3MO6A

Investigation of global and local effects of radiation damage on porcine pancreatic elastase. sixth stage of radiation damage
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Chymotrypsin-like elastase family member 1
publication title X-ray-induced deterioration of disulfide bridges at atomic resolution.
pubmed doi rcsb
total genus 64
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2010-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mo6A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mo6A01
1DSTA 1ZLRA 1FJSA 2J4IA 4JMYA 4B76A 4MNWA 3RMOH 4NSYA 5FPSA 1OKXA 1FNIA 3ZYDA 3VFEA 5JYIA 1NS3A 2NWNA 3KN2A 4K1EA 1HGTH 1B5GH 1XUFA 5EXNA 1HLTH 3SI3H 3O8RA 1P2IA 4Y10E 4FUIA 2BD2A 1MQ6A 3D65E 3ZZ7A 3A8BA 3KGPA 2GV6A 1HB0B 3PTNA 2ZFRH 1FPCH 1HBTH 3SHCH 4WH6A 2HALA 4NGAH 1BA8B 1HJ9A 2P8OC 3F6UH 4LZ4B 1J16A 5T6FA 3I78A 1MZDA 5JB8S 2ANWA 3B8JA 3QZRA 2Z3DA 1W7GH 1O2VA 2CHAB 4INKA 4KP0A 5K7RA 2A4GA 1BTPA 8GCHF 2RDLA 2XCFA 1TLDA 2PWXA 5EU8A 1LVYA 1MKXK 4DIIH 2WPIS 2A5KA 3NXPA 2OBOA 1OPHB 2BDCA 2B8OH 1LHGH 2FLBH 1ZRKA 2EEKA 2Z6BD 2KAIA 1AB9B 3DT0H 5EGMA 1HJAC 2BQWB 2NU4E 9ESTA 2AH4X 1GJ7B 3LIWA 4KELA 2FOMB 3T27A 1SGIB 4CRAA 2VB0A 1A46H 1O2PA 1HPGA 1L0ZA 1TWXB 4O03A 1VCQA 1YPJH 1S82A 2O8UA 3A84A 3ZVBA 1YCPK 3SJIA 3GCNA 7GCHG 1MTNC 4Q7ZA 1EJMA 1AY6H 3A7ZA 1GBFA 1BZXE 5FCKA 3UTUH 1OOKB 1XVMA 1J14A 1O3KA 1GMCF 5H4IB 3ZZ4A 3S7KB 1ANDA 2PLXA 1C1SA 3TJUA 1O5FH 3DD2H 2VVVA 3RXLA 1GI1A 5HGGA 2ZU3A 1LKAA 1P0SH 1W10U 2A7HA 1GMDF 4Y7BA 4CHAB 1ZMLA 1GBAA 5FHTA 2R2WU 1OWEA 3GYLB 4WXIA 2XYAA 1SLWB 4ZXYH 1QY6A 5HXFA 1WTHD 1K9OE 1XX9A 2ZDMA 2Q1JA 1HIAB 1TYNA 1GHYH 4X1QU 1ELCA 4ABGA 3LC5A 1AUTC 4YOIA 1W11U 1THPB 2G55A 2VWNA 1Y5BT 4HZHA 4ABIA 4CR5A 1C5MD 3HK6B 2H9EH 3BTME 2FOCA 3A81A 3RXAA 2XXLA 2C8YB 1QHRB 2BDHA 2IOTA 3SW2B 4YT6H 1Z1JA 1P03A 3U9AH 2BY8X 4FUCA 1NU7B 1O3PB 3SGQE 1K2I1 4NFEA 1C1OA 1SQAA 3ZZ6A 2PKAA 3LGTA 1QURH 1AKSA 4MNVA 5FAHA 6LPRA 1C4Y2 1KIGH 1L1GA 4Q80A 3PO1C 4X6NA 1BT7A 5EPYA 2VNTA 4BTIB 1P8VC 3HATH 2ZO3H 2WYJA 1O2YA 4LXBH 1BBRE 3SJKA 1O38A 4AGKA 3VGCC 1MTSA 1ZTKA 1BTUA 4X0WU 2BXUH 2ANYA 1Z8JB 5C1YA 1MD7A 2UUJB 2BX4A 2WPLS 3SUGA 3SN8A 1GCDA 8LPRA 2F9OA 1O2GH 3UPEA 5FXLA 1IQJA 1C1WH 1HYLA 1AWHB 4JYUH 7LPRA 1QTFA 1KSNA 1O2HA 2I6QA 1YC0A 1TFXA 3KQEA 1ANEA 2Y6TA 4IMZA 4FU7A 1GJ4H 3MU0A 4NIXA 3TPIZ 2GGVB 5EW1H 2EI7A 2AERH 2DUCA 3RP2A 1QJ7B 3SU0A 2V3OH 1ORFA 4JK5A 4DJZB 2ZHWH 1PPEE 2HOBA 1E35B 2AGIX 3L6PA 1DT2A 3EA7A 4FUDA 1PQ7A 1F92A 1O0DH 1VCPA 4MTBA 4CRGA 4JZEH 1VJ9U 1S83A 7KMEH 1VCWA 1Y3VA 3GCTG 3GOVB 5E0JA 5A8YA 4AORA 4FUGA 2BM2A 2D2DA 2FS8A 1HCGA 2ODPA 5FPTA 4X6PA 1LHFH 3T25A 2C8ZB 1HNEE 3FP8E 3QZQA 5JB9S 4TPIZ 1C2LA 2ZFPH 2PV9B 1GWAA 2Y5FA 2V6NA 1KXCA 3QN7A 2A45B 2FP7B 3UFAA 1G36A 1O34A 1VGCC 1N6YA 1TA2A 3M7UA 1C1PA 4NA8A 3SU4A 1HAHH 3RC5A 4Q7XA 3SOSA 1ZTJA 1P11E 1TNJA 1PPFE 2FI3E 2Z7FE 3KHVA 3S9AA 1Z7KA 3A82A 1SG8B 1IOEA 1SHHB 3RC4A 2H1UA 3OYPA 2BVSH 2OTVA 1HAXB 2QXGA 1WYKA 4BAOB 2TGTA 1DVAH 3RXHA 2A4QA 6GCHF 3AW1A 3QDZB 3RXFA 3VB6A 3GCHC 3RXGA 2J2UA 1PPGE 1XUIA 4YLUA 1ELAA 3BIUH 3RMLH 1ELVA 1BQYA 1MBMA 2W3KA 3V12A 1O2NA 4LZ1H 1LTOA 2VH0A 2D1JA 3SU2A 1L4ZA 2XWBI 2JH0D 4GUXA 4CH8B 1TIOA 1C9PA 3P17H 4KTUA 3MNBA 5HYOA 3SV2H 1K1NA 1UCYH 1ETTH 1KDQB 1D3QB 1TX6A 5C67A 4BXSA 1V2LT 5BRRE 4GLYA 2PUXB 1ESAA 1FY5A 4ZROA 2F9NA 3AAUA 1ZJDA 3QLPH 5DGJA 1Q2WA 4UONA 1FY4A 3K65B 4Z0KA 2BXTH 1V2TT 3M37A 2CMYA 2FIRH 1IQFA 3RXEA 3RXRA 1VJAU 2PGQB 3MH7A 3MYWA 1MMJN 4H6SB 1BBRK 4QT8C 3RXIA 1SB1H 1FIWA 1H9IE 2FZZA 4B74A 3KEEA 2UWLA 3LONA 4WJG2 1KTSB 1O3LA 4UDWH 1P09A 5F03A 1FDPA 1XUHA 5EODA 3ZZAA 4CBOA 1IQMA 2ANKH 2Q6FA 1GG6C 4ABHA 3CS7A 1DLEA 3ZV8A 1EB1H 3PB1E 5DP9A 1K1MA 1IAUA 1HXFH 3BF6H 1TNLA 3AVZA 1VR1H 1YLCA 2V0BA 5PTPA 2H9HA 4B73A 1BRAA 3F1SB 2ZTYA 1NM6A 1C1TA 1BOQA 1NZQH 2JETB 2FX6A 1GJAB 1GBHA 4K8BA 4DGJA 5HM9A 3U69H 2Z9GA 2UWPA 1ZPZA 1EAWA 3E8LA 5J4QA 1MKWH 3TJVA 1JOUB 4IS5A 4ABDA 1KLJH 1O3OA 1T8LA 1CBWC 1KY9A 3URDA 4ISLA 3DA9B 3U8TH 1DM4B 2ZGJA 1V2UT 3ZVFA 3AW0A 1UTKA 1GMHF 2BD4A 1CSOE 1T32A 4R0IA 3TITA 3UWJH 1ELBA 1QRWA 1V2NT 3BTTE 1UVUH 1OP2A 1ELFA 1ZHRA 1GDNA 2K1QA 3ZZBA 1YPEH 1Z8RA 1DICA 4MDSA 1GL1A 2KAIB 3L3TA 4X1NU 6CHAC 1AI8H 1GHAG 2BMGB 1A3EH 3GICB 1MH0A 2SFAA 4Y8XA 1YPGH 1O2TA 4X2YA 1AGJA 4THNH 3TK6A 1DWBH 2BOHB 2FYQA 3U1JB 1LHEH 2RCEA 3SNEA 3LOXA 2CV3A 4NZQA 4XE4A 4R8TB 1GGDB 1TPPA 3EGKH 1H1BA 2GZ7A 1O2LA 1K21H 4OS5A 4X2XA 8KME2 1ZSJA 1BCUH 1P9SA 4U2WA 3M61U 5DO4H 3S69A 1NROH 1W2KH 1C2KA 4DG4A 3H7TA 4GVUA 1QA0A 1FV9A 4H42U 2ZTXA 3ATLA 3EAJA 1KLTA 2SGAA 2STBE 1EJNA 2AMPA 4OS6A 5AVDA 4AFQA 4D76A 1SQTA 2PSXA 4ABFA 4TPYA 3TNSA 4IN2A 3UY9A 1O5CB 5LPFA 1YPHC 1AZZA 3HPTB 1ZMJA 2BY6X 1HUTH 3Q00A 5JBBS 1ELDE 2SNWA 4DVAU 1YF4A 1U6QA 2J38A 3ENSB 3SO3A 1GI0A 1XXFA 5C5OA 2Z3EA 1M9UA 3A85A 3GDVA 1EB2A 1C5RA 5A0BA 2ZNKH 1EX3A 1O2ZA 2GT8A 1ZPBA 5EPNA 1YPMH 3LH3A 1UVTH 4X6OA 2ZGHA 1V2PT 1C5XB 2ZU2A 1HAYB 1X7AC 3S7HB 1BTZA 1C4V2 3FP7E 3M5MA 1F2SE 3LJJA 2GX4A 1O5BB 2IN2A 2OD3B 1HAGE 2FI4E 2F91A 2PKAB 3BTEE 3LKWA 1MD8A 1AKSB 4NA9H 2GT7A 1ZMNA 3A8CA 3RXOA 1V3XA 2QC2A 5AF9H 2ZZUH 2VGCB 4NIVA 4XDEA 1GJ9B 4CRFA 2AIPA 5LPRA 4MLFB 1TE0A 4O3UA 4AFZA 1QB9A 1P2JA 1QL8A 1C2JA 1VITH 1EAIA 2G5NA 3U8RH 3SNCA 2BYAX 3ESTA 1FUJA 3V13A 3E91A 3R3GB 3TIUA 3SU3A 4UFDH 3NWUA 2FXRA 1AIXH 1ZHPA 4Y0ZE 1UK3A 2VIVA 1TX7A 1GL0E 3OSYA 4ZHLU 1TBZH 1HDTH 1UVOA 4XFQA 2VH6A 3SV8A 1EZXC 1GVLA 1SOZA 1XUKA 4U01A 3UIRA 1CA0B 1O3NA 1UHBA 1C1MA 1TNHA 3D49H 3QTVH 4HGCA 1S5SA 3NPSA 4XOJA 2CHAC 3PWCA 3V3MA 1O2UA 5DKMA 2ZTZA 1GJ6A 5JPMH 1NT1A 1O30A 1PYTC 2A4RA 3PLKA 1C5PA 3SU6A 2H5DA 5JBTA 1DWEH 2OLGA 4XBBA 1ELTA 7GCHF 2WPKS 3M3SA 1IQEA 3LH1A 4AB8A 2ZG0H 2CGAA 1XXDA 2G5VA 1SGFA 3SNBA 1TALA 1WOFA 2ZDKA 1SMFE 2BY9X 4CBNA 3FFGA 1G2MA 4Y0YE 2P93A 3UR9A 3VEQB 3BG4B 4CH2B 4H4FA 1GCTC 3NUMA 2PHBA 1LQDB 2RA0A 2A7JA 2M5TA 1TGSZ 4K8YA 1SBWA 2FOFA 3D23A 3SHAH 4IN1A 3MNXA 1BTHH 2A2QH 1LDTT 1C2FA 2HLCA 3GDUA 3GISB 3OU0A 1GHZA 4K5ZA 4MPVA 2ZGCA 2G51A 1C5QA 4BAKB 1SGRE 1EQ9A 4CHAC 2JKHA 2GKVE 4AOQA 2EI8A 1SHYA 2Z94A 3ZVDA 2QF0A 5DP4A 1EKBB 2J34A 1P9UA 2QF3A 5DP3A 1O2WA 5HM2A 2XCNA 2V3HH 4WMDA 4X1RU 3SUEA 2WUBA 1E0FD 1SC8U 2WUCA 2NU1E 1TNGA 4FUFA 1C5NH 3MO3A 4FVDA 4ISHH 1FY8E 2ZKSA 3MNSA 3TJOA 4JZDH 3TGJE 4FUBA 3VXFH 4DOQA 2ZCLP 2F9UA 4JYTA 2R9PA 1LHCH 3ZV9A 1Y3WA 2TGPZ 2QXJA 1CA8B 4Z6AH 2XC0A 4GCHF 2XBVA 4I31A 2FOAA 2GCHF 4PROA 1BHXB 2FEQH 1O3IA 1FN6A 2QYIA 1P57B 3T62A 3LDXH 1O5AB 2FDAA 4FUJA 2GCTC 1CT0E 3A89A 3PLPA 5B6OA 2Q6GA 2O8TA 4MVNA 2Y81A 1DXPA 1A1RA 4HI3A 3EQ0H 1G2LA 2FOBA 1BIOA 4OS7A 3MTYA 1LHDH 1GJ8B 1YGCH 3BEFB 3ODDA 1EATA 1GI5A 3JZ1B 3P70B 1P2OA 4B2BA 1H8DH 1F5KU 1WU1A 1O5DH 1GBBA 2OCVB 2NU3E 3QGNB 1Z8GA 4DURA 5DP5A 1A7SA 2OC1A 1EP6A 2P95A 1K1LA 2P8OB 5SGAE 2CXVA 4CREA 1W0ZU 4ZKNU 1Z6EA 1C1NA 1GPZA 2HWLB 1UMAH 2TIOA 1AE8H 1SGCA 3TVJB 4WH8A 1GI3A 1EAXA 1W3CA 1O2QA 2BZ6H 1KXAA 3MHWU 1SFQB 4JYVH 2C90B 3BG8A 2BDGA 1P3CA 2PTNA 2WPHS 1O3AA 1DLKB 2GZ8A 2AGGX 3TH3H 3RXSA 2PSYA 1P10A 4AZ2B 1EZQA 5DP6A 4A5TS 2GDEH 1YP9A 2Y7ZA 5JBAS 1P01A 5DJ7A 2DE8A 1D3DB 1P2KA 1HJAB 5F8XA 5EOKA 2FO9A 2ZDAH 3UOUA 4GAWA 1ETSH 1YKTA 5A8XA 5L30H 2AMDA 2FYRA 3A7TA 3QO6A 1C9TA 3IWMA 1ANCA 2ZWLH 1O3CA 4FU8A 2ODQA 2PFEA 4X1SU 1HAPH 3SZNA 2QCYA 1P06A 2VINA 2THFB 3A87A 3SUDA 1Z6JH 4TYDA 1Y8TA 1TRNA 2HRVA 2VVUA 2H6MA 2OQUA 1MAYA 1AQ7A 4B75A 2BB4A 4A1TA 5FX6A 2BY7X 1N8OC 3SV9A 2BDIA 1A5GH 4BAMB 1NRPH 2TGAA 1G9IE 1RXPA 3L33A 3SORA 4WWYA 1FLEE 4BTUB 2HVXA 3E6PH 2VIOA 1NY22 2O9QA 3HKIB 2PUQH 3SV7A 3PMHB 1MU8B 3S0NA 1GMCG 2A2XH 2XW9A 2P3FH 3VXEH 1AZ8A 1QCPA 3DFLA 3A7WA 1UCYE 1J17T 2YNBA 1O2XA 1QB1A 2FPZA 1TQ0B 3VPKA 1JWTA 1WCZA 4NCYA 3SJ8A 2UUYA 5LPEA 1K28D 2CF8H 1ESBA 1C2EA 5CHAB 3SGBE 1ID5H 3TU7H 3C27B 1MTWA 1W13U 4RKJB 1PFXC 1E36B 3FVFB 4ZHAA 2OQ5A 1PQ5A 2BLVA 2FMJA 3BTWE 1PYTD 2GV7A 1KXEA 1W0YH 2ZF0H 2RG3A 1S84A 5ETXA 1BB0B 1A0JA 4J1YA 1AFQC 1OWHA 3SJ9A 1EZSC 4AG1A 1TPSA 1AVXA 4UD9H 4ZKOU 1GBIA 2P16A 5IDKA 4X8TH 4X8VH 1ZSLA 1Y59T 1B7XB 1HAOH 1LKBA 1HAZB 1C5UA 3P8GA 1NO9H 3NCLA 4X2VA 1TMBH 4GSOA 2FESH 1QGFA 1OYTH 1O3MA 2EI6A 3PYHA 3ELAH 4XSKU 2ZEBA 3BN9A 1QB6A 1AE5A 2QGRA 2BLWA 1B0FA 2OBQA 3BTQE 4D7GA 1QRZA 4OS4A 1C2IA 1MCTA 1CGJE 4IC6A 1T31A 1AMHA 2F9BH 1UTPA 1C1QA 3KF2A 4FUHA 4NSVA 5AFZH 3MU5A 2VWOA 1W8BH 3A86A 1O2RA 1UHBB 1SPJA 4GHQA 4YM9A 3RMMH 1ZGVA 3RC6A 1IHSH 1GBLA 1SGFG 1NFWA 1GI6A 3RXDA 2NU2E 1ZHMA 2WV4A 3VB7A 3M5OA 2WPJS 4ZH8A 4WVPE 3O8BA 2BZAA 2FI5E 5LGOA 3BTKE 5I46H 5T3HA 3ZZ9A 5A0CA 1DOJA 2BVXH 1A3BH 4E06H 5L2YH 1LPZB 2C4FH 4YO9A 1O37A 1EOJA 1J8AA 1CGIE 1O39A 1NTPA 1DY9A 1F0SA 2AEIH 1GVZA 3JZ2B 4TY6A 1RGQA 2ULLA 3STJA 4E7RG 3IG6B 5L6NH 1V2QT 4YTAA 1OP8A 1GGDC 3GY5A 4TWYA 3KIDU 5ESBA 3GYMA 1BJVA 4K69A 5FBEA 1OWDA 2YOLA 4Q2KA 4YOGA 3UNQA 2JH5D 1MTUA 3K2UA 1YPLH 4AX9H 1FPHH 2F3CE 3BTGE 3T28A 4I8KA 1O5EH 1PPCE 3SBKA 1LVBA 3RM0H 1ZR0A 2HPPH 1HAVA 2WINI 5JDUB 1PPHE 2A5AA 4KGAA 3RXMA 3GCHB 1NU9A 3DUXH 1F5LA 2G4TA 2PKSC 2XRCA 2BD8A 3P8FA 5T6GA 1ZRBA 3C1KA 1FMGA 1FAKH 5EXLA 1UTMA 4FVBA 2IPHA 1V6DA 5AFYH 1JBUH 1WQVH 1P2QA 1CO7E 1HV7A 2BLQA 6GCHG 2PR3A 3TH4H 1VZQH 3UUZA 3VB5A 3SUFA 2OC0A 3MU4A 1SLXB 2BD9A 3M7TA 1QQUA 2GVFA 1KXDA 1H9LB 1CE5A 2F9PA 2W3IA 1P05A 4IC5A 1G30B 1UJ1A 4RSPA 1GHBG 1FY3A 1GHXH 1A0HB 2AIQA 1IQHA 2A5IA 2A0QB 1BMNH 1F0TA 1A2CH 3QX5H 1PQ8A 3R0FA 5HMAA 1RIWC 1BMMH 1CQQA 5GXPA 3BIVH 3KCGH 4ABAA 2ZU5A 3MH5A 2R3UA 4HFPB 2BHGA 3V0XA 5K0HA 3E0NB 4FUEA 2ESTE 1OWJA 2GTBA 1G3EA 2GMTB 1EPTC 1C5ZB 2G4UA 1O2OA 1K1OA 1N6XA 1RTLA 2HNTF 3ZYEA 1Z1IA 2QV1A 3Q76A 1O3BA 3RU4E 4OGYA 1JMOH 2LNCA 1XM1A 1QR3E 1GJCB 3RLYH 3VB4A 1CVWH 1SGPE 3LGIA 1E37B 2C8XB 1ABIH 5E0GA 4INLA 2Y5HA 1GG6B 4H6TA 1F0RA 8ESTE 4JCNA 2FOEA 4YLQH 5EQQA 1O5GH 1BTXA 2G8TA 1G32B 4J2YB 4NIYA 1A0LA 4MG3A 1YPHE 3PMBB 2B5TB 2R0LA 3BV9B 3STIA 1TX8A 1GDQA 1ZZZA 3QWCH 3SJOA 2XNIA 1MKWK 1F7ZA 1AN1E 3U1IB 3PMAB 3RXBA 1SSXA 2Y5GA 3I77A 1XUJA 1EUFA 1QBOA 3MOCA 1T4UH 4I8GA 1RFNA 4K1SA 1DWDH 2ALVA 1DY8A 7ESTE 1H4WA 1UO6A 1CBWB 1LMWB 2HNTC 3PLBA 1TGCA 4ASHA 3ATMA 3RXTA 1ELGA 2SGEE 1C2GA 5A2MH 2WV5A 1C5TA 1HRTH 4TWWA 4Y71A 3PTBA 1C5VA 3CP7A 2QXIA 4CRCA 1P2NA 4CR9A 1VITG 1J9CH 1W12U 5FCRA 2J92A 2ZFTA 3RLWH 6CHAB 3VB3A 2ZGXH 1O2KA 1NRQH 3Q3KA 1L2EA 1GMHG 3H7OA 1UTOA 1LCYA 1LPKB 4ESTE 2R0KA 1SGDE 2W26A 2C93B 1O2JA 1DPOA 5EW2H 1W7XH 2H5CA 1SLUB 3P8NA 1TONA 1TABE 5F8ZA 3BTHE 4DCDA 3P92A 3H5CB 1V2WT 2BDYA 1GJBB 2RA3A 1MBQA 1TQ7B 1BHXF 2ZDNA 1JIRA 2B7DH 4IW4E 1GBDA 4U32A 3MNCA 3EDXB 1V2VT 3P95A 3T5FH 4BNRA 3KQDA 4AYYB 1UK4A 1QA7A 1SL3A 1UTNA 1SI5H 3DFJA 4M7GA 5GCHG 1AWFH 2FOHA 3TJNA 1EJAA 2ASUB 4GPGA 3MU8A 3IITA 3BSQA 2FWWA 2H9TH 1MKXH 1Y3XA 1AB9C 1E38B 1TBQH 4O9VA 1FQ3A 1TB6H 3W94A 1JIMA 1Y5UT 5GDSH 3UNRA 2CJIA 2QA9E 1A4WH 2NU0E 1DX5M 1OWIA 1C5WB 2Z9JA 3KQBA 1KLIH 2LPRA 2VIWA 2ZU1A 3URCA 5A09A 2PW8H 1AUJA 1FZZA 2QAAA 4Y76A 3ZVCA 1WUNH 2O8LA 4X2WA 3ZVAA 2SGFE 3EA8A 1QL9A 3M7QA 1O3DA 1YCPH 4O97A 5J4SA 2ZHDA 4SGAE 3OX7U 4X6MA 4JZIA 3SI4H 1HXEH 2ZFFH 2EC9H 3LGVA 1K22H 1H9HE 1OYQA 1P2MA 1GI7B 3NZIA 1G3DA 4B71A 3KNXA 3RM2H 2J94A 1ETRH 1XMNB 1CT2E 1ZYOA 2I6SA 1RRKA 4Y8YA 2D26C 4JZFH 5A8ZA 3A83A 4E7NA 1BUIA 1OSSA 2FTLE 2HGTH 3ZZ5A 2EA3A 4Y11E 3ATKA 1THRH 1GI8B 2BOKA 1MCVA 3LGWA 3UOPA 5F6MA 4VGCB 4MNXA 3MU1A 5G4BA 1IHTH 1QFKH 2ALPA 1W14U 3LT3A 1Y3YA 4KTSA 5GJ4B 3ZZDA 3HKJB 1LQEA 3LGUA 1XKAC 3GY4A 1O2IA 3ZZ3A 2ZQ1A 1NN6A 1CGHA 4A1XA 4E05H 2A1DB 4B2AA 4A1VA 2QIQA 3MMGA 2FTMA 4U30A 1AHTH 1V2RT 3QK1A 1C5YB 4ABEA 1PPZA 1S0RA 1ZTLA 3LPRA 1IQLA 2BY5X 3MO9A 1CHOG 3SNDA 2ZFQH 3KQCA 2VVCA 5FX5A 4B2CA 1C5LH 3SGAE 1EASA 2Y82A 1QRXA 4SGBE 3V7TA 3LGYA 5CMXH 1EOLA 1O3GA 4AN7A 3M5LA 3SU1A 1GBMA 1V2OT 4WXVA 2W7SA 3D62A 3E90B 2VWMA 5IYTA 3U98H 2ZQ2A 1BJUA 1O2SA 4OS2A 4YT7H 2Z9LA 3TNTA 1GBJA 1GCTB 4YZUA 3SV6A 4D8NA 3P8OA 5EQSA 2QXHA 3Q3YA 1O31A 2J9NA 1RJXB 1P12E 3FANA 4IMQA 1SLVB 3SQHE 3CENA 1FY1A 1YPKH 3RU4D 4NA7A 4K60A 1ELEE 1NRSH 1SVPA 1BRUP 3ZZ8A 1D3TB 4UFEH 4BANB 3AASA 2B0FA 4I32A 2OXSA 2VWLA 3K9XB 3GCTF 1DUAA 1GHVH 4I8JA 1RD3B 2AGEX 1HAVB 4CRDA 1DE7H 1FAXA 1NESE 4ABBA 5A0AE 1S6HA 2OP9A 4A92A 3ITIA 1FN8A 1MQ5A 5DP8A 1E34B 4FXGH 1HJ8A 1ARBA 4KKDA 3T29A 5C1UA 2QY0B 3E16B 1FI8A 1DSUA 3M36A 3U8OH 2AMQA 3GY3A 4Y7AA 6ESTA 1G37A 1TMTH 1DS2E 4UFGH 1Q3XA 1C2MA 4UE7H 1S6FA 4DY7B 5CHAC 1GI4A 5E0HA 2CN0H 3HGPA 8GCHG 5GPIB 1AVWA 2Z9KA 5I25A 3RUOA 2BQ6B 3K6YA 2ODYB 4MPWA 2BD7A 4LOYH 1V2KT 1NFXA 3FP6E 3GY7A 1DDJA 3NK8A 4MPXA 2F83A 4KTCA 1GVKB 1MTNB 1EPTA 2ZFSA 3DHKH 2GCTB 1UVSH 3W95A 2XC4A 4NG9H 1AU8A 1OX1A 4B1TA 4BAHB 1AO5A 2C8WB 4ZXXH 5C3NA 3BEIB 1H8IH 2G00A 4RKOB 1A5HA 4GCHG 3GY2A 1WAYB 1KTTB 3Q3XA 2GCHG 1ACBE 1TNKA 2OINA 2STAE 1WBGB 2ILNA 4AFUA 1RTFB 1CU1A 3TGKE 2BLOA 4K2YA 3WY8A 1AFEH 2BX3A 2F9VA 1SGTA 4FU9A 4YOJA 2A7CA 1EXFA 5TCAA 4Y6DA 1O32A 3GDSA 4ISOA 1MZAA 4IBLH 1V2MT 1TRYA 3F9HA 4RN6A 3CS0A 3T26A 3SU5A 1DITH 3MFJA 1P3EA 3PWBA 4ZHMU 1MU6B 1OWKA 1GMDG 2Q6DA 3RU4T 2VIDA 1O3EA 3FZZA 3K6ZA 4WMEA 5EG4A 1UTQA 1ESTA 4WY3A 3FZDA 2SGDE 3EE0B 2BVRH 3OTJE 2BDBA 3ZZCA 3MO6A 3LJOA 5E2OA 1V2ST 1MUEB 2GZ9A 3S9CA 4UEHH 1WSSH 2ZIQH 3RXVA 1TAWA 3PMJA 2AFQB 1NRNH 1UTLM 1T8MA 1F0UA 3GCOA 5GIBA 4X1PU 4ZMAH 3N7OA 3PO1B 2UWOA 1D4PB 2ZPSA 2VU8E 4ZUHA 5GWZA 3M35A 4X8SH 4Y8ZA 1D3PB 1ZSKA 1BRCE 5EQRA 3A80A 1BBRH 2CF9H 4AYVB 2OC7A 1MAXA 1NPMA 1K1JA 1LVOA 1TGBA 4I8HA 5DPAA 3VGCB 1OP0A 1TBRH 2FM2A 1K1IA 3T2NA 3E3TA 4DIHH 2ZC9H 1GI2A 2XBWA 5LH8A 2ZPQA 5C1XA 4AFSA 1DWCH 2AS9A 4BAQB 3SQEE 1GJDB 1GHWH 3RXPA 1PQAA 1ARCA 4WMFA 4MQAA 2JETC 1FXYA 3E0PB 3I29A 1N8OB 3RXQA 1L1NA 2AYWA 1Y3UA 3AAVA 2G81E 1A5IA 1GBKA 1JRTA 1YBWA 1ZJKA 1XKBC 2J95A 4MPUA 1GHAF 1TMUH 4K1TA 1GHBF 2C3SA 3F9EA 3B23B 3F9GA 1UVPA 2UUFB 1Z8IB 3ZVEA 1ANBA 1B0EA 1Z71A 2WYGA 1C2HA 2FS9A 2Z3CA 2O8MA 1ZPCA 4DT7B 5C20A 1F5RA 3M3TA 2A4OA 1TPOA 4NWLA 4NWKA 1UTJA 1BTWA 5TCCA 2VIPA 3ZVGA 2ZDLA 3MI4A 1EAUA 3UWIA 1T8OA 1O2MA 1SOTA 2D8WA 2VJ1A 1YCPM 4ABJA 3GY6A 1WV7H 1EZUC 1VGCB 1GJ5H 4Y79A 1QJ1B 1TGTA 1D6RA 1KXBA 1C5SA 3MWIU 4D7FA 3MH4A 4I33A 1ZOMA 3UQVA 1C2DA 2W7UA 3B9FH 1NRRH 1YLDA 2GMTC 1BMLA 1AFQB 1T4VH 1YM0A 4LK4A 1OS8A 4IGDA 1K1PA 2OUAA 2ZGBH 2QN5T 1SQOA 4OGXA 1HAIH 4XBDA 1QNJA 2P3TB 2Y80A 1V2JT 2XBXA 1TOMH 2DE9A 5E2PA 5FPYA 2W5EA 4WF8A 2IJOB 1WQSA 1QBNA 3QUMP 5ABWA 5JBCS 1HIAA 1O33A 2A32A 3F68H 1BMAA 1UCYK 5ESTE 2ZDVH 1SGEE 4DW2U 1BTYA 3HGNA 1AD8H 1ABJH 2ZHEH 3PM3A 1KYNA 2R2MB 1IQIA 3ATIA 3LU9B 4A7IB 1C1VH 4TY7A 2A31A 4XBCA 4AG2A 2GD4B 4HTCH 2V35A 1VITF 2JH6D 1GDUA 1CT4E 4X8UH 1ZGIA 2XTTB 2XBYA 2PTCE 3FAOA 5TJXA 2TBSA 5BPEA 4ZAEA 1AVGH 2BTCE 1MTVA 2FX4A 4ISNA 1UK2A 4NIWA 1S81A 1NFUA 2SNVA 1P02A 3TLOA 1RTKA 1S0QA 3E1XB 1O3FA 3A7VA 2VGCC 4NZLA 4JK6A 3UNSA 3TGIE 2G52A 1GI9B 4K3JA 1DXWA 4BOHA 4D9QA 1D9IA 4NFFA 1BRBE 1DANH 1C1UH 1TNIA 1LVMA 4F49A 1QL7A 1WTGH 1BITA 1XVOA 3OY5U 1C1RA 4INHA 4ZKRU 1TGNA 1INCA 2BDAA 2P59A 2XWAA 1RS0A 1TRMA 2O8WA 2UUKB 5GCHF 2ZCHP 1C4U2 3RXCA 1O36A 3RDZA 1Y5AT 1CA0C 5F8TA 2ZHFH 3BEUA 1LO6A 4BXWA 3EA9A 4O3TA 1NFYA 1C5OH 3RXUA 1P04A 2ZU4A 1J15A 1QIXB 5C5NA 3O8DA 1PPBH 2VIQA 4I8LA 2ZECA 2ZPRA 2PKSB 3G01A 1O3JA 5AHGH 2OC8A 1KXFA 3OY6U 5EXMA 2HPQH 1TA6A 1QBVH 1O3HA 2HNTE 2SGPE 2H2ZA 3EYDA 1FONA 3RMNH 2FLRH 1OXGA 2GP9B 2BQ7B 3UR6A 4BTTB 5C2ZA 1PJPA 3NKKA 1A61H 1DFPA 1QJ6B 2FOGA 2WPMS 1G3CA 3BG4C 1TPAE 1S85A 4AB9A 1XUGA 5T6DA 5DK1A 3BTDE 1SGYE 4GHTA 3QGJA 3P6ZB 3F9FA 1L1JA 1T7CA 4D9RA 4JZ1A 2B9LA 1GBEA 3UQOA 1RIWB 3KL6A 4OS1A 5CE1A 2BD3A 1CHGA 1D6WA 4ISIH 2FODA 2TRMA 4A6LA 2TGDA 1EPTB 3O8CA 3A8DA 1T8NA 4ZKSU 2ZHQH 1QQ4A 3A88A 2SGQE 3S9BA 3TH2H 2GDDA 3ODFA 3RXKA 4UFFH 1EP5A 1SGNE 3ATWA 1N1LA 3UREA 3BTFE 1GBCA 1NC6A 2R3YA 3RXJA 2ANMH 4I7YH 2P94A 1SGQE 2Z9IA 3Q77A 1JXPA 2ZCKP 1SR5C 1IQGA 2ZP0H 1JRSA 5L2ZH 1SFIA 1IQKA 1KDQA 1O35A 4YESB 3M3VA 1THSH 2PGBB 4F4OC 3A7YA 4VGCC 1CHOF 2ZA5A 3M5NA 5E8EH 5DP7A 5FBIA 2TPIZ 3MH6A 3SNAA 1IQNA 1GBTA 2ZI2H 1YYY1 3LC3A 1BDAA 4Q7YA 3PV4A 2BD5A 3A7XA 3A8AA 1DUEA 3HK3B 3TK5A 1L4DA 1Q31A 1FIZA 4MNYA 1HFDA 2P3UB 9LPRA 2XC5A 3TK9A 4AGJA 3GY8A 2Y7XA 5DG6A 4CRBA 1TOCB 3PROA 1LPGB 1G3BA 3QTOH 2YNAA
chains in the Genus database with same CATH superfamily
3PV2A 1DSTA 1ZLRA 1FJSA 2J4IA 3PV5A 4JMYA 4B76A 4MNWA 3RMOH 4NSYA 5FPSA 1OKXA 1FNIA 3ZYDA 3VFEA 5JYIA 1NS3A 2NWNA 3KN2A 4K1EA 1HGTH 1B5GH 1XUFA 5EXNA 1HLTH 3SI3H 3O8RA 1P2IA 4Y10E 4FUIA 2BD2A 1MQ6A 3D65E 3ZZ7A 3A8BA 3KGPA 4B6FA 2GV6A 1HB0B 3PTNA 2ZFRH 1FPCH 1HBTH 3SHCH 4WH6A 2HALA 4NGAH 2J98B 1YLNA 1BA8B 1HJ9A 2P8OC 3F6UH 4LZ4B 1J16A 5T6FA 3I78A 1MZDA 5JB8S 2ANWA 3B8JA 3QZRA 2Z3DA 1W7GH 1O2VA 2CHAB 4INKA 4KP0A 5K7RA 2A4GA 1BTPA 8GCHF 2RDLA 2XCFA 1TLDA 2PWXA 5EU8A 1LVYA 1MKXK 4DIIH 3DSGA 2WPIS 2A5KA 3NXPA 2OBOA 1OPHB 2BDCA 2B8OH 1LHGH 2FLBH 1ZRKA 2EEKA 2Z6BD 2KAIA 1AB9B 3DT0H 5EGMA 1HJAC 2BQWB 2NU4E 9ESTA 2AH4X 1GJ7B 3LIWA 3OE7D 4KELA 2FOMB 3T27A 1SGIB 4CRAA 2VB0A 1A46H 1O2PA 1HPGA 1L0ZA 1TWXB 4O03A 1VCQA 1YPJH 1S82A 2O8UA 3A84A 3ZVBA 2L74A 1YCPK 3SJIA 3GCNA 7GCHG 1MTNC 4Q7ZA 1EJMA 1AY6H 3A7ZA 1GBFA 1BZXE 5FCKA 3UTUH 1OOKB 1XVMA 1J14A 1O3KA 4B6EA 1GMCF 5H4IB 3ZZ4A 2YMSC 3S7KB 2PP6A 1ANDA 2PLXA 1C1SA 3TJUA 1O5FH 2WZQA 2VVVA 3RXLA 3DD2H 1GI1A 1H8ED 5HGGA 2ZU3A 1LKAA 1P0SH 1W10U 2A7HA 1GMDF 1NBME 4Y7BA 4CHAB 1SKYE 1ZMLA 3DCLA 1GBAA 5FHTA 2R2WU 1OWEA 3GYLB 4WXIA 2XYAA 1SLWB 4ZXYH 1QY6A 5HXFA 1WTHD 1K9OE 1XX9A 2ZDMA 2Q1JA 4XRNA 1HIAB 1TYNA 1GHYH 4X1QU 1ELCA 4ABGA 3LC5A 1AUTC 4YOIA 1W11U 1THPB 2G55A 2VWNA 1Y5BT 4HZHA 4ABIA 4CR5A 1C5MD 3HK6B 2H9EH 3BTME 2FOCA 3A81A 3RXAA 2XXLA 2C8YB 1QHRB 2BDHA 2IOTA 3N7EA 3SW2B 4YT6H 1Z1JA 1P03A 3U9AH 2BY8X 4FUCA 1NU7B 1O3PB 3SGQE 1K2I1 4NFEA 1C1OA 1SQAA 3ZZ6A 2PKAA 3LGTA 1QURH 1AKSA 4MNVA 5FAHA 6LPRA 1C4Y2 1KIGH 1L1GA 4Q80A 4Q4LA 3PO1C 4X6NA 1BT7A 5EPYA 2VNTA 4BTIB 1P8VC 3HATH 2ZO3H 2WYJA 1O2YA 4ASUD 2V7QD 4LXBH 1BBRE 3SJKA 1O38A 2XNDD 4AGKA 3VGCC 1MTSA 1ZTKA 1BTUA 4X0WU 2WPDD 3CNRA 2BXUH 4HG6A 2ANYA 1Z8JB 5C1YA 1MD7A 2UUJB 2BX4A 2WPLS 3SUGA 3SN8A 1GCDA 8LPRA 2F9OA 1O2GH 3UPEA 5FXLA 1IQJA 1C1WH 1HYLA 1AWHB 4JYUH 7LPRA 1QTFA 1KSNA 1O2HA 2I6QA 1YC0A 1TFXA 3KQEA 1ANEA 2Y6TA 4IMZA 4FU7A 1GJ4H 3MU0A 4NIXA 3TPIZ 2GGVB 5EW1H 2EI7A 2AERH 2DUCA 3RP2A 1QJ7B 3SU0A 2V3OH 1ORFA 4JK5A 4DJZB 2ZHWH 1PPEE 2HOBA 1E35B 2AGIX 3L6PA 1DT2A 3EA7A 4FUDA 1PQ7A 1F92A 1O0DH 5DSFA 1VCPA 4MTBA 4CRGA 4JZEH 1VJ9U 1S83A 7KMEH 1VCWA 1Y3VA 3GCTG 3GOVB 5E0JA 2OK5A 5A8YA 4AORA 4FUGA 2KX4A 2BM2A 2D2DA 2FS8A 1HCGA 2ODPA 5FPTA 4X6PA 1LHFH 3T25A 2C8ZB 1HNEE 3FP8E 3QZQA 5JB9S 4TPIZ 1C2LA 2ZFPH 2PV9B 1GWAA 2Y5FA 2V6NA 1KXCA 3QN7A 2A45B 2FP7B 3UFAA 1G36A 1O34A 1VGCC 1N6YA 1TA2A 3M7UA 1C1PA 4NA8A 4RT0A 3SU4A 3SYJA 1HAHH 3RC5A 4Q7XA 3SOSA 1ZTJA 1P11E 1TNJA 1PPFE 2FI3E 2Z7FE 3KHVA 3S9AA 1Z7KA 3A82A 1SG8B 1IOEA 1SHHB 3RC4A 2H1UA 3OYPA 2BVSH 2OTVA 1HAXB 2QXGA 1WYKA 4BAOB 2CK3D 1DVAH 2TGTA 2A4QA 3RXHA 3AW1A 6GCHF 3QDZB 3RXFA 3VB6A 3GCHC 3RXGA 2J2UA 1PPGE 1XUIA 4YLUA 1ELAA 3BIUH 3RMLH 1ELVA 1BQYA 1MBMA 2W3KA 4Z1MD 3V12A 1O2NA 4LZ1H 1LTOA 2VH0A 2D1JA 3SU2A 1L4ZA 2XWBI 2JH0D 4GUXA 4CH8B 1TIOA 1C9PA 3P17H 4KTUA 3MNBA 5HYOA 3SV2H 3OEHD 1K1NA 1UCYH 1ETTH 1KDQB 1D3QB 1TX6A 5C67A 4BXSA 1V2LT 5BRRE 5KECA 4GLYA 2PUXB 1ESAA 1FY5A 4ZROA 2F9NA 3AAUA 1ZJDA 3QLPH 2HVYB 5DGJA 1Q2WA 4UONA 2J5UA 1FY4A 3K65B 3OEED 4Z0KA 2BXTH 1V2TT 3M37A 2CMYA 2FIRH 2K0QA 1IQFA 1OHHD 3RXEA 1VJAU 3RXRA 2PGQB 3MH7A 3MYWA 1MMJN 4H6SB 1BBRK 4QT8C 3RXIA 1SB1H 1FIWA 1H9IE 2FZZA 4B74A 3KEEA 2UWLA 3LONA 4WJG2 1KTSB 1O3LA 4UDWH 1P09A 5F03A 1FDPA 1XUHA 5EODA 3ZZAA 4CBOA 1IQMA 2ANKH 2Q6FA 1GG6C 4ABHA 3CS7A 1DLEA 3ZV8A 1EB1H 3PB1E 4TSFD 5DP9A 1K1MA 1IAUA 1HXFH 3BF6H 1TNLA 3AVZA 1VR1H 1YLCA 2V0BA 2YMSD 2H9HA 5PTPA 4B73A 1BRAA 3F1SB 2ZTYA 3MQKC 1NM6A 1C1TA 1BOQA 1NZQH 2JETB 4DT4A 2FX6A 1GJAB 1GBHA 4K8BA 4DGJA 5HM9A 3U69H 2Z9GA 3U28C 2UWPA 1ZPZA 1EAWA 3E8LA 5J4QA 1MKWH 3TJVA 1JOUB 4IS5A 4ABDA 2J97A 1KLJH 1O3OA 1T8LA 1CBWC 1KY9A 3URDA 4ISLA 3DA9B 3U8TH 3EE7A 1DM4B 2ZGJA 1V2UT 3ZVFA 3AW0A 1UTKA 1GMHF 2KCAA 2BD4A 4RI0A 1CSOE 1T32A 4R0IA 3TITA 3UWJH 1ELBA 1QRWA 1V2NT 3BTTE 1UVUH 1OP2A 1ELFA 1ZHRA 1GDNA 2K1QA 3ZZBA 1YPEH 1Z8RA 1DICA 4MDSA 1GL1A 2KAIB 3L3TA 4X1NU 6CHAC 1AI8H 1GHAG 2BMGB 1A3EH 3GICB 1MH0A 2SFAA 4Y8XA 2IJD1 1YPGH 1O2TA 4X2YA 1AGJA 4THNH 3TK6A 1DWBH 2BOHB 2FYQA 3U1JB 1LHEH 2RCEA 2WSSD 3SNEA 3LOXA 2CV3A 4NZQA 4XE4A 4R8TB 1GGDB 1TPPA 3EGKH 1H1BA 2GZ7A 1O2LA 1K21H 4OS5A 4X2XA 8KME2 1ZSJA 1BCUH 1P9SA 2KFWA 4U2WA 3FOAA 3M61U 5DO4H 3S69A 1NROH 1W2KH 1C2KA 4DG4A 3H7TA 4GVUA 1QA0A 1FV9A 2QF5A 4H42U 2ZTXA 3ATLA 3EAJA 1KLTA 2SGAA 2STBE 1EJNA 2AMPA 4OS6A 5AVDA 4AFQA 4D76A 3DSOA 1SQTA 2PSXA 4ABFA 4TPYA 3TNSA 4IN2A 3UY9A 1O5CB 5LPFA 1YPHC 1AZZA 3HPTB 1ZMJA 2BY6X 1HUTH 3Q00A 5JBBS 1ELDE 2SNWA 4DVAU 1YF4A 1U6QA 2J38A 3ENSB 3SO3A 1GI0A 1XXFA 5C5OA 4FETA 2Z3EA 1M9UA 3A85A 3GDVA 3SZEA 1EB2A 1C5RA 5A0BA 2ZNKH 4Q63A 1EX3A 1O2ZA 2GT8A 1ZPBA 5EPNA 1YPMH 3LH3A 3KQ5A 1UVTH 4X6OA 2ZGHA 1V2PT 1C5XB 2ZU2A 1HAYB 1X7AC 3S7HB 1BTZA 1C4V2 3FP7E 3M5MA 1F2SE 3LJJA 2GX4A 1O5BB 2IN2A 1HAGE 2OD3B 2FI4E 2F91A 2PKAB 3BTEE 3LKWA 1MD8A 1AKSB 4NA9H 2GT7A 1ZMNA 3A8CA 3RXOA 1V3XA 2QC2A 5AF9H 4RT1A 2ZZUH 2VGCB 1KMHB 4NIVA 4XDEA 1GJ9B 4CRFA 2AIPA 5LPRA 4MLFB 1TE0A 4O3UA 4AFZA 3FN8A 1QB9A 1P2JA 1QL8A 1C2JA 1VITH 1EAIA 2G5NA 3U8RH 3SNCA 2BYAX 2V3MA 3ESTA 1FUJA 3V13A 3E91A 3R3GB 3TIUA 3SU3A 4UFDH 3NWUA 3AK5A 2FXRA 1AIXH 1ZHPA 4Y0ZE 1UK3A 2VIVA 1TX7A 5FL7D 1GL0E 3OSYA 4ZHLU 1TBZH 1HDTH 1UVOA 4XFQA 2VH6A 3SV8A 1EZXC 1GVLA 1SOZA 1XUKA 4U01A 3UIRA 1CA0B 1O3NA 1UHBA 1C1MA 1TNHA 3D49H 3QTVH 4HGCA 1S5SA 3NPSA 2JJ1D 4XOJA 5EJZA 2CHAC 3PWCA 3V3MA 3OAAD 1O2UA 5DKMA 2ZTZA 1GJ6A 5JPMH 1NT1A 5GNDA 1O30A 1PYTC 2A4RA 3PLKA 1C5PA 3SU6A 2H5DA 5JBTA 1DWEH 2OLGA 4XBBA 2RDEA 1ELTA 7GCHF 2WPKS 1W0JD 3M3SA 1IQEA 3LH1A 4AB8A 2ZG0H 2CGAA 1XXDA 2G5VA 1SGFA 3SNBA 1TALA 1E1QD 1WOFA 1SMFE 2BY9X 2ZDKA 4CBNA 3OFND 3FFGA 1G2MA 4Y0YE 2P93A 3UR9A 3VEQB 3BG4B 4CH2B 2EY4C 1GCTC 4H4FA 3NUMA 2PHBA 1LQDB 2RA0A 2A7JA 2M5TA 1TGSZ 4K8YA 1SBWA 2FOFA 3D23A 3SHAH 4IN1A 3MNXA 1BTHH 1WDIA 4XD7D 2A2QH 1LDTT 1C2FA 2HLCA 3GDUA 3GISB 3OU0A 1GHZA 4K5ZA 4MPVA 2ZGCA 2G51A 1C5QA 4P00A 4BAKB 1SGRE 1EQ9A 4CHAC 2JKHA 2GKVE 4AOQA 2EI8A 1SHYA 2Z94A 3ZVDA 2QF0A 5DP4A 1EKBB 2J34A 1P9UA 2QF3A 5DP3A 1O2WA 5HM2A 2XCNA 2V3HH 4WMDA 4X1RU 3SUEA 2WUBA 1E0FD 1SC8U 2WUCA 3PRBA 2NU1E 1TNGA 4FUFA 1C5NH 3MO3A 4FVDA 4ISHH 1FY8E 2ZKSA 3MNSA 3TJOA 4JZDH 3TGJE 4FUBA 3VXFH 4DOQA 3VG8A 2ZCLP 2F9UA 3H09A 4JYTA 2R9PA 1LHCH 3ZV9A 1Y3WA 2TGPZ 2K8IA 1CA8B 2QXJA 4Z6AH 2XC0A 4GCHF 2XBVA 4I31A 2FOAA 2GCHF 4PROA 1BHXB 2FEQH 1O3IA 1FN6A 1SQRA 1P57B 2QYIA 3LDXH 3T62A 1O5AB 2FDAA 4FUJA 2GCTC 1CT0E 3A89A 3PLPA 5B6OA 2Q6GA 2O8TA 4MVNA 2Y81A 1DXPA 1A1RA 4HI3A 3EQ0H 1G2LA 2FOBA 1BIOA 4OS7A 2HLDD 3MTYA 5KGOA 1LHDH 1GJ8B 1YGCH 3BEFB 3ODDA 1EATA 1GI5A 3JZ1B 3P70B 1P2OA 4B2BA 1H8DH 1F5KU 1WU1A 1O5DH 4AC9A 1GBBA 2OCVB 2NU3E 3QGNB 1Z8GA 4DURA 5DP5A 1A7SA 2OC1A 1EP6A 2P95A 1K1LA 2P8OB 5SGAE 2CXVA 4CREA 1W0ZU 4ZKNU 1Z6EA 1C1NA 1GPZA 2HWLB 1UMAH 2TIOA 1AE8H 1SGCA 3TVJB 4WH8A 1GI3A 1EAXA 1E79D 1W3CA 1O2QA 2BZ6H 1KXAA 4I86A 3MHWU 1SFQB 4JYVH 2C90B 3BG8A 2BDGA 5C94A 1P3CA 2PTNA 2WPHS 1O3AA 1DLKB 2GZ8A 2AGGX 3TH3H 3RXSA 2PSYA 1P10A 4AZ2B 1EZQA 5DP6A 4A5TS 2GDEH 1YP9A 2Y7ZA 5JBAS 1P01A 5DJ7A 2DE8A 1D3DB 1P2KA 1HJAB 5F8XA 5EOKA 2FO9A 2ZDAH 3UOUA 4GAWA 1ETSH 1YKTA 5A8XA 5L30H 2AMDA 2FYRA 3A7TA 3QO6A 1C9TA 4ACAA 3IWMA 1ANCA 2ZWLH 1O3CA 4FU8A 2ODQA 2PFEA 1W0KD 4X1SU 1HAPH 3SZNA 2QCYA 1P06A 2VINA 2THFB 3A87A 3SUDA 1Z6JH 4TYDA 1Y8TA 1TRNA 2HRVA 2VVUA 2H6MA 2OQUA 1MAYA 1AQ7A 2YMSB 4B75A 2BB4A 4A1TA 5FX6A 2BY7X 3DSPA 1N8OC 3SV9A 2BDIA 3F2GA 1A5GH 4BAMB 1NRPH 2TGAA 1G9IE 1RXPA 3L33A 3SORA 4WWYA 2VBCA 1FLEE 4BTUB 2HVXA 3E6PH 2VIOA 1NY22 2O9QA 3HKIB 2PUQH 2GJGA 1MABB 3SV7A 3PMHB 1MU8B 3S0NA 1GMCG 2A2XH 2XW9A 2P3FH 3VXEH 1AZ8A 1QCPA 3DFLA 3A7WA 1UCYE 1J17T 2YNBA 1O2XA 1QB1A 2FPZA 2WV9A 1TQ0B 3VPKA 1JWTA 1WCZA 4NCYA 3SJ8A 2UUYA 5LPEA 1K28D 2CF8H 1ESBA 1C2EA 5CHAB 3SGBE 1ID5H 3TU7H 3C27B 1MTWA 1W13U 4RKJB 1PFXC 1E36B 3FVFB 4ZHAA 2OQ5A 1PQ5A 2BLVA 2FMJA 3BTWE 1PYTD 2GV7A 4F48B 1KXEA 1W0YH 2ZF0H 1K0HA 2RG3A 1S84A 5ETXA 1BB0B 1A0JA 4J1YA 1AFQC 1OWHA 5T1VA 3SJ9A 1EZSC 4AG1A 1TPSA 1AVXA 4UD9H 4ZKOU 1GBIA 5CHBA 2P16A 5IDKA 4X8TH 4X8VH 1ZSLA 1Y59T 2M2AA 1B7XB 1HAOH 1LKBA 1HAZB 1C5UA 3P8GA 1NO9H 3NCLA 4X2VA 1TMBH 4GSOA 2FESH 1QGFA 1OYTH 1O3MA 2EI6A 3PYHA 3ELAH 4XSKU 2ZEBA 3BN9A 1QB6A 1AE5A 2QGRA 2BLWA 1B0FA 2OBQA 3BTQE 4D7GA 2JDID 1QRZA 4OS4A 5C17A 1C2IA 1MCTA 1CGJE 4IC6A 1T31A 1AMHA 2F9BH 1UTPA 1C1QA 3KF2A 4FUHA 4NSVA 5AFZH 3MU5A 2VWOA 1W8BH 3A86A 1O2RA 1UHBB 1SPJA 4GHQA 4YM9A 3RMMH 1ZGVA 3RC6A 1IHSH 1GBLA 1SGFG 1NFWA 1GI6A 3RXDA 2NU2E 1ZHMA 2WV4A 3VB7A 3M5OA 2WPJS 4ZH8A 4WVPE 3O8BA 2BZAA 2FI5E 5LGOA 3BTKE 5I46H 5T3HA 3ZZ9A 2F43B 1DOJA 5A0CA 2BVXH 2LELA 1A3BH 4E06H 5L2YH 1LPZB 2C4FH 4YO9A 1O37A 1EOJA 2QF4A 1J8AA 1CGIE 4YXWD 1O39A 1NTPA 1DY9A 1F0SA 2AEIH 1GVZA 3JZ2B 4TY6A 1RGQA 2ULLA 3STJA 4E7RG 3IG6B 5L6NH 1YWUA 1V2QT 4YTAA 1OP8A 2F4LA 1GGDC 3GY5A 4TWYA 3KIDU 3OTPA 3N7DA 5ESBA 3GYMA 1BJVA 4K69A 5FBEA 1OWDA 2YOLA 4Q2KA 4YOGA 3UNQA 2JH5D 1MTUA 3K2UA 1YPLH 4AX9H 1FPHH 2F3CE 3BTGE 3T28A 4I8KA 1O5EH 1PPCE 3SBKA 1LVBA 3RM0H 1ZR0A 2HPPH 1HAVA 2WINI 5B6LA 5JDUB 1PPHE 2A5AA 4KGAA 5HIZA 3GCHB 3RXMA 1NU9A 3DUXH 1F5LA 2G4TA 2PKSC 2XRCA 2BD8A 3P8FA 5T6GA 1ZRBA 3C1KA 1FMGA 1FAKH 5EXLA 1UTMA 4FVBA 2IPHA 1V6DA 5AFYH 1JBUH 1WQVH 1P2QA 1CO7E 1HV7A 2BLQA 6GCHG 2PR3A 3TH4H 2KCYA 1VZQH 3UUZA 3VB5A 3SUFA 2OC0A 3MU4A 1SLXB 2BD9A 3M7TA 1QQUA 2GVFA 1KXDA 1H9LB 1CE5A 2F9PA 2W3IA 1P05A 4IC5A 1G30B 1UJ1A 4RSPA 1GHBG 1FY3A 1GHXH 1A0HB 2AIQA 1IQHA 2A5IA 2A0QB 1BMNH 1F0TA 1A2CH 3QX5H 1PQ8A 3R0FA 5HMAA 1RIWC 1BMMH 1CQQA 5GXPA 3BIVH 3KCGH 4ABAA 2ZU5A 3MH5A 2R3UA 4HFPB 2BHGA 3V0XA 5K0HA 3E0NB 4FUEA 2ESTE 1OWJA 2GTBA 1G3EA 2GMTB 1EPTC 1C5ZB 2G4UA 1O2OA 1K1OA 1N6XA 1RTLA 2HNTF 3ZYEA 1Z1IA 2QV1A 3Q76A 1O3BA 3RU4E 4OGYA 1JMOH 2LNCA 1XM1A 1QR3E 1GJCB 3RLYH 3VB4A 1CVWH 1SGPE 3LGIA 4F55A 1E37B 2C8XB 1ABIH 5E0GA 4INLA 2Y5HA 2EQNA 1GG6B 4H6TA 1F0RA 8ESTE 4JCNA 2FOEA 3F2FA 4YLQH 5EQQA 1O5GH 1BTXA 2G8TA 1G32B 4J2YB 4NIYA 1A0LA 4MG3A 1YPHE 3PMBB 2B5TB 2LP6A 2R0LA 3BV9B 2WHXA 3STIA 1TX8A 1GDQA 1ZZZA 3QWCH 3SJOA 2XNIA 1MKWK 1F7ZA 1AN1E 3U1IB 3PMAB 3RXBA 1SSXA 2Y5GA 3I77A 1XUJA 1EUFA 1QBOA 3MOCA 1T4UH 4I8GA 1RFNA 4K1SA 1DWDH 2ALVA 1DY8A 7ESTE 1H4WA 1UO6A 1CBWB 1LMWB 2HNTC 2KZ4A 3PLBA 1TGCA 4ASHA 3ATMA 3RXTA 1ELGA 2SGEE 1C2GA 5A2MH 2WV5A 1C5TA 1HRTH 4TWWA 4Y71A 3PTBA 1C5VA 3CP7A 2QXIA 4CRCA 1P2NA 4CR9A 1VITG 1J9CH 1W12U 5FCRA 2J92A 2ZFTA 3RLWH 6CHAB 3VB3A 2AHME 1O2KA 1NRQH 2ZGXH 3Q3KA 1L2EA 1GMHG 3H7OA 1UTOA 1LCYA 5DN6D 1LPKB 4ESTE 2R0KA 1SGDE 2W26A 2C93B 1O2JA 3GS9A 1DPOA 5EW2H 1W7XH 2H5CA 1SLUB 3P8NA 1TONA 1TABE 5F8ZA 3BTHE 4DCDA 2JJ2D 3P92A 3H5CB 1V2WT 2BDYA 1GJBB 2RA3A 1MBQA 3NRLA 1TQ7B 1BHXF 2ZDNA 1JIRA 2B7DH 4IW4E 3UAIC 1GBDA 2RFKC 4U32A 3MNCA 3EDXB 1V2VT 3P95A 3T5FH 4BNRA 3KQDA 4AYYB 1UK4A 1QA7A 1SL3A 1UTNA 1SI5H 3DFJA 4M7GA 5GCHG 1AWFH 2FOHA 3TJNA 1EJAA 2ASUB 4GPGA 3MU8A 3IITA 3W1EA 3BSQA 4OM9A 2FWWA 2H9TH 1MKXH 1Y3XA 1AB9C 1E38B 1TBQH 4O9VA 1FQ3A 1TB6H 3W94A 1JIMA 1Y5UT 5GDSH 3UNRA 2CJIA 2QA9E 1A4WH 5CDFE 2NU0E 1DX5M 1OWIA 1C5WB 2Z9JA 3KQBA 1KLIH 2LPRA 2VIWA 2ZU1A 3URCA 5A09A 2PW8H 1AUJA 1FZZA 2QAAA 4Y76A 3ZVCA 1WUNH 2O8LA 4X2WA 3ZVAA 2SGFE 3EA8A 1QL9A 3M7QA 1O3DA 1YCPH 4M9FA 4O97A 5J4SA 2ZHDA 4SGAE 3OX7U 4X6MA 4JZIA 3SI4H 1HXEH 2ZFFH 2EC9H 3LGVA 1K22H 1H9HE 1OYQA 1P2MA 1GI7B 3NZIA 1G3DA 4B71A 3KNXA 3RM2H 2J94A 1ETRH 1XMNB 1CT2E 1ZYOA 2I6SA 3KYFA 1RRKA 4Y8YA 2D26C 4JZFH 5A8ZA 3A83A 4E7NA 2QE7D 1BUIA 1OSSA 2FTLE 2HGTH 3ZZ5A 2EA3A 4Y11E 3ATKA 1THRH 3N99A 1GI8B 2BOKA 1MCVA 3LGWA 5F53A 3UOPA 5F6MA 4VGCB 4MNXA 3MU1A 5G4BA 1IHTH 1QFKH 2ALPA 1W14U 3LT3A 1Y3YA 4KTSA 5GJ4B 3WW7A 3HKJB 1LQEA 3ZZDA 3LGUA 1XKAC 3GY4A 1O2IA 3ZZ3A 2ZQ1A 1NN6A 1CGHA 4A1XA 4E05H 2A1DB 4B2AA 4A1VA 2QIQA 3MMGA 2FTMA 4U30A 1AHTH 1V2RT 3QK1A 1C5YB 4ABEA 1PPZA 1S0RA 1ZTLA 3LPRA 1IQLA 2BY5X 3MO9A 1CHOG 3SNDA 2ZFQH 3KQCA 2VVCA 5FX5A 4B2CA 1C5LH 3SGAE 1EASA 2Y82A 1QRXA 4SGBE 3V7TA 3LGYA 5CMXH 1EOLA 1O3GA 4AN7A 3M5LA 3SU1A 5HKKD 1GBMA 1V2OT 4WXVA 2W7SA 3D62A 3E90B 2VWMA 5IYTA 3U98H 2ZQ2A 1BJUA 1O2SA 4OS2A 4YT7H 2Z9LA 3TNTA 1GBJA 1GCTB 4YZUA 3SV6A 4D8NA 3P8OA 5EQSA 2QXHA 3Q3YA 1O31A 1QZ8A 2J9NA 4FOUC 1RJXB 1P12E 3FANA 4IMQA 1SLVB 3SQHE 3CENA 1FY1A 1YPKH 3RU4D 4NA7A 4K60A 1ELEE 1NRSH 1SVPA 1BRUP 3ZZ8A 1D3TB 4UFEH 4BANB 3AASA 2B0FA 4I32A 2OXSA 2VWLA 3K9XB 3GCTF 1DUAA 1GHVH 4I8JA 2KCOA 1RD3B 1HAVB 2AGEX 1DE7H 5EJLA 1FAXA 1NESE 4ABBA 4CRDA 5A0AE 1S6LA 1S6HA 2OP9A 4A92A 3ITIA 3UB0A 1FN8A 1MQ5A 5DP8A 1E34B 4FXGH 1HJ8A 1ARBA 4KKDA 3T29A 5C1UA 2QY0B 3E16B 1FI8A 1DSUA 3M36A 3U8OH 2AMQA 3GY3A 4Y7AA 6ESTA 1G37A 1TMTH 1DS2E 4UFGH 1Q3XA 1C2MA 4UE7H 1S6FA 4DY7B 5CHAC 1GI4A 5E0HA 2CN0H 3HGPA 8GCHG 5GPIB 1AVWA 2Z9KA 5I25A 3RUOA 2BQ6B 3K6YA 2ODYB 4MPWA 1YY3A 2BD7A 4LOYH 1V2KT 1NFXA 3FP6E 3GY7A 1DDJA 1COWD 3NK8A 4MPXA 2F83A 4KTCA 1GVKB 1MTNB 1EPTA 2ZFSA 3DHKH 2GCTB 1UVSH 3W95A 2XC4A 4NG9H 1AU8A 1OX1A 4B1TA 4BAHB 1AO5A 2C8WB 4ZXXH 5C3NA 3BEIB 1WXRA 1H8IH 2G00A 4RKOB 1A5HA 4GCHG 3GY2A 1WAYB 1KTTB 3Q3XA 2GCHG 1ACBE 1TNKA 2OINA 2STAE 1WBGB 2ILNA 4AFUA 1RTFB 1CU1A 1E1RD 3TGKE 3PRDA 2BLOA 4K2YA 3WY8A 1AFEH 2BX3A 2F9VA 1SGTA 4FU9A 4YOJA 2A7CA 1EXFA 5TCAA 4Y6DA 1O32A 3GDSA 4ISOA 1MZAA 5HIYA 4IBLH 1V2MT 1TRYA 3F9HA 4RN6A 1EFRD 3CS0A 3T26A 3SU5A 1DITH 3MFJA 1P3EA 3PWBA 4ZHMU 1MU6B 1OWKA 1GMDG 2Q6DA 3RU4T 2VIDA 1O3EA 3FZZA 3K6ZA 4WMEA 5EG4A 1UTQA 1ESTA 4P02A 4WY3A 5KEDA 3FZDA 2SGDE 3EE0B 2BVRH 3OTJE 2BDBA 3ZZCA 2KM0A 3MO6A 3LJOA 2IPQX 5E2OA 1V2ST 1MUEB 2GZ9A 3ZIAD 3S9CA 4UEHH 1WSSH 2ZIQH 2W6ID 3RXVA 1TAWA 3PMJA 2AFQB 1NRNH 1UTLM 1T8MA 1F0UA 3GCOA 5GIBA 4X1PU 4ZMAH 3N7OA 3PO1B 2UWOA 1D4PB 2ZPSA 2VU8E 4ZUHA 5GWZA 3M35A 4X8SH 4Y8ZA 1D3PB 1ZSKA 1BRCE 5EQRA 3A80A 1BBRH 2CF9H 4AYVB 2OC7A 4ACBA 1MAXA 1NPMA 1K1JA 1LVOA 1TGBA 4I8HA 5DPAA 3VGCB 1OP0A 1TBRH 4TT3D 2FM2A 1K1IA 3T2NA 3E3TA 4DIHH 2J98A 2ZC9H 1GI2A 2XBWA 5LH8A 2ZPQA 5C1XA 4AFSA 1DWCH 2AS9A 4BAQB 3SQEE 1GJDB 1GHWH 3RXPA 1PQAA 1ARCA 4WMFA 4MQAA 2JETC 1FXYA 2KR7A 3E0PB 3I29A 1N8OB 3RXQA 1L1NA 2AYWA 1Y3UA 3AAVA 2G81E 1A5IA 1GBKA 1JRTA 1YBWA 1ZJKA 1XKBC 2J95A 4MPUA 1GHAF 1TMUH 4K1TA 1GHBF 2C3SA 3F9EA 3B23B 3F9GA 1UVPA 2UUFB 1Z8IB 3ZVEA 1ANBA 1B0EA 1Z71A 2WYGA 1C2HA 2FS9A 2Z3CA 2O8MA 2W6JD 1ZPCA 4DT7B 5C20A 1F5RA 3M3TA 2A4OA 1TPOA 4NWLA 4NWKA 1UTJA 1BTWA 1H8HD 2VIPA 5TCCA 3ZVGA 2ZDLA 3MI4A 1EAUA 3UWIA 3FKSD 1T8OA 1O2MA 1SOTA 2D8WA 2VJ1A 1YCPM 4ABJA 3GY6A 1WV7H 1EZUC 1VGCB 1VKYA 1GJ5H 4Y79A 1QJ1B 3WWFA 1TGTA 1D6RA 1KXBA 1C5SA 3MWIU 4D7FA 3MH4A 4I33A 1ZOMA 3UQVA 1C2DA 2W7UA 3WWBA 3F2HA 3B9FH 1NRRH 1YLDA 2GMTC 1BMLA 1AFQB 1T4VH 1YM0A 4LK4A 1OS8A 4IGDA 1K1PA 2OUAA 2ZGBH 2QN5T 1SQOA 4OGXA 1HAIH 4XBDA 1QNJA 2P3TB 2Y80A 1V2JT 2XBXA 1TOMH 2DE9A 5C0UA 5E2PA 5FPYA 2W5EA 4WF8A 2IJOB 1WQSA 5IK2D 1QBNA 3QUMP 5ABWA 5JBCS 1HIAA 1O33A 2A32A 3F68H 1BMAA 1UCYK 5ESTE 5EIYA 2ZDVH 1SGEE 4DW2U 1BTYA 3HGNA 1AD8H 1ABJH 2ZHEH 1UW7A 3PM3A 4ZCNA 1KYNA 2R2MB 3KYGA 1NBMD 1IQIA 3ATIA 3LU9B 4A7IB 1C1VH 4TY7A 2A31A 4XBCA 4AG2A 2GD4B 4HTCH 2V35A 1VITF 2JH6D 1GDUA 1CT4E 4X8UH 1ZGIA 2XTTB 2XBYA 2PTCE 3FAOA 5TJXA 2TBSA 5BPEA 4ZAEA 1AVGH 2BTCE 1MTVA 2FX4A 4ISNA 3F0OA 1UK2A 4NIWA 1S81A 1NFUA 2SNVA 1P02A 3TLOA 1RTKA 1S0QA 3E1XB 1O3FA 3A7VA 2VGCC 4NZLA 3F3BA 4JK6A 3UNSA 3TGIE 2G52A 1GI9B 2KCPA 4K3JA 1DXWA 4BOHA 4D9QA 1D9IA 4NFFA 1BRBE 1DANH 1C1UH 1TNIA 1LVMA 4F49A 1QL7A 1WTGH 1BITA 1XVOA 3OY5U 1C1RA 4INHA 4ZKRU 1TGNA 1INCA 2BDAA 2P59A 2XWAA 1RS0A 1TRMA 2O8WA 2UUKB 5GCHF 2ZCHP 2L6OA 1C4U2 3RXCA 1O36A 5C0TA 3RDZA 1Y5AT 1CA0C 5F8TA 2ZHFH 3BEUA 1LO6A 4BXWA 3EA9A 4O3TA 1NFYA 1C5OH 3RXUA 1P04A 2ZU4A 1J15A 1QIXB 5C5NA 3O8DA 1PPBH 2VIQA 4I8LA 2ZECA 2ZPRA 2PKSB 3G01A 1O3JA 5AHGH 2OC8A 1KXFA 3OY6U 5EXMA 2HPQH 1TA6A 1QBVH 1O3HA 2HNTE 2SGPE 2H2ZA 3EYDA 1FONA 3RMNH 2FLRH 1BMFD 1OXGA 2GP9B 2BQ7B 3UR6A 4BTTB 5C2ZA 1PJPA 3NKKA 1A61H 1DFPA 1QJ6B 2FOGA 2WPMS 1G3CA 3BG4C 3F0PA 1TPAE 1S85A 4AB9A 1XUGA 5T6DA 5DK1A 3BTDE 1SGYE 4GHTA 3QGJA 3P6ZB 3F9FA 1L1JA 1T7CA 4D9RA 4JZ1A 2B9LA 1GBEA 3UQOA 1RIWB 3KL6A 4OS1A 5CE1A 2BD3A 1CHGA 1D6WA 4ISIH 2FODA 2TRMA 4A6LA 2TGDA 1EPTB 3O8CA 3A8DA 1T8NA 4ZKSU 2ZHQH 1QQ4A 3A88A 2SGQE 3S9BA 3TH2H 2GDDA 3ODFA 1FX0B 3RXKA 4UFFH 1EP5A 1SGNE 3ATWA 1N1LA 3UREA 3BTFE 1GBCA 1NC6A 2R3YA 3RXJA 2ANMH 4I7YH 2P94A 1SGQE 2Z9IA 3Q77A 1JXPA 2ZCKP 1SR5C 2JIZD 1IQGA 2ZP0H 1JRSA 5L2ZH 1SFIA 1IQKA 1KDQA 1O35A 4YESB 3M3VA 1THSH 2PGBB 4F4OC 3A7YA 4VGCC 1CHOF 2ZA5A 3M5NA 5E8EH 5DP7A 5FBIA 2TPIZ 3MH6A 3SNAA 1IQNA 1GBTA 2XOKD 5EJ1A 2ZI2H 1YYY1 3LC3A 1BDAA 4Q7YA 3PV4A 3FO8D 2BD5A 3A7XA 3A8AA 1DUEA 3HK3B 3TK5A 1L4DA 1Q31A 1FIZA 4MNYA 1HFDA 2P3UB 9LPRA 2XC5A 3TK9A 4AGJA 3GY8A 2Y7XA 5DG6A 4CRBA 1TOCB 3PROA 1LPGB 1G3BA 3QTOH 2YNAA
chains in the Genus database with same CATH topology
1DSTA 1ZLRA 1FJSA 2J4IA 4JMYA 4B76A 4MNWA 3RMOH 4NSYA 5FPSA 1OKXA 1FNIA 3ZYDA 3VFEA 5JYIA 1NS3A 2NWNA 3KN2A 4K1EA 1HGTH 1B5GH 1XUFA 5EXNA 1HLTH 3SI3H 3O8RA 1P2IA 4Y10E 4FUIA 2BD2A 1MQ6A 3D65E 3ZZ7A 3A8BA 3KGPA 2GV6A 1HB0B 3PTNA 2ZFRH 1FPCH 1HBTH 3SHCH 4WH6A 2HALA 4NGAH 1BA8B 1HJ9A 2P8OC 3F6UH 4LZ4B 1J16A 5T6FA 3I78A 1MZDA 5JB8S 2ANWA 3B8JA 3QZRA 2Z3DA 1W7GH 1O2VA 2CHAB 4INKA 4KP0A 5K7RA 2A4GA 1BTPA 8GCHF 2RDLA 2XCFA 1TLDA 2PWXA 5EU8A 1LVYA 1MKXK 4DIIH 2WPIS 2A5KA 3NXPA 2OBOA 1OPHB 2BDCA 2B8OH 1LHGH 2FLBH 1ZRKA 2EEKA 2Z6BD 2KAIA 1AB9B 3DT0H 5EGMA 1HJAC 2BQWB 2NU4E 9ESTA 2AH4X 1GJ7B 3LIWA 4KELA 2FOMB 3T27A 1SGIB 4CRAA 2VB0A 1A46H 1O2PA 1HPGA 1L0ZA 1TWXB 4O03A 1VCQA 1YPJH 1S82A 2O8UA 3A84A 3ZVBA 1YCPK 3SJIA 3GCNA 7GCHG 1MTNC 4Q7ZA 1EJMA 1AY6H 3A7ZA 1GBFA 1BZXE 5FCKA 3UTUH 1OOKB 1XVMA 1J14A 1O3KA 1GMCF 5H4IB 3ZZ4A 3S7KB 1ANDA 2PLXA 1C1SA 3TJUA 1O5FH 3DD2H 2VVVA 3RXLA 1GI1A 5HGGA 2ZU3A 1LKAA 1P0SH 1W10U 2A7HA 1GMDF 4Y7BA 4CHAB 1ZMLA 1GBAA 5FHTA 2R2WU 1OWEA 3GYLB 4WXIA 2XYAA 1SLWB 4ZXYH 1QY6A 5HXFA 1WTHD 1K9OE 1XX9A 2ZDMA 2Q1JA 1HIAB 1TYNA 1GHYH 4X1QU 1ELCA 4ABGA 3LC5A 1AUTC 4YOIA 1W11U 1THPB 2G55A 2VWNA 1Y5BT 4HZHA 4ABIA 4CR5A 1C5MD 3HK6B 2H9EH 3BTME 2FOCA 3A81A 3RXAA 2XXLA 2C8YB 1QHRB 2BDHA 2IOTA 3SW2B 4YT6H 1Z1JA 1P03A 3U9AH 2BY8X 4FUCA 1NU7B 1O3PB 3SGQE 1K2I1 4NFEA 1C1OA 1SQAA 3ZZ6A 2PKAA 3LGTA 1QURH 1AKSA 4MNVA 5FAHA 6LPRA 1C4Y2 1KIGH 1L1GA 4Q80A 3PO1C 4X6NA 1BT7A 5EPYA 2VNTA 4BTIB 1P8VC 3HATH 2ZO3H 2WYJA 1O2YA 4LXBH 1BBRE 3SJKA 1O38A 4AGKA 3VGCC 1MTSA 1ZTKA 1BTUA 4X0WU 2BXUH 2ANYA 1Z8JB 5C1YA 1MD7A 2UUJB 2BX4A 2WPLS 3SUGA 3SN8A 1GCDA 8LPRA 2F9OA 1O2GH 3UPEA 5FXLA 1IQJA 1C1WH 1HYLA 1AWHB 4JYUH 7LPRA 1QTFA 1KSNA 1O2HA 2I6QA 1YC0A 1TFXA 3KQEA 1ANEA 2Y6TA 4IMZA 4FU7A 1GJ4H 3MU0A 4NIXA 3TPIZ 2GGVB 5EW1H 2EI7A 2AERH 2DUCA 3RP2A 1QJ7B 3SU0A 2V3OH 1ORFA 4JK5A 4DJZB 2ZHWH 1PPEE 2HOBA 1E35B 2AGIX 3L6PA 1DT2A 3EA7A 4FUDA 1PQ7A 1F92A 1O0DH 1VCPA 4MTBA 4CRGA 4JZEH 1VJ9U 1S83A 7KMEH 1VCWA 1Y3VA 3GCTG 3GOVB 5E0JA 5A8YA 4AORA 4FUGA 2BM2A 2D2DA 2FS8A 1HCGA 2ODPA 5FPTA 4X6PA 1LHFH 3T25A 2C8ZB 1HNEE 3FP8E 3QZQA 5JB9S 4TPIZ 1C2LA 2ZFPH 2PV9B 1GWAA 2Y5FA 2V6NA 1KXCA 3QN7A 2A45B 2FP7B 3UFAA 1G36A 1O34A 1VGCC 1N6YA 1TA2A 3M7UA 1C1PA 4NA8A 3SU4A 1HAHH 3RC5A 4Q7XA 3SOSA 1ZTJA 1P11E 1TNJA 1PPFE 2FI3E 2Z7FE 3KHVA 3S9AA 1Z7KA 3A82A 1SG8B 1IOEA 1SHHB 3RC4A 2H1UA 3OYPA 2BVSH 2OTVA 1HAXB 2QXGA 1WYKA 4BAOB 2TGTA 1DVAH 3RXHA 2A4QA 6GCHF 3AW1A 3QDZB 3RXFA 3VB6A 3GCHC 3RXGA 2J2UA 1PPGE 1XUIA 4YLUA 1ELAA 3BIUH 3RMLH 1ELVA 1BQYA 1MBMA 2W3KA 3V12A 1O2NA 4LZ1H 1LTOA 2VH0A 2D1JA 3SU2A 1L4ZA 2XWBI 2JH0D 4GUXA 4CH8B 1TIOA 1C9PA 3P17H 4KTUA 3MNBA 5HYOA 3SV2H 1K1NA 1UCYH 1ETTH 1KDQB 1D3QB 1TX6A 5C67A 4BXSA 1V2LT 5BRRE 4GLYA 2PUXB 1ESAA 1FY5A 4ZROA 2F9NA 3AAUA 1ZJDA 3QLPH 5DGJA 1Q2WA 4UONA 1FY4A 3K65B 4Z0KA 2BXTH 1V2TT 3M37A 2CMYA 2FIRH 1IQFA 3RXEA 3RXRA 1VJAU 2PGQB 3MH7A 3MYWA 1MMJN 4H6SB 1BBRK 4QT8C 3RXIA 1SB1H 1FIWA 1H9IE 2FZZA 4B74A 3KEEA 2UWLA 3LONA 4WJG2 1KTSB 1O3LA 4UDWH 1P09A 5F03A 1FDPA 1XUHA 5EODA 3ZZAA 4CBOA 1IQMA 2ANKH 2Q6FA 1GG6C 4ABHA 3CS7A 1DLEA 3ZV8A 1EB1H 3PB1E 5DP9A 1K1MA 1IAUA 1HXFH 3BF6H 1TNLA 3AVZA 1VR1H 1YLCA 2V0BA 5PTPA 2H9HA 4B73A 1BRAA 3F1SB 2ZTYA 1NM6A 1C1TA 1BOQA 1NZQH 2JETB 2FX6A 1GJAB 1GBHA 4K8BA 4DGJA 5HM9A 3U69H 2Z9GA 2UWPA 1ZPZA 1EAWA 3E8LA 5J4QA 1MKWH 3TJVA 1JOUB 4IS5A 4ABDA 1KLJH 1O3OA 1T8LA 1CBWC 1KY9A 3URDA 4ISLA 3DA9B 3U8TH 1DM4B 2ZGJA 1V2UT 3ZVFA 3AW0A 1UTKA 1GMHF 2BD4A 1CSOE 1T32A 4R0IA 3TITA 3UWJH 1ELBA 1QRWA 1V2NT 3BTTE 1UVUH 1OP2A 1ELFA 1ZHRA 1GDNA 2K1QA 3ZZBA 1YPEH 1Z8RA 1DICA 4MDSA 1GL1A 2KAIB 3L3TA 4X1NU 6CHAC 1AI8H 1GHAG 2BMGB 1A3EH 3GICB 1MH0A 2SFAA 4Y8XA 1YPGH 1O2TA 4X2YA 1AGJA 4THNH 3TK6A 1DWBH 2BOHB 2FYQA 3U1JB 1LHEH 2RCEA 3SNEA 3LOXA 2CV3A 4NZQA 4XE4A 4R8TB 1GGDB 1TPPA 3EGKH 1H1BA 2GZ7A 1O2LA 1K21H 4OS5A 4X2XA 8KME2 1ZSJA 1BCUH 1P9SA 4U2WA 3M61U 5DO4H 3S69A 1NROH 1W2KH 1C2KA 4DG4A 3H7TA 4GVUA 1QA0A 1FV9A 4H42U 2ZTXA 3ATLA 3EAJA 1KLTA 2SGAA 2STBE 1EJNA 2AMPA 4OS6A 5AVDA 4AFQA 4D76A 1SQTA 2PSXA 4ABFA 4TPYA 3TNSA 4IN2A 3UY9A 1O5CB 5LPFA 1YPHC 1AZZA 3HPTB 1ZMJA 2BY6X 1HUTH 3Q00A 5JBBS 1ELDE 2SNWA 4DVAU 1YF4A 1U6QA 2J38A 3ENSB 3SO3A 1GI0A 1XXFA 5C5OA 2Z3EA 1M9UA 3A85A 3GDVA 1EB2A 1C5RA 5A0BA 2ZNKH 1EX3A 1O2ZA 2GT8A 1ZPBA 5EPNA 1YPMH 3LH3A 1UVTH 4X6OA 2ZGHA 1V2PT 1C5XB 2ZU2A 1HAYB 1X7AC 3S7HB 1BTZA 1C4V2 3FP7E 3M5MA 1F2SE 3LJJA 2GX4A 1O5BB 2IN2A 2OD3B 1HAGE 2FI4E 2F91A 2PKAB 3BTEE 3LKWA 1MD8A 1AKSB 4NA9H 2GT7A 1ZMNA 3A8CA 3RXOA 1V3XA 2QC2A 5AF9H 2ZZUH 2VGCB 4NIVA 4XDEA 1GJ9B 4CRFA 2AIPA 5LPRA 4MLFB 1TE0A 4O3UA 4AFZA 1QB9A 1P2JA 1QL8A 1C2JA 1VITH 1EAIA 2G5NA 3U8RH 3SNCA 2BYAX 3ESTA 1FUJA 3V13A 3E91A 3R3GB 3TIUA 3SU3A 4UFDH 3NWUA 2FXRA 1AIXH 1ZHPA 4Y0ZE 1UK3A 2VIVA 1TX7A 1GL0E 3OSYA 4ZHLU 1TBZH 1HDTH 1UVOA 4XFQA 2VH6A 3SV8A 1EZXC 1GVLA 1SOZA 1XUKA 4U01A 3UIRA 1CA0B 1O3NA 1UHBA 1C1MA 1TNHA 3D49H 3QTVH 4HGCA 1S5SA 3NPSA 4XOJA 2CHAC 3PWCA 3V3MA 1O2UA 5DKMA 2ZTZA 1GJ6A 5JPMH 1NT1A 1O30A 1PYTC 2A4RA 3PLKA 1C5PA 3SU6A 2H5DA 5JBTA 1DWEH 2OLGA 4XBBA 1ELTA 7GCHF 2WPKS 3M3SA 1IQEA 3LH1A 4AB8A 2ZG0H 2CGAA 1XXDA 2G5VA 1SGFA 3SNBA 1TALA 1WOFA 2ZDKA 1SMFE 2BY9X 4CBNA 3FFGA 1G2MA 4Y0YE 2P93A 3UR9A 3VEQB 3BG4B 4CH2B 4H4FA 1GCTC 3NUMA 2PHBA 1LQDB 2RA0A 2A7JA 2M5TA 1TGSZ 4K8YA 1SBWA 2FOFA 3D23A 3SHAH 4IN1A 3MNXA 1BTHH 2A2QH 1LDTT 1C2FA 2HLCA 3GDUA 3GISB 3OU0A 1GHZA 4K5ZA 4MPVA 2ZGCA 2G51A 1C5QA 4BAKB 1SGRE 1EQ9A 4CHAC 2JKHA 2GKVE 4AOQA 2EI8A 1SHYA 2Z94A 3ZVDA 2QF0A 5DP4A 1EKBB 2J34A 1P9UA 2QF3A 5DP3A 1O2WA 5HM2A 2XCNA 2V3HH 4WMDA 4X1RU 3SUEA 2WUBA 1E0FD 1SC8U 2WUCA 2NU1E 1TNGA 4FUFA 1C5NH 3MO3A 4FVDA 4ISHH 1FY8E 2ZKSA 3MNSA 3TJOA 4JZDH 3TGJE 4FUBA 3VXFH 4DOQA 2ZCLP 2F9UA 4JYTA 2R9PA 1LHCH 3ZV9A 1Y3WA 2TGPZ 2QXJA 1CA8B 4Z6AH 2XC0A 4GCHF 2XBVA 4I31A 2FOAA 2GCHF 4PROA 1BHXB 2FEQH 1O3IA 1FN6A 2QYIA 1P57B 3T62A 3LDXH 1O5AB 2FDAA 4FUJA 2GCTC 1CT0E 3A89A 3PLPA 5B6OA 2Q6GA 2O8TA 4MVNA 2Y81A 1DXPA 1A1RA 4HI3A 3EQ0H 1G2LA 2FOBA 1BIOA 4OS7A 3MTYA 1LHDH 1GJ8B 1YGCH 3BEFB 3ODDA 1EATA 1GI5A 3JZ1B 3P70B 1P2OA 4B2BA 1H8DH 1F5KU 1WU1A 1O5DH 1GBBA 2OCVB 2NU3E 3QGNB 1Z8GA 4DURA 5DP5A 1A7SA 2OC1A 1EP6A 2P95A 1K1LA 2P8OB 5SGAE 2CXVA 4CREA 1W0ZU 4ZKNU 1Z6EA 1C1NA 1GPZA 2HWLB 1UMAH 2TIOA 1AE8H 1SGCA 3TVJB 4WH8A 1GI3A 1EAXA 1W3CA 1O2QA 2BZ6H 1KXAA 3MHWU 1SFQB 4JYVH 2C90B 3BG8A 2BDGA 1P3CA 2PTNA 2WPHS 1O3AA 1DLKB 2GZ8A 2AGGX 3TH3H 3RXSA 2PSYA 1P10A 4AZ2B 1EZQA 5DP6A 4A5TS 2GDEH 1YP9A 2Y7ZA 5JBAS 1P01A 5DJ7A 2DE8A 1D3DB 1P2KA 1HJAB 5F8XA 5EOKA 2FO9A 2ZDAH 3UOUA 4GAWA 1ETSH 1YKTA 5A8XA 5L30H 2AMDA 2FYRA 3A7TA 3QO6A 1C9TA 3IWMA 1ANCA 2ZWLH 1O3CA 4FU8A 2ODQA 2PFEA 4X1SU 1HAPH 3SZNA 2QCYA 1P06A 2VINA 2THFB 3A87A 3SUDA 1Z6JH 4TYDA 1Y8TA 1TRNA 2HRVA 2VVUA 2H6MA 2OQUA 1MAYA 1AQ7A 4B75A 2BB4A 4A1TA 5FX6A 2BY7X 1N8OC 3SV9A 2BDIA 1A5GH 4BAMB 1NRPH 2TGAA 1G9IE 1RXPA 3L33A 3SORA 4WWYA 1FLEE 4BTUB 2HVXA 3E6PH 2VIOA 1NY22 2O9QA 3HKIB 2PUQH 3SV7A 3PMHB 1MU8B 3S0NA 1GMCG 2A2XH 2XW9A 2P3FH 3VXEH 1AZ8A 1QCPA 3DFLA 3A7WA 1UCYE 1J17T 2YNBA 1O2XA 1QB1A 2FPZA 1TQ0B 3VPKA 1JWTA 1WCZA 4NCYA 3SJ8A 2UUYA 5LPEA 1K28D 2CF8H 1ESBA 1C2EA 5CHAB 3SGBE 1ID5H 3TU7H 3C27B 1MTWA 1W13U 4RKJB 1PFXC 1E36B 3FVFB 4ZHAA 2OQ5A 1PQ5A 2BLVA 2FMJA 3BTWE 1PYTD 2GV7A 1KXEA 1W0YH 2ZF0H 2RG3A 1S84A 5ETXA 1BB0B 1A0JA 4J1YA 1AFQC 1OWHA 3SJ9A 1EZSC 4AG1A 1TPSA 1AVXA 4UD9H 4ZKOU 1GBIA 2P16A 5IDKA 4X8TH 4X8VH 1ZSLA 1Y59T 1B7XB 1HAOH 1LKBA 1HAZB 1C5UA 3P8GA 1NO9H 3NCLA 4X2VA 1TMBH 4GSOA 2FESH 1QGFA 1OYTH 1O3MA 2EI6A 3PYHA 3ELAH 4XSKU 2ZEBA 3BN9A 1QB6A 1AE5A 2QGRA 2BLWA 1B0FA 2OBQA 3BTQE 4D7GA 1QRZA 4OS4A 1C2IA 1MCTA 1CGJE 4IC6A 1T31A 1AMHA 2F9BH 1UTPA 1C1QA 3KF2A 4FUHA 4NSVA 5AFZH 3MU5A 2VWOA 1W8BH 3A86A 1O2RA 1UHBB 1SPJA 4GHQA 4YM9A 3RMMH 1ZGVA 3RC6A 1IHSH 1GBLA 1SGFG 1NFWA 1GI6A 3RXDA 2NU2E 1ZHMA 2WV4A 3VB7A 3M5OA 2WPJS 4ZH8A 4WVPE 3O8BA 2BZAA 2FI5E 5LGOA 3B