA 3PMAB 1H8IH 2TGAA 2BDBA 1CGJE 1S6HA 2D8WA 2QXIA 2JETB 1F5KU 2BX4A 1KDQA 3A89A 1MTWA 5JBTA 4ZUHA 1HJ8A 5EOKA 3SNCA 5BPEA 4Y79A 1S84A 3UWJH 3URCA 2AGIX 1TX6A 5EW2H 1O2HA 1W10U 1TONA 2OBQA 4X2XA 1MU6B 1TNGA 4GLYA 1W0YH 1JRSA 1GI7B 1TQ0B 1D3PB 1VITF 2FIRH 3U98H 4NSVA 2PKSB 1BRUP 3SUGA 1TRNA 3U69H 2HLCA 1A61H 1RRKA 1SGCA 3TGIE 2XC0A 1XXDA 2H6MA 1Q2WA 3JZ2B 4OGYA 3FP7E 2GD4B 3FVFB 4X8UH 1FPHH 4MVNA 4CRCA 1O2IA 1KXEA 1AN1E 1UTLM 3RM0H 4INHA 4LOYH 1FAXA 2C8YB 3ZVEA 2FOEA 2QCYA 4JYTA 1QJ1B 3MFJA 2AMQA 1EPTC 2W26A 1CHGA 1T8OA 1CSOE 4YOGA 5DJ7A 2G55A 1ZTKA 2EI8A 3S0NA 1TALA 1MMJN 4XBCA 5I46H 4AG1A 3SUDA 3M35A 4D9QA 3MU8A 1FONA 1OWIA 1TNHA 3K65B 4AGJA 4ZAEA 4DGJA 2ZFRH 1NRRH 2XXLA 1ANDA 1ZMJA 4DW2U 2XRCA 2R0KA 5FPYA 1GVZA 4IMQA 3TK9A 3FANA 1GBTA 4KTCA 1ZPCA 4NIVA 1P06A 1PPZA 5E0HA 3DA9B 4CHAC 2FI3E 1F5RA 4OS1A 4YT7H 4WMFA 3NZIA 1QBOA 1TOMH 1BTYA 1V6DA 4X6OA 3LOXA 4GVUA 1FIWA 1O2PA 4ABGA 5EODA 2BTCE 2VIVA 4WH8A 4BAQB 3EGKH 4J2YB 3GY7A 1HAHH 4JMYA 3TGJE 4E05H 2BY6X 4CH2B 3QDZB 1WYKA 2GV6A 4BAOB 2ZFFH 1GBCA 3BTQE 3RLYH 1TGSZ 5C1YA 1SGIB 4WVPE 3FFGA 3ZZ8A 2OINA 4OS6A 3PWCA 5L2ZH 1BBRK 2XBWA 4X2YA 3BG8A 1GBFA 3JZ1B 1O3HA 2A5AA 1GMHG 3VXFH 4R0IA 1O2TA 2XBYA 1BTXA 3KF2A 1A4WH 3S7HB 5E0GA 1C2IA 1EAXA 1LDTT 1P2MA 1BA8B 1EQ9A 3SU6A 3QUMP 2ZFSA 1QL9A 2TGPZ 3A7ZA 3ATIA 4O03A 3O8BA 1S83A 3E0PB 3S9AA 3STIA 1KXCA 1PPHE 5EQSA 2FOFA 1P09A 5HM9A 3VEQB 2ZDLA 4B73A 4THNH 1Y59T 2O8TA 2ZEBA 4K60A 6ESTA 1V2RT 3LGYA 2P95A 1PYTC 5FBEA 8ESTE 3RMMH 3EYDA 3BIVH 2QN5T 2ZFQH 1GI4A 4ABDA 2OD3B 3UOUA 2HNTE 1W0ZU 4E7RG 2SGQE 3QN7A 2ZGJA 3MI4A 3SJIA 2GZ9A 2G5VA 4DVAU 2PSXA 4WMDA 5EQRA 2C8XB 4LZ4B 1FY3A 5C2ZA 1G2MA 2FX4A 2R3UA 2H9HA 4X1SU 3HATH 2BXUH 4K3JA 4NGAH 3PMBB 1SI5H 1LO6A 1MKXK 1XM1A 3GY4A 3MH5A 3KCGH 4CRFA 7GCHF 3ODDA 3L3TA 2GCHF 3MWIU 4B2CA 3BTEE 1NRPH 3ZVFA 3ZZDA 5EQQA 4J1YA 1G3DA 1OOKB 2PTCE 4U32A 2J2UA 3QO6A 3RP2A 2F9NA 1VITG 1C9PA 1ZR0A 3MH7A 1VR1H 1WV7H 1NU9A 3D65E 1MBMA 4Y8XA 4JZFH 2ZHDA 2O8WA 3ENSB 5C20A 1SGDE 3BTHE 4OS5A 4BANB 5JBBS 2FS9A 2G8TA 2SGPE 1P2QA 1XX9A 1GBJA 1GBKA 1O31A 1NPMA 1FJSA 1Z71A 1MAXA 1MKWH 2FX6A 3E16B 1YCPK 3T2NA 1QB6A 2PFEA 1FNIA 1F0TA 5F03A 5AFYH 1SBWA 1L0ZA 2Q6GA 1KXBA 5JDUB 2TRMA 1O5BB 4Y0YE 1C1OA 1ZRKA 2ZU4A 1W13U 4FUGA 4BTIB 4O9VA 3T25A 5GIBA 3PO1C 1IQLA 1EOJA 1OPHB 2GDDA 3W94A 1SC8U 4WH6A 4B74A 3P6ZB 1G3EA 1V2TT 1MH0A 1A5HA 2OQUA 1VGCB 2QXJA 3F6UH 2XYAA 4D8NA 6LPRA 9LPRA 3GOVB 1C1MA 2NU1E 1IOEA 1GBBA 1OYQA 4BXSA 1BZXE 4D9RA 1VCPA 1IQFA 1O3NA 1YPMH 1S0QA 5J4SA 4BAMB 5DP4A 3ZVBA 2Q6FA 1RFNA 1WBGB 4ABEA 4MDSA 3U1IB 3BTFE 3VGCB 1HXFH 1SL3A 1J8AA 1UVPA 1UK2A 4Y11E 1ETTH 1S82A 4AB9A 2F91A 1Y5UT 3BEFB 3LU9B 1O3DA 1FPCH 1G2LA 3SHCH 3SJ8A 5A8ZA 1GG6B 1O0DH 1Z7KA 1K1OA 3HKIB 1FY5A 3GCOA 3SV8A 1AFQC 3GCHB 1QA0A 3LJJA 3MO6A 2OQ5A 2UWLA 2BHGA 1VCWA 4Y6DA 2RDLA 1CU1A 1HGTH 1Y3YA 3A83A 1MZAA 2QAAA 3KIDU 3KNXA 4XSKU 3A7TA 1GDQA 3EE0B 3A84A 3A8CA 2F3CE 2Y5HA 3A7WA 1MTVA 2NU3E 1OWHA 2V6NA 1BB0B 1SHHB 2FS8A 1MKXH 1PPFE 1RD3B 1E35B 2P93A 3OSYA 4ABHA 3ATLA 4I32A 2YNAA 3A85A 1P2NA 4AYYB 1LKBA 4RKOB 3GY3A 4ABAA 1C5UA 1XMNB 4E7NA 2BDAA 4Y7BA 1PQ7A 2STBE 1RTKA 1NS3A 2NU4E 3RDZA 5C67A 1SGFG 2GVFA 1P2IA 1YPHE 4CREA 4U2WA 4VGCB 1W7XH 1BTWA 5A0AE 1QRXA 3UTUH 1TWXB 1HAGE 3AVZA 1HXEH 3V12A 1INCA 1GHYH 4OS2A 2ZF0H 1W11U 2CHAC 4UFEH 4K8BA 1ZHMA 1GCTB 2EI6A 2A4QA 7GCHG 1ZJKA 1TOCB 3D49H 2GCHG 2H2ZA 1C2GA 1BMMH 4WXIA 1CBWC 4ZKRU 3BTDE 1EOLA 5CMXH 4BAKB 2Y81A 2ZU5A 2GKVE 4AYVB 2BOHB 4Y71A 1AVGH 5GDSH 1NFWA 4ZXXH 3M61U 1KTTB 1K21H 1O2SA 1W8BH 3R0FA 1UTOA 2RA0A 3MU5A 4NFFA 1SQAA 2P8OB 4MPUA 1O2YA 2QA9E 1VJ9U 1LHFH 4ESTE 1CGHA 1Z6JH 2PKAB 1P0SH 3PYHA 3OYPA 3RXPA 4NA9H 1Z8RA 2J95A 3V0XA 1YLDA 2Z3EA 3VB4A 3LH1A 1VCQA 4A7IB 4FU8A 3IWMA 1O3FA 4MTBA 1GJ6A 1HAIH 1UCYE 2Y7ZA 3SBKA 5FBIA 5L2YH 4SGAE 4GSOA 2Y82A 3LH3A 1O3AA 2FLBH 3GY6A 5JBCS 3OY6U 1QJ6B 5K0HA 4UD9H 4F4OC 1OXGA 3LGIA 5DP3A 1SGYE 5C5OA 3KGPA 4DG4A 1NRNH 4AB8A 1P01A 2Y80A 5IDKA 3GCTF 1WAYB 1UMAH 4BXWA 1D4PB 3NK8A 3P8OA 5JBAS 5LPFA 1O38A 5JPMH 1QBVH 1YP9A 3FZZA 1FV9A 1K2I1 2Z6BD 2FOGA 1ZSJA 4ABBA 2Z9IA 4ZXYH 3RXTA 2OTVA 5EPYA 4FUHA 6CHAB 1XUFA 1A46H 3PMJA 3M5MA 1QURH 1F7ZA 2ZPSA 2XCNA 2OC1A 1SB1H 3S7KB 2VWMA 3UOPA 5EXMA 1M9UA 1F0SA 1RIWB 3LC5A 4GHQA 4LXBH 3VB6A 3BG4C 1AHTH 5A2MH 3P8NA 2LNCA 2GT8A 3ZZ3A 1C5VA 4DJZB 5FCRA 1AB9C 2HPPH 1BRBE 4NIYA 2OLGA 1UK4A 5DG6A 4ZHMU 1O3CA 1DITH 2SGAA 4HGCA 2BY8X 2ZGBH 1DY8A 2P94A 4GAWA 3F1SB 1TAWA 3MH6A 2Z9KA 4INKA 1GI0A 3RU4T 1DPOA 1O5AB 1OP2A 4JZ1A 2AIQA 1GJ8B 2F9BH 1GI8B 1KLJH 2QXGA 1UTJA 3GDVA 1C5NH 5DGJA 2F9UA 1AGJA 2FOHA 2Y7XA 3SU2A 1C4V2 3TITA 4AFQA 2TPIZ 3SU5A 1GJ9B 1QIXB 3PB1E 1BT7A 1D3TB 2QV1A 4RSPA 2PUQH 1SGQE 4B75A 1YF4A 3STJA 2FPZA 3C1KA 3MO9A 2H5DA 1ELFA 1AKSA 1CGIE 2FI5E 2BVRH 1K1IA 2QY0B 2JETC 1HV7A 1TRMA 1HAYB 1N8OB 5FAHA 1FXYA 1YPLH 3UUZA 5HXFA 1O5FH 2STAE 1G3CA 1C1QA 4NSYA 1TGBA 3ZVDA 1LVBA 1EKBB 4B76A 3LKWA 1PPCE 1GHAF 1C1VH 2R9PA 2JH6D 1V2VT 3RU4D 4UDWH 1V2NT 4YM9A 3PTNA 1B0FA 3KQCA 2FOBA 4D7GA 3EDXB 1C5LH 1HAOH 4TPIZ 5TCAA 1SG8B 2IPHA 1HUTH 1AWHB 3QTVH 3HPTB 1O3EA 2WPJS 5DO4H 5FX5A 4I7YH 1DDJA 4Q80A 3MNBA 1QCPA 4HTCH 1ETRH 2BD3A 3A81A 5L30H 4NZLA 4KTUA 5A0CA 4AOQA 3PV4A 5BRRE 2ZDNA 1S81A 1W2KH 2BOKA 1C2LA 3PM3A 3U8RH 8GCHF 1HDTH 3MU1A 3QGNB 1XKBC 1Z6EA 1BTPA 3E91A 2ZQ1A 4X6MA 2CGAA 3RMNH 3SO3A 3TJVA 3ZZ5A 4YOJA 1FQ3A 1TPAE 2W3KA 1IQJA 4M7GA 1Y5AT 2JH5D 3VXEH 4DIHH 1GJ4H 1E36B 2R2WU 2ZC9H 4NIXA 5ETXA 4B2BA 3DUXH 1AO5A 3M5OA 1AVWA 3V13A 1AI8H 5EGMA 3RXFA 4I31A 1CQQA 4MLFB 1FY4A 2H1UA 3SGQE 1AZZA 1TMBH 1QFKH 2BY7X 3SI3H 1TX7A 1GHXH 3P8GA 2Z94A 3TNTA 1DUEA 2AFQB 3M5LA 1EZSC 3RXJA 1UO6A 1AVXA 3ZV8A 1HAVA 3DHKH 2WPIS 2OXSA 2PGBB 2VH6A 1O36A 1GI6A 4CBOA 2UWPA 4NWKA 1CA8B 1UTKA 1THSH 3A82A 3MNCA 1DE7H 4WJG2 2VIOA 4FUEA 1DFPA 1PQ5A 1K1JA 1GVKB 4IC6A 2GMTB 3ZYDA 2Z9LA 1FUJA 1MCVA 1TNKA 2F9PA 2J34A 1S0RA 3UNQA 4ZKNU 1AQ7A 2A32A 1O3IA 3LGTA 1UHBA 3NPSA 1OYTH 1JBUH 3ZZ6A 1GVLA 2FMJA 2F9VA 3SU0A 2W7SA 1QQUA 1CA0C 4K1EA 1K9OE 1WTHD 1BQYA 3P95A 1C1RA 2OC8A 2HRVA 1A3EH 2FOAA 1IQGA 1TGTA 3P92A 4E06H 1P2OA 3F9FA 3TJOA 2R3YA 2XWBI 1DS2E 3H5CB 2BM2A 2D26C 1QY6A 2BDGA 1Z8JB 1MKWK 3TIUA 4DIIH 1DXPA 1NRSH 2H9TH 5E8EH 3RXOA 1P11E 1A5IA 2ZZUH 1W7GH 1ZZZA 1MTUA 1NY22 7ESTE 5GPIB 1P05A 2WPLS 1O37A 1TFXA 1QBNA 1NFXA 1TBRH 4YESB 4MG3A 2C93B 2VGCC 3M3VA 4RKJB 1HCGA 1KTSB 2PGQB 3MHWU 4GUXA 2FEQH 1FLEE 2WYGA 5C3NA 1W14U 3UNRA 3KQBA 1Z1JA 2BD4A 1SLUB 1AWFH 1EPTB 1LCYA 2ZO3H 4IN2A 1ZRBA 3AW1A 2JKHA 4NZQA 2G81E 4FU9A 1DLEA 3RXRA 1DT2A 2GZ8A 2VIPA 1OKXA 3M7QA 2PWXA 5E2PA 2R0LA 1GHAG 1GHVH 1EP5A 2AS9A 1SHYA 4CRAA 1YPEH 3ZZ9A 1AIXH 1C1UH 2HGTH 4K1TA 3EAJA 1WQVH 2CF8H 1T4UH 1QL8A 3ESTA 1PPBH 2PR3A 1ELGA 1O2XA 1QB9A 1TABE 2XWAA 1DUAA 2O8MA 2O8UA 1N1LA 1A2CH 1BIOA 1SGNE 1EZUC 2BDIA 4CHAB 4DT7B 3MNXA 3RC4A 1K28D 1L1JA 4TYDA 4IMZA 8GCHG 1ZSLA 1TLDA 2GX4A 2FOMB 2CN0H 4HZHA 3TK5A 4CR9A 2CJIA 1TYNA 3Q00A 1D3QB 2ALVA 2ZPQA 1J15A 3RXSA 1ZMLA 2BDCA 1KYNA 3GDSA 1O5CB 1O3GA 6GCHF 1UTQA 3CS0A 3GY2A 2FTMA 1ANEA 1BRCE 1O2WA 1MTNC 1OWKA 1XVMA 1SOZA 1D3DB 2ZP0H 2ASUB 1OWJA 2ZCHP 4A92A 3O8CA 4FUBA 1C5PA 2FTLE 4FUJA 3SV6A 1C5QA 1EP6A 3UQVA 1ABJH 2B5TB 2UUYA 1O2RA 1LPKB 1U6QA 1PYTD 2PHBA 3D23A 1DWDH 1CT2E 1CHOF 2BLWA 5DKMA 1E0FD 1C1PA 4DURA 2FXRA 1HIAB 4K5ZA 1O5GH 1ZLRA 1AD8H 3TLOA 3UFAA 1AU8A 1TA6A 2ODPA 1VITH 1EAWA 1F92A 5FX6A 3PMHB 1LQEA 4JZEH 2VH0A 3RU4E 2FYQA 1SR5C 2Z9GA 4AORA 3SV2H 3RXIA 1E34B 2FP7B 3MYWA 1TE0A 2FO9A 3RC5A 1PPGE 4U30A 1GPZA 1EATA 1AE5A 4X1RU 3ZZ4A 1EZQA 3RXGA 1YPGH 2BQ6B 2WINI 3A7XA 5JYIA 2RG3A 1EXFA 4YO9A 3BF6H 4ZROA 1E37B 4PROA 1TRYA 3O8RA 2G52A 4OS4A 3TNSA 5GCHF 1LTOA 1C1NA 4VGCC 1P2KA 1G9IE 1AFEH 3CENA 2GP9B 1ZGIA 2BYAX 4YTAA 5ABWA 1SGTA 3VB7A 1ETSH 4UONA 1SFQB 1GI2A 2GDEH 1NRQH 3BTME 3E1XB 1HJ9A 3E0NB 1C2MA 1QJ7B 4ZMAH 5HYOA 1S5SA 1P2JA 5FPTA 2P59A 3QK1A 2OP9A 3P70B 4I8JA 1XUJA 4FUDA 2KAIB 1FMGA 4UE7H 1Y3UA 3BTWE 2QF3A 3MH4A 1O33A 4YZUA 4Y76A 5DP5A 3UR6A 1MCTA 1UCYH 2WV5A 4JK6A 1LKAA 3PO1B 4IBLH 1GGDB 1LQDB 3PTBA 2ZHQH 3Q3KA 3A86A 2EC9H 1MD7A 1ZYOA 3KQDA 3SNAA 2ZHFH 1O2QA 3U9AH 4NA8A 2QXHA 3RXMA 1UVOA 1O2VA 1H1BA 4Z6AH 1XUIA 1EB2A 7LPRA 1V3XA 1SLXB 3A8DA 1O2UA 2DUCA 1O2ZA 4TWYA 3KL6A 2Q6DA 3SU1A 3QX5H 1P10A 3ZZCA 5F8TA 1AY6H 1CT0E 1ELVA 1WTGH 2EA3A 1W12U 3I78A 2ODYB 1DWCH 2C4FH 2ZKSA 3WY8A 3FZDA 2FI4E 4TPYA 3HK6B 1RGQA 5EPNA 1KXAA 1BDAA 4HI3A 5AFZH 1GBEA 3QZRA 6GCHG 4F49A 1AFQB 1P57B 5AVDA 2GTBA 5CHAC 2PV9B 1ZGVA 4O3TA 1ARCA 4WWYA 1ESAA 3ELAH 1S85A 1O3LA 1BBRE 3BN9A 4YLUA 1SQOA 3EA8A 2BD8A 1GBMA 2FDAA 4D76A 1YLCA 1ZMNA 1BCUH 1LHDH 1GJ5H 1BRAA 2BVXH 3FP8E 1P3CA 1RS0A 1V2LT 3LONA 2C8WB 4X2VA 3SNDA 1CHOG 4UFFH 1FZZA 4ZH8A 4X6NA 1BTUA 1HAXB 2VVCA 4X1NU 4X8VH 1GJAB 3U8OH 5EW1H 1XUKA 1HJAB 1QQ4A 4FUIA 3S9BA 1DWBH 2ZU1A 4HFPB 1ANCA 2P16A 1DY9A 3RXQA 5C1XA 3RMOH 2YNBA 2FODA 1KIGH 2ESTE 5FHTA 3SJKA 3TJNA 5C5NA 3SV9A 2ZNKH 2WV4A 3HK3B 3E8LA 2HALA 5C1UA 2CHAB 2VB0A 4K8YA 4UEHH 4BAHB 1GMCF 2WYJA 1ELBA 1GL1A 3TU7H 1GI9B 3OTJE 1B5GH 1JIMA 1LVYA 3Q76A 1UVUH 1EAUA 3LGWA 3GYLB 1O3PB 2WPMS 3T28A 1JWTA 3GCNA 3PLBA 1GBIA 1CBWB 3A7YA 3NCLA 2V0BA 1PFXC 5GCHG 1ELCA 1OX1A 2RA3A 1A0JA 1NESE 4WF8A 2J92A 4MNXA 1RTFB 2XBVA 1V2OT 3BTKE 1TX8A 2ZECA 4NA7A 4JCNA 3AAVA 1SGRE 2VVUA 3I77A 2HNTC 4WXVA 4LZ1H 3UWIA 3SGAE 1ZPBA 5A0BA 5J4QA 5IYTA 1GJDB 2FLRH 3LC3A 2AIPA 2TBSA 2VU8E 1HYLA 3RC6A 2IOTA 1T8MA 1MBQA 4AFSA 4ZHLU 5G4BA 1O5EH 3RXCA 2BD9A 1IHSH 1FN8A 2EI7A 1H9HE 1BITA 2SNVA 3C27B 1JIRA 3S9CA 4Y0ZE 4IS5A 1NT1A 2BQ7B 1FY1A 4K2YA 1QTFA 4H6SB 3SJOA 1N8OC 1YBWA 2JH0D 1IQKA 2ILNA 2VNTA 1GI3A 1GI1A 1MZDA 2W3IA 2B9LA 2QYIA 1PQAA 3DT0H 2RCEA 2ZGCA 1YPKH 1XVOA 2H5CA 1T4VH 3RXLA 2ZGHA 3KQEA 3VFEA 3NUMA 1O39A 2VVVA 2BD5A 2FZZA 4A5TS 1SMFE 3SOSA 2K1QA 2BZ6H 2SGFE 1L1NA 4ABIA 4MQAA 4IN1A 2GCTC 1QB1A 3ATWA 2HPQH 2C90B 2VJ1A 1ESBA 2ZDMA 2BLVA 2AMDA 1DSTA 1H9LB 1Z1IA 1EJMA 3ATMA 3SJ9A 3UR9A 2SGDE 2A4GA 2ZG0H 4H42U 2TIOA 4MNWA 4KTSA 2W5EA 1TNLA 3QLPH 2XNIA 2VWLA 1GBLA 1MD8A 3I29A 2A5KA 3M5NA 4ISNA 4ZKSU 1HRTH 1DX5M 2FM2A 1TPOA 2SGEE 3ZZBA 3ZYEA 4BNRA 1H8DH 1DVAH 2C3SA 1ACBE 2ZFTA 2FWWA 3BG4B 1AE8H 4B1TA 3ODFA 1A0LA 4X6PA 5GXPA 3SI4H 2PKSC 1BHXF 3RXDA 3RXVA 1GHWH 3OY5U 3R3GB 1HB0B 1CVWH 1JRTA 4GCHF 4IC5A 1DICA 4ZHAA 1ZHRA 1AB9B 1ZOMA 2ZDVH 5AF9H 4KELA 4IW4E 1UJ1A 2A4OA 1IQEA 5F8ZA 1SOTA 3Q77A 4MPVA 2XTTB 4O3UA 4RN6A 3A7VA 4DCDA 1QRZA 1S6FA 5SGAE 1C2FA 3T26A 2AMPA 1O3MA 2ANMH 3MMGA 4GPGA 1C2KA 1A1RA 1O2LA 7KMEH 4ISLA 3RXKA 2V3OH 1C2DA 1C5ZB 2WUBA 1UTNA 4XE4A 3RUOA 1BJVA 4FU7A 1V2ST 1T31A 1NO9H 5E0JA 3BTTE 3T27A 1K22H 2PSYA 3LIWA 4JZDH 3GCTG 2EEKA 1SGFA 2XC4A 4TY7A 4X0WU 4ABJA 2IJOB 3SUEA 4OS7A 2W7UA 2SNWA 5GJ4B 1O2OA 3HKJB 1NFYA 1AMHA 1O34A 5TJXA 1YKTA 1KLTA 1P8VC 1YPHC 1QNJA 4Q7YA 1LHCH 4JYUH 1YC0A 1MU8B 2FYRA 4FUCA 4A6LA 1V2UT 1LMWB 2LPRA 2WUCA 4WMEA 1GCDA 1K1LA 4Y7AA 1LPZB 2AH4X 3SUFA 3AW0A 1BHXB 3T5FH 2H9EH 3FAOA 2UUFB 1J16A 3DFLA 2ZU2A 2ZIQH 1LVOA 2O9QA 5LPEA 3RXEA 3P17H 3GYMA 1O32A 3ZZ7A 1TB6H 1H4WA 4ISOA 1XXFA 4ASHA 2A5IA 1QL7A 1JXPA 1ORFA 1ZTJA 4NIWA 3AAUA 1TGNA 1EX3A 3RXAA 3ZVCA 3A88A 5DP8A 5B6OA 4I8HA 2TGTA 3K6YA 5FCKA 1G32B 1XUHA 5T6GA 1BTZA 1P04A 2A2QH 4ABFA 1BJUA 5FPSA 1Z8GA 1QA7A 3RM2H 1XKAC 3A8AA 1C5MD 1GJCB 3V7TA 1K1NA 1AUJA 4INLA 2A2XH 1T7CA 4YLQH 4AG2A 1DWEH 4IGDA 1UVTH 1F0UA 3SHAH 1YGCH 3UPEA 3B9FH 3G01A 1WQSA 2KAIA 3MU0A 3TH4H 5LPRA 2HOBA 1YM0A 2Z9JA 4XDEA 1F5LA 3U1JB 1YPJH 1J14A 1AZ8A 1JOUB 2QIQA 1F2SE 1K1PA 4X8TH 3BSQA 5DP7A 1G30B 5H4IB 3PLPA 2UWOA 4Q7XA 2PUXB 1DSUA 1CT4E 2ANWA 1O2JA 3U8TH 3L33A 1RTLA 1C5XB 2B8OH 3BIUH 2BY5X 2WPHS 1GWAA 1V2JT 3FP6E 5DK1A 4AX9H 4KGAA 1D9IA 4BTTB 3OX7U 1MQ6A 4JK5A 2ZQ2A 4TWWA 4AGKA 2ULLA 2D2DA 4GCHG 2D1JA 4AFUA 2BX3A 1UK3A 1CA0B 5EXLA 1HFDA 2OBOA 4I8GA 3B23B 2ZDAH 1C1TA 5A8YA 2PLXA 5LH8A 1A3BH 3N7OA 1SFIA 1GDUA 2J94A 1QGFA 2ZCLP 3GICB 1ELDE 3QGJA 5HM2A 1LHEH 2CV3A 1NM6A 3ATKA 1FI8A 2WPKS 8KME2 1LVMA 1GI5A 1EUFA 4CR5A 4A1XA 1AKSB 3VB3A 2PW8H 2G4TA 2ZTXA 2ZTYA 3B8JA 1TBQH 3IITA 1KLIH 3LGVA 1P03A 1HBTH 1ELEE 1OWEA 1T8NA 1TMUH 1ZSKA 2BLQA 1GL0E 1UCYK 2VGCB 4B71A 2HWLB 1O2NA 1VZQH 3NKKA 3SORA 4BTUB 2PKAA 1C5YB 1WSSH 1OP0A 3ZV9A 2AGGX 1HAZB 1VGCC 3BV9B 3QWCH 1GHBF 2BY9X 1WOFA 1OP8A 2G51A 1ZJDA 4K69A 3SNEA 3SZNA 1ABIH 1OS8A 4CH8B 2G00A 4X8SH 2NU0E 4U01A 1TPSA 4FXGH 4ISIH 3GY8A 4XFQA 4A1VA 1P9UA 1V2MT 3NWUA 3SGBE 2OC0A 3V3MA 3UY9A 4DY7B 2AERH 3SW2B 3VGCC
chains in the Genus database with same CATH superfamily
2DE9A 3E3TA 4NCYA 4B2AA 1FY8E 1EB1H 3MNSA 3QZQA 3VPKA 1V2WT 1ELTA 1PPEE 1GG6C 1K1MA 5GWZA 4Q7ZA 2GV7A 3GCHC 4Y8ZA 1KSNA 1C1WH 1DANH 1KDQB 1PQ8A 2Z3CA 4I86A 5T6DA 1TBZH 4HG6A 1BTHH 1MQ5A 1C5RA 2ZPRA 4H6TA 4AFZA 1G36A 1O35A 1UTPA 3PROA 3TH3H 5EG4A 1T8LA 2PTNA 2TGDA 2VIQA 2AGEX 4X2WA 5HMAA 1NN6A 2A7CA 1ARBA 1H9IE 1TNJA 2CXVA 4ZKOU 4I8KA 1WCZA 2ZHWH 1GMDF 1YYY1 4UFGH 2OCVB 4NG9H 4K1SA 1HAVB 1IQIA 1GGDC 1Y5BT 1BBRH 4JZIA 1GDNA 1IAUA 4FVDA 1MTNB 1V2QT 2J38A 3UQOA 1MUEB 1DM4B 1C5SA 1O2KA 3LPRA 3UNSA 1ZTLA 1DLKB 2Z3DA 3TGKE 1TA2A 3LGUA 3SQEE 1NZQH 3VB5A 3F68H 3LT3A 1FN6A 1UHBB 3ZZAA 2UUJB 4XBBA 4R8TB 3D62A 3UIRA 1TMTH 4FVBA 1GCTC 2IN2A 1V2KT 1RJXB 3NXPA 2A7HA 4NFEA 4OGXA 5CDFE 1EJNA 2KCPA 3DFJA 5FXLA 3RLWH 3ZVAA 2I6SA 4CBNA 1AUTC 1SVPA 2V35A 4GHTA 1THPB 5DP9A 1IQHA 1E79D 3HGNA 1VJAU 2ZU3A 1O2MA 2P3TB 2Y5GA 3SU4A 2Y6TA 3M3SA 1C2EA 2P8OC 1D6WA 2FOCA 2BD7A 4CRGA 2BDYA 1ELAA 2ZTZA 1O30A 9ESTA 5ESTE 3DSPA 4ISHH 2AEIH 2WV9A 4KP0A 1HJAC 2ZWLH 4WY3A 2OUAA 3E6PH 4LK4A 2BB4A 5DPAA 1Y3VA 2BDHA 3TJUA 2VIWA 4B6EA 1N6XA 1ZPZA 4MNYA 3OU0A 3OFND 1ZHPA 1LHGH 5HKKD 1DXWA 5LGOA 3BEIB 1YCPH 3EA7A 3PLKA 3O8DA 4I8LA 1ESTA 1PJPA 3MOCA 1NC6A 1GHBG 2KR7A 1O2GH 1N6YA 5PTPA 1W3CA 1BMNH 3M7TA 2NU2E 3UREA 1V2PT 4NWLA 2XW9A 3M36A 3K6ZA 1Y3XA 1HAPH 4XOJA 1KY9A 1J17T 3RXUA 1C2JA 2YMSD 1UTMA 1SGPE 2VIDA 2Q1JA 3K9XB 2SFAA 3ITIA 1Q31A 4CRBA 1TGCA 2AYWA 2HVXA 3LDXH 1P3EA 3KQ5A 3Q3YA 2BVSH 6CHAC 1C2HA 1SLVB 2DE8A 1F0RA 1EASA 5AHGH 3KEEA 2XBXA 3H7OA 5EXNA 5JB9S 2P3FH 1C5TA 1Y8TA 2CMYA 1EJAA 2L6OA 1MAYA 1P12E 2BXTH 1CO7E 3M3TA 5HIZA 2ZGXH 1T32A 2ALPA 8LPRA 1NFUA 3DD2H 3SNBA 3HGPA 4DOQA 1QHRB 1RIWC 1GMDG 1HPGA 2UUKB 1RXPA 2XC5A 3AASA 1GJBB 4D7FA 3FOAA 3PWBA 3IG6B 2GZ7A 3F9EA 5CHAB 1O5DH 3TK6A 1L2EA 3WW7A 1B7XB 4Y10E 2VINA 1TNIA 4O97A 5A09A 2GT7A 3KYGA 2QC2A 1SLWB 1LPGB 3MU4A 1E38B 2B7DH 4JYVH 2A45B 3LJOA 4UFDH 4Q2KA 4AN7A 1THRH 2HLDD 1Y3WA 3TVJB 1L4ZA 1SQTA 5L6NH 1WUNH 3P8FA 1ID5H 1DOJA 1B0EA 5FL7D 1SSXA 4MPWA 1WU1A 3A80A 5DP6A 2R2MB 2BD2A 2HNTF 3OAAD 1SPJA 2A0QB 5ESBA 3Q3XA 3CS7A 1X7AC 2ZA5A 1EZXC 2A7JA 1ANBA 1TQ7B 1A0HB 1O3KA 2ANKH 2ODQA 3SN8A 1FIZA 3QTOH 1UVSH 3K2UA 1SGEE 1TIOA 2CF9H 5T6FA 4YOIA 3F9GA 1IHTH 2NWNA 2W6JD 1TPPA 3SV7A 1OSSA 1IQMA 4X1PU 1GHZA 3SZEA 1Z8IB 1KXDA 2ANYA 5HGGA 2GGVB 1Q3XA 1GBDA 3E90B 1HNEE 2OC7A 3A8BA 3URDA 1BMAA 1C4Y2 2Z7FE 4F55A 2ZDKA 2BZAA 4SGBE 2A4RA 1EPTA 2J9NA 1HLTH 4Z0KA 2ZCKP 3H7TA 5TCCA 5F6MA 5E2OA 2FESH 1FDPA 3SQHE 3M37A 1O3BA 3A87A 2BMGB 2THFB 2XCFA 2QF0A 3BTGE 2F83A 1D6RA 3GY5A 3KHVA 3TPIZ 1NU7B 5T3HA 1IQNA 1FAKH 3T29A 4YT6H 3W1EA 5C0UA 3S69A 1C1SA 3TH2H 3RMLH 4CRDA 1BOQA 4XBDA 1C4U2 1GJ7B 4Y8YA 4I33A 3RXBA 3MTYA 1YCPM 3EA9A 3W95A 3BEUA 1C9TA 1OWDA 1QRWA 3SU3A 1QR3E 2ZHEH 4QT8C 1H8ED 3RXHA 1MTSA 2G5NA 1C5WB 1G37A 1NTPA 3GISB 1EAIA 3KN2A 5F8XA 2VWOA 3M7UA 3ZVGA 1MABB 2J4IA 3GDUA 3EQ0H 1L1GA 1JMOH 3L6PA 5K7RA 4A1TA 1O3OA 1GMHF 2O8LA 1CE5A 1NROH 5CE1A 1L4DA 3CP7A 2VWNA 4X1QU 3N7EA 1G3BA 2BLOA 1P9SA 2I6QA 2Y5FA 2ZFPH 4KKDA 4FUFA 3MO3A 5JB8S 2A31A 1GBHA 2P3UB 1J9CH 5DSFA 2GMTC 2M5TA 5EU8A 1BMLA 2ZI2H 5I25A 4TY6A 1C5OH 2GCTB 1A5GH 1XUGA 2C8ZB 5A8XA 4MPXA 1GMCG 1O3JA 1KXFA 1BUIA 2F9OA 4MNVA 2YOLA 4AZ2B 2B0FA 1GBAA 1P02A 2A1DB 2G4UA 2QGRA 2V3HH 4H4FA 4BOHA 3T62A 1A7SA 2BQWB 1HIAA 3F9HA 3PMAB 1H8IH 2HVYB 2TGAA 2BDBA 1CGJE 1S6HA 2D8WA 2QXIA 2JETB 1F5KU 2BX4A 1KDQA 3A89A 1MTWA 5JBTA 4ZUHA 1HJ8A 5EOKA 3SNCA 5BPEA 4Y79A 1S84A 3UWJH 3URCA 1UW7A 2AGIX 1TX6A 5EW2H 1O2HA 1W10U 1TONA 2OBQA 4X2XA 1MU6B 1TNGA 4GLYA 1W0YH 1JRSA 1GI7B 1TQ0B 1D3PB 1VITF 2FIRH 3U98H 4NSVA 2PKSB 1BRUP 3SUGA 1TRNA 3U69H 2HLCA 1A61H 1RRKA 1SGCA 5HIYA 2XC0A 1XXDA 2H6MA 1Q2WA 3JZ2B 4OGYA 3FP7E 2GD4B 3FVFB 4X8UH 1FPHH 4MVNA 4CRCA 1O2IA 1KXEA 1AN1E 1UTLM 3RM0H 4INHA 4LOYH 1FAXA 2C8YB 3ZVEA 2FOEA 2QCYA 4JYTA 1QJ1B 3MFJA 2AMQA 1EPTC 2W26A 1CHGA 1T8OA 1CSOE 4YOGA 5DJ7A 4OM9A 2G55A 1ZTKA 2EI8A 3S0NA 5CHBA 1TALA 1MMJN 4XBCA 5I46H 4AG1A 3SUDA 3M35A 4D9QA 3MU8A 1FONA 1OWIA 1TNHA 3K65B 4AGJA 4ZAEA 4DGJA 2ZFRH 1NRRH 2XXLA 1ANDA 1ZMJA 4DW2U 2XRCA 2R0KA 5FPYA 1GVZA 4IMQA 3TK9A 3FANA 1GBTA 4KTCA 1ZPCA 4NIVA 1P06A 1PPZA 5E0HA 3DA9B 4CHAC 2FI3E 1F5RA 4OS1A 4YT7H 4WMFA 2KZ4A 3NZIA 1QBOA 1TOMH 1BTYA 2VBCA 1V6DA 4X6OA 3LOXA 4GVUA 1FIWA 1O2PA 4ABGA 5EODA 2BTCE 2VIVA 4WH8A 4BAQB 3EGKH 2J98A 4J2YB 3GY7A 1HAHH 4JMYA 3TGJE 4E05H 2BY6X 4CH2B 3QDZB 1WYKA 2GV6A 4BAOB 2ZFFH 1GBCA 3BTQE 3RLYH 1TGSZ 5C1YA 1SGIB 4WVPE 2KFWA 3FFGA 1NBMD 3ZZ8A 2OINA 2QE7D 4OS6A 3PWCA 5L2ZH 1BBRK 2XBWA 4X2YA 3BG8A 1GBFA 3JZ1B 1O3HA 2A5AA 1GMHG 3VXFH 4R0IA 1O2TA 2XBYA 4RT1A 1BTXA 3KF2A 1A4WH 3S7HB 5E0GA 1C2IA 1EAXA 1LDTT 1P2MA 1BA8B 1EQ9A 3SU6A 5F53A 3QUMP 2ZFSA 1QL9A 2TGPZ 3A7ZA 3ATIA 4O03A 3O8BA 1S83A 3E0PB 3S9AA 3STIA 1KXCA 1PPHE 5EQSA 2FOFA 1P09A 5HM9A 3VEQB 2ZDLA 4B73A 4THNH 1Y59T 2O8TA 2ZEBA 4K60A 6ESTA 1V2RT 3LGYA 2P95A 1PYTC 5FBEA 8ESTE 3RMMH 3EYDA 3BIVH 2QN5T 2ZFQH 1GI4A 4ABDA 2OD3B 3UOUA 2HNTE 1W0ZU 4E7RG 2SGQE 3QN7A 2ZGJA 3MI4A 3SJIA 2GZ9A 2G5VA 4DVAU 2PSXA 4WMDA 5EQRA 2C8XB 4LZ4B 1FY3A 5C2ZA 2JJ1D 1G2MA 2FX4A 2R3UA 2H9HA 4X1SU 3HATH 1WDIA 2BXUH 4K3JA 4NGAH 3F2GA 3PMBB 1SI5H 1LO6A 1MKXK 1XM1A 3GY4A 3MH5A 3KCGH 4CRFA 7GCHF 3ODDA 3L3TA 2GCHF 3MWIU 2RDEA 4B2CA 3BTEE 1NRPH 3ZVFA 3ZZDA 5EQQA 4J1YA 1G3DA 1OOKB 2PTCE 4U32A 2J2UA 3QO6A 3RP2A 2F9NA 1VITG 1C9PA 1ZR0A 3MH7A 1VR1H 1WV7H 1NU9A 3D65E 1MBMA 4Y8XA 3PV5A 4JZFH 2ZHDA 2O8WA 1WXRA 3ENSB 5C20A 1SGDE 3BTHE 4OS5A 4BANB 5JBBS 2FS9A 3CNRA 2G8TA 2SGPE 1P2QA 1XX9A 1GBJA 1GBKA 1O31A 1NPMA 1FJSA 1Z71A 1MAXA 1MKWH 2FX6A 3E16B 1YCPK 3T2NA 1QB6A 2PFEA 1FNIA 1F0TA 5F03A 5AFYH 1SBWA 1L0ZA 2Q6GA 1KXBA 5JDUB 2TRMA 1O5BB 4Y0YE 1C1OA 1ZRKA 2ZU4A 1W13U 4FUGA 4BTIB 4O9VA 3T25A 5GIBA 3PO1C 1IQLA 5KGOA 1EOJA 1OPHB 2GDDA 3W94A 1SC8U 4WH6A 4B74A 3P6ZB 1G3EA 1V2TT 4ZCNA 1MH0A 3DCLA 1A5HA 2OQUA 1VGCB 2QXJA 3F6UH 2XYAA 4D8NA 6LPRA 9LPRA 3GOVB 1C1MA 2NU1E 1IOEA 1GBBA 1OYQA 4BXSA 1BZXE 4D9RA 1VCPA 1IQFA 1O3NA 1YPMH 1S0QA 5J4SA 4BAMB 5DP4A 3ZVBA 2Q6FA 1RFNA 1WBGB 4ABEA 4MDSA 3U1IB 3BTFE 3VGCB 1HXFH 1SL3A 1J8AA 1UVPA 1UK2A 4Y11E 1ETTH 1S82A 4AB9A 2F91A 1Y5UT 3BEFB 3LU9B 1O3DA 1FPCH 2RFKC 1G2LA 3SHCH 3SJ8A 5A8ZA 1GG6B 1O0DH 1Z7KA 1K1OA 2K0QA 1FY5A 3HKIB 3GCOA 3SV8A 1AFQC 3GCHB 1QA0A 2LELA 3LJJA 3MO6A 2OQ5A 2UWLA 2BHGA 1VCWA 4Y6DA 2RDLA 1CU1A 1HGTH 1Y3YA 4XD7D 3A83A 1MZAA 1E1QD 2QAAA 3KIDU 3KNXA 4XSKU 3A7TA 1GDQA 3N7DA 3EE0B 3A84A 3A8CA 1OHHD 2F3CE 2Y5HA 3A7WA 1MTVA 2NU3E 1OWHA 2V6NA 1BB0B 2XNDD 1SHHB 2FS8A 1MKXH 1PPFE 1RD3B 1E35B 2P93A 3OSYA 4ABHA 3ATLA 4I32A 2AHME 2YNAA 3A85A 1P2NA 4AYYB 1LKBA 4RKOB 3GY3A 4ABAA 1C5UA 1XMNB 4E7NA 2BDAA 4Y7BA 1PQ7A 2STBE 4FETA 1RTKA 1NS3A 2NU4E 3RDZA 5C67A 1SGFG 2GVFA 1P2IA 1YPHE 4CREA 4U2WA 4VGCB 1W7XH 1BTWA 5A0AE 1QRXA 3UTUH 1TWXB 2KCOA 1HAGE 3AVZA 1FX0B 1HXEH 3V12A 1INCA 1GHYH 4OS2A 2ZF0H 1W11U 2CHAC 5EJ1A 4UFEH 4K8BA 1ZHMA 2K8IA 2CK3D 1GCTB 2EI6A 2A4QA 7GCHG 1ZJKA 1TOCB 3D49H 2GCHG 5KECA 2H2ZA 1C2GA 1BMMH 4WXIA 1CBWC 4ZKRU 3BTDE 1EOLA 5CMXH 4BAKB 2Y81A 2ZU5A 2GKVE 2PP6A 4AYVB 2BOHB 4Y71A 1AVGH 5GDSH 1NFWA 4ZXXH 3M61U 1KTTB 1K21H 1O2SA 1W8BH 3R0FA 1UTOA 2RA0A 3MU5A 4NFFA 4Q4LA 1SQAA 2P8OB 4MPUA 1O2YA 2QA9E 1NBME 1VJ9U 1LHFH 4ESTE 1CGHA 3GS9A 2YMSB 1Z6JH 2PKAB 1P0SH 3PYHA 4TT3D 3OYPA 3RXPA 4NA9H 1Z8RA 2J95A 3V0XA 1YLDA 2KCAA 2Z3EA 3VB4A 3LH1A 1VCQA 4A7IB 4FU8A 3IWMA 1O3FA 4MTBA 1GJ6A 1HAIH 1UCYE 2Y7ZA 3SBKA 5FBIA 5L2YH 4SGAE 4GSOA 2Y82A 2JIZD 3LH3A 1O3AA 2FLBH 3GY6A 5JBCS 3OY6U 1QJ6B 4XRNA 5K0HA 4UD9H 4F4OC 1OXGA 4YXWD 3LGIA 5DP3A 1SGYE 5C5OA 3KGPA 4DG4A 1NRNH 4AB8A 1KMHB 1P01A 3OTPA 2Y80A 5IDKA 3GCTF 1WAYB 1UMAH 2XOKD 4BXWA 1D4PB 3NK8A 3P8OA 5JBAS 5LPFA 1O38A 5JPMH 1QBVH 1YP9A 3FZZA 1FV9A 1K2I1 2Z6BD 2FOGA 1ZSJA 4ABBA 2Z9IA 4ZXYH 3RXTA 2OTVA 5EPYA 4FUHA 6CHAB 1XUFA 1A46H 3PMJA 2J5UA 3M5MA 1QURH 1F7ZA 2ZPSA 2XCNA 2OC1A 1SB1H 3UAIC 3S7KB 2VWMA 3UOPA 5EXMA 1M9UA 1F0SA 1RIWB 3LC5A 4GHQA 4LXBH 3VB6A 3BG4C 1AHTH 5A2MH 3P8NA 2LNCA 2GT8A 3ZZ3A 5C17A 1C5VA 4DJZB 5FCRA 1AB9C 2HPPH 3WWFA 1BRBE 4NIYA 2OLGA 1UK4A 5DG6A 4ZHMU 1O3CA 1DITH 2SGAA 4HGCA 2BY8X 2ZGBH 2KCYA 1DY8A 2P94A 4GAWA 3F1SB 1TAWA 3MH6A 2Z9KA 4INKA 1GI0A 3RU4T 1YWUA 3PV2A 1DPOA 1O5AB 1OP2A 4JZ1A 4Z1MD 2AIQA 1GJ8B 2F9BH 1GI8B 1KLJH 2QXGA 1UTJA 3GDVA 1C5NH 5DGJA 2F9UA 1SKYE 1AGJA 2FOHA 2Y7XA 3SU2A 1C4V2 3TITA 4AFQA 2TPIZ 3SU5A 1GJ9B 1K0HA 1QIXB 3PB1E 1BT7A 1D3TB 2QV1A 4RSPA 2PUQH 2WHXA 1SGQE 4B75A 1YF4A 3STJA 2FPZA 3C1KA 3MO9A 2H5DA 1ELFA 1AKSA 1CGIE 2FI5E 2BVRH 1K1IA 2QY0B 2JETC 1HV7A 1TRMA 1HAYB 1N8OB 5FAHA 1FXYA 1YPLH 3UUZA 5HXFA 1O5FH 2STAE 1G3CA 1C1QA 4NSYA 1TGBA 3ZVDA 1LVBA 1EKBB 4B76A 3LKWA 1PPCE 1GHAF 1C1VH 2R9PA 2JH6D 1V2VT 3RU4D 4UDWH 1V2NT 4YM9A 3PTNA 1B0FA 3KQCA 2FOBA 4D7GA 3EDXB 1C5LH 1HAOH 4TPIZ 5TCAA 1SG8B 2IPHA 1HUTH 1AWHB 3PRBA 3HPTB 3QTVH 1O3EA 2WPJS 5C94A 5DO4H 5FX5A 4I7YH 1DDJA 4Q80A 3MNBA 1QCPA 4HTCH 1E1RD 1ETRH 2BD3A 3A81A 4NZLA 5L30H 4KTUA 5A0CA 4AOQA 3PV4A 5BRRE 2ZDNA 1S81A 1W2KH 2BOKA 1C2LA 3PM3A 3U8RH 8GCHF 1HDTH 3MU1A 3QGNB 1XKBC 1Z6EA 1BTPA 2F4LA 3E91A 2ZQ1A 4X6MA 2CGAA 3RMNH 3SO3A 3TJVA 3ZZ5A 4YOJA 4DT4A 1FQ3A 1TPAE 2W3KA 1IQJA 4M7GA 1Y5AT 2JH5D 3VXEH 4DIHH 1GJ4H 1E36B 2R2WU 2ZC9H 4NIXA 5ETXA 5GNDA 4B2BA 3DUXH 1AO5A 3M5OA 1AVWA 3V13A 1AI8H 5EGMA 3RXFA 4I31A 1CQQA 4MLFB 1FY4A 2H1UA 3SGQE 1AZZA 1TMBH 1QFKH 2BY7X 3SI3H 1TX7A 1GHXH 3P8GA 2Z94A 3TNTA 1DUEA 2AFQB 3M5LA 1EZSC 3RXJA 4F48B 1UO6A 1AVXA 3ZV8A 5EIYA 1HAVA 3DHKH 3NRLA 2WPIS 2OXSA 2PGBB 2VH6A 1O36A 1GI6A 4CBOA 2UWPA 4NWKA 1CA8B 1UTKA 1THSH 3A82A 3MNCA 1DE7H 4WJG2 2VIOA 4FUEA 1DFPA 1PQ5A 1K1JA 1GVKB 4IC6A 2GMTB 3ZYDA 2Z9LA 1FUJA 1MCVA 1TNKA 2F9PA 2J34A 1S0RA 3UNQA 4ZKNU 1AQ7A 2A32A 1O3IA 3LGTA 1UHBA 3NPSA 1OYTH 1JBUH 3U28C 3ZZ6A 1GVLA 2FMJA 2F9VA 3SU0A 2W7SA 1QQUA 1CA0C 4K1EA 1K9OE 1WTHD 1BQYA 3P95A 1C1RA 2OC8A 2HRVA 1A3EH 2FOAA 1IQGA 3SYJA 1TGTA 3P92A 4E06H 1P2OA 3F9FA 3TJOA 2R3YA 2XWBI 1DS2E 3H5CB 2BM2A 2D26C 1QY6A 2BDGA 1Z8JB 1MKWK 4Q63A 3TIUA 4DIIH 1DXPA 1NRSH 2H9TH 5E8EH 3RXOA 1P11E 1A5IA 2ZZUH 1W7GH 1ZZZA 1MTUA 1NY22 7ESTE 5GPIB 1P05A 2WPLS 1O37A 1TFXA 1QBNA 1NFXA 1TBRH 4YESB 4MG3A 2C93B 3F0PA 2VGCC 3M3VA 4RKJB 1HCGA 1KTSB 2PGQB 3MHWU 4GUXA 2FEQH 1FLEE 2WYGA 5C3NA 1W14U 3UNRA 3KQBA 1Z1JA 2BD4A 1SLUB 1AWFH 1EPTB 1LCYA 2ZO3H 4IN2A 1ZRBA 3AW1A 2JKHA 4NZQA 2G81E 4FU9A 1DLEA 3RXRA 1DT2A 2GZ8A 2VIPA 1OKXA 3M7QA 2PWXA 5E2PA 2R0LA 1GHAG 1GHVH 2V3MA 1EP5A 2AS9A 1SHYA 4CRAA 1YPEH 3ZZ9A 1AIXH 1C1UH 2HGTH 4K1TA 3EAJA 1WQVH 2CF8H 1T4UH 1QL8A 3ESTA 1PPBH 1VKYA 2PR3A 1ELGA 1O2XA 1QB9A 1TABE 2XWAA 1DUAA 2O8MA 2O8UA 1N1LA 1A2CH 1BIOA 1SGNE 1EZUC 2BDIA 4CHAB 4DT7B 3MNXA 3RC4A 1K28D 1L1JA 4TYDA 4P02A 4IMZA 2IPQX 2L74A 8GCHG 1ZSLA 1TLDA 2GX4A 2FOMB 2CN0H 4HZHA 3TK5A 4CR9A 2CJIA 1TYNA 3Q00A 1D3QB 3OE7D 2ALVA 2ZPQA 1J15A 1QZ8A 3RXSA 1ZMLA 2BDCA 1KYNA 3GDSA 1O5CB 1O3GA 6GCHF 1UTQA 3CS0A 3GY2A 2FTMA 1ANEA 1BRCE 1O2WA 1MTNC 1OWKA 1XVMA 1SOZA 1D3DB 2ZP0H 2ASUB 1OWJA 2ZCHP 3DSOA 4A92A 3O8CA 4FUBA 1C5PA 2FTLE 4FUJA 3SV6A 1C5QA 1EP6A 3UQVA 1ABJH 2B5TB 2UUYA 1O2RA 1LPKB 1U6QA 1PYTD 2PHBA 3D23A 3F0OA 1DWDH 1CT2E 1CHOF 2BLWA 5DKMA 1E0FD 1C1PA 4DURA 2FXRA 1HIAB 4K5ZA 1O5GH 1ZLRA 1AD8H 3TLOA 5EJLA 3UFAA 1AU8A 1TA6A 2ODPA 1VITH 1EAWA 1F92A 5FX6A 3PMHB 1LQEA 4JZEH 2VH0A 3RU4E 2FYQA 1SR5C 3PRDA 2LP6A 2Z9GA 4AORA 3SV2H 3RXIA 1E34B 2FP7B 3MYWA 1TE0A 2FO9A 3RC5A 1PPGE 4U30A 1GPZA 1EATA 1AE5A 4X1RU 3ZZ4A 1EZQA 3RXGA 1YPGH 2BQ6B 2WINI 3A7XA 5JYIA 2RG3A 1EFRD 1EXFA 4YO9A 3BF6H 4ZROA 1E37B 4PROA 1TRYA 3O8RA 2G52A 4OS4A 3TNSA 5GCHF 3DSGA 1LTOA 1C1NA 4VGCC 1P2KA 1G9IE 1AFEH 3CENA 2GP9B 1ZGIA 2BYAX 4YTAA 5ABWA 1SGTA 3FKSD 4ASUD 3VB7A 1ETSH 4UONA 1SFQB 1GI2A 2GDEH 1NRQH 3BTME 3MQKC 3E1XB 1HJ9A 3E0NB 1C2MA 1QJ7B 4ZMAH 5HYOA 1S5SA 1P2JA 5FPTA 2P59A 3QK1A 2OP9A 3P70B 4I8JA 1XUJA 4FUDA 2KAIB 1FMGA 4UE7H 1Y3UA 3BTWE 2QF3A 3MH4A 1O33A 4YZUA 4Y76A 5DP5A 3UR6A 1MCTA 1UCYH 2WV5A 4JK6A 1LKAA 3PO1B 4IBLH 1GGDB 1LQDB 3PTBA 2ZHQH 3Q3KA 3A86A 2EC9H 1MD7A 1ZYOA 3KQDA 3SNAA 2J98B 2ZHFH 1O2QA 3U9AH 4NA8A 2QXHA 3RXMA 1UVOA 1O2VA 1H1BA 4Z6AH 1XUIA 1EB2A 7LPRA 1V3XA 1SLXB 3A8DA 1O2UA 2DUCA 1O2ZA 4TWYA 3KL6A 2Q6DA 2YMSC 3SU1A 3QX5H 1P10A 3ZZCA 5F8TA 1AY6H 1CT0E 1ELVA 1WTGH 2EA3A 2KX4A 1W12U 3I78A 2ODYB 1DWCH 2C4FH 2ZKSA 3WY8A 2OK5A 3FZDA 2FI4E 4TPYA 3HK6B 1RGQA 5EPNA 1KXAA 1BDAA 4HI3A 3F2HA 5AFZH 1GBEA 3QZRA 6GCHG 4F49A 1AFQB 1P57B 5KEDA 5AVDA 2GTBA 5CHAC 2PV9B 1ZGVA 4O3TA 1ARCA 4WWYA 2JDID 1ESAA 3ELAH 1S85A 1O3LA 1BBRE 3EE7A 3BN9A 4YLUA 1SQOA 3EA8A 2BD8A 1GBMA 2FDAA 4D76A 1YLCA 1ZMNA 1BCUH 1LHDH 2V7QD 1GJ5H 1BRAA 2BVXH 3FP8E 1P3CA 1RS0A 1V2LT 3LONA 2C8WB 4X2VA 3SNDA 1CHOG 4UFFH 1FZZA 4ZH8A 4X6NA 1BTUA 1HAXB 2VVCA 4X1NU 4X8VH 1GJAB 3U8OH 5EW1H 1XUKA 1HJAB 1QQ4A 4FUIA 3S9BA 1DWBH 2ZU1A 4HFPB 5DN6D 4P00A 1ANCA 2P16A 1DY9A 3RXQA 3ZIAD 5C1XA 3F3BA 3RMOH 2YNBA 2FODA 1KIGH 2ESTE 5FHTA 3SJKA 3TJNA 5C5NA 3SV9A 2ZNKH 2WV4A 3HK3B 3E8LA 2HALA 5C1UA 2CHAB 2VB0A 1H8HD 4K8YA 4UEHH 2IJD1 4BAHB 1GMCF 2WYJA 1ELBA 1GL1A 3TU7H 1GI9B 3OTJE 1B5GH 1JIMA 1LVYA 3Q76A 1UVUH 1EAUA 3LGWA 3GYLB 1O3PB 2WPMS 3T28A 1JWTA 3GCNA 3PLBA 1GBIA 1CBWB 3A7YA 3NCLA 1YY3A 2V0BA 1PFXC 5GCHG 1ELCA 1OX1A 2RA3A 1A0JA 1NESE 4WF8A 2J92A 4MNXA 5C0TA 1RTFB 2XBVA 1V2OT 3BTKE 1TX8A 2ZECA 4NA7A 4JCNA 3AAVA 1SGRE 2VVUA 3I77A 2HNTC 4WXVA 4LZ1H 3UWIA 3SGAE 3AK5A 4AC9A 1ZPBA 5A0BA 5J4QA 5IYTA 1GJDB 2FLRH 3LC3A 2AIPA 2TBSA 2VU8E 1HYLA 3RC6A 2IOTA 1T8MA 1MBQA 4AFSA 4ZHLU 5G4BA 1O5EH 3RXCA 2BD9A 1IHSH 1FN8A 2EI7A 1H9HE 1BITA 2SNVA 3C27B 1JIRA 3S9CA 4Y0ZE 4IS5A 3H09A 1NT1A 2BQ7B 1FY1A 4K2YA 1QTFA 4H6SB 3SJOA 1N8OC 1YBWA 2JH0D 1IQKA 2ILNA 2VNTA 1GI3A 1GI1A 1MZDA 3WWBA 2W3IA 2B9LA 2QYIA 1PQAA 3DT0H 2RCEA 2ZGCA 1YPKH 1XVOA 2H5CA 1T4VH 3RXLA 2ZGHA 3KQEA 3VFEA 5B6LA 3NUMA 1O39A 2VVVA 2BD5A 2FZZA 4A5TS 1SMFE 3SOSA 2K1QA 2BZ6H 2SGFE 1L1NA 4ABIA 4MQAA 4IN1A 2GCTC 1QB1A 3ATWA 2HPQH 2C90B 2VJ1A 1ESBA 2ZDMA 2BLVA 2AMDA 1DSTA 1H9LB 1Z1IA 1EJMA 3ATMA 3SJ9A 3UR9A 2SGDE 2A4GA 2ZG0H 4H42U 2TIOA 4MNWA 4KTSA 2W5EA 1TNLA 3QLPH 2XNIA 2VWLA 1GBLA 1MD8A 3I29A 2A5KA 3M5NA 4ISNA 4ZKSU 1HRTH 1DX5M 2WSSD 2FM2A 1TPOA 2SGEE 3ZZBA 2EY4C 3ZYEA 3OEHD 1H8DH 1DVAH 2C3SA 4BNRA 1ACBE 2ZFTA 2FWWA 3N99A 3BG4B 1AE8H 4B1TA 3ODFA 1A0LA 4X6PA 2J97A 5GXPA 3SI4H 2PKSC 1BHXF 3RXDA 3RXVA 1GHWH 3OY5U 2QF4A 1HB0B 3R3GB 1W0KD 1CVWH 1JRTA 4GCHF 4IC5A 1DICA 4ZHAA 1ZHRA 1AB9B 1ZOMA 2ZDVH 5AF9H 4KELA 4IW4E 1UJ1A 2A4OA 1IQEA 5F8ZA 4ACBA 1SOTA 3Q77A 4MPVA 2XTTB 4O3UA 2M2AA 4RN6A 3A7VA 4DCDA 3FN8A 1QRZA 1S6FA 5SGAE 1C2FA 3T26A 2AMPA 1O3MA 1W0JD 2ANMH 3MMGA 4GPGA 1C2KA 1A1RA 1O2LA 7KMEH 4ISLA 3RXKA 1SQRA 2V3OH 1C2DA 1C5ZB 2WUBA 1UTNA 4XE4A 3RUOA 1BJVA 4FU7A 1V2ST 1T31A 1NO9H 5E0JA 3BTTE 3T27A 1K22H 2PSYA 3LIWA 4JZDH 3GCTG 2EEKA 1SGFA 2XC4A 4TY7A 4X0WU 4ABJA 2IJOB 3SUEA 4OS7A 2JJ2D 2W7UA 2SNWA 5GJ4B 1O2OA 3HKJB 1NFYA 1AMHA 1O34A 5TJXA 1YKTA 1KLTA 1P8VC 1YPHC 1QNJA 4Q7YA 1LHCH 4JYUH 1YC0A 4FOUC 1MU8B 2FYRA 4FUCA 4A6LA 1V2UT 1LMWB 2LPRA 2WUCA 4WMEA 1GCDA 1K1LA 4Y7AA 1LPZB 2AH4X 3SUFA 3AW0A 1BHXB 3T5FH 2H9EH 3FAOA 4TSFD 2QF5A 2UUFB 1J16A 3DFLA 2ZU2A 2ZIQH 1LVOA 2O9QA 5LPEA 4M9FA 3KYFA 3RXEA 3P17H 3GYMA 1O32A 3ZZ7A 1TB6H 1H4WA 4ISOA 1XXFA 4ASHA 2A5IA 1QL7A 1JXPA 1ORFA 1YLNA 1ZTJA 4NIWA 3AAUA 1TGNA 1EX3A 3RXAA 3ZVCA 3A88A 5DP8A 2W6ID 5B6OA 4I8HA 2TGTA 3K6YA 5FCKA 1G32B 1XUHA 5T6GA 1BTZA 1P04A 2A2QH 4ABFA 1BJUA 5FPSA 4ACAA 1Z8GA 1QA7A 3RM2H 5EJZA 1XKAC 3A8AA 1C5MD 1GJCB 3V7TA 1K1NA 1AUJA 4INLA 2A2XH 1T7CA 4YLQH 4AG2A 1DWEH 4IGDA 1UVTH 1F0UA 3SHAH 1YGCH 3UPEA 3B9FH 3G01A 1WQSA 2KAIA 3MU0A 3TH4H 5LPRA 2HOBA 4RT0A 1YM0A 2Z9JA 4XDEA 1F5LA 1S6LA 3U1JB 1YPJH 1J14A 1AZ8A 1JOUB 2QIQA 1F2SE 2WPDD 1K1PA 4X8TH 3BSQA 5DP7A 1G30B 5H4IB 3VG8A 3PLPA 2UWOA 4Q7XA 2PUXB 1DSUA 1CT4E 2ANWA 1O2JA 2F43B 3U8TH 3L33A 1RTLA 1C5XB 2EQNA 2B8OH 3BIUH 2BY5X 4RI0A 2WPHS 1GWAA 1V2JT 5T1VA 3FP6E 5DK1A 4AX9H 3UB0A 2WZQA 4KGAA 1D9IA 4BTTB 3OX7U 1MQ6A 4JK5A 2ZQ2A 2GJGA 4TWWA 4AGKA 2ULLA 2D2DA 4GCHG 2D1JA 4AFUA 2BX3A 1UK3A 1CA0B 5EXLA 5IK2D 1HFDA 2OBOA 4I8GA 3B23B 2ZDAH 1COWD 1C1TA 5A8YA 2PLXA 3OEED 5LH8A 1A3BH 3N7OA 1SFIA 1GDUA 2J94A 1QGFA 2ZCLP 3GICB 1ELDE 3QGJA 5HM2A 4B6FA 1LHEH 2CV3A 1NM6A 3ATKA 1FI8A 2WPKS 8KME2 1LVMA 1GI5A 1EUFA 4CR5A 4A1XA 1AKSB 3VB3A 2PW8H 2G4TA 2ZTXA 2ZTYA 3F2FA 1BMFD 3B8JA 1TBQH 3IITA 1KLIH 3LGVA 1P03A 1HBTH 1ELEE 1OWEA 1T8NA 1TMUH 1ZSKA 2KM0A 2BLQA 1GL0E 1UCYK 2VGCB 4B71A 2HWLB 1O2NA 1VZQH 3NKKA 3SORA 4BTUB 2PKAA 1C5YB 1WSSH 1OP0A 3ZV9A 2AGGX 1HAZB 1VGCC 3BV9B 3QWCH 1GHBF 2BY9X 1WOFA 1OP8A 2G51A 1ZJDA 4K69A 3SNEA 3SZNA 3FO8D 1ABIH 1OS8A 4CH8B 2G00A 4X8SH 2NU0E 3TGIE 4U01A 1TPSA 4FXGH 4ISIH 3GY8A 4XFQA 4A1VA 1P9UA 1V2MT 3NWUA 3SGBE 2OC0A 3V3MA 3UY9A 4DY7B 2AERH 3SW2B 3VGCC
chains in the Genus database with same CATH topology
2DE9A 3E3TA 4NCYA 4B2AA 1FY8E 1EB1H 3MNSA 3QZQA 3VPKA 1V2WT 1ELTA 1PPEE 1GG6C 1K1MA 5GWZA 4Q7ZA 2GV7A 3GCHC 4Y8ZA 1KSNA 1C1WH 1DANH 1KDQB 1PQ8A 2Z3CA 5T6DA 1TBZH 1BTHH 1MQ5A 1C5RA 2ZPRA 4H6TA 4AFZA 1G36A 1O35A 1UTPA 3PROA 3TH3H 5EG4A 1T8LA 2PTNA 2TGDA 2VIQA 2AGEX 4X2WA 5HMAA 1NN6A 2A7CA 1ARBA 1H9IE 1TNJA 2CXVA 4ZKOU 4I8KA 1WCZA 2ZHWH 1GMDF 1YYY1 4UFGH 2OCVB 4NG9H 4K1SA 1HAVB 1IQIA 1GGDC 1Y5BT 1BBRH 4JZIA 1GDNA 1IAUA 4FVDA 1MTNB 1V2QT 2J38A 3UQOA 1MUEB 1DM4B 1C5SA 1O2KA 3LPRA 3UNSA 1ZTLA 1DLKB 2Z3DA 3TGKE 1TA2A 3LGUA 3SQEE 1NZQH 3VB5A 3F68H 3LT3A 1FN6A 1UHBB 3ZZAA 2UUJB 4XBBA 4R8TB 3D62A 3UIRA 1TMTH 4FVBA 1GCTC 2IN2A 1V2KT 1RJXB 3NXPA 2A7HA 4NFEA 4OGXA 1EJNA 5FXLA 3DFJA 3RLWH 4CBNA 3ZVAA 2I6SA 1AUTC 1SVPA 2V35A 4GHTA 1THPB 5DP9A 1IQHA 3HGNA 1VJAU 2ZU3A 1O2MA 2P3TB 2Y5GA 3SU4A 2Y6TA 3M3SA 1C2EA 2P8OC 1D6WA 2FOCA 2BD7A 4CRGA 2BDYA 1ELAA 2ZTZA 1O30A 9ESTA 5ESTE 4ISHH 2AEIH 4KP0A 1HJAC 2ZWLH 4WY3A 2OUAA 3E6PH 4LK4A 2BB4A 5DPAA 1Y3VA 2BDHA 3TJUA 2VIWA 1N6XA 1ZPZA 4MNYA 3OU0A 1ZHPA 1LHGH 1DXWA 5LGOA 3BEIB 1YCPH 3EA7A 3PLKA 3O8DA 4I8LA 1ESTA 1PJPA 3MOCA 1NC6A 1GHBG 1O2GH 1N6YA 5PTPA 1W3CA 1BMNH 3M7TA 2NU2E 3UREA 1V2PT 4NWLA 2XW9A 3M36A 3K6ZA 1Y3XA 1HAPH 4XOJA 1KY9A 1J17T 3RXUA 1C2JA 1UTMA 1SGPE 2VIDA 2Q1JA 3K9XB 2SFAA 3ITIA 1Q31A 4CRBA 1TGCA 2AYWA 2HVXA 3LDXH 1P3EA 3Q3YA 2BVSH 6CHAC 1C2HA 1SLVB 2DE8A 1F0RA 1EASA 5AHGH 3KEEA 2XBXA 3H7OA 5EXNA 5JB9S 2P3FH 1C5TA 1Y8TA 2CMYA 1EJAA 1MAYA 1P12E 2BXTH 1CO7E 3M3TA 8LPRA 2ZGXH 1T32A 2ALPA 1NFUA 3DD2H 3SNBA 3HGPA 4DOQA 1QHRB 1RIWC 1GMDG 1HPGA 2UUKB 1RXPA 2XC5A 3AASA 1GJBB 4D7FA 3PWBA 3IG6B 2GZ7A 3F9EA 5CHAB 1O5DH 3TK6A 1L2EA 1B7XB 4Y10E 2VINA 1TNIA 4O97A 5A09A 2GT7A 2QC2A 1SLWB 1LPGB 3MU4A 1E38B 2B7DH 4JYVH 2A45B 3LJOA 4UFDH 4Q2KA 4AN7A 1THRH 1Y3WA 3TVJB 1L4ZA 1SQTA 5L6NH 1WUNH 3P8FA 1ID5H 1DOJA 1B0EA 1SSXA 4MPWA 1WU1A 3A80A 5DP6A 2R2MB 2BD2A 2HNTF 1SPJA 2A0QB 5ESBA 3Q3XA 3CS7A 1X7AC 2ZA5A 1EZXC 2A7JA 1ANBA 1TQ7B 1A0HB 1O3KA 2ANKH 2ODQA 3SN8A 1FIZA 3QTOH 1UVSH 3K2UA 1SGEE 1TIOA 2CF9H 5T6FA 4YOIA 3F9GA 1IHTH 2NWNA 1TPPA 3SV7A 1OSSA 1IQMA 4X1PU 1GHZA 1Z8IB 1KXDA 2ANYA 5HGGA 2GGVB 1Q3XA 1GBDA 3E90B 1HNEE 2OC7A 3A8BA 3URDA 1BMAA 1C4Y2 2Z7FE 2ZDKA 2BZAA 4SGBE 2A4RA 1EPTA 2J9NA 1HLTH 4Z0KA 2ZCKP 3H7TA 5TCCA 5F6MA 5E2OA 2FESH 1FDPA 3SQHE 3M37A 1O3BA 3A87A 2BMGB 2THFB 2XCFA 2QF0A 3BTGE 2F83A 1D6RA 3GY5A 3KHVA 3TPIZ 1NU7B 5T3HA 1IQNA 1FAKH 3T29A 4YT6H 3S69A 1C1SA 3TH2H 3RMLH 4CRDA 1BOQA 4XBDA 1C4U2 1GJ7B 4Y8YA 4I33A 3RXBA 3MTYA 1YCPM 3EA9A 3W95A 3BEUA 1C9TA 1OWDA 1QRWA 3SU3A 1QR3E 2ZHEH 4QT8C 3RXHA 1MTSA 2G5NA 1C5WB 1G37A 1NTPA 3GISB 1EAIA 3KN2A 5F8XA 2VWOA 3M7UA 3ZVGA 2J4IA 3GDUA 3EQ0H 1L1GA 1JMOH 3L6PA 5K7RA 4A1TA 1O3OA 1GMHF 2O8LA 1CE5A 1NROH 5CE1A 1L4DA 3CP7A 2VWNA 4X1QU 1G3BA 2BLOA 1P9SA 2I6QA 2Y5FA 2ZFPH 4KKDA 4FUFA 3MO3A 5JB8S 2A31A 1GBHA 2P3UB 1J9CH 2GMTC 2M5TA 5EU8A 1BMLA 2ZI2H 5I25A 4TY6A 1C5OH 2GCTB 1A5GH 1XUGA 2C8ZB 5A8XA 4MPXA 1GMCG 1O3JA 1KXFA 1BUIA 2F9OA 4MNVA 2YOLA 4AZ2B 2B0FA 1GBAA 1P02A 2A1DB 2G4UA 2QGRA 2V3HH 4H4FA 4BOHA 3T62A 1A7SA 2BQWB 1HIAA 3F9HA 3PMAB 1H8IH 2TGAA 2BDBA 1CGJE 1S6HA 2D8WA 2QXIA 2JETB 1F5KU 2BX4A 1KDQA 3A89A 1MTWA 5JBTA 4ZUHA 1HJ8A 5EOKA 3SNCA 5BPEA 4Y79A 1S84A 3UWJH 3URCA 2AGIX 1TX6A 5EW2H 1O2HA 1W10U 1TONA 2OBQA 4X2XA 1MU6B 1TNGA 4GLYA 1W0YH 1JRSA 1GI7B 1TQ0B 1D3PB 1VITF 2FIRH 3U98H 4NSVA 2PKSB 1BRUP 3SUGA 1TRNA 3U69H 2HLCA 1A61H 1RRKA 1SGCA 3TGIE 2XC0A 1XXDA 2H6MA 1Q2WA 3JZ2B 4OGYA 3FP7E 2GD4B 3FVFB 4X8UH 1FPHH 4MVNA 4CRCA 1O2IA 1KXEA 1AN1E 1UTLM 3RM0H 4INHA 4LOYH 1FAXA 2C8YB 3ZVEA 2FOEA 2QCYA 4JYTA 1QJ1B 3MFJA 2AMQA 1EPTC 2W26A 1CHGA 1T8OA 1CSOE 4YOGA 5DJ7A 2G55A 1ZTKA 2EI8A 3S0NA 1TALA 1MMJN 4XBCA 5I46H 4AG1A 3SUDA 3M35A 4D9QA 3MU8A 1FONA 1OWIA 1TNHA 3K65B 4AGJA 4ZAEA 4DGJA 2ZFRH 1NRRH 2XXLA 1ANDA 1ZMJA 4DW2U 2XRCA 2R0KA 5FPYA 1GVZA 4IMQA 3TK9A 3FANA 1GBTA 4KTCA 1ZPCA 4NIVA 1P06A 1PPZA 5E0HA 3DA9B 4CHAC 2FI3E 1F5RA 4OS1A 4YT7H 4WMFA 3NZIA 1QBOA 1TOMH 1BTYA 1V6DA 4X6OA 3LOXA 4GVUA 1FIWA 1O2PA 4ABGA 5EODA 2BTCE 2VIVA 4WH8A 4BAQB 3EGKH 4J2YB 3GY7A 1HAHH 4JMYA 3TGJE 4E05H 2BY6X 4CH2B 3QDZB 1WYKA 2GV6A 4BAOB 2ZFFH 1GBCA 3BTQE 3RLYH 1TGSZ 5C1YA 1SGIB 4WVPE 3FFGA 3ZZ8A 2OINA 4OS6A 3PWCA 5L2ZH 1BBRK 2XBWA 4X2YA 3BG8A 1GBFA 3JZ1B 1O3HA 2A5AA 1GMHG 3VXFH 4R0IA 1O2TA 2XBYA 1BTXA 3KF2A 1A4WH 3S7HB 5E0GA 1C2IA 1EAXA 1LDTT 1P2MA 1BA8B 1EQ9A 3SU6A 3QUMP 2ZFSA 1QL9A 2TGPZ 3A7ZA 3ATIA 4O03A 3O8BA 1S83A 3E0PB 3S9AA 3STIA 1KXCA 1PPHE 5EQSA 2FOFA 1P09A 5HM9A 3VEQB 2ZDLA 4B73A 4THNH 1Y59T 2O8TA 2ZEBA 4K60A 6ESTA 1V2RT 3LGYA 2P95A 1PYTC 5FBEA 8ESTE 3RMMH 3EYDA 3BIVH 2QN5T 2ZFQH 1GI4A 4ABDA 2OD3B 3UOUA 2HNTE 1W0ZU 4E7RG 2SGQE 3QN7A 2ZGJA 3MI4A 3SJIA 2GZ9A 2G5VA 4DVAU 2PSXA 4WMDA 5EQRA 2C8XB 4LZ4B 1FY3A 5C2ZA 1G2MA 2FX4A 2R3UA 2H9HA 4X1SU 3HATH 2BXUH 4K3JA 4NGAH 3PMBB 1SI5H 1LO6A 1MKXK 1XM1A 3GY4A 3MH5A 3KCGH 4CRFA 7GCHF 3ODDA 3L3TA 2GCHF 3MWIU 4B2CA 3BTEE 1NRPH 3ZVFA 3ZZDA 5EQQA 4J1YA 1G3DA 1OOKB 2PTCE 4U32A 2J2UA 3QO6A 3RP2A 2F9NA 1VITG 1C9PA 1ZR0A 3MH7A 1VR1H 1WV7H 1NU9A 3D65E 1MBMA 4Y8XA 4JZFH 2ZHDA 2O8WA 3ENSB 5C20A 1SGDE 3BTHE 4OS5A 4BANB 5JBBS 2FS9A 2G8TA 2SGPE 1P2QA 1XX9A 1GBJA 1GBKA 1O31A 1NPMA 1FJSA 1Z71A 1MAXA 1MKWH 2FX6A 3E16B 1YCPK 3T2NA 1QB6A 2PFEA 1FNIA 1F0TA 5F03A 5AFYH 1SBWA 1L0ZA 2Q6GA 1KXBA 5JDUB 2TRMA 1O5BB 4Y0YE 1C1OA 1ZRKA 2ZU4A 1W13U 4FUGA 4BTIB 4O9VA 3T25A 5GIBA 3PO1C 1IQLA 1EOJA 1OPHB 2GDDA 3W94A 1SC8U 4WH6A 4B74A 3P6ZB 1G3EA 1V2TT 1MH0A 1A5HA 2OQUA 1VGCB 2QXJA 3F6UH 2XYAA 4D8NA 6LPRA 9LPRA 3GOVB 1C1MA 2NU1E 1IOEA 1GBBA 1OYQA 4BXSA 1BZXE 4D9RA 1VCPA 1IQFA 1O3NA 1YPMH 1S0QA 5J4SA 4BAMB 5DP4A 3ZVBA 2Q6FA 1RFNA 1WBGB 4ABEA 4MDSA 3U1IB 3BTFE 3VGCB 1HXFH 1SL3A 1J8AA 1UVPA 1UK2A 4Y11E 1ETTH 1S82A 4AB9A 2F91A 1Y5UT 3BEFB 3LU9B 1O3DA 1FPCH 1G2LA 3SHCH 3SJ8A 5A8ZA 1GG6B 1O0DH 1Z7KA 1K1OA 3HKIB 1FY5A 3GCOA 3SV8A 1AFQC 3GCHB 1QA0A 3LJJA 3MO6A 2OQ5A 2UWLA 2BHGA 1VCWA 4Y6DA 2RDLA 1CU1A 1HGTH 1Y3YA 3A83A 1MZAA 2QAAA 3KIDU 3KNXA 4XSKU 3A7TA 1GDQA 3EE0B 3A84A 3A8CA 2F3CE 2Y5HA 3A7WA 1MTVA 2NU3E 1OWHA 2V6NA 1BB0B 1SHHB 2FS8A 1MKXH 1PPFE 1RD3B 1E35B 2P93A 3OSYA 4ABHA 3ATLA 4I32A 2YNAA 3A85A 1P2NA 4AYYB 1LKBA 4RKOB 3GY3A 4ABAA 1C5UA 1XMNB 4E7NA 2BDAA 4Y7BA 1PQ7A 2STBE 1RTKA 1NS3A 2NU4E 3RDZA 5C67A 1SGFG 2GVFA 1P2IA 1YPHE 4CREA 4U2WA 4VGCB 1W7XH 1BTWA 5A0AE 1QRXA 3UTUH 1TWXB 1HAGE 3AVZA 1HXEH 3V12A 1INCA 1GHYH 4OS2A 2ZF0H 1W11U 2CHAC 4UFEH 4K8BA 1ZHMA 1GCTB 2EI6A 2A4QA 7GCHG 1ZJKA 1TOCB 3D49H 2GCHG 2H2ZA 1C2GA 1BMMH 4WXIA 1CBWC 4ZKRU 3BTDE 1EOLA 5CMXH 4BAKB 2Y81A 2ZU5A 2GKVE 4AYVB 2BOHB 4Y71A 1AVGH 5GDSH 1NFWA 4ZXXH 3M61U 1KTTB 1K21H 1O2SA 1W8BH 3R0FA 1UTOA 2RA0A 3MU5A 4NFFA 1SQAA 2P8OB 4MPUA 1O2YA 2QA9E 1VJ9U 1LHFH 4ESTE 1CGHA 1Z6JH 2PKAB 1P0SH 3PYHA 3OYPA 3RXPA 4NA9H 1Z8RA 2J95A 3V0XA 1YLDA 2Z3EA 3VB4A 3LH1A 1VCQA 4A7IB 4FU8A 3IWMA 1O3FA 4MTBA 1GJ6A 1HAIH 1UCYE 2Y7ZA 3SBKA 5FBIA 5L2YH 4SGAE 4GSOA 2Y82A 3LH3A 1O3AA 2FLBH 3GY6A 5JBCS 3OY6U 1QJ6B 5K0HA 4UD9H 4F4OC 1OXGA 3LGIA 5DP3A 1SGYE 5C5OA 3KGPA 4DG4A 1NRNH 4AB8A 1P01A 2Y80A 5IDKA 3GCTF 1WAYB 1UMAH 4BXWA 1D4PB 3NK8A 3P8OA 5JBAS 5LPFA 1O38A 5JPMH 1QBVH 1YP9A 3FZZA 1FV9A 1K2I1 2Z6BD 2FOGA 1ZSJA 4ABBA 2Z9IA 4ZXYH 3RXTA 2OTVA 5EPYA 4FUHA 6CHAB 1XUFA 1A46H 3PMJA 3M5MA 1QURH 1F7ZA 2ZPSA 2XCNA 2OC1A 1SB1H 3S7KB 2VWMA 3UOPA 5EXMA 1M9UA 1F0SA 1RIWB 3LC5A 4GHQA 4LXBH 3VB6A 3BG4C 1AHTH 5A2MH 3P8NA 2LNCA 2GT8A 3ZZ3A 1C5VA 4DJZB 5FCRA 1AB9C 2HPPH 1BRBE 4NIYA 2OLGA 1UK4A 5DG6A 4ZHMU 1O3CA 1DITH 2SGAA 4HGCA 2BY8X 2ZGBH 1DY8A 2P94A 4GAWA 3F1SB 1TAWA 3MH6A 2Z9KA 4INKA 1GI0A 3RU4T 1DPOA 1O5AB 1OP2A 4JZ1A 2AIQA 1GJ8B 2F9BH 1GI8B 1KLJH 2QXGA 1UTJA 3GDVA 1C5NH 5DGJA 2F9UA 1AGJA 2FOHA 2Y7XA 3SU2A 1C4V2 3TITA 4AFQA 2TPIZ 3SU5A 1GJ9B 1QIXB 3PB1E 1BT7A 1D3TB 2QV1A 4RSPA 2PUQH 1SGQE 4B75A 1YF4A 3STJA 2FPZA 3C1KA 3MO9A 2H5DA 1ELFA 1AKSA 1CGIE 2FI5E 2BVRH 1