3MO6A

Investigation of global and local effects of radiation damage on porcine pancreatic elastase. sixth stage of radiation damage
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray-induced deterioration of disulfide bridges at atomic resolution.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Chymotrypsin-like elastase family member 1
total genus 64
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2010-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mo6A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mo6A01
2FP7B 4ZROA 1O2KA 2ALPA 1W10U 1A7SA 3LH3A 2OQ5A 1DPOA 1V2OT 3BTKE 3SNCA 1OPHB 1FY4A 2PTCE 5E2OA 3RDZA 2FLBH 2GDDA 1F0UA 2J2UA 2ODPA 1C9TA 2VH6A 1QFKH 1HGTH 3M3TA 3MO3A 1CGIE 1GMHF 1Y3YA 3SNEA 4B2AA 1DVAH 1C5UA 1DLKB 4TPYA 4DVAU 3R0FA 5DP6A 1G37A 1ESAA 1GCDA 2TGAA 2UUYA 4MNWA 3ZV9A 1P05A 1H8DH 4ABEA 1AWFH 4CHAB 1FIZA 2ZTZA 1TMBH 1TX8A 1EATA 3AASA 1CGHA 2SFAA 4WMFA 5GCHF 1IQNA 7ESTE 1C5NH 2BY8X 2QYIA 1A3BH 1LVMA 1TPPA 2STAE 3AW0A 2G5NA 1MBQA 1AU8A 1H9IE 2WPHS 1CHGA 3LJOA 1JXPA 3A83A 2BDHA 2IOTA 3LOXA 1GBLA 3Q3KA 3ODDA 2B9LA 1CA0B 1C4V2 1VCWA 1SQAA 1ZMJA 5E0GA 3T25A 1LVBA 3C27B 4FUCA 4Y8XA 1G30B 2H5DA 3M35A 1A1RA 1V2NT 1TE0A 4H6TA 3BG8A 1T8LA 2HWLB 3SU4A 1EZQA 1GI5A 2XBVA 1TFXA 3ODFA 2GGVB 2ZPSA 4R8TB 1EB2A 2Q6GA 1MTNC 3W95A 3F6UH 5EXNA 3E0PB 2QF0A 2G52A 2WPIS 4INLA 2O8UA 1NY22 3GY2A 4INHA 1BQYA 3SI4H 3MH6A 1KLIH 1DS2E 1UMAH 2BD2A 4CHAC 5JBCS 2UUJB 1K1MA 5FCKA 5A0CA 1SGNE 1DE7H 1TRMA 2WUCA 3DFLA 1F92A 1O30A 2QA9E 4Q2KA 4D9RA 3L3TA 1GDUA 2XXLA 4NZLA 1H1BA 1MAXA 4TWWA 1JIRA 4X8SH 5A2MH 1BUIA 3M5NA 3SU3A 3NWUA 1EPTA 2AIPA 1VCQA 1MU8B 3EDXB 1ZRBA 1KYNA 3KCGH 1C5RA 4K8BA 3PB1E 1ZLRA 2YNAA 1O3OA 1XUIA 1BB0B 4LZ4B 1RTKA 2XC5A 2C4FH 4JZDH 2LNCA 4VGCB 5E2PA 3SO3A 1P9UA 1JIMA 2ZO3H 3TJNA 2M5TA 1C5OH 4JZ1A 1ZR0A 2G4UA 1MKXH 4TY6A 1XVMA 3HGNA 2I6SA 1ZSKA 5FX5A 1QL7A 1MTSA 3BIUH 4FU8A 1O2RA 1PPBH 3LGVA 2XYAA 3RU4D 3KGPA 5ABWA 2BVRH 3P6ZB 1O2TA 1XUKA 1C5TA 5ESTE 2F9PA 4F49A 3BTWE 5A09A 2C90B 1Z71A 2PLXA 5DP7A 4CBOA 1DX5M 3MU4A 2G5VA 5CHAC 1PQAA 2BDGA 5EGMA 1C5VA 1Z6JH 2CXVA 3GY3A 2D2DA 1OWJA 2ZHFH 3SW2B 1ZHMA 2RA3A 2HNTE 3LT3A 4Y71A 3VEQB 1DUEA 1UTLM 5TCAA 3ELAH 1NTPA 2ZKSA 4KELA 2VGCB 1ZPZA 1AN1E 1EAWA 1SGIB 1WOFA 2HVXA 1CSOE 3RXUA 1OP2A 1TPAE 1N1LA 3H7OA 3SGBE 2CF8H 2FMJA 1IOEA 3OY5U 3UOPA 2V3HH 2C93B 3PLBA 3SU5A 4WJG2 3Q3XA 3SUEA 3LKWA 2OCVB 3VB3A 4BAQB 3RXLA 2GCTB 4IN1A 3TVJB 1YPHC 4GLYA 2PKSB 1S0RA 4LXBH 2ZQ1A 4HTCH 1O5FH 4ABIA 1GI0A 2Y81A 2QXHA 4Z0KA 1K28D 1T32A 5BPEA 1O33A 4K5ZA 4Z6AH 1WU1A 1J9CH 1MMJN 2ZFPH 3OSYA 1FIWA 2BMGB 3ZVBA 3SU1A 1UJ1A 3SQEE 1F0RA 3MOCA 3RMLH 3RMNH 3QN7A 1YPGH 1WAYB 1RIWB 4DT7B 2GT8A 9LPRA 2VVCA 1EQ9A 1FN8A 4K1SA 3QTOH 3SUGA 1A0JA 2ZTXA 3T26A 5PTPA 2PHBA 1LPGB 2GVFA 3GOVB 4X6MA 5DK1A 1BOQA 1YKTA 3MU1A 1XMNB 1QBNA 4I8JA 1GI4A 1GHYH 4NG9H 3BTME 1GBJA 1SGRE 1YC0A 3V7TA 1PPEE 5C5OA 1PPHE 1GHBG 1SGCA 3SQHE 1DT2A 1UHBB 1FQ3A 3PLPA 5F8XA 3BEIB 3P8GA 1IAUA 2YOLA 3F9GA 3BF6H 2ZU2A 1ZRKA 1WUNH 4X8UH 1LVOA 1V2RT 4H4FA 5A0AE 4DY7B 3MH7A 5HYOA 2J34A 3P92A 2O8TA 1HAPH 1YYY1 1O3GA 3M5MA 3QK1A 2ZCHP 2B0FA 3K9XB 1O2GH 4ZKOU 2WV5A 2FOHA 5E0JA 1DFPA 1SHHB 2QF3A 4A1XA 1O35A 3BG4B 1O3CA 1FPHH 4JYUH 2PSXA 2BY7X 3PMAB 1VCPA 3LGWA 2R2MB 2VIVA 4OS5A 1O3NA 3IG6B 3A85A 3Q77A 1FY5A 3A87A 3U8TH 4X1RU 1BTZA 2PKAB 2ZDLA 1SGPE 1HIAB 1BTXA 3RXJA 1OSSA 3RXVA 2AFQB 1Q3XA 5FBIA 5F8ZA 4Y10E 1T4VH 5C1XA 4AB8A 1G3DA 3M5OA 2F3CE 1O0DH 1GDNA 1LVYA 3A7WA 1GG6B 3WY8A 1HAOH 2D1JA 1NRSH 2GMTB 4CH2B 1O32A 2ZHWH 3F1SB 4X6PA 3SJ8A 3LU9B 3BIVH 1ESBA 1CBWB 1NRRH 1P2KA 1WTHD 1Z6EA 5A8YA 4IN2A 3TH2H 1NU9A 1LTOA 3RXDA 4FUIA 1FMGA 1PPFE 4WWYA 1EZUC 1XUJA 1ELFA 2ZU1A 3ITIA 5EPYA 1SGQE 1Z1IA 1GMHG 4WXIA 5EQRA 2BB4A 2TPIZ 2FXRA 3EA9A 2H1UA 4DG4A 1G3BA 3MH4A 1BIOA 3MTYA 1HJ8A 2BY9X 2ZU3A 3ZYEA 1KLTA 1O2JA 2BD5A 3ATMA 2B8OH 4WF8A 1QGFA 3ZZ7A 1ZSJA 1AO5A 1QCPA 1ORFA 3TH4H 3C1KA 2ZDVH 2F91A 3A7XA 2BXUH 2TGDA 1CO7E 5JB9S 2VJ1A 1C1NA 2SGEE 1K1PA 1DY8A 1MUEB 1O5GH 4FU7A 4AB9A 1O38A 1C2FA 3ZZCA 3P8OA 1T8MA 3SU6A 2WYJA 3SZNA 1AZZA 2G81E 1C9PA 1CBWC 1LHDH 3GDSA 1G2LA 2ZG0H 1WQVH 8ESTE 2VIQA 3TGIE 4I8GA 1B0FA 3TNTA 1MD8A 2A31A 1AFEH 4XBCA 2IN2A 1G32B 2Z3EA 1HB0B 3EA7A 2Z9KA 4SGAE 5HGGA 1K1NA 3RXSA 1O2MA 1LCYA 4BAOB 1GHWH 3KNXA 5DP8A 1VGCC 1AVXA 1TAWA 4I33A 3V13A 7GCHG 1CHOG 5DP3A 4B2BA 1BMMH 3VB7A 4E7RG 4NCYA 1LMWB 1C1TA 1EOLA 3V0XA 1P09A 3GCTG 4FVDA 2W7SA 2OC8A 3N7OA 4K2YA 1OWHA 1AKSA 3D23A 1RS0A 1D6WA 1V3XA 3TU7H 3S9CA 1TNLA 5EXMA 1GMDG 3KL6A 1P04A 3LC5A 5B6OA 1HBTH 1HDTH 1UK4A 1BT7A 1YPLH 1QJ6B 2BM2A 1PYTD 5GPIB 2Z9JA 1YLDA 3HGPA 1C5YB 2AYWA 1FONA 2BX3A 1QL9A 1AE5A 4BAMB 4X6NA 1AMHA 2BDBA 1YM0A 1QA7A 2SGQE 4WY3A 4YZUA 1C2EA 4ABBA 1FI8A 1UO6A 1GG6C 5HXFA 1AZ8A 4AN7A 1Z8RA 3TITA 4Q7XA 4AGJA 3A7YA 1K9OE 4FUBA 4UE7H 2ZA5A 3A82A 1LHGH 1J17T 4UEHH 5LPEA 1GBCA 3E6PH 4HZHA 3OY6U 1V2ST 4Q7YA 4YLQH 2WPKS 4CRFA 3SJIA 1O3FA 1GGDC 1Y5BT 1MCVA 4KGAA 2VGCC 2H6MA 3UUZA 4X8TH 1O2XA 4TYDA 1P11E 3IITA 3PWBA 4U32A 1OWDA 1EPTB 1KDQA 4SGBE 3E1XB 6GCHG 2ZDAH 5IYTA 1BMAA 2XC4A 2ZFTA 1SQOA 4JMYA 3LPRA 2EEKA 3QWCH 3RLYH 1EZSC 1UTMA 1QBVH 5C3NA 1JMOH 2UWLA 1T31A 5A8ZA 1P3CA 1Y3XA 1UTPA 2EI7A 3VB6A 4NGAH 1ZHPA 1EP5A 3S0NA 1KTTB 1KXBA 4RN6A 4LZ1H 1HRTH 4LOYH 4Y6DA 6GCHF 2CHAB 4VGCC 3MFJA 3SU2A 2C8ZB 2EC9H 4ESTE 2ALVA 4ZHAA 1FXYA 1L1NA 2P8OB 1PQ5A 1SFIA 1V2WT 3LONA 3SUDA 3VB4A 2FPZA 2BD3A 3W94A 1MAYA 1K21H 3E3TA 1LDTT 2ZNKH 5C20A 1QL8A 3RP2A 1S85A 5ESBA 3L33A 2ZI2H 1AFQC 3F68H 3M7QA 3IWMA 2AH4X 2BY5X 4E06H 5HMAA 4OGXA 1V6DA 3I77A 4BANB 1C5SA 3A86A 1WQSA 4QT8C 4X8VH 3RXCA 5HM2A 2OUAA 3V3MA 4UD9H 3TGJE 2ZWLH 1L4ZA 1YPHE 3B9FH 3HKJB 4NIWA 3NXPA 1EJAA 1HJ9A 2FI4E 3FZDA 1N8OC 2BVXH 2CHAC 5TCCA 4JZEH 1UTNA 3P70B 3ATIA 2PKSC 2UWOA 1Q2WA 4MPUA 4OGYA 1MTNB 4MDSA 1BJVA 1GBDA 4O9VA 1DWEH 2ILNA 2UWPA 2VINA 2LPRA 1NC6A 2R0KA 1GJ5H 3Q76A 1AKSB 3HK6B 4ABHA 3MU0A 5CMXH 3MWIU 5F6MA 1V2VT 4YM9A 1INCA 2QC2A 5EU8A 1FJSA 2QN5T 1GCTB 2OC1A 3EE0B 1OWEA 1HV7A 1NS3A 3M3SA 2YNBA 1AI8H 3TK9A 4ISNA 1QRXA 1IQMA 3PMHB 1G9IE 1UHBA 1D3PB 1W11U 4XSKU 3UY9A 2ZFFH 4KTSA 1O2OA 1J8AA 5DPAA 2B7DH 3ZYDA 1RGQA 4XE4A 4DURA 1EB1H 5DGJA 1GMCF 3A8CA 4MPXA 2FOEA 1PJPA 4HI3A 1C2JA 2ZDNA 1GJBB 4TY7A 3R3GB 1NU7B 2NU1E 5FPSA 1WCZA 1W7XH 1B5GH 3M61U 1WV7H 1GDQA 3ATWA 1GHVH 3NK8A 4NIXA 2ANWA 3K2UA 2BQ6B 2GZ9A 1SSXA 5C1YA 3O8DA 2XWAA 1EZXC 2OBOA 5GXPA 1ETSH 1O3AA 3RXHA 1SMFE 1JOUB 3URDA 4B75A 4MPVA 1J14A 1FNIA 2ZCKP 2GZ8A 4AYVB 4KTCA 4WMEA 1GCTC 2W3KA 3JZ2B 1C2DA 3RM0H 1QIXB 4KP0A 1F2SE 1GJ8B 1O39A 3BN9A 1TGTA 2ZDKA 2TBSA 5T6DA 1SVPA 6CHAC 3SJ9A 2O8MA 1SGDE 4NZQA 2NU0E 2DUCA 3I29A 3SI3H 1Z8JB 1HAYB 3B8JA 1QURH 1EASA 4ZAEA 1HLTH 1ELBA 2FOGA 4A1TA 1RXPA 5JBAS 1H9LB 3ZVCA 3FP8E 3RMOH 3SBKA 1LKAA 1P2OA 1A5IA 1C2GA 1P9SA 2OTVA 3HK3B 1N6XA 4CH8B 3PLKA 2R3UA 3TIUA 5JPMH 1BHXB 1TBQH 3MU5A 1FAKH 4XDEA 4BTTB 1LQEA 3DT0H 2FOFA 1GI6A 4ISLA 2VWOA 4RKOB 2ZEBA 1UCYE 1FY1A 1K1IA 3PMBB 1N6YA 1DM4B 4ISHH 3GCHC 1JWTA 1IHTH 1C1RA 1TNKA 2FDAA 1ZPCA 3U1JB 1PQ8A 1SPJA 3ZZ3A 2A4OA 1UK3A 2VU8E 1MD7A 4MNVA 2BVSH 1P02A 3UWJH 3O8CA 3P8NA 2FS9A 4OS7A 1KXAA 1YF4A 3A8BA 2VWLA 3NZIA 4IC6A 2BZAA 2FEQH 2ZFRH 1TMTH 5L30H 2ZHDA 1FPCH 3LDXH 4IGDA 4ZKRU 1GL0E 1IQGA 2A45B 3FANA 4BNRA 3TJOA 4YTAA 2EA3A 1BRUP 1SG8B 2PFEA 3STJA 4X2YA 4JYTA 2WUBA 4J1YA 4ABFA 5JBTA 4B76A 5GIBA 3CENA 1QQUA 2TIOA 5LPRA 3QGNB 1OOKB 2W5EA 2Z9IA 2A32A 2TGTA 3S69A 2Y7ZA 1V2QT 1ARCA 1FZZA 2KAIA 1AB9B 3A7VA 4MQAA 1TNHA 1ETTH 1P0SH 2OP9A 2WYGA 3ZVGA 3RXEA 4UFGH 2GT7A 4DGJA 5T3HA 2FYQA 3EA8A 5CE1A 3HATH 1FLEE 3LGTA 4OS6A 1GHBF 3LGYA 2PTNA 3NKKA 4CBNA 4ZHLU 1W3CA 1EP6A 4H42U 4NIYA 1DY9A 2Z6BD 3TJVA 1O2QA 1BTYA 1O3IA 4U01A 1DXWA 1SHYA 1YPMH 5ETXA 3KIDU 1O5EH 1GI2A 4YOIA 2PWXA 3RMMH 3ZZ9A 1UCYH 1C2KA 2JH0D 1P8VC 3SHAH 2OXSA 2V35A 4ZKNU 1QB6A 1DWCH 2PR3A 2V6NA 2F83A 4K8YA 3RC5A 4ASHA 1PPGE 3FZZA 1ZPBA 4B1TA 1Z7KA 1HAVB 1W2KH 2BQ7B 1HJAC 4FUDA 1C2HA 2STBE 3Q3YA 1XM1A 1UK2A 3K6YA 3SHCH 2AS9A 1YBWA 4X1NU 1LQDB 1CU1A 3MH5A 1GBFA 1OP8A 4X2XA 2VIWA 4I31A 1JBUH 4NA8A 3BTHE 3M5LA 4CRGA 1SGFA 2XW9A 5TJXA 1NPMA 3ATLA 2PW8H 5C5NA 1AUJA 1AUTC 1YCPM 2FZZA 1PFXC 1TALA 2JETB 1H4WA 4DIHH 1KSNA 5LH8A 1OYTH 1Z1JA 2JKHA 2VWNA 5J4QA 5SGAE 2FX4A 1P2NA 3GYMA 1TQ7B 3FAOA 4WH8A 1S81A 2W7UA 2HLCA 3MNSA 2FTLE 1AY6H 4CRAA 1TPSA 2XRCA 3A7ZA 3RC4A 3QLPH 2HOBA 3OYPA 2QCYA 2BDCA 3M36A 1BZXE 5LPFA 1BMNH 1AHTH 2VVVA 2HPQH 1BTPA 1S6HA 5G4BA 1MZAA 1MTUA 1A61H 2BZ6H 1IQKA 4B73A 1FY8E 1TGBA 1P10A 1BMLA 2XBYA 4JZIA 3RXRA 1C1UH 2BDAA 2D26C 1ELAA 2OBQA 1CA8B 3V12A 2XBWA 2BYAX 2BLQA 1SGTA 3A8AA 4AG2A 1C1PA 4GCHG 2WPMS 1QB9A 1ABIH 2VIPA 4ZXXH 1F5LA 1RTLA 4XBDA 1AIXH 2W26A 1DSTA 5FX6A 2FODA 1BHXF 4FUGA 2A4RA 1DOJA 2HNTF 3U1IB 2VNTA 2FX6A 1GBIA 2AGIX 5AFYH 1YPEH 5J4SA 1HAXB 2SGAA 4YT6H 2VIOA 1AVWA 3ZVAA 2HALA 1E37B 3S7KB 3HPTB 4A1VA 5JYIA 4Y8ZA 1UTOA 3ESTA 1VITF 1GJCB 1TNGA 5FXLA 3SV6A 3RXFA 1GHXH 3BTFE 2NU2E 1PYTC 2P94A 4Q80A 1C1MA 1RFNA 3LH1A 2FYRA 3QTVH 4ZHMU 3MI4A 1AFQB 1A0LA 5AHGH 1C5PA 2JH6D 4ISOA 1SL3A 1FV9A 1V2TT 4CREA 2XBXA 1KTSB 2SGPE 3UNSA 1BITA 1QY6A 3ZZ6A 1UTQA 2NU3E 2RCEA 3CP7A 4U2WA 3D49H 2EI6A 1NFWA 1TBRH 4Q7ZA 2A7CA 3U8OH 2ZGXH 2QIQA 1TX7A 1MQ6A 1ELDE 1GVKB 3CS0A 2UUFB 3AAUA 3TLOA 1EKBB 2BOHB 2HPPH 4IW4E 1C5LH 1QB1A 4IS5A 2GX4A 5E8EH 2I6QA 3SUFA 2KAIB 1SB1H 1Y8TA 4YO9A 3GY4A 1GVLA 4O3UA 4BTIB 2BQWB 3MO9A 5E0HA 3UIRA 3MU8A 1HJAB 1SLWB 4MLFB 3ZVDA 1TMUH 1HIAA 1Y59T 4XBBA 1K2I1 3PTBA 4RKJB 4AOQA 3QGJA 1OWIA 1AGJA 1MTWA 3TK6A 4AYYB 3ZVFA 3M7TA 7LPRA 1GL1A 1HUTH 4D76A 2ODQA 1C2LA 2R3YA 4AFSA 1H9HE 1RTFB 3VPKA 1C5QA 2HRVA 2H5CA 1QRWA 1C1OA 4FUHA 5EW2H 4A92A 2C3SA 1SGYE 2B5TB 1V2PT 3MNXA 1MBMA 5L2YH 1MTVA 1HYLA 1Y3WA 3ZZDA 3ZZAA 1MU6B 2XNIA 1NN6A 2J95A 3F9EA 4UONA 2AMQA 1VR1H 2BD8A 3E91A 2F9BH 3M3VA 4XOJA 1CT0E 3MYWA 1HAHH 2P3UB 1SLVB 1F5KU 1DUAA 4H6SB 1P2IA 4DIIH 4K3JA 2J92A 2Y5FA 3T28A 3SJOA 2D8WA 2THFB 1QJ7B 1EUFA 2FS8A 2ULLA 1YPKH 2ZFSA 1NFXA 1P2QA 1ZOMA 1V2MT 2Z3DA 5K7RA 2Z3CA 1W8BH 3BV9B 4ISIH 1TIOA 1YCPH 3UQOA 3RLWH 5C67A 2Y80A 1UVUH 1P57B 2PGQB 4UFDH 1E38B 1HAZB 5JB8S 3OTJE 5DO4H 1TYNA 4O97A 2FOCA 1NRNH 1RRKA 2GP9B 2ZGHA 1ABJH 1AE8H 5EOKA 2AEIH 2C8XB 2GKVE 1E0FD 1ELCA 2ZU4A 3KEEA 3STIA 3NUMA 5EPNA 4FUEA 2ANKH 3PROA 3VGCC 2FOMB 1ZTJA 2PKAA 5EG4A 1ZJDA 4R0IA 3P95A 1BBRH 1GI7B 4Y0ZE 1W13U 3RU4E 7KMEH 2CF9H 1K1OA 4NA7A 1NROH 5AFZH 1HPGA 1TRNA 1CVWH 4Y0YE 5L2ZH 6CHAB 2P16A 2NWNA 1GJAB 2ZU5A 4CR9A 1HXEH 4GCHF 1C5ZB 1EOJA 3A89A 2VWMA 3RU4T 4DCDA 4THNH 2WV4A 3M7UA 3RXPA 3HKIB 3SV9A 1CT4E 2TRMA 4DJZB 1EAUA 1W12U 4Y11E 2G55A 1XXFA 2BD4A 1KXEA 1YP9A 1QR3E 1DITH 1OX1A 1CQQA 2Y5GA 5FPYA 2GZ7A 1S5SA 2ODYB 1TOCB 1C1VH 1DWBH 1TNIA 1Q31A 1O5BB 2BDYA 4A5TS 4GUXA 1ELGA 5H4IB 4D8NA 2AGEX 3E90B 2A5IA 1FDPA 1BBRE 2P3TB 4GSOA 1QRZA 4K60A 3KQEA 2XCNA 1GMCG 1A0HB 2VB0A 3U98H 1T8NA 3BTTE 2ZP0H 1B0EA 3KQDA 1L1GA 1E35B 1GJ4H 2ASUB 4YESB 1NRPH 1O2YA 2CJIA 4ABJA 2UUKB 1JRTA 3QX5H 1G3CA 1L0ZA 1GMDF 3H7TA 2P95A 3GISB 1QQ4A 1OKXA 2XCFA 3RXQA 4X2WA 1YGCH 1IQIA 1TBZH 1Y5UT 1SLUB 3RXAA 1NM6A 4I8HA 1E34B 2QV1A 3RXOA 2Q6DA 7GCHF 1SGEE 1ZHRA 1J15A 4GHTA 4ZH8A 1C5XB 1K1LA 1NFUA 1TGSZ 2GTBA 2HNTC 1OXGA 3URCA 2J94A 3PMJA 2BOKA 1GHAG 1FN6A 6LPRA 1S6FA 5FAHA 1C5MD 3E16B 4YOGA 1FAXA 3LIWA 1ZMLA 1THPB 5EXLA 1EAXA 1TA6A 1IHSH 1V2UT 3GCHB 1O2VA 3NPSA 4UDWH 1P03A 4FU9A 2QGRA 5CHAB 2FIRH 4AGKA 1XUHA 3K65B 1Z8IB 2ZIQH 4TPIZ 3SOSA 1O2IA 1WTGH 2V0BA 1AQ7A 2DE9A 5DP4A 1DANH 1C5WB 2JH5D 5C1UA 2IPHA 1CA0C 1IQJA 1JRSA 1O3LA 4MNYA 1MZDA 1EJMA 2PGBB 1O3EA 4GVUA 5EODA 1H8IH 2BLWA 2V3OH 3PTNA 3OU0A 2F9VA 1Y3VA 3FFGA 4JZFH 1PPCE 2CMYA 3NCLA 1SI5H 2P8OC 4YLUA 1CGJE 4WMDA 4HGCA 5JDUB 1CT2E 8GCHG 1NESE 1L2EA 2ZFQH 1XVOA 2Z7FE 1DSUA 3S9BA 2Z9LA 2A2XH 2K1QA 1RJXB 3FP6E 4AFUA 2ZPRA 3VXFH 5DP9A 1HNEE 1LKBA 2BLOA 3PV4A 3SV2H 1V2LT 3E8LA 3RC6A 3AW1A 1KXFA 1IQEA 1GHAF 3ZV8A 1A3EH 4PROA 3JZ1B 1EX3A 5FPTA 3EGKH 1ELVA 2QXGA 4NFFA 4I7YH 1TWXB 3RUOA 4NFEA 4ZMAH 5FBEA 3UNRA 3RXMA 2OLGA 1C1SA 1L4DA 4FUJA 3VFEA 1P2MA 3T27A 3S9AA 3U8RH 1QHRB 2J9NA 5GJ4B 1PQ7A 2A5KA 2C8WB 2GMTC 2O8LA 1S0QA 1X7AC 2PUXB 2ZECA 3O8BA 1VITH 1D4PB 1UVOA 3SV8A 3UREA 1IQLA 1GJ7B 3FP7E 1IQFA 1D3QB 5FHTA 2Z9GA 3A8DA 2Z94A 3H5CB 5BRRE 1OS8A 2W3IA 1EAIA 3SORA 4M7GA 4DOQA 4FVBA 3F9FA 2ZC9H 1O3PB 4Y76A 3DD2H 1O2WA 4FXGH 1G3EA 3DUXH 4AFZA 4JCNA 2XWBI 1D3TB 1XUGA 3BTDE 5K0HA 1TNJA 4B71A 1KDQB 3VB5A 3LGUA 3SGQE 1TQ0B 1ANCA 2BD7A 2BXTH 5DP5A 2FWWA 1ACBE 4GPGA 1PPZA 3BTQE 5T6GA 2GCHG 2A7JA 3BTGE 4X6OA 4KTUA 1BRCE 3L6PA 3TH3H 1HFDA 4XFQA 2G4TA 1VGCB 2DE8A 1DWDH 3D65E 1UTKA 4WVPE 1HXFH 4WXVA 1MQ5A 1O3JA 4NIVA 1B7XB 2CGAA 2ZGCA 3DA9B 5HM9A 1AVGH 1QA0A 2GV7A 2XC0A 1N8OB 2BTCE 4ABAA 3BSQA 1M9UA 2G8TA 3BTEE 4D7FA 5AF9H 1TABE 1A5HA 3UTUH 1O3HA 3GY6A 1UVSH 4LK4A 1S82A 1GJDB 1A46H 3DFJA 3GY8A 1A4WH 1RIWC 4OS4A 1VITG 1LPKB 1ZMNA 2ZCLP 3AVZA 1AB9C 1F0SA 4IMZA 3S7HB 1O2ZA 1ETRH 1ZJKA 3O8RA 1GVZA 2EI8A 2SGFE 2Y6TA 2ZQ2A 2GD4B 4X1PU 2TGPZ 1WYKA 3KN2A 1LHEH 1TGNA 4HFPB 1AD8H 2OQUA 1ZTLA 4NSYA 2BDIA 1C1QA 1TONA 1MKXK 2ANYA 1C4Y2 4INKA 3BEFB 3G01A 2P59A 1WBGB 4A6LA 4BAHB 1O5DH 1D3DB 1BRBE 1GBTA 3SU0A 1IQHA 1YPJH 4X1SU 5F8TA 3SJKA 4OS2A 1KXDA 2QXJA 2SGDE 3MNCA 4BTUB 1ZYOA 4O3TA 3PO1B 1S84A 1BJUA 2C8YB 3E0NB 2SNWA 4K1TA 4BXWA 1BDAA 1GI1A 2ZDMA 2H9TH 2Q1JA 5LGOA 1BTWA 4I8KA 3QDZB 1Y3UA 3RXBA 2WPLS 3A88A 2OC0A 2G51A 4ABGA 3MHWU 4MNXA 1TX6A 1GGDB 1QTFA 2AIQA 1G36A 3KF2A 1DXPA 2FOBA 2ZHQH 2BX4A 1GBMA 3GCNA 4X1QU 1ZSLA 1GHZA 3PM3A 1MKWH 1O31A 1J16A 4IC5A 1NRQH 1SLXB 1O37A 2A7HA 3TGKE 9ESTA 1HAIH 1O3DA 2QY0B 4J2YB 2JETC 2A5AA 4AFQA 1LHCH 3LGIA 1SFQB 2Y5HA 3UNQA 1FY3A 2BLVA 2PUQH 2H9EH 3VGCB 1GBKA 3KQCA 3RXIA 1ESTA 2ZGJA 2H9HA 1XX9A 2NU4E 5F03A 1O2UA 4MPWA 1AWHB 1MKWK 1C2MA 1OP0A 3QZQA 1XKAC 1O2HA 1DICA 3SV7A 1ZTKA 2F9OA 1QBOA 2BHGA 3ATKA 3T2NA 1O2SA 3GDVA 1O34A 2A4GA 3RXTA 3F9HA 2CV3A 1GJ9B 3A81A 3DHKH 3QO6A 2R0LA 1UVPA 4K1EA 1KXCA 4F4OC 2ZHEH 1MH0A 2WPJS 2FLRH 4MTBA 2ZGBH 3ZVEA 4BXSA 1S83A 2ZZUH 2QAAA 2AMPA 2GCHF 2J4IA 3UWIA 5JBBS 2PSYA 4D7GA 2GDEH 3GDUA 2Y82A 2AMDA 3QUMP 1HAVA 4BOHA 4CRBA 3CS7A 5EQSA 2BY6X 2FESH 5L6NH 1ELTA 5AVDA 2QXIA 2VVUA 1EPTC 1SC8U 1XKBC 1G2MA 1TGCA 4I32A 4Y8YA 3VXEH 3LJJA 2OC7A 1YLCA 2IJOB 1ID5H 3T5FH 3U69H 3GY7A 1YCPK 1UTJA 5T6FA 4MVNA 4Y79A 1KY9A 3RM2H 3PYHA 4D9QA 1ZGVA 8LPRA 1TLDA 4GAWA 3OX7U 1EXFA 3ZZ4A 1EJNA 1MCTA 2F9UA 1BTUA 2A1DB 4K69A 2CN0H 4NSVA 4E7NA 8KME2 1O2PA 2OINA 4E05H 3UR6A 4GHQA 4B74A 1Y5AT 2A2QH 2F9NA 3SNBA 4BAKB 4A7IB 1P12E 1NFYA 1NZQH 1SOZA 3TNSA 1UCYK 3ENSB 2P3FH 1QJ1B 1T7CA 1NO9H 3QZRA 5A8XA 1P01A 2AERH 1VJAU 1TA2A 4JK5A 1O2NA 4CRDA 2Q6FA 1GJ6A 1VZQH 3SGAE 3A84A 2ANMH 4CR5A 1SQTA 4NWLA 5DG6A 1L1JA 1BA8B 4NWKA 1XUFA 3UR9A 5A0BA 2P93A 1OWKA 1BRAA 1LO6A 3SNDA 3ZZBA 5FCRA 1A2CH 4JYVH 2AGGX 2GCTC 3RXGA 1WSSH 5GCHG 4X2VA 1GWAA 1GI9B 3P8FA 2ESTE 4AZ2B 2HGTH 3ZZ8A 1W14U 3P17H 1C4U2 2J38A 1VJ9U 1O2LA 5EQQA 1RD3B 2FI3E 4UFEH 2A4QA 1T4UH 2A0QB 1O3MA 5GWZA 1BTHH 4ZXYH 3D62A 1BCUH 2RDLA 1TPOA 5I25A 3TJUA 2RG3A 1K1JA 3GY5A 2OD3B 3A7TA 3I78A 4AORA 3SNAA 4FUFA 1D9IA 3SN8A 5EW1H 3FVFB 1GPZA 3GICB 1LPZB 1QNJA 1HAGE 2RA0A 4DW2U 1NT1A 1V2JT 3Q00A 3UQVA 1Z8GA 1C1WH 4IBLH 1KIGH 1GBBA 1ELEE 3LC3A 4RSPA 2G00A 1ZGIA 1SR5C 4JK6A 3BG4C 1P2JA 1THSH 1U6QA 2Y7XA 1KLJH 1TRYA 1O36A 1SBWA 3B23B 1V2KT 2XTTB 4YOJA 1W7GH 4O03A 2GV6A 1O3KA 1XXDA 2H2ZA 1UVTH 1P06A 3GCOA 3GCTF 1TB6H 4U30A 3KQBA 1O5AB 1THRH 3K6ZA 1O5CB 4ABDA 3UOUA 4OS1A 1GI8B 1FUJA 5IDKA 1GBHA 4IMQA 4Y7BA 4TWYA 2PV9B 1CHOF 1ANDA 1K22H 5GDSH 2SNVA 1SOTA 2R2WU 1E36B 3ZZ5A 2FI5E 4CRCA 2FTMA 1DDJA 1GBEA 1W0YH 2O9QA 4KKDA 4ZKSU 3RXKA 3M37A 1T8OA 4WH6A 3U9AH 4UFFH 2O8WA 3EAJA 4ZUHA 1ZZZA 3TK5A 4YT7H 1GBAA 2VH0A 3PO1C 3T62A 3UPEA 1LHFH 2FM2A 3EYDA 3GYLB 4AG1A 1BBRK 2WINI 3TPIZ 4AX9H 4Y7AA 1HCGA 2ZF0H 3T29A 5I46H 1P3EA 1O3BA 2VIDA 3MMGA 3EQ0H 4I8LA 1DLEA 1F0TA 3MNBA 3BEUA 1F5RA 1OYQA 3MO6A 1ARBA 1TOMH 1CE5A 4MG3A 1ANBA 1F7ZA 1SGFG 1GI3A 2R9PA 1C2IA 5C2ZA 2ZTYA 3PWCA 3AAVA 1A5GH 3A80A 4NA9H 2FOAA 3UFAA 1W0ZU 3KHVA 4X0WU 2BD9A 8GCHF 5DJ7A 1ANEA 1D6RA 4B2CA 6ESTA 5DKMA 2ZPQA 2FO9A
chains in the Genus database with same CATH superfamily
2FP7B 4ZROA 2M2AA 1O2KA 2ALPA 1W10U 1A7SA 1NBMD 3LH3A 2OQ5A 1DPOA 1V2OT 3BTKE 3SNCA 1OPHB 1FY4A 2F4LA 2PTCE 5E2OA 3RDZA 2FLBH 2GDDA 1F0UA 2J2UA 2ODPA 1C9TA 2VH6A 5C0UA 1QFKH 1HGTH 3M3TA 3MO3A 1CGIE 1GMHF 1Y3YA 3SNEA 4B2AA 1DVAH 1C5UA 1DLKB 4TPYA 3WWBA 4DVAU 3R0FA 2L6OA 1G37A 1ESAA 5DP6A 1GCDA 2LP6A 2TGAA 2UUYA 4MNWA 3ZV9A 1P05A 1H8DH 4ABEA 1AWFH 4CHAB 1FIZA 2ZTZA 1TMBH 1TX8A 1EATA 3AASA 1CGHA 2SFAA 4WMFA 5GCHF 1IQNA 7ESTE 1C5NH 2BY8X 2QYIA 1A3BH 1LVMA 1TPPA 2STAE 3AW0A 2G5NA 1MBQA 1AU8A 1H9IE 2WPHS 1CHGA 3LJOA 1JXPA 3A83A 2BDHA 2IOTA 3LOXA 1GBLA 3Q3KA 3ODDA 2B9LA 1CA0B 1C4V2 1VCWA 1SQAA 1ZMJA 5E0GA 3T25A 1LVBA 3C27B 4FUCA 4Y8XA 1G30B 2H5DA 3M35A 1A1RA 1V2NT 1TE0A 4H6TA 3BG8A 1T8LA 2HWLB 3SU4A 1EZQA 1GI5A 4P00A 2XBVA 1TFXA 3ODFA 2GGVB 2ZPSA 4R8TB 1EB2A 2KFWA 1MTNC 2Q6GA 3W95A 3F6UH 5EXNA 3E0PB 2QF0A 2G52A 2WPIS 4INLA 2O8UA 1NY22 3GY2A 4INHA 1BQYA 3SI4H 3MH6A 1KLIH 1DS2E 1UMAH 2BD2A 4CHAC 5JBCS 2UUJB 1K1MA 5FCKA 5A0CA 1SGNE 1DE7H 1TRMA 2WUCA 3DFLA 1F92A 1O30A 2JJ1D 1SQRA 2QA9E 4Q2KA 4D9RA 3L3TA 1GDUA 2XXLA 4NZLA 1H1BA 1MAXA 4TWWA 1JIRA 4X8SH 4YXWD 5A2MH 1BUIA 3M5NA 3SU3A 3NWUA 1EPTA 2AIPA 1VCQA 1MU8B 3EDXB 1ZRBA 1KYNA 3KCGH 1C5RA 4K8BA 3PB1E 1ZLRA 2YNAA 1O3OA 5EJ1A 1XUIA 1BB0B 4LZ4B 1RTKA 2XC5A 2C4FH 4JZDH 2LNCA 4VGCB 5E2PA 3SO3A 1P9UA 1JIMA 2ZO3H 3TJNA 2M5TA 1C5OH 4JZ1A 1YY3A 1ZR0A 2G4UA 1MKXH 2KCYA 4TY6A 1XVMA 3HGNA 2I6SA 1ZSKA 5FX5A 1QL7A 1MTSA 3BIUH 4FU8A 1O2RA 1PPBH 3LGVA 2XYAA 3RU4D 3KGPA 5ABWA 2BVRH 3P6ZB 1O2TA 1XUKA 1C5TA 5ESTE 2F9PA 4F49A 3BTWE 5A09A 2C90B 1Z71A 2PLXA 5DP7A 4CBOA 1DX5M 3MU4A 2G5VA 5CHAC 1PQAA 2BDGA 5EGMA 1C5VA 1Z6JH 2CXVA 3GY3A 2D2DA 1OWJA 2ZHFH 3SW2B 1ZHMA 2RA3A 2HNTE 5B6LA 3LT3A 2RDEA 4Y71A 3VEQB 1DUEA 2K8IA 5HIYA 1UTLM 5TCAA 3ELAH 3FKSD 1NTPA 2ZKSA 4KELA 2VGCB 1ZPZA 1AN1E 1EAWA 1SGIB 1WOFA 2HVXA 1CSOE 3RXUA 3KYGA 1OP2A 1TPAE 1N1LA 3H7OA 3SGBE 2CF8H 2FMJA 1IOEA 3OY5U 3UOPA 2V3HH 2C93B 3PLBA 3SU5A 4WJG2 3Q3XA 3SUEA 3LKWA 2OCVB 3VB3A 4BAQB 3RXLA 2GCTB 4IN1A 3TVJB 1YPHC 4GLYA 2PKSB 2WPDD 1S0RA 4LXBH 2ZQ1A 4HTCH 1O5FH 4ABIA 1GI0A 2Y81A 2QXHA 4Z0KA 1K28D 1T32A 5BPEA 3OFND 1O33A 4K5ZA 4Z6AH 1WU1A 1J9CH 1MMJN 2ZFPH 3OSYA 1FIWA 2BMGB 3ZVBA 3SU1A 1UJ1A 3SQEE 1F0RA 3MOCA 3RMLH 3PRDA 3RMNH 3QN7A 1YPGH 1WAYB 4Q4LA 1RIWB 4DT7B 4DT4A 2GT8A 9LPRA 2VVCA 1EQ9A 1FN8A 4K1SA 3QTOH 3SUGA 1A0JA 2ZTXA 1WXRA 3T26A 5PTPA 2PHBA 1LPGB 2GVFA 3GOVB 4X6MA 5DK1A 1BOQA 1YKTA 3MU1A 1XMNB 1QBNA 4I8JA 1GI4A 1GHYH 4NG9H 3BTME 1GBJA 1SGRE 1YC0A 3V7TA 1PPEE 5C5OA 1PPHE 1GHBG 1SGCA 3SQHE 1DT2A 1UHBB 1FQ3A 3PLPA 5F8XA 3BEIB 3P8GA 1IAUA 2WSSD 2YOLA 3F9GA 3BF6H 2ZU2A 1ZRKA 1WUNH 4X8UH 1LVOA 2WZQA 1V2RT 4H4FA 5A0AE 4DY7B 3MH7A 5HYOA 2J34A 3P92A 2O8TA 1HAPH 1YYY1 1O3GA 3M5MA 3QK1A 2ZCHP 2B0FA 2IJD1 3K9XB 1O2GH 4ZKOU 2WV5A 2FOHA 5E0JA 1DFPA 1SHHB 2QF3A 4A1XA 1O35A 3BG4B 1O3CA 1FPHH 1S6LA 4JYUH 2PSXA 2BY7X 3PMAB 1VCPA 3LGWA 2R2MB 2VIVA 4OS5A 1O3NA 3IG6B 3A85A 3Q77A 1FY5A 2XOKD 3A87A 3U8TH 4X1RU 1BTZA 2PKAB 2ZDLA 1SGPE 1HIAB 1BTXA 3RXJA 1OSSA 3RXVA 2AFQB 1Q3XA 5FBIA 5F8ZA 1E79D 4Y10E 1T4VH 5C1XA 4AB8A 1G3DA 3M5OA 2F3CE 1O0DH 1GDNA 1LVYA 3A7WA 1GG6B 3WY8A 1HAOH 2D1JA 1NRSH 2GMTB 4CH2B 2AHME 1O32A 2ZHWH 3F1SB 4X6PA 3SJ8A 3LU9B 3BIVH 1ESBA 1CBWB 1NRRH 1P2KA 1K0HA 1WTHD 1Z6EA 5A8YA 4IN2A 3TH2H 1NU9A 1LTOA 3RXDA 4FUIA 1FMGA 1PPFE 4WWYA 1EZUC 1XUJA 1ELFA 2ZU1A 3ITIA 5EPYA 1SGQE 1Z1IA 2KZ4A 1GMHG 4WXIA 5EQRA 2BB4A 2TPIZ 2FXRA 3EA9A 2H1UA 4DG4A 1G3BA 3MH4A 1BIOA 3MTYA 1HJ8A 2BY9X 2ZU3A 3ZYEA 1KLTA 1O2JA 2BD5A 3ATMA 2B8OH 4WF8A 1QGFA 1MABB 3ZZ7A 1ZSJA 1AO5A 1QCPA 1ORFA 3TH4H 3C1KA 2ZDVH 2F91A 3A7XA 2BXUH 2TGDA 1CO7E 5JB9S 1C1NA 1K1PA 2SGEE 1DY8A 2VJ1A 1MUEB 1O5GH 4FU7A 3UAIC 4AB9A 1O38A 1C2FA 3ZZCA 3P8OA 3SZEA 1T8MA 3SU6A 2WYJA 3SZNA 2W6ID 1AZZA 2G81E 1C9PA 1CBWC 1LHDH 3GDSA 1G2LA 2ZG0H 1WQVH 8ESTE 2VBCA 2VIQA 4I8GA 3TGIE 1B0FA 1EFRD 3TNTA 1MD8A 2A31A 1AFEH 4XBCA 2IN2A 1G32B 2Z3EA 1HB0B 3EA7A 2Z9KA 4SGAE 5HGGA 2JIZD 1K1NA 3RXSA 1O2MA 1LCYA 4BAOB 1GHWH 3KNXA 5DP8A 1VGCC 1AVXA 1TAWA 2QE7D 4I33A 3V13A 7GCHG 1CHOG 5DP3A 4B2BA 3DSOA 1BMMH 3VB7A 4E7RG 4NCYA 1LMWB 1C1TA 1EOLA 3V0XA 1P09A 3GCTG 3ZIAD 4FVDA 2W7SA 2OC8A 3N7OA 4K2YA 1OWHA 1AKSA 3D23A 1RS0A 1D6WA 1V3XA 3GS9A 3TU7H 3S9CA 1TNLA 5EXMA 1GMDG 3KL6A 1P04A 3LC5A 5B6OA 1HBTH 1HDTH 1UK4A 1BT7A 1YPLH 3AK5A 1QJ6B 2BM2A 1PYTD 5GPIB 2Z9JA 1YLDA 3HGPA 1C5YB 2AYWA 1FONA 2KCAA 2BX3A 1QL9A 1AE5A 4BAMB 4X6NA 1AMHA 3PRBA 2BDBA 1YM0A 1QA7A 2EY4C 2SGQE 4WY3A 4YZUA 1C2EA 4ABBA 1FI8A 1UO6A 1GG6C 5HXFA 1AZ8A 4AN7A 1Z8RA 4F48B 3TITA 2WHXA 4Q7XA 4AGJA 3A7YA 5KECA 2HLDD 1K9OE 4FUBA 4UE7H 2ZA5A 3A82A 1LHGH 1J17T 4UEHH 5LPEA 2JDID 1GBCA 3E6PH 4HZHA 2J98B 3OY6U 1V2ST 4Q7YA 4YLQH 2WPKS 4CRFA 3SJIA 1O3FA 1GGDC 1Y5BT 1MCVA 4KGAA 2VGCC 2H6MA 3UUZA 5HIZA 4X8TH 1O2XA 4TYDA 1P11E 3IITA 2V3MA 3PWBA 5CDFE 4U32A 1OWDA 1EPTB 1KDQA 1E1QD 3E1XB 4SGBE 6GCHG 2ZDAH 5IYTA 1BMAA 4ASUD 2XC4A 2ZFTA 1SQOA 4JMYA 3LPRA 2EEKA 3QWCH 3RLYH 1EZSC 1UTMA 1QBVH 5C3NA 1JMOH 2UWLA 1T31A 5A8ZA 1P3CA 1Y3XA 1UTPA 2EI7A 3VB6A 4NGAH 1ZHPA 1EP5A 3S0NA 1KTTB 1KXBA 4RN6A 4LZ1H 1HRTH 4LOYH 4Y6DA 6GCHF 2CHAB 3OTPA 4VGCC 3MFJA 3SU2A 2C8ZB 2EC9H 4ESTE 2ALVA 4ZHAA 1FXYA 1L1NA 2P8OB 1PQ5A 1SFIA 1V2WT 3LONA 2QF4A 3SUDA 3VB4A 2FPZA 2BD3A 3W94A 1MAYA 1K21H 3E3TA 1LDTT 2ZNKH 5C20A 1QL8A 3RP2A 1S85A 5ESBA 3L33A 2ZI2H 1AFQC 3F68H 3M7QA 3IWMA 2AH4X 2BY5X 4E06H 5HMAA 4OGXA 1V6DA 3I77A 4BANB 1C5SA 3A86A 1WQSA 4QT8C 2HVYB 4X8VH 3RXCA 5HM2A 2OUAA 3V3MA 4UD9H 3TGJE 2ZWLH 1L4ZA 1YPHE 3B9FH 3HKJB 4NIWA 3NXPA 1EJAA 1HJ9A 2FI4E 3FZDA 1N8OC 2BVXH 2CHAC 5TCCA 2XNDD 4JZEH 1UTNA 3P70B 3ATIA 2PKSC 2UWOA 1Q2WA 4MPUA 4OGYA 1MTNB 4MDSA 1BJVA 1GBDA 4O9VA 1DWEH 2ILNA 2UWPA 2VINA 2LPRA 1NC6A 2R0KA 1GJ5H 3Q76A 1AKSB 3HK6B 4ABHA 3MU0A 5CMXH 2RFKC 3MWIU 5F6MA 1V2VT 4YM9A 1INCA 2QC2A 5EU8A 1FJSA 2QN5T 1GCTB 2OC1A 3EE0B 1OWEA 1HV7A 1NS3A 3M3SA 2YNBA 1AI8H 4Z1MD 3TK9A 4ISNA 1QRXA 1IQMA 1KMHB 3PMHB 1G9IE 1UHBA 1D3PB 1W11U 4XSKU 3UY9A 2ZFFH 4KTSA 1O2OA 1J8AA 5DPAA 2B7DH 3ZYDA 1RGQA 4XE4A 4DURA 1EB1H 5DGJA 1GMCF 3A8CA 4MPXA 3WWFA 2FOEA 1PJPA 4HI3A 1C2JA 2ZDNA 1GJBB 3H09A 4TY7A 3R3GB 1NU7B 2NU1E 5FPSA 1WCZA 1W7XH 1B5GH 3M61U 1WV7H 2V7QD 1GDQA 3ATWA 1GHVH 3NK8A 4NIXA 2ANWA 3K2UA 2BQ6B 2GZ9A 1SSXA 5C1YA 3O8DA 1OHHD 2XWAA 1EZXC 2OBOA 5GXPA 1ETSH 1O3AA 3RXHA 1SMFE 1JOUB 3URDA 4B75A 4MPVA 1J14A 1FNIA 2ZCKP 2GZ8A 4TSFD 4AYVB 4KTCA 4WMEA 1GCTC 2W3KA 3JZ2B 1C2DA 3RM0H 1QIXB 4KP0A 1F2SE 1GJ8B 1O39A 3BN9A 5CHBA 1TGTA 2ZDKA 2TBSA 4P02A 1SVPA 5T6DA 6CHAC 3SJ9A 2O8MA 1SGDE 4NZQA 2NU0E 2DUCA 3I29A 3SI3H 1Z8JB 1HAYB 5C17A 3B8JA 1QURH 1EASA 3PV5A 4ZAEA 1HLTH 1ELBA 2FOGA 4A1TA 1RXPA 5JBAS 1H9LB 3ZVCA 3FP8E 3RMOH 2F43B 3SBKA 1LKAA 1P2OA 1A5IA 1C2GA 2KR7A 1P9SA 2OTVA 3HK3B 1N6XA 4CH8B 3PLKA 2R3UA 3TIUA 5JPMH 1BHXB 1TBQH 3MU5A 1FAKH 4XDEA 4BTTB 2YMSB 1LQEA 3DT0H 2FOFA 1GI6A 4ISLA 2VWOA 4RKOB 2ZEBA 1UCYE 1FY1A 1K1IA 3PMBB 1N6YA 1DM4B 4ISHH 3GCHC 1JWTA 1IHTH 1C1RA 1TNKA 2FDAA 1ZPCA 3U1JB 1PQ8A 3OEED 2J5UA 1SPJA 3ZZ3A 2A4OA 1UK3A 2VU8E 1MD7A 4MNVA 2BVSH 1P02A 5EJZA 3UWJH 3O8CA 3P8NA 2FS9A 4OS7A 1KXAA 1WDIA 1YF4A 3A8BA 2VWLA 3NZIA 4IC6A 2BZAA 2FEQH 2ZFRH 1TMTH 3FOAA 5L30H 2ZHDA 1FPCH 3LDXH 4IGDA 4ZKRU 1GL0E 1IQGA 2A45B 3FANA 4BNRA 3TJOA 4YTAA 2EA3A 1BRUP 1SG8B 2PFEA 3STJA 4X2YA 4JYTA 2WUBA 4J1YA 4M9FA 4ABFA 5JBTA 4B76A 5GIBA 3CENA 1QQUA 2TIOA 5LPRA 3QGNB 1OOKB 2W5EA 2Z9IA 2A32A 2TGTA 2GJGA 3S69A 2Y7ZA 1V2QT 1ARCA 1FZZA 2KAIA 1AB9B 3A7VA 4MQAA 1TNHA 1ETTH 1P0SH 2OP9A 2WYGA 3ZVGA 3RXEA 4UFGH 2GT7A 4DGJA 5T3HA 2FYQA 3EA8A 5CE1A 3HATH 1FLEE 2JJ2D 3LGTA 4B6FA 3KYFA 4OS6A 1GHBF 3LGYA 2PTNA 3NKKA 4CBNA 4ZHLU 1W3CA 1EP6A 4H42U 4NIYA 1DY9A 2Z6BD 3TJVA 1O2QA 1BTYA 1O3IA 4U01A 1DXWA 1SHYA 1YPMH 5ETXA 2OK5A 3KIDU 1O5EH 1GI2A 4YOIA 2PWXA 3RMMH 3ZZ9A 1UCYH 1C2KA 2JH0D 1P8VC 3SHAH 2OXSA 2V35A 4ZKNU 1QB6A 1DWCH 2PR3A 2V6NA 2F83A 4K8YA 3RC5A 4ASHA 1PPGE 3FZZA 1ZPBA 4B1TA 1Z7KA 1HAVB 1W2KH 2BQ7B 1HJAC 4FUDA 1C2HA 4TT3D 2STBE 3Q3YA 1XM1A 1UK2A 3K6YA 3SHCH 2AS9A 1YBWA 4X1NU 1LQDB 1CU1A 3MH5A 1GBFA 1OP8A 4X2XA 2VIWA 4I31A 1SKYE 1JBUH 4NA8A 2YMSC 3BTHE 3M5LA 4CRGA 3EE7A 1SGFA 2LELA 2XW9A 5TJXA 1NPMA 3ATLA 2PW8H 2WV9A 5C5NA 1AUJA 1AUTC 1YCPM 2FZZA 1PFXC 1TALA 2JETB 1H4WA 4DIHH 1KSNA 5LH8A 1OYTH 1Z1JA 2JKHA 2VWNA 5J4QA 5SGAE 2FX4A 1P2NA 3GYMA 1TQ7B 3FAOA 4WH8A 1S81A 2W7UA 2HLCA 3MNSA 2FTLE 1AY6H 4CRAA 1TPSA 2XRCA 3A7ZA 3RC4A 3QLPH 2HOBA 3DSGA 3OYPA 2QCYA 2BDCA 3M36A 1BZXE 5LPFA 1BMNH 1AHTH 2VVVA 2HPQH 1BTPA 1S6HA 5G4BA 1MZAA 1MTUA 1A61H 2BZ6H 1IQKA 4B73A 1FY8E 1TGBA 1P10A 1BMLA 2XBYA 4JZIA 3RXRA 1C1UH 2BDAA 2D26C 1ELAA 2OBQA 1CA8B 3V12A 2XBWA 2BYAX 2BLQA 1SGTA 3A8AA 4AG2A 1C1PA 4GCHG 2WPMS 1QB9A 1ABIH 2VIPA 4ZXXH 1F5LA 1RTLA 4XBDA 5IK2D 1AIXH 2W26A 1DSTA 5EJLA 5FX6A 2FODA 1BHXF 4FUGA 2A4RA 1DOJA 2HNTF 3U1IB 2VNTA 2FX6A 1GBIA 2AGIX 2J97A 5AFYH 1YPEH 5J4SA 1HAXB 2SGAA 4YT6H 2VIOA 1AVWA 3ZVAA 2HALA 1E37B 3S7KB 3HPTB 3NRLA 4A1VA 3N99A 5JYIA 4Y8ZA 1UTOA 3ESTA 1VITF 1GJCB 1TNGA 5FXLA 3SV6A 3RXFA 3F3BA 4I86A 1GHXH 3BTFE 2NU2E 1PYTC 2P94A 4Q80A 1C1MA 1RFNA 3LH1A 2FYRA 3QTVH 4ZHMU 3MI4A 1AFQB 1A0LA 1YLNA 5AHGH 1C5PA 2JH6D 4ISOA 1SL3A 1FV9A 1V2TT 4CREA 2XBXA 1KTSB 2SGPE 3UNSA 1BITA 1QY6A 3ZZ6A 1UTQA 2NU3E 2RCEA 3CP7A 4U2WA 3D49H 2EI6A 1NFWA 1TBRH 2EQNA 3F0OA 4Q7ZA 2A7CA 5DSFA 3U8OH 2ZGXH 2QIQA 1TX7A 1MQ6A 1ELDE 1GVKB 3CS0A 2UUFB 3AAUA 3TLOA 1EKBB 2BOHB 2HPPH 4IW4E 1C5LH 1QB1A 4IS5A 2GX4A 3VG8A 5E8EH 2I6QA 3SUFA 2KAIB 3F2GA 1SB1H 1Y8TA 4OM9A 4YO9A 3GY4A 1GVLA 4O3UA 4BTIB 2BQWB 3MO9A 5E0HA 3UIRA 4F55A 3MU8A 1HJAB 1SLWB 4MLFB 3ZVDA 1TMUH 1HIAA 1Y59T 4XBBA 1K2I1 3PTBA 4RKJB 4AOQA 3QGJA 1OWIA 1AGJA 2KM0A 1MTWA 3TK6A 2YMSD 4AYYB 3ZVFA 3M7TA 7LPRA 1GL1A 1HUTH 4D76A 2ODQA 1C2LA 2R3YA 4AFSA 1H9HE 1RTFB 3VPKA 1C5QA 2HRVA 2H5CA 1QRWA 1C1OA 4FUHA 4RT1A 5EW2H 4A92A 2C3SA 1SGYE 2B5TB 1V2PT 3MNXA 1MBMA 5L2YH 1MTVA 1HYLA 3DCLA 1Y3WA 3ZZDA 3ZZAA 1MU6B 2XNIA 1NN6A 2J95A 3F9EA 4UONA 2AMQA 1VR1H 2BD8A 3E91A 2F9BH 3M3VA 4XOJA 1CT0E 3F0PA 3MYWA 1HAHH 2P3UB 1SLVB 1F5KU 1DUAA 4H6SB 1P2IA 4DIIH 4K3JA 2J92A 2Y5FA 3T28A 3SJOA 2D8WA 2THFB 1QJ7B 1EUFA 2FS8A 2ULLA 1H8ED 1YPKH 2ZFSA 4XRNA 1NFXA 1P2QA 1ZOMA 1V2MT 2Z3DA 5K7RA 2Z3CA 1W8BH 1BMFD 3BV9B 2PP6A 5F53A 4ISIH 1TIOA 1YCPH 3UQOA 3RLWH 5C67A 2Y80A 1UVUH 1P57B 2PGQB 4UFDH 1E38B 1HAZB 5JB8S 3OTJE 5DO4H 1TYNA 4O97A 2FOCA 1NRNH 1RRKA 2GP9B 2ZGHA 1ABJH 3N7DA 1AE8H 5EOKA 2AEIH 2C8XB 2GKVE 1E0FD 1ELCA 2ZU4A 3KEEA 3STIA 3NUMA 5EPNA 4FUEA 2ANKH 3PROA 3VGCC 4RI0A 2FOMB 1ZTJA 2PKAA 5EG4A 1ZJDA 4R0IA 3P95A 3SYJA 1BBRH 1GI7B 4Y0ZE 1W13U 3RU4E 7KMEH 2CF9H 1K1OA 4NA7A 1NROH 5AFZH 1HPGA 1TRNA 1CVWH 4Y0YE 5L2ZH 6CHAB 2P16A 2NWNA 1GJAB 2ZU5A 4CR9A 1HXEH 4GCHF 1C5ZB 1EOJA 3A89A 2VWMA 1E1RD 3RU4T 4DCDA 4THNH 5EIYA 2KCPA 2WV4A 3M7UA 3RXPA 3HKIB 3SV9A 1CT4E 2TRMA 4DJZB 1EAUA 1W12U 4Y11E 2G55A 2K0QA 1XXFA 2BD4A 3FO8D 1KXEA 1YP9A 1QR3E 1DITH 1OX1A 1CQQA 2Y5GA 5FPYA 2GZ7A 1S5SA 2ODYB 1TOCB 1C1VH 1DWBH 1TNIA 1Q31A 1O5BB 2BDYA 4A5TS 4GUXA 1ELGA 5H4IB 4D8NA 2AGEX 3E90B 2A5IA 1FDPA 1BBRE 2P3TB 4GSOA 1QRZA 2QF5A 4K60A 3KQEA 2XCNA 1GMCG 1A0HB 2VB0A 3U98H 1T8NA 3BTTE 2ZP0H 1B0EA 3KQDA 1L1GA 1E35B 1GJ4H 2ASUB 4YESB 1NRPH 1O2YA 2CJIA 4ABJA 2UUKB 1JRTA 3QX5H 1G3CA 1L0ZA 1GMDF 3H7TA 4FETA 5DN6D 2P95A 3GISB 1QQ4A 1OKXA 2XCFA 3RXQA 4X2WA 1YGCH 1IQIA 1TBZH 1Y5UT 1SLUB 1NBME 1NM6A 4I8HA 3RXAA 1E34B 5KGOA 2QV1A 3RXOA 2Q6DA 7GCHF 1SGEE 1ZHRA 1J15A 4GHTA 4HG6A 4ZH8A 2J98A 1C5XB 1K1LA 1NFUA 1TGSZ 2GTBA 2HNTC 1OXGA 3URCA 2J94A 3PMJA 2BOKA 2W6JD 1GHAG 1FN6A 6LPRA 1VKYA 1S6FA 5FAHA 1C5MD 3E16B 4YOGA 1FAXA 3LIWA 1ZMLA 1THPB 5EXLA 1EAXA 1TA6A 1IHSH 1V2UT 3GCHB 1O2VA 1QZ8A 3NPSA 3OE7D 4UDWH 1P03A 4FU9A 2QGRA 5CHAB 2FIRH 4AGKA 1XUHA 3K65B 1Z8IB 2ZIQH 4TPIZ 3SOSA 1O2IA 1WTGH 2V0BA 1AQ7A 2DE9A 5DP4A 1DANH 1C5WB 2JH5D 5C1UA 3UB0A 2IPHA 1CA0C 1W0JD 1IQJA 1JRSA 1O3LA 4MNYA 4B6EA 1MZDA 1EJMA 2PGBB 4ACAA 1O3EA 4GVUA 5EODA 1H8IH 2BLWA 2V3OH 3PTNA 3OU0A 2F9VA 1Y3VA 3FFGA 4JZFH 1PPCE 2CMYA 3NCLA 1SI5H 2P8OC 4YLUA 1CGJE 4WMDA 4HGCA 5JDUB 1CT2E 8GCHG 1NESE 1L2EA 2ZFQH 1XVOA 2Z7FE 1DSUA 3S9BA 2Z9LA 2A2XH 2K1QA 3MQKC 1RJXB 3FP6E 4AFUA 2ZPRA 3VXFH 5DP9A 1HNEE 1LKBA 2BLOA 3PV4A 3SV2H 1V2LT 3E8LA 3RC6A 3AW1A 1KXFA 1IQEA 1GHAF 3ZV8A 1A3EH 4PROA 3JZ1B 1EX3A 5FPTA 3EGKH 1ELVA 2QXGA 4NFFA 4I7YH 1TWXB 3RUOA 4NFEA 4ZMAH 5FBEA 4ZCNA 3UNRA 3RXMA 2OLGA 1C1SA 3CNRA 1L4DA 4FUJA 3VFEA 1P2MA 3F2HA 3T27A 3S9AA 3U8RH 1QHRB 2J9NA 5GJ4B 1PQ7A 2A5KA 2C8WB 2GMTC 2O8LA 1S0QA 1X7AC 2PUXB 2ZECA 3O8BA 1VITH 1D4PB 1UVOA 3SV8A 3UREA 1IQLA 3F2FA 1GJ7B 3FP7E 1IQFA 1D3QB 5FHTA 2Z9GA 3A8DA 2Z94A 3H5CB 5BRRE 1OS8A 2W3IA 1EAIA 3SORA 4M7GA 4DOQA 4FVBA 3F9FA 2ZC9H 1O3PB 4Y76A 3DD2H 1O2WA 4FXGH 1G3EA 3DUXH 4AFZA 4JCNA 2XWBI 1D3TB 1XUGA 3BTDE 5K0HA 1TNJA 4B71A 1KDQB 3VB5A 3LGUA 3SGQE 1TQ0B 1ANCA 5GNDA 2BD7A 2BXTH 5DP5A 2FWWA 1ACBE 4GPGA 1PPZA 3BTQE 5T6GA 2GCHG 2A7JA 3BTGE 4X6OA 4KTUA 1BRCE 3L6PA 3TH3H 1HFDA 4XFQA 2G4TA 1VGCB 2DE8A 1DWDH 3D65E 1UTKA 4WVPE 1HXFH 4WXVA 1MQ5A 1O3JA 4NIVA 1B7XB 2CGAA 2ZGCA 3DA9B 5HM9A 1AVGH 1QA0A 2GV7A 2XC0A 1N8OB 2BTCE 4ABAA 3BSQA 1M9UA 2G8TA 3BTEE 4D7FA 5AF9H 1TABE 1A5HA 3UTUH 1O3HA 3GY6A 1UVSH 4LK4A 1S82A 1GJDB 1A46H 3DFJA 3GY8A 1A4WH 1RIWC 4OS4A 1VITG 1LPKB 1ZMNA 2ZCLP 3AVZA 1AB9C 1F0SA 4IMZA 3S7HB 1O2ZA 1ETRH 1ZJKA 4XD7D 3O8RA 1GVZA 2EI8A 2SGFE 4Q63A 2Y6TA 2ZQ2A 2GD4B 4X1PU 2TGPZ 1WYKA 3KN2A 1LHEH 1TGNA 4HFPB 1AD8H 2OQUA 5T1VA 1ZTLA 4NSYA 2BDIA 1C1QA 1TONA 1MKXK 2ANYA 1C4Y2 4INKA 3BEFB 3G01A 2P59A 1WBGB 3WW7A 4A6LA 4BAHB 1O5DH 3OEHD 1D3DB 1BRBE 1GBTA 3SU0A 1IQHA 1YPJH 4X1SU 5F8TA 3SJKA 4OS2A 1KXDA 2QXJA 2SGDE 3MNCA 4BTUB 1ZYOA 5C94A 4O3TA 3PO1B 1S84A 1BJUA 2C8YB 3E0NB 2SNWA 4K1TA 4BXWA 1BDAA 1GI1A 2ZDMA 2H9TH 2Q1JA 1W0KD 5LGOA 1BTWA 4I8KA 3QDZB 1Y3UA 3RXBA 2WPLS 3A88A 2OC0A 2G51A 4ABGA 3MHWU 4MNXA 1TX6A 2IPQX 1GGDB 1QTFA 2AIQA 1G36A 3KF2A 1DXPA 2FOBA 2ZHQH 2BX4A 1GBMA 3GCNA 4X1QU 1ZSLA 1GHZA 3PM3A 1MKWH 1O31A 1J16A 4IC5A 1NRQH 1SLXB 1O37A 2A7HA 3TGKE 9ESTA 1HAIH 1O3DA 2QY0B 4J2YB 2JETC 2A5AA 4AFQA 1LHCH 3LGIA 1SFQB 2Y5HA 3UNQA 1FY3A 2BLVA 2PUQH 2H9EH 3VGCB 1GBKA 3KQCA 3RXIA 1ESTA 2ZGJA 2H9HA 1XX9A 2NU4E 5F03A 1O2UA 4MPWA 1AWHB 1MKWK 1C2MA 1OP0A 3QZQA 1XKAC 1O2HA 1DICA 3U28C 3SV7A 1ZTKA 2F9OA 1QBOA 2BHGA 3ATKA 3T2NA 1COWD 1O2SA 3GDVA 1O34A 2A4GA 3RXTA 3F9HA 2CV3A 1GJ9B 3A81A 3DHKH 3QO6A 2R0LA 1UVPA 4K1EA 1KXCA 4F4OC 2ZHEH 1MH0A 2WPJS 2FLRH 4MTBA 2ZGBH 3ZVEA 4BXSA 1S83A 2ZZUH 2QAAA 2AMPA 2GCHF 2J4IA 3UWIA 5JBBS 2PSYA 4D7GA 3PV2A 2GDEH 3GDUA 2Y82A 2AMDA 3QUMP 1HAVA 4BOHA 4CRBA 3CS7A 5EQSA 2BY6X 2FESH 2KX4A 5L6NH 1FX0B 5C0TA 1ELTA 5AVDA 2QXIA 2VVUA 1EPTC 1SC8U 3N7EA 1XKBC 1G2MA 1TGCA 4I32A 4Y8YA 3VXEH 3LJJA 2OC7A 1YLCA 2IJOB 1ID5H 3T5FH 5FL7D 3U69H 3GY7A 1YCPK 1UTJA 5T6FA 4MVNA 4Y79A 1KY9A 3RM2H 3PYHA 4D9QA 1ZGVA 8LPRA 1TLDA 4GAWA 3OX7U 1EXFA 3ZZ4A 1EJNA 1MCTA 2F9UA 1BTUA 2A1DB 4K69A 2CN0H 4NSVA 4E7NA 8KME2 1O2PA 2OINA 4E05H 3UR6A 4GHQA 4B74A 1Y5AT 2A2QH 2F9NA 3SNBA 4BAKB 4A7IB 1P12E 1NFYA 1NZQH 1SOZA 3TNSA 5KEDA 1UCYK 1H8HD 3ENSB 2P3FH 1QJ1B 1T7CA 1NO9H 3QZRA 5A8XA 1P01A 2AERH 1VJAU 1TA2A 4JK5A 1O2NA 4CRDA 2Q6FA 1GJ6A 1VZQH 3SGAE 3A84A 2ANMH 4CR5A 1SQTA 4NWLA 5DG6A 1L1JA 1BA8B 4NWKA 1XUFA 3UR9A 5A0BA 2P93A 1OWKA 1BRAA 1LO6A 3SNDA 3ZZBA 5FCRA 1A2CH 4JYVH 2AGGX 2GCTC 3RXGA 1WSSH 5GCHG 4X2VA 1GWAA 1GI9B 3P8FA 2ESTE 4AZ2B 2HGTH 3ZZ8A 1W14U 3P17H 1C4U2 2J38A 1VJ9U 1O2LA 5EQQA 1RD3B 2FI3E 1UW7A 4UFEH 2A4QA 1T4UH 2A0QB 1O3MA 5GWZA 1BTHH 4ZXYH 3D62A 1BCUH 2RDLA 1TPOA 3W1EA 4FOUC 3TJUA 5I25A 2CK3D 2RG3A 1K1JA 3GY5A 2OD3B 3A7TA 3I78A 4AORA 3SNAA 4FUFA 1D9IA 3SN8A 5EW1H 3FVFB 1GPZA 3GICB 1LPZB 1QNJA 1HAGE 2RA0A 3DSPA 1NT1A 4DW2U 1V2JT 3Q00A 3UQVA 1Z8GA 1C1WH 3FN8A 4IBLH 1KIGH 1GBBA 1ELEE 3LC3A 4RSPA 2G00A 1ZGIA 1SR5C 2KCOA 4JK6A 3BG4C 1P2JA 1THSH 1U6QA 2Y7XA 1KLJH 1TRYA 1O36A 1SBWA 3B23B 1V2KT 2XTTB 4YOJA 1W7GH 4O03A 2GV6A 1O3KA 1XXDA 4RT0A 2H2ZA 1UVTH 1P06A 3GCOA 3GCTF 1TB6H 4U30A 3KQBA 1O5AB 1THRH 3K6ZA 1O5CB 4ABDA 3UOUA 4OS1A 1GI8B 4ACBA 1FUJA 5IDKA 1GBHA 4IMQA 4Y7BA 4TWYA 2PV9B 1CHOF 1ANDA 1K22H 5GDSH 2SNVA 1SOTA 2R2WU 1E36B 3ZZ5A 2FI5E 4CRCA 2FTMA 1DDJA 1GBEA 1W0YH 2O9QA 4KKDA 4ZKSU 3RXKA 3M37A 1T8OA 4WH6A 3U9AH 4UFFH 2O8WA 3EAJA 4ZUHA 1ZZZA 3KQ5A 3TK5A 4YT7H 1GBAA 2VH0A 3PO1C 3T62A 3UPEA 1LHFH 2FM2A 3EYDA 3GYLB 4AG1A 1BBRK 2WINI 3TPIZ 4AX9H 4Y7AA 1HCGA 1YWUA 2ZF0H 3T29A 5I46H 1P3EA 1O3BA 2VIDA 3MMGA 3EQ0H 4I8LA 4AC9A 1DLEA 1F0TA 3MNBA 3BEUA 1F5RA 1OYQA 2L74A 1ARBA 3MO6A 1TOMH 1CE5A 4MG3A 1ANBA 1F7ZA 1SGFG 1GI3A 2R9PA 1C2IA 5C2ZA 2ZTYA 3PWCA 3AAVA 1A5GH 3OAAD 3A80A 4NA9H 2FOAA 3UFAA 1W0ZU 3KHVA 4X0WU 2BD9A 8GCHF 5HKKD 5DJ7A 1ANEA 1D6RA 4B2CA 6ESTA 5DKMA 2ZPQA 2FO9A
chains in the Genus database with same CATH topology
2FP7B 4ZROA 1O2KA 2ALPA 1W10U 1A7SA 3LH3A 2OQ5A 1DPOA 1V2OT 3BTKE 3SNCA 1OPHB 1FY4A 2PTCE 5E2OA 3RDZA 2FLBH 2GDDA 1F0UA 2J2UA 2ODPA 1C9TA 2VH6A 1QFKH 1HGTH 3M3TA 3MO3A 1CGIE 1GMHF 1Y3YA 3SNEA 4B2AA 1DVAH 1C5UA 1DLKB 4TPYA 4DVAU 3R0FA 5DP6A 1G37A 1ESAA 1GCDA 2TGAA 2UUYA 4MNWA 3ZV9A 1P05A 1H8DH 4ABEA 1AWFH 4CHAB 1FIZA 2ZTZA 1TMBH 1TX8A 1EATA 3AASA 1CGHA 2SFAA 4WMFA 5GCHF 1IQNA 7ESTE 1C5NH 2BY8X 2QYIA 1A3BH 1LVMA 1TPPA 2STAE 3AW0A 2G5NA 1MBQA 1AU8A 1H9IE 2WPHS 1CHGA 3LJOA 1JXPA 3A83A 2BDHA 2IOTA 3LOXA 1GBLA 3Q3KA 3ODDA 2B9LA 1CA0B 1C4V2 1VCWA 1SQAA 1ZMJA 5E0GA 3T25A 1LVBA 3C27B 4FUCA 4Y8XA 1G30B 2H5DA 3M35A 1A1RA 1V2NT 1TE0A 4H6TA 3BG8A 1T8LA 2HWLB 3SU4A 1EZQA 1GI5A 2XBVA 1TFXA 3ODFA 2GGVB 2ZPSA 4R8TB 1EB2A 2Q6GA 1MTNC 3W95A 3F6UH 5EXNA 3E0PB 2QF0A 2G52A 2WPIS 4INLA 2O8UA 1NY22 3GY2A 4INHA 1BQYA 3SI4H 3MH6A 1KLIH 1DS2E 1UMAH 2BD2A 4CHAC 5JBCS 2UUJB 1K1MA 5FCKA 5A0CA 1SGNE 1DE7H 1TRMA 2WUCA 3DFLA 1F92A 1O30A 2QA9E 4Q2KA 4D9RA 3L3TA 1GDUA 2XXLA 4NZLA 1H1BA 1MAXA 4TWWA 1JIRA 4X8SH 5A2MH 1BUIA 3M5NA 3SU3A 3NWUA 1EPTA 2AIPA 1VCQA 1MU8B 3EDXB 1ZRBA 1KYNA 3KCGH 1C5RA 4K8BA 3PB1E 1ZLRA 2YNAA 1O3OA 1XUIA 1BB0B 4LZ4B 1RTKA 2XC5A 2C4FH 4JZDH 2LNCA 4VGCB 5E2PA 3SO3A 1P9UA 1JIMA 2ZO3H 3TJNA 2M5TA 1C5OH 4JZ1A 1ZR0A 2G4UA 1MKXH 4TY6A 1XVMA 3HGNA 2I6SA 1ZSKA 5FX5A 1QL7A 1MTSA 3BIUH 4FU8A 1O2RA 1PPBH 3LGVA 2XYAA 3RU4D 3KGPA 5ABWA 2BVRH 3P6ZB 1O2TA 1XUKA 1C5TA 5ESTE 2F9PA 4F49A 3BTWE 5A09A 2C90B 1Z71A 2PLXA 5DP7A 4CBOA 1DX5M 3MU4A 2G5VA 5CHAC 1PQAA 2BDGA 5EGMA 1C5VA 1Z6JH 2CXVA 3GY3A 2D2DA 1OWJA 2ZHFH 3SW2B 1ZHMA 2RA3A 2HNTE 3LT3A 4Y71A 3VEQB 1DUEA 1UTLM 5TCAA 3ELAH 1NTPA 2ZKSA 4KELA 2VGCB 1ZPZA 1AN1E 1EAWA 1SGIB 1WOFA 2HVXA 1CSOE 3RXUA 1OP2A 1TPAE 1N1LA 3H7OA 3SGBE 2CF8H 2FMJA 1IOEA 3OY5U 3UOPA 2V3HH 2C93B 3PLBA 3SU5A 4WJG2 3Q3XA 3SUEA 3LKWA 2OCVB 3VB3A 4BAQB 3RXLA 2GCTB 4IN1A 3TVJB 1YPHC 4GLYA 2PKSB 1S0RA 4LXBH 2ZQ1A 4HTCH 1O5FH 4ABIA 1GI0A 2Y81A 2QXHA 4Z0KA 1K28D 1T32A 5BPEA 1O33A 4K5ZA 4Z6AH 1WU1A 1J9CH 1MMJN 2ZFPH 3OSYA 1FIWA 2BMGB 3ZVBA 3SU1A 1UJ1A 3SQEE 1F0RA 3MOCA 3RMLH 3RMNH 3QN7A 1YPGH 1WAYB 1RIWB 4DT7B 2GT8A 9LPRA 2VVCA 1EQ9A 1FN8A 4K1SA 3QTOH 3SUGA 1A0JA 2ZTXA 3T26A 5PTPA 2PHBA 1LPGB 2GVFA 3GOVB 4X6MA 5DK1A 1BOQA 1YKTA 3MU1A 1XMNB 1QBNA 4I8JA 1GI4A 1GHYH 4NG9H 3BTME 1GBJA 1SGRE 1YC0A 3V7TA 1PPEE 5C5OA 1PPHE 1GHBG 1SGCA 3SQHE 1DT2A 1UHBB 1FQ3A 3PLPA 5F8XA 3BEIB 3P8GA 1IAUA 2YOLA 3F9GA 3BF6H 2ZU2A 1ZRKA 1WUNH 4X8UH 1LVOA 1V2RT 4H4FA 5A0AE 4DY7B 3MH7A 5HYOA 2J34A 3P92A 2O8TA 1HAPH 1YYY1 1O3GA 3M5MA 3QK1A 2ZCHP 2B0FA 3K9XB 1O2GH 4ZKOU 2WV5A 2FOHA 5E0JA 1DFPA 1SHHB 2QF3A 4A1XA 1O35A 3BG4B 1O3CA 1FPHH 4JYUH 2PSXA 2BY7X 3PMAB 1VCPA 3LGWA 2R2MB 2VIVA 4OS5A 1O3NA 3IG6B 3A85A 3Q77A 1FY5A 3A87A 3U8TH 4X1RU 1BTZA 2PKAB 2ZDLA 1SGPE 1HIAB 1BTXA 3RXJA 1OSSA 3RXVA 2AFQB 1Q3XA 5FBIA 5F8ZA 4Y10E 1T4VH 5C1XA 4AB8A 1G3DA 3M5OA 2F3CE 1O0DH 1GDNA 1LVYA 3A7WA 1GG6B 3WY8A 1HAOH 2D1JA 1NRSH 2GMTB 4CH2B 1O32A 2ZHWH 3F1SB 4X6PA 3SJ8A 3LU9B 3BIVH 1ESBA 1CBWB 1NRRH 1P2KA 1WTHD 1Z6EA 5A8YA 4IN2A 3TH2H 1NU9A 1LTOA 3RXDA 4FUIA 1FMGA 1PPFE 4WWYA 1EZUC 1XUJA 1ELFA 2ZU1A 3ITIA 5EPYA 1SGQE 1Z1IA 1GMHG 4WXIA 5EQRA 2BB4A 2TPIZ 2FXRA 3EA9A 2H1UA 4DG4A 1G3BA 3MH4A 1BIOA 3MTYA 1HJ8A 2BY9X 2ZU3A 3ZYEA 1KLTA 1O2JA 2BD5A 3ATMA 2B8OH 4WF8A 1QGFA 3ZZ7A 1ZSJA 1AO5A 1QCPA 1ORFA 3TH4H 3C1KA 2ZDVH 2F91A 3A7XA 2BXUH 2TGDA 1CO7E 5JB9S 2VJ1A 1C1NA 2SGEE 1K1PA 1DY8A 1MUEB 1O5GH 4FU7A 4AB9A 1O38A 1C2FA 3ZZCA 3P8OA 1T8MA 3SU6A 2WYJA 3SZNA 1AZZA 2G81E 1C9PA 1CBWC 1LHDH 3GDSA 1G2LA 2ZG0H 1WQVH 8ESTE 2VIQA 3TGIE 4I8GA 1B0FA 3TNTA 1MD8A 2A31A 1AFEH 4XBCA 2IN2A 1G32B 2Z3EA 1HB0B 3EA7A 2Z9KA 4SGAE 5HGGA 1K1NA 3RXSA 1O2MA 1LCYA 4BAOB 1GHWH 3KNXA 5DP8A 1VGCC 1AVXA 1TAWA 4I33A 3V13A 7GCHG 1CHOG 5DP3A 4B2BA 1BMMH 3VB7A 4E7RG 4NCYA 1LMWB 1C1TA 1EOLA 3V0XA 1P09A 3GCTG 4FVDA 2W7SA 2OC8A 3N7OA 4K2YA 1OWHA 1AKSA 3D23A 1RS0A 1D6WA 1V3XA 3TU7H 3S9CA 1TNLA 5EXMA 1GMDG 3KL6A 1P04A 3LC5A 5B6OA 1HBTH 1HDTH 1UK4A 1BT7A 1YPLH 1QJ6B 2BM2A 1PYTD 5GPIB 2Z9JA 1YLDA 3HGPA 1C5YB 2AYWA 1FONA 2BX3A 1QL9A 1AE5A 4BAMB 4X6NA 1AMHA 2BDBA 1YM0A 1QA7A 2SGQE 4WY3A 4YZUA 1C2EA 4ABBA 1FI8A 1UO6A 1GG6C 5HXFA 1AZ8A 4AN7A 1Z8RA 3TITA 4Q7XA 4AGJA 3A7YA 1K9OE 4FUBA 4UE7H 2ZA5A 3A82A 1LHGH 1J17T 4UEHH 5LPEA 1GBCA 3E6PH 4HZHA 3OY6U 1V2ST 4Q7YA 4YLQH 2WPKS 4CRFA 3SJIA 1O3FA 1GGDC 1Y5BT 1MCVA 4KGAA 2VGCC 2H6MA 3UUZA 4X8TH 1O2XA 4TYDA 1P11E 3IITA 3PWBA 4U32A 1OWDA 1EPTB 1KDQA 4SGBE 3E1XB 6GCHG 2ZDAH 5IYTA 1BMAA 2XC4A 2ZFTA 1SQOA 4JMYA 3LPRA 2EEKA 3QWCH 3RLYH 1EZSC 1UTMA 1QBVH 5C3NA 1JMOH 2UWLA 1T31A 5A8ZA 1P3CA 1Y3XA 1UTPA 2EI7A 3VB6A 4NGAH 1ZHPA 1EP5A 3S0NA 1KTTB 1KXBA 4RN6A 4LZ1H 1HRTH 4LOYH 4Y6DA 6GCHF 2CHAB 4VGCC 3MFJA 3SU2A 2C8ZB 2EC9H 4ESTE 2ALVA 4ZHAA 1FXYA 1L1NA 2P8OB 1PQ5A 1SFIA 1V2WT 3LONA 3SUDA 3VB4A 2FPZA 2BD3A 3W94A 1MAYA 1K21H 3E3TA 1LDTT 2ZNKH 5C20A 1QL8A 3RP2A 1S85A 5ESBA 3L33A 2ZI2H 1AFQC 3F68H 3M7QA 3IWMA 2AH4X 2BY5X 4E06H 5HMAA 4OGXA 1V6DA 3I77A 4BANB 1C5SA 3A86A 1WQSA 4QT8C 4X8VH 3RXCA 5HM2A 2OUAA 3V3MA 4UD9H 3TGJE 2ZWLH 1L4ZA 1YPHE 3B9FH 3HKJB 4NIWA 3NXPA 1EJAA 1HJ9A 2FI4E 3FZDA 1N8OC 2BVXH 2CHAC 5TCCA 4JZEH 1UTNA 3P70B 3ATIA 2PKSC 2UWOA 1Q2WA 4MPUA 4OGYA 1MTNB 4MDSA 1BJVA 1GBDA 4O9VA 1DWEH 2ILNA 2UWPA 2VINA 2LPRA 1NC6A 2R0KA 1GJ5H 3Q76A 1AKSB 3HK6B 4ABHA 3MU0A 5CMXH 3MWIU 5F6MA 1V2VT 4YM9A 1INCA 2QC2A 5EU8A 1FJSA 2QN5T 1GCTB 2OC1A 3EE0B 1OWEA 1HV7A 1NS3A 3M3SA 2YNBA 1AI8H 3TK9A 4ISNA 1QRXA 1IQMA 3PMHB 1G9IE 1UHBA 1D3PB 1W11U 4XSKU 3UY9A 2ZFFH 4KTSA 1O2OA 1J8AA 5DPAA 2B7DH 3ZYDA 1RGQA 4XE4A 4DURA 1EB1H 5DGJA 1GMCF 3A8CA 4MPXA 2FOEA 1PJPA 4HI3A 1C2JA 2ZDNA 1GJBB 4TY7A 3R3GB 1NU7B 2NU1E 5FPSA 1WCZA 1W7XH 1B5GH 3M61U 1WV7H 1GDQA 3ATWA 1GHVH 3NK8A 4NIXA 2ANWA 3K2UA 2BQ6B 2GZ9A 1SSXA 5C1YA 3O8DA 2XWAA 1EZXC 2OBOA 5GXPA 1ETSH 1O3AA 3RXHA 1SMFE 1JOUB 3URDA 4B75A 4MPVA 1J14A 1FNIA 2ZCKP 2GZ8A 4AYVB 4KTCA 4WMEA 1GCTC 2W3KA 3JZ2B 1C2DA 3RM0H 1QIXB 4KP0A 1F2SE 1GJ8B 1O39A 3BN9A 1TGTA 2ZDKA 2TBSA 5T6DA 1SVPA 6CHAC 3SJ9A 2O8MA 1SGDE 4NZQA 2NU0E 2DUCA 3I29A 3SI3H 1Z8JB 1HAYB 3B8JA 1QURH 1EASA 4ZAEA 1HLTH 1ELBA 2FOGA 4A1TA 1RXPA 5JBAS 1H9LB 3ZVCA 3FP8E 3RMOH 3SBKA 1LKAA 1P2OA 1A5IA 1C2GA 1P9SA 2OTVA 3HK3B 1N6XA 4CH8B 3PLKA 2R3UA 3TIUA 5JPMH 1BHXB 1TBQH 3MU5A 1FAKH 4XDEA 4BTTB 1LQEA 3DT0H 2FOFA 1GI6A 4ISLA 2VWOA 4RKOB 2ZEBA 1UCYE 1FY1A 1K1IA 3PMBB 1N6YA 1DM4B 4ISHH 3GCHC 1JWTA 1IHTH 1C1RA 1TNKA 2FDAA 1ZPCA 3U1JB 1PQ8A 1SPJA 3ZZ3A 2A4OA 1UK3A 2VU8E 1MD7A 4MNVA 2BVSH 1P02A 3UWJH 3O8CA 3P8NA 2FS9A 4OS7A 1KXAA 1YF4A 3A8BA 2VWLA 3NZIA 4IC6A 2BZAA 2FEQH 2ZFRH 1TMTH 5L30H 2ZHDA 1FPCH 3LDXH 4IGDA 4ZKRU 1GL0E 1IQGA 2A45B 3FANA 4BNRA 3TJOA 4YTAA 2EA3A 1BRUP 1SG8B 2PFEA 3STJA 4X2YA 4JYTA 2WUBA 4J1YA 4ABFA 5JBTA 4B76A 5GIBA 3CENA 1QQUA 2TIOA 5LPRA 3QGNB 1OOKB 2W5EA 2Z9IA 2A32A 2TGTA 3S69A 2Y7ZA 1V2QT 1ARCA 1FZZA 2KAIA 1AB9B 3A7VA 4MQAA 1TNHA 1ETTH 1P0SH 2OP9A 2WYGA 3ZVGA 3RXEA 4UFGH 2GT7A 4DGJA 5T3HA 2FYQA 3EA8A 5CE1A 3HATH 1FLEE 3LGTA 4OS6A 1GHBF 3LGYA 2PTNA 3NKKA 4CBNA 4ZHLU 1W3CA 1EP6A 4H42U 4NIYA 1DY9A 2Z6BD 3TJVA 1O2QA 1BTYA 1O3IA 4U01A 1DXWA 1SHYA 1YPMH 5ETXA 3KIDU 1O5EH 1GI2A 4YOIA 2PWXA 3RMMH 3ZZ9A 1UCYH 1C2KA 2JH0D 1P8VC 3SHAH 2OXSA 2V35A 4ZKNU 1QB6A 1DWCH 2PR3A 2V6NA 2F83A 4K8YA 3RC5A 4ASHA 1PPGE 3FZZA 1ZPBA 4B1TA 1Z7KA 1HAVB 1W2KH 2BQ7B 1HJAC 4FUDA 1C2HA 2STBE 3Q3YA 1XM1A 1UK2A 3K6YA 3SHCH 2AS9A 1YBWA 4X1NU 1LQDB 1CU1A 3MH5A 1GBFA 1OP8A 4X2XA 2VIWA 4I31A 1JBUH 4NA8A 3BTHE 3M5LA 4CRGA 1SGFA 2XW9A 5TJXA 1NPMA 3ATLA 2PW8H 5C5NA 1AUJA 1AUTC 1YCPM 2FZZA 1PFXC 1TALA 2JETB 1H4WA 4DIHH 1KSNA 5LH8A 1OYTH 1Z1JA 2JKHA 2VWNA 5J4QA 5SGAE 2FX4A 1P2NA 3GYMA 1TQ7B 3FAOA 4WH8A 1S81A 2W7UA 2HLCA 3MNSA 2FTLE 1AY6H 4CRAA 1TPSA 2XRCA 3A7ZA 3RC4A 3QLPH 2HOBA 3OYPA 2QCYA 2BDCA 3M36A 1BZXE 5LPFA 1BMNH 1AHTH 2VVVA 2HPQH 1BTPA 1S6HA 5G4BA 1MZAA 1MTUA 1A61H 2BZ6H 1IQKA 4B73A 1FY8E 1TGBA 1P10A 1BMLA