1DUEA

Crystal structure of exfoliative toxin a s195a mutant
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
242
structure length
242
Chain Sequence
EVSAEEIKKHEEKWNKYYGVNAFNLPKELFSKVDEKDRQKYPYNTIGNVFVKGQTSATGVLIGKNTVLTNRHIAKFANGDPSKVSFRPSINTDDNGNTETPYGEYEVKEILQEPFGAGVDLALIRLKPDQNGVSLGDKISPAKIGTSNDLKDGDKLELIGYPFDHKVNQMHRSEIELTTLSRGLRYYGFTVPGNAGSGIFNSNGELVGIHSSKVSHLDREHQINYGVGIGNYVKRIINEKNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural similarities and differences in Staphylococcus aureus exfoliative Toxins A and B as revealed by their crystal structures
pubmed rcsb
source organism Staphylococcus aureus
molecule tags Toxin, hydrolase
molecule keywords EXFOLIATIVE TOXIN A
total genus 69
structure length 242
sequence length 242
ec nomenclature ec 3.4.21.-:
pdb deposition date 2000-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1dueA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1dueA01
1RTFB 2EEKA 1KXFA 1KDQB 2XXLA 1IQFA 1P05A 1F7ZA 3A86A 1UVUH 3TH4H 3SV9A 1MAYA 4FVBA 1ESAA 1RTLA 7KMEH 2Z6BD 2A5KA 3EGKH 1LVYA 3Q00A 4X1NU 3Q77A 1TMBH 3V7TA 3PV4A 1O5EH 4O97A 1DSTA 1P01A 4KTCA 4CH2B 4BAHB 4R0IA 1GBDA 1TABE 1ELCA 1GBIA 1FY8E 1Z7KA 1NRNH 1ZPZA 3MTYA 3GY8A 2GZ7A 2ZHEH 1WQSA 1W7XH 2PR3A 4F49A 3QZRA 1MQ5A 1O2GH 1IHSH 1C2EA 5AFYH 4CR5A 3PYHA 1AUTC 4BTTB 3ODFA 4JYTA 2ANWA 1A7SA 1XX9A 2TPIZ 4X0WU 1VJAU 3HK6B 1T4UH 5B6OA 2O8TA 3VXEH 5FBIA 2WV5A 1HJAC 1GMCG 1C2KA 1NU9A 2CHAC 2JH6D 1GBCA 1CO7E 4WVPE 2BY5X 4Q80A 3HATH 2GZ9A 1IQJA 3T2NA 1JXPA 3KQEA 2I6QA 3TPIZ 4WY3A 2C3SA 1NFXA 1NZQH 2ILNA 4JK6A 4Y79A 1UTJA 3BF6H 1DWCH 4K60A 4MDSA 3BN9A 1K2I1 2P93A 1T8MA 5A2MH 3MHWU 1UTMA 1TPAE 1QRZA 1O35A 2BY8X 1YC0A 5LGOA 2JH5D 2TGTA 1EZUC 1ZHPA 1Z8GA 2FXRA 4X2WA 1O2VA 3A8DA 5DP6A 5JBAS 2SNWA 1G2MA 3RMNH 1Z6JH 2VVVA 1HAPH 1BITA 2Z3CA 3BIUH 2B7DH 2YOLA 3B8JA 4UONA 1BBRK 1P2IA 1GI8B 2ZDMA 2TGPZ 4PROA 2ZGCA 3ATIA 1SSXA 1TA6A 1MU8B 2VWOA 1C5WB 1O3BA 3BTKE 4IS5A 3TH2H 1AFQC 1K1PA 3CS0A 1GJ5H 2LPRA 1CT4E 4D8NA 2FPZA 4FUBA 2Q6GA 1L2EA 5A0CA 1FZZA 1AVWA 1F5LA 1IHTH 3ZZ3A 3TJUA 3LC5A 3GY3A 5FHTA 2A1DB 1L0ZA 2AMQA 2V6NA 3NUMA 2XYAA 2G8TA 4K69A 2BXTH 2Y6TA 4CRFA 1G32B 3K6YA 1OP8A 1BTZA 1TGCA 3BEUA 1TNJA 4GSOA 4H42U 1S6HA 3RMMH 4DIIH 2SGEE 2QXGA 3SJ8A 1GHBF 1Y59T 4MPVA 2VGCC 3A81A 5T6DA 2PTNA 1C1QA 5FX5A 4WXIA 1OWJA 1P57B 2PKSB 2JETC 1OWHA 5K0HA 2G4UA 2PKAB 1VCPA 3L3TA 1MTNB 8GCHF 3TK6A 5E8EH 1NFYA 3CP7A 3RXEA 3MYWA 4YT7H 1ETTH 1RTKA 2G00A 5F03A 4ABBA 1FDPA 3ZVAA 1YF4A 2ANYA 1TOMH 1GDUA 2P3UB 4JZDH 1MTUA 1OKXA 3H5CB 4JZFH 1BMNH 3FVFB 2IN2A 5CHAB 3MU0A 1THSH 4XBDA 1HXFH 3T27A 1MTNC 1SLXB 3PO1C 2J4IA 1O2IA 4K8YA 2ZWLH 4GAWA 5TCAA 3FZDA 3T28A 1O5BB 2VINA 4NSVA 3RXKA 3MFJA 5EW2H 1S85A 3SU5A 4DCDA 1AKSB 1GI9B 1SGRE 1AB9C 1GJAB 1CT2E 1W10U 1C9PA 3D62A 1AGJA 2G5NA 2F3CE 1E35B 4D7GA 1WAYB 1BHXB 1DICA 1FAKH 1F5RA 2FTLE 1EAWA 1J8AA 4IC6A 2V0BA 3S9AA 1GJ9B 3JZ1B 1G2LA 2OC8A 1O38A 5JBTA 4ZHMU 1BJUA 4WMEA 1SGTA 1XXFA 2J92A 1BTUA 5SGAE 2KAIA 3TNTA 4BAQB 3UNRA 2CF9H 1UO6A 1LPGB 4IGDA 4Q2KA 3LIWA 3NCLA 4X1SU 3RXBA 3SU0A 3V3MA 3SHAH 3LT3A 4D7FA 4A1XA 4MVNA 1FPHH 3SJOA 4TPIZ 2W3KA 2QAAA 4FU7A 1CT0E 2F9NA 5F6MA 2XCNA 3A8AA 1QY6A 1C5XB 2CGAA 3U8RH 5GJ4B 4UDWH 2QIQA 2FESH 3UQVA 1EB1H 1P2OA 3FP8E 1KTSB 3M3SA 2TBSA 2PKAA 4X6PA 1TYNA 1FV9A 3MO3A 1OP2A 4WMDA 1MCVA 1B5GH 2ZGJA 2J94A 3KQBA 2ZF0H 1GBAA 2EI8A 2VB0A 3M7TA 4CHAB 1YCPM 4B2BA 2Y5GA 1OWEA 3EE0B 1V3XA 1L1JA 4ABIA 4LOYH 3ATLA 5DP7A 3A7ZA 4LZ4B 1O2RA 1DUEA 4CRDA 1RXPA 3MNBA 4NCYA 2ZU5A 5HGGA 2AH4X 1YCPH 1V2QT 2YNBA 2VWNA 3T62A 1FN8A 4A6LA 1O2JA 2ZDNA 2VVUA 1Z71A 4Y6DA 2VJ1A 4NA9H 1O5CB 3SBKA 1MD7A 1YPHC 1V2ST 3BTTE 4O03A 2FMJA 3MNSA 5C3NA 3L33A 4YOIA 1O2ZA 2ZI2H 2BOHB 1T4VH 5AFZH 1IQGA 2QF3A 2A4RA 1G36A 3FZZA 1YPMH 4JZ1A 3KL6A 1TPSA 3MH5A 3VEQB 2C8YB 1BTYA 2PGQB 2BZAA 1OPHB 1UTNA 4ZHLU 1SGQE 1PPCE 4F4OC 3A80A 5JBCS 3KQCA 1UVPA 1QL7A 1UTPA 2QXJA 3A89A 3U8OH 4TWYA 1MZDA 1VGCC 4O3TA 1TWXB 1L4DA 2VGCB 1AHTH 1AU8A 1SGCA 2G4TA 1K1NA 4ABJA 1C2LA 1LHEH 3VB7A 1TRMA 4DIHH 3VB5A 5L2YH 1GMDG 2PKSC 2OTVA 5TJXA 5HYOA 1O3AA 1K1MA 4FUJA 1QQ4A 1PQ5A 1GHYH 3ZVEA 1C5MD 1CGHA 5EPNA 3SU6A 1AO5A 4OGXA 4NA7A 4Z6AH 2P3FH 3SORA 3H7TA 3RXRA 1NFUA 1C4V2 2RA3A 1BIOA 1QBVH 1YLDA 3LU9B 4K1SA 5GCHF 2OUAA 2ODQA 1ELTA 2FYQA 1SPJA 3E0PB 3HKIB 1HAIH 1O39A 3QGJA 2UWPA 4HFPB 3RXGA 2QF0A 3F68H 3UOUA 1PPHE 1QB9A 1NRRH 1GMDF 1XUKA 2FOCA 4NFFA 2R0LA 4DG4A 1K1LA 1G9IE 1SFQB 1Q3XA 2ZFTA 1RJXB 3M7QA 3F6UH 1XUIA 1MAXA 1C5QA 1O2KA 1XUHA 3N7OA 2BY7X 1GHAG 1GI0A 1SQOA 3RC4A 2ESTE 1CHOF 2Y5FA 1P10A 5EXNA 1TNKA 1A1RA 2CXVA 3SZNA 3LJOA 3U98H 1C5YB 1GBMA 2UUJB 3UOPA 2A2QH 4K3JA 1Y5AT 4FUFA 4X8VH 3SJKA 3F9FA 4GUXA 1EAUA 1O5AB 3T5FH 4Y7AA 1CSOE 4OS4A 1GBLA 4IMZA 2ZQ2A 1LQDB 1V2OT 3RXFA 1JIMA 1SLWB 3RM0H 4BTUB 4DY7B 5FCRA 1QJ6B 4VGCC 3W94A 3AW0A 3ESTA 2F9BH 1ESTA 1SFIA 4NA8A 1H1BA 1W8BH 3BV9B 3A82A 3FFGA 3M5MA 1C1RA 1BTPA 4ABDA 2SGQE 3SO3A 3RXDA 2XWBI 2ZDLA 4YTAA 3GCHB 4YM9A 3KNXA 4AFQA 1GGDB 1AFQB 4NSYA 1DFPA 2FODA 3KHVA 4E05H 1KXCA 2TIOA 3QN7A 3GDVA 1UTLM 4AORA 4BANB 3S9CA 2ZHWH 2TRMA 4B76A 2Z9GA 1P2MA 1OWDA 4A5TS 1C1UH 1EASA 3TK9A 3CS7A 3QO6A 3MU4A 1C1SA 4NZLA 3P8OA 3NXPA 8LPRA 2Z3DA 1AMHA 1ELVA 5FPYA 2BX4A 2ZU3A 2ZFFH 2VH6A 3PWBA 1UTKA 1O2OA 1SC8U 3ZZ8A 1G30B 5E0HA 2Q1JA 5DKMA 2NU4E 1TBZH 1ZJKA 1SG8B 1S0RA 4Y7BA 4K1EA 1GI4A 5DGJA 2BD2A 1GL0E 1YPHE 1GBJA 2VIQA 2XBWA 4YLQH 1Y8TA 2WPKS 3A7WA 4CBOA 1TBQH 1B0EA 4B2CA 4CREA 1O30A 1WV7H 2A4QA 1O2MA 1DITH 2BY6X 1P09A 3SHCH 1A0HB 1GI7B 4OS1A 5FCKA 5LPFA 3QWCH 2AS9A 2Y5HA 3K9XB 4Z0KA 4ABEA 2BD8A 2B9LA 1QRWA 4MNVA 1O3EA 1XKAC 1GBKA 3AAUA 4NWLA 1ZSJA 1BRAA 3SJIA 1C1VH 2Y81A 2FS8A 1O3IA 1H9IE 3SNEA 3QLPH 3SQHE 2ASUB 1BRCE 4ZKSU 3GCOA 4H6SB 5GWZA 3VB6A 1XVMA 3RC5A 1B0FA 1TGBA 4FUIA 2GTBA 5T6FA 4FXGH 1GHZA 2ALVA 3NKKA 1O2LA 1WTHD 2BD9A 4IBLH 2SNVA 4ZKRU 1QR3E 1A5GH 5HXFA 3SGBE 2IPHA 2XRCA 1KLJH 4KTSA 1QIXB 1BA8B 2OP9A 2P59A 3BG4B 1ZJDA 1E34B 3TGIE 1GMHG 4X2XA 4TY6A 2FO9A 4X1PU 1HIAA 2AYWA 1DT2A 2B8OH 3SJ9A 2YNAA 3ZZ6A 1C5ZB 1MKWH 3ZVBA 1AD8H 1W7GH 1ANDA 3V0XA 1W0ZU 2Y7ZA 4AX9H 1JRTA 1O37A 4NG9H 4A1TA 1THRH 5CE1A 3M35A 2ZFRH 3TK5A 1SI5H 2A5AA 1EAIA 1QURH 1WQVH 1PFXC 3DT0H 1EXFA 1C1PA 3ZVDA 1AWHB 5GXPA 2PTCE 1CA8B 1S5SA 1GJ7B 4MNYA 1TONA 3MOCA 3SGAE 1IQMA 1QB6A 4BOHA 1XUGA 4X6NA 1FIWA 1BTXA 3GYLB 1C5RA 1S82A 4Y8ZA 4BAKB 1LHGH 6GCHF 1TX6A 2STBE 4X8UH 1LHCH 3L6PA 3ATKA 1IQNA 5H4IB 1UTQA 2D2DA 3HK3B 1MZAA 3I29A 2G81E 2A7CA 4MNWA 1O2UA 2FDAA 3ZZ9A 1JMOH 5ESBA 1CVWH 4K8BA 1GJ4H 4I31A 2ZU4A 1FONA 5EOKA 2ODYB 4OGYA 1A0LA 3MH7A 1HAVB 3F9GA 2HGTH 1DSUA 2GCHG 1GMHF 3S0NA 1ZHRA 3GICB 1ZPCA 2PSXA 1AB9B 1PQ7A 3TVJB 2G52A 5BPEA 1V2RT 2B5TB 1GBTA 1PQAA 4I8GA 1ANBA 4WWYA 1C5OH 2W7UA 1SHHB 1MUEB 1YYY1 2FX4A 3TH3H 2D26C 1P2NA 2OLGA 2EI6A 1SVPA 2W5EA 1HAYB 1IAUA 4AG2A 1S84A 3RU4D 2HNTF 2QCYA 1EJAA 1YPJH 3GDUA 3P8NA 5EQRA 1TQ0B 3SU4A 2OINA 3BTQE 5FX6A 1THPB 3RXVA 1EP5A 2B0FA 4X2YA 1ZGVA 1GI2A 2UWLA 4JCNA 5PTPA 1CQQA 1ZTKA 2F83A 1E37B 2SGAA 4AFSA 3SNCA 4X2VA 3AASA 1V2UT 5FPTA 5T3HA 1BBRE 1QRXA 4U2WA 3FAOA 2FS9A 1EAXA 4HI3A 1IQLA 1C1TA 2PUXB 1QL8A 1MCTA 3P17H 4IC5A 4FUHA 2CF8H 3BTEE 3A88A 4AFUA 1L1GA 1UVSH 5TCCA 3NK8A 1C5SA 1A46H 1VZQH 5I25A 1HDTH 1BMAA 1EPTC 1PYTD 4ZROA 1UK2A 2NU1E 3A8CA 1WCZA 4YOJA 3E16B 3W95A 2BY9X 1QBNA 3B9FH 3GY6A 4O3UA 5A8YA 2BZ6H 1P3CA 4ZKOU 3GDSA 3DD2H 1BRBE 4I7YH 3LH3A 2WV4A 2G55A 1G3DA 1CGJE 4DW2U 1VITH 1AFEH 1FLEE 1GBHA 1J16A 1Z8JB 2SGFE 1P12E 1P2JA 2FOBA 4X1RU 1TRNA 5J4SA 1JIRA 3BTFE 1BZXE 5L2ZH 1O3MA 5JB9S 1SMFE 4J1YA 2ZG0H 2A32A 1CE5A 1BMLA 3S9BA 3A7TA 1YCPK 1YBWA 4Y8YA 1T8NA 1HLTH 1P2QA 4GHTA 1C2HA 1DPOA 2Q6DA 1XUFA 1YLCA 1FNIA 3M7UA 3RU4E 1MH0A 1DLKB 4DOQA 3MH4A 4E06H 4J2YB 1DVAH 3RXCA 4MNXA 1DANH 1LMWB 3H7OA 1XM1A 2V3OH 3UFAA 5FXLA 3E1XB 4A7IB 1O3DA 3VFEA 3E8LA 1GVLA 3MU5A 3RU4T 1GJ6A 1AZZA 1HJAB 1ZOMA 1TE0A 1E0FD 1GVKB 4AZ2B 2NU2E 1P2KA 2GCTB 2C90B 1YPKH 3LDXH 2ZCLP 3JZ2B 3PLPA 1NROH 2FWWA 1DUAA 1AE8H 1O3HA 1ABJH 2OBOA 1L4ZA 2QYIA 1N8OC 6ESTA 1GDQA 3PLBA 2VIOA 4BXWA 2C8XB 1W11U 1EP6A 1TX7A 1SGEE 3RXPA 3NWUA 2DE8A 3HKJB 4A1VA 1AE5A 1ZLRA 3M5OA 3RC6A 1FAXA 1K28D 3ZZAA 3MNCA 1W0YH 2ZFSA 2ZTZA 1MBQA 3PMHB 4D76A 4Q7ZA 1XKBC 3ATMA 1EB2A 1JOUB 1T8OA 4BNRA 3URDA 4JZEH 4D9QA 1RIWB 1NESE 2ZECA 1TB6H 3P8FA 4I8HA 3M36A 3E90B 3O8CA 1HAVA 3EAJA 1C4Y2 2CN0H 1WSSH 3IG6B 1SOZA 1QTFA 2P16A 1P9SA 4ISLA 5I46H 1SGIB 2VWMA 3D65E 1BCUH 2HRVA 2R0KA 2ZNKH 3E6PH 4OS6A 3F9HA 2BB4A 3F9EA 2ZHDA 4YESB 5K7RA 2RG3A 2FX6A 1AQ7A 1DWEH 3LJJA 4UE7H 5C1XA 5A0AE 2GD4B 2HVXA 1O3NA 1O3LA 1W12U 4GCHF 6LPRA 1V6DA 2ZPQA 3S7KB 4BAMB 4RKJB 1KLTA 3P6ZB 1AN1E 1IQEA 5DP5A 4JK5A 3SUGA 1K1OA 1NS3A 2VIVA 2PW8H 4BTIB 3E0NB 2PV9B 2A4OA 4K5ZA 2IOTA 1P03A 4AB9A 2ZQ1A 1W3CA 4NWKA 5DO4H 1HXEH 3EA9A 3PB1E 3MO9A 1T32A 1GGDC 1AY6H 2CHAB 3Q76A 4LZ1H 2Z9KA 2ZCHP 3QUMP 3GCHC 1A5HA 4ZXYH 3ZYDA 1D3TB 3SNDA 2QA9E 3BG4C 1C2JA 3ZV9A 1HJ8A 3E3TA 1HB0B 1K22H 1LKBA 3GY5A 1FY4A 1MMJN 4JYVH 1QA7A 1W13U 4IN2A 1XVOA 1O2PA 2P3TB 4B1TA 3M37A 4TYDA 1ESBA 2BQ6B 4ZMAH 4NGAH 1QGFA 1V2VT 5HMAA 4Y0YE 1AVXA 1GCTB 4H4FA 3RUOA 1Q2WA 1AVGH 4CR9A 1UK4A 1Z8IB 2J95A 3T26A 1LPZB 1SL3A 2F9OA 1V2KT 1EZQA 1QB1A 2O8MA 1SGFG 1JRSA 3VGCB 5DP9A 1G3BA 2AERH 3OX7U 2FLBH 1C5UA 1ID5H 3RXOA 1ZMJA 5A8XA 2QXHA 1PPZA 2ULLA 2CJIA 3AVZA 2BDBA 2EI7A 4DGJA 2FIRH 1ELGA 1K1IA 3UUZA 2VU8E 3BTWE 5ESTE 1DOJA 1GBEA 1VCWA 5AHGH 1D3QB 5EXLA 1ZMNA 5CMXH 1KLIH 3LGUA 2O9QA 3WY8A 3M61U 5HM2A 1LO6A 2O8UA 2BM2A 1OYQA 3ZZDA 5DG6A 1TLDA 1C5LH 4GPGA 4K2YA 1GJDB 1FY5A 3GCTG 1DM4B 4Y10E 2ANKH 1GHVH 2UUKB 1QJ7B 1TA2A 2HPQH 2I6SA 2FEQH 1LHDH 3TJNA 2PUQH 1P0SH 3OYPA 3LC3A 2PFEA 4XSKU 2AMPA 1O3KA 1CBWC 3GY7A 2VWLA 4RSPA 4X6MA 4XBCA 2FTMA 1EOJA 4CH8B 4U01A 1QFKH 1MBMA 1ARBA 2BVSH 1OWKA 4UFGH 2UWOA 3GCTF 3RXIA 1GHAF 2Z9LA 1O31A 2H2ZA 2J38A 3U8TH 1S0QA 2GDEH 3SI4H 3BTME 1JWTA 3EA8A 5F8XA 1GI5A 2ODPA 2Y7XA 1RFNA 1C5VA 1J15A 5EXMA 2ZU1A 1TAWA 4X1QU 1RIWC 1NRSH 4K1TA 1TALA 2ZDAH 1HBTH 3QZQA 1UCYK 4ZKNU 4NIYA 1BDAA 1RS0A 2EC9H 2AGIX 1UCYE 4I8JA 2NWNA 2ZGBH 1FN6A 1PQ8A 1SGYE 2AIPA 3GOVB 1WTGH 2AGGX 4IW4E 3UY9A 3A87A 1AWFH 2DUCA 2ZGXH 4RKOB 1SLUB 2ZZUH 3Q3XA 4B71A 1EJMA 2XC0A 1H4WA 3P8GA 1C1WH 4UD9H 1MTVA 4TWWA 1J9CH 2ZHFH 2BVXH 3U1JB 2ZDKA 1A2CH 2SGPE 4ISHH 3ZZBA 1SQAA 3BIVH 1MTWA 4YZUA 7ESTE 4MQAA 2C8ZB 2ZPRA 1BOQA 3NPSA 2OC7A 5IDKA 4AGJA 4AYYB 3LONA 1HAXB 1GMCF 4MLFB 7GCHF 1N6YA 5EW1H 2HPPH 2AMDA 1Z1JA 1C2MA 1HAHH 1HAOH 2PWXA 4DT7B 2R9PA 1EUFA 1AI8H 2GDDA 4FVDA 3GCNA 1QCPA 4HTCH 3STIA 1Z8RA 1O32A 5EG4A 1UMAH 3LGVA 1WOFA 1KXAA 3A7VA 1EJNA 3LGYA 1SGPE 4THNH 1IQHA 1TOCB 4JMYA 3CENA 4A92A 4XOJA 1DY9A 8KME2 3LGTA 1WU1A 3MU8A 1K21H 1FXYA 2BD3A 1Q31A 1GCDA 1NFWA 2QV1A 2BMGB 1GG6C 3PMBB 3MMGA 2GX4A 1IQKA 1MU6B 1OWIA 2FOMB 5EU8A 2THFB 5JPMH 5ABWA 3DUXH 3SV8A 1Y3WA 3LGWA 1CBWB 3RXSA 4AOQA 2K1QA 1EZSC 1ANEA 2F9PA 3RDZA 1NRPH 1VJ9U 1YGCH 5EQSA 3TGKE 1LPKB 2C8WB 5C5OA 2ZA5A 2PGBB 5GDSH 1AKSA 1O3FA 1NU7B 3DA9B 3S7HB 3VPKA 1C1MA 1LVMA 4AFZA 1LTOA 1EPTB 1YKTA 1TFXA 1DXPA 4I8KA 4FU9A 1P02A 1F0RA 1GWAA 1KIGH 3BSQA 3PROA 1O0DH 1FQ3A 2VIDA 3DHKH 3V12A 5G4BA 2Z9IA 5C20A 3SV6A 2Y82A 1IQIA 3TJVA 2BQWB 1CA0B 1BHXF 3P95A 1NTPA 3EYDA 1ZPBA 1ZYOA 4WXVA 4BXSA 1GBBA 1NT1A 3SUEA 4AB8A 1GHBG 2ZEBA 2P8OB 4XE4A 1YPLH 4CRAA 1GHWH 2A2XH 1AIXH 2QY0B 2FOAA 5JYIA 2WPHS 1NY22 2FOGA 5C2ZA 1G3EA 2AEIH 3ZVFA 1D6WA 4YLUA 3RXHA 4UFDH 3SW2B 1ELBA 3TGJE 3FANA 1O2XA 4B74A 1TGNA 1D4PB 3PLKA 4WMFA 4E7RG 4U30A 1EQ9A 3RXTA 1VR1H 1C5TA 3KN2A 1QBOA 1SQTA 1TMUH 4GHQA 1O3OA 1O33A 2TGAA 3A85A 3UWJH 4MPXA 4YOGA 2ZGHA 1GBFA 5E0JA 1KXEA 1Y3VA 3O8DA 3T25A 2Y80A 3Q3YA 4JZIA 2XBYA 2VNTA 4OS7A 4ESTE 2PLXA 4FUGA 4E7NA 6CHAC 1KY9A 2GCHF 1KSNA 4DVAU 2FI4E 3SU3A 1V2LT 3UREA 4ISOA 1HFDA 5ETXA 2C4FH 2VVCA 1F2SE 2M5TA 2DE9A 5GIBA 5T6GA 3TU7H 3UTUH 3SNBA 1EOLA 4D9RA 1C1NA 1UCYH 1ZHMA 3LPRA 1DWDH 2GCTC 4ABFA 1GHXH 1QNJA 1F5KU 3FP6E 1MTSA 3EQ0H 1UJ1A 2A31A 3D23A 5EQQA 4SGAE 1PPBH 3M5LA 3K2UA 2GV6A 4ABAA 1NM6A 6GCHG 1CHGA 2BD4A 2VIPA 4TPYA 2JKHA 1MKXK 3OSYA 1FJSA 1P04A 1TX8A 1F0SA 3OU0A 4INKA 3V13A 3I78A 1HAZB 4NFEA 2A7HA 1O5FH 1OX1A 3ZZ7A 1VGCB 2GVFA 3UNSA 4IN1A 1SB1H 2BDGA 1ZMLA 3O8RA 3QK1A 1P06A 5C5NA 5A0BA 3MU1A 4GVUA 3SI3H 2J2UA 1O5DH 1OYTH 2CMYA 4NIVA 1BT7A 4R8TB 2C93B 3TJOA 5BRRE 3T29A 1O2SA 2BHGA 3HPTB 3LGIA 3RXMA 2KAIB 1O3JA 2OC0A 3RP2A 2J34A 1ZR0A 1ZTJA 2HALA 2O8WA 3BTGE 4I32A 1TNLA 4CRCA 4H6TA 4AN7A 3IITA 4DURA 1SGFA 3A83A 1WYKA 1MKWK 3AAVA 3UWIA 1FY3A 1BQYA 4MG3A 1YPEH 1UVOA 1NC6A 4LXBH 1GDNA 2XBXA 5A8ZA 2R2WU 1HIAB 3URCA 1PJPA 1LHFH 2BD7A 3IWMA 3SN8A 4Q7XA 3SGQE 1MKXH 2P8OC 3ZVGA 1H8IH 5IYTA 1OXGA 3VXFH 1Y5BT 3QDZB 3S69A 2GMTB 2ZDVH 1HRTH 1ELAA 1N1LA 1A5IA 3C27B 3TNSA 5J4QA 2H9HA 3KIDU 3QGNB 1ANCA 2CV3A 2Z7FE 3SOSA 2QGRA 3GY4A 1A4WH 3BTDE 1H9HE 5F8ZA 1K9OE 1UTOA 1CGIE 4WF8A 2P94A 4BAOB 3SU2A 1D3PB 1HGTH 1SOTA 2FI3E 1HAGE 2XBVA 2PHBA 2IJOB 4MTBA 2HLCA 1H9LB 3R0FA 2H1UA 2FZZA 2WINI 5EODA 5LH8A 1BJVA 1HUTH 3TLOA 2A0QB 1ORFA 5DP8A 1QQUA 1QJ1B 1F0TA 1CHOG 1ELFA 1BTWA 1GI1A 1D3DB 1UK3A 2GP9B 1WUNH 2OC1A 3STJA 5GCHG 1C4U2 1DLEA 1VITF 1YM0A 3ZV8A 3U1IB 2R3YA 3PMAB 3BEFB 2SFAA 1OS8A 2GKVE 3K6ZA 1FI8A 3UPEA 7LPRA 1O36A 1MQ6A 3KF2A 3BG8A 4HGCA 1TGTA 3Q3KA 4NIXA 1PPEE 2OBQA 1FUJA 2W26A 1FY1A 2WYGA 3LKWA 4KGAA 3KCGH 1HNEE 1XUJA 2HOBA 2ZHQH 2W7SA 3QX5H 3M3TA 1O2WA 1EKBB 1BBRH 2ZU2A 1V2JT 2HNTE 1GI6A 2D8WA 3M3VA 1TMTH 1A3BH 1P11E 3R3GB 5C1UA 2STAE 3M5NA 3QTOH 3SQEE 1HYLA 1DS2E 1C1OA 2ZTXA 1P8VC 1V2TT 3DFJA 2BYAX 1TPPA 4UFEH 1OOKB 4CRGA 1CU1A 1HJ9A 2H9EH 5E2PA 1KXBA 4UEHH 4VGCB 1OSSA 1ARCA 1ELEE 4LK4A 1ACBE 2P95A 4I33A 4ISNA 1ZRKA 1DDJA 1PPGE 3VGCC 1P3EA 2A5IA 4QT8C 1JBUH 1NN6A 1C2DA 2WUBA 4MPUA 3RLWH 1LVOA 2TGDA 2XTTB 4U32A 5DJ7A 1ZGIA 2OQ5A 1SLVB 4B73A 5L6NH 5F8TA 1ELDE 5C67A 2OQUA 3PM3A 3KEEA 1KTTB 1G3CA 1A0JA 1DY8A 4X6OA 1ZSLA 1O34A 2FOEA 2J9NA 7GCHG 8ESTE 3MWIU 2Z9JA 4AG1A 3A84A 1Z1IA 1IOEA 2ZC9H 1KDQA 2VIWA 4FUEA 2QC2A 2BQ7B 5A09A 1HPGA 1SGDE 1F92A 2GMTC 4Y0ZE 4ZAEA 1NPMA 3F1SB 2XC4A 2EA3A 5EPYA 3GYMA 2Q6FA 2RDLA 5AVDA 1E38B 1LDTT 1MD8A 1TNHA 2JETB 4X8TH 1NRQH 1O3PB 1QL9A 4WH6A 2SGDE 1S83A 2ZP0H 2BOKA 3ENSB 4OS2A 1G37A 3MO6A 2GT8A 1ABIH 2AFQB 2BXUH 9LPRA 2D1JA 1BUIA 3EDXB 2BDAA 3GY2A 2F91A 2FLRH 1TQ7B 1ZSKA 3OY6U 3C1KA 3LOXA 1BMMH 1TNIA 1O5GH 1T31A 1UHBB 5FAHA 1YPGH 5JDUB 1O2QA 1FIZA 1VITG 1ZRBA 2WPJS 1INCA 2FOFA 2VH0A 2H9TH 3ZVCA 4CBNA 1GL1A 1QA0A 2H5DA 3ZYEA 4KTUA 4IMQA 3AW1A 3ZZ4A 1NO9H 1FPCH 1V2MT 1RD3B 4KKDA 3ZZCA 4KELA 1GJ8B 2WPLS 3RM2H 2XCFA 1S6FA 1GVZA 1B7XB 1H8DH 2A45B 4TY7A 2O8LA 2WYJA 4YO9A 1BTHH 1C5PA 2XW9A 4INLA 1EATA 4HZHA 2WPMS 4Y76A 3O8BA 6CHAB 1K1JA 2NU3E 3VB3A 1C2IA 2ANMH 2ZTYA 1UVTH 1T8LA 1DX5M 1SGNE 3I77A 3MH6A 1YP9A 5CHAC 3PWCA 1D9IA 2UUYA 1GG6B 4ABHA 1O3GA 3RXUA 1TRYA 2ZCKP 1C2FA 2XC5A 4SGBE 3RXQA 2QN5T 2UUFB 2NU0E 4UFFH 2AIQA 3ODDA 3UQOA 5FBEA 3B23B 4B75A 4OS5A 3RMOH 3QTVH 3BTHE 4ZXXH 4M7GA 4FUDA 1TPOA 4WH8A 2W3IA 1Y3UA 2HNTC 5E0GA 2ZIQH 2ZKSA 3FP7E 5EGMA 5LPEA 4JYUH 3G01A 1A61H 1DE7H 1SHYA 2QXIA 5GPIB 1W14U 2ZPSA 2F9UA 1OP0A 1VCQA 1QHRB 1ZTLA 1DWBH 3EA7A 5JBBS 1WBGB 3SV2H 2FI5E 1GI3A 3PO1B 1P9UA 2HWLB 3OTJE 8GCHG 4MPWA 3SUFA 1C5NH 4Y11E 1LQEA 3GISB 5HM9A 2LNCA 3NZIA 1EZXC 3RXLA 2OCVB 4ASHA 2BLOA 2FM2A 2WPIS 1DXWA 1CA0C 2OXSA 4WJG2 4ZUHA 3LH1A 2R2MB 2H5CA 3SUDA 1TIOA 2Z3EA 1GCTC 2H6MA 4DJZB 2AGEX 3ELAH 2OD3B 4FUCA 1BRUP 2ALPA 2BLWA 2BX3A 2FP7B 2A4GA 9ESTA 4XFQA 3SV7A 2BDCA 2XWAA 4X8SH 3RXJA 3A7YA 2G5VA 3UNQA 1ZZZA 3RLYH 1GJBB 1O2NA 5AF9H 2FOHA 3U9AH 2ZFPH 1Y3YA 4YT6H 5E2OA 1PYTC 1SBWA 3ITIA 5DPAA 2V35A 1Y5UT 1GJCB 4GCHG 3OY5U 2ZFQH 1T7CA 3A8BA 1EPTA 1M9UA 2GT7A 4ZH8A 1N6XA 1D6RA 1E36B 1KXDA 1UHBA 3ATWA 2BD5A 3SU1A 3A7XA 3K65B 2BDYA 2BVRH 4NZQA 3PTNA 1Z6EA 2FYRA 4GLYA 1SR5C 1O3CA 2A7JA 4Y71A 2WUCA 2PSYA 5JB8S 2GZ8A 1EX3A 1TNGA 4Y8XA 4ISIH 1A3EH 1AZ8A 1XMNB 2BTCE 2XNIA 3UR6A 1Y3XA 1J14A 5DK1A 4RN6A 5DP3A 4I8LA 2GV7A 4Q7YA 4FU8A 2JH0D 4B2AA 2RCEA 4INHA 2BDHA 3VB4A 2V3HH 3BEIB 1HCGA 3D49H 2GGVB 1J17T 1V2PT 4O9VA 1XXDA 4ZHAA 5L30H 3UR9A 1F0UA 2BDIA 1RGQA 1S81A 1C2GA 1BB0B 3DFLA 1C9TA 4ABGA 1LVBA 5LPRA 1U6QA 3PTBA 1TBRH 3U69H 3RMLH 1KYNA 3E91A 3ZZ5A 4XBBA 1O2TA 3TITA 1ETRH 1V2NT 4CHAC 2R3UA 1TGSZ 1HV7A 3P70B 4AYVB 1W2KH 4NIWA 2ZO3H 4XDEA 3PMJA 4CRBA 1GPZA 1V2WT 3HGNA 3MI4A 1ETSH 4KP0A 3MNXA 2F9VA 2BLQA 2G51A 3HGPA 3RXAA 2RA0A 1O2YA 1L1NA 1FMGA 2Z94A 1RRKA 1AUJA 1N8OB 5DP4A 3P92A 5FPSA 1PPFE 1LCYA 3SNAA 3TIUA 1O2HA 3KGPA 3KQDA 4AGKA 1X7AC 2BLVA 3UIRA 5C1YA 1LKAA
chains in the Genus database with same CATH superfamily
1RTFB 2EEKA 1KXFA 1KDQB 2XXLA 1IQFA 1P05A 1F7ZA 3A86A 3OAAD 3F2FA 1UVUH 3TH4H 3SV9A 4I86A 1MAYA 4FVBA 1ESAA 5C0TA 1RTLA 7KMEH 2Z6BD 2A5KA 3EGKH 1LVYA 4ZCNA 3Q00A 4X1NU 3Q77A 1TMBH 3V7TA 1WXRA 3PV4A 1O5EH 4O97A 1DSTA 1P01A 4KTCA 4CH2B 4BAHB 4R0IA 1GBDA 1TABE 1ELCA 1GBIA 1FY8E 1Z7KA 1NRNH 1ZPZA 3MTYA 3GY8A 2GZ7A 2KCYA 2ZHEH 1WQSA 1W7XH 2PR3A 4F49A 3QZRA 1MQ5A 1O2GH 1IHSH 1C2EA 5AFYH 4CR5A 3PYHA 1AUTC 4P00A 4BTTB 1UW7A 3ODFA 4JYTA 2ANWA 1A7SA 1XX9A 2TPIZ 4X0WU 1VJAU 3HK6B 1T4UH 5B6OA 2O8TA 3VXEH 5FBIA 2WV5A 1HJAC 1GMCG 1C2KA 1NU9A 2CHAC 2JH6D 1GBCA 1CO7E 4WVPE 2BY5X 3F2GA 3HATH 4Q80A 2GZ9A 1IQJA 3T2NA 1JXPA 3KQEA 2I6QA 3TPIZ 4WY3A 2C3SA 1NFXA 1NZQH 2ILNA 4JK6A 4Y79A 1UTJA 3BF6H 4F48B 1DWCH 4K60A 4MDSA 3BN9A 1K2I1 2P93A 1T8MA 5A2MH 3MHWU 1UTMA 1TPAE 1QRZA 1O35A 2BY8X 1YC0A 5LGOA 2JH5D 2TGTA 1EZUC 1ZHPA 1Z8GA 2FXRA 2IJD1 4X2WA 1O2VA 3A8DA 5DP6A 5JBAS 2SNWA 1G2MA 3RMNH 1Z6JH 2VVVA 1HAPH 1BITA 2Z3CA 3BIUH 2B7DH 2YOLA 3B8JA 3OTPA 4UONA 5EJLA 1BBRK 1P2IA 1GI8B 2ZDMA 2TGPZ 4PROA 2ZGCA 3ATIA 1SSXA 1TA6A 1MU8B 1C5WB 1O3BA 2VWOA 3BTKE 4IS5A 3TH2H 5C17A 1AFQC 1K1PA 3CS0A 1GJ5H 2LPRA 1CT4E 4D8NA 2FPZA 4FUBA 2Q6GA 1L2EA 5A0CA 1FZZA 1AVWA 1F5LA 1IHTH 3ZZ3A 3TJUA 3LC5A 3GY3A 3OE7D 2A1DB 5FHTA 1L0ZA 2AMQA 2V6NA 3NUMA 2XYAA 2G8TA 4K69A 2BXTH 2Y6TA 4CRFA 5T1VA 1G32B 3K6YA 1OP8A 1BTZA 1TGCA 3BEUA 1TNJA 4GSOA 4H42U 1S6HA 3RMMH 4DIIH 2SGEE 2QXGA 3SJ8A 1GHBF 3PRDA 1Y59T 4MPVA 2VGCC 3A81A 5T6DA 2PTNA 1C1QA 5FX5A 4WXIA 1OWJA 1P57B 2PKSB 2JETC 1OWHA 5K0HA 2G4UA 2PKAB 1VCPA 1K0HA 3L3TA 1MTNB 8GCHF 3TK6A 5E8EH 1NFYA 3CP7A 3RXEA 3KYFA 1BMFD 3MYWA 4YT7H 1ETTH 1RTKA 2G00A 5F03A 4ABBA 1FDPA 3ZVAA 5KECA 1YF4A 2ANYA 1TOMH 1GDUA 2P3UB 2M2AA 4JZDH 1MTUA 1OKXA 3H5CB 4JZFH 1BMNH 3FVFB 2IN2A 5CHAB 3MU0A 1THSH 4XBDA 1HXFH 3T27A 1MTNC 1SLXB 3PO1C 2J4IA 1O2IA 4K8YA 2ZWLH 4GAWA 5TCAA 3FZDA 3T28A 1O5BB 2VINA 4NSVA 3RXKA 3MFJA 5EW2H 1S85A 3SU5A 4DCDA 1AKSB 1GI9B 1SGRE 1AB9C 2WHXA 1GJAB 1CT2E 1W10U 1C9PA 3D62A 1AGJA 2G5NA 2F3CE 1E35B 4D7GA 1WAYB 1BHXB 1DICA 1FAKH 1F5RA 2FTLE 1EAWA 1J8AA 4IC6A 2V0BA 5DSFA 3S9AA 1GJ9B 3DCLA 3JZ1B 1G2LA 5FL7D 2OC8A 1O38A 5JBTA 4ZHMU 1BJUA 4WMEA 1SGTA 1XXFA 2J92A 1BTUA 5SGAE 2KAIA 3TNTA 4BAQB 3UNRA 2CF9H 1UO6A 1LPGB 4IGDA 4Q2KA 3LIWA 3NCLA 4X1SU 3RXBA 3SU0A 3V3MA 3SHAH 3LT3A 4D7FA 4A1XA 4MVNA 1FPHH 3SJOA 4TPIZ 2W3KA 2QAAA 2V7QD 4FU7A 1CT0E 2F9NA 5F6MA 2XCNA 3A8AA 1QY6A 1C5XB 2CGAA 3U8RH 5GJ4B 4UDWH 2QIQA 2KCOA 2FESH 3UQVA 1EB1H 1P2OA 3FP8E 1KTSB 3M3SA 2TBSA 2PKAA 4X6PA 1TYNA 2KR7A 1FV9A 3MO3A 1OP2A 3U28C 4WMDA 1MCVA 1B5GH 2ZGJA 2J94A 3KQBA 2ZF0H 1GBAA 2EI8A 2VB0A 3M7TA 4CHAB 1YCPM 4B2BA 1QZ8A 2Y5GA 1OWEA 3EE0B 1V3XA 1L1JA 4ABIA 4LOYH 3ATLA 5DP7A 3A7ZA 4LZ4B 1SQRA 2J98A 1KMHB 1O2RA 1DUEA 4CRDA 1RXPA 3MNBA 4NCYA 2ZU5A 5HGGA 5HKKD 3SZEA 2AH4X 1YCPH 1V2QT 2YNBA 2VWNA 3T62A 1FN8A 4A6LA 1O2JA 2ZDNA 2VVUA 1Z71A 4Y6DA 3N7EA 2VJ1A 4RI0A 4NA9H 1O5CB 3SBKA 1MD7A 1YPHC 1V2ST 3BTTE 4O03A 2FMJA 3MNSA 5C3NA 3L33A 4YOIA 1O2ZA 2ZI2H 3F3BA 2BOHB 1T4VH 5AFZH 1IQGA 2QF3A 2A4RA 1G36A 3FZZA 1YPMH 4JZ1A 3KL6A 1TPSA 3MH5A 3VEQB 2C8YB 1BTYA 4ACBA 2PGQB 2BZAA 2K8IA 1OPHB 1UTNA 4ZHLU 1SGQE 1PPCE 3KQ5A 4F4OC 3A80A 5JBCS 3KQCA 1UVPA 5EJZA 1QL7A 1UTPA 2QXJA 2LP6A 3A89A 3U8OH 4TWYA 1MZDA 1VGCC 4O3TA 1TWXB 1L4DA 2VGCB 1AHTH 1AU8A 1SGCA 2G4TA 1K1NA 4ABJA 1C2LA 1LHEH 3VB7A 1TRMA 4DIHH 3VB5A 5L2YH 1GMDG 2PKSC 2OTVA 5TJXA 5HYOA 1O3AA 1K1MA 4FUJA 1QQ4A 1PQ5A 1GHYH 3ZVEA 4B6FA 1C5MD 1CGHA 5EPNA 3SU6A 1AO5A 4OGXA 3FOAA 4NA7A 4Z6AH 2P3FH 3SORA 3H7TA 3RXRA 1NFUA 1C4V2 2RA3A 1BIOA 1QBVH 1YLDA 3LU9B 4K1SA 5GCHF 2OUAA 2ODQA 1ELTA 2FYQA 1SPJA 3E0PB 3HKIB 1HAIH 1O39A 3QGJA 2UWPA 4HFPB 3RXGA 2QF0A 3F68H 3UOUA 1PPHE 1QB9A 1NRRH 1GMDF 1XUKA 2FOCA 4NFFA 2R0LA 4DG4A 1K1LA 1G9IE 1SFQB 1Q3XA 2ZFTA 1RJXB 3M7QA 4YXWD 3F6UH 1XUIA 1MAXA 1C5QA 2AHME 1O2KA 1XUHA 3N7OA 2BY7X 1GHAG 1GI0A 1SQOA 3RC4A 2ESTE 1CHOF 2Y5FA 1P10A 5EXNA 1TNKA 3N99A 1A1RA 2CXVA 3SZNA 3LJOA 3U98H 1C5YB 4P02A 1GBMA 2UUJB 3SYJA 3UOPA 2A2QH 4K3JA 1Y5AT 4FUFA 4X8VH 3SJKA 3KYGA 3F9FA 4GUXA 1EAUA 1O5AB 3T5FH 4Y7AA 1CSOE 4OS4A 1GBLA 4IMZA 2ZQ2A 1LQDB 1V2OT 3RXFA 1JIMA 1SLWB 3RM0H 4BTUB 4DY7B 5FCRA 1QJ6B 4VGCC 3W94A 3AW0A 3ESTA 2F9BH 1ESTA 1SFIA 4NA8A 1H1BA 1W8BH 2L6OA 3A82A 3BV9B 3FFGA 3M5MA 1C1RA 1BTPA 4ABDA 2SGQE 3SO3A 3RXDA 2XWBI 2ZDLA 4YTAA 3PV5A 3GCHB 5KGOA 3KNXA 4AFQA 4YM9A 1GGDB 1AFQB 4NSYA 1DFPA 2FODA 3KHVA 4E05H 1KXCA 2TIOA 3QN7A 3GDVA 1UTLM 4AORA 4BANB 3S9CA 2ZHWH 2TRMA 4B76A 2Z9GA 1P2MA 1OWDA 4A5TS 1C1UH 1EASA 3TK9A 3CS7A 3QO6A 3MU4A 1C1SA 4NZLA 3P8OA 3NXPA 8LPRA 2Z3DA 1AMHA 1ELVA 5FPYA 2BX4A 2ZU3A 2ZFFH 2VH6A 3PWBA 1UTKA 1O2OA 1SC8U 3ZZ8A 1G30B 5E0HA 2Q1JA 5DKMA 1MABB 2NU4E 1TBZH 1ZJKA 1SG8B 1S0RA 4Y7BA 4K1EA 1GI4A 5DGJA 2BD2A 1GL0E 1YPHE 1GBJA 2VIQA 2XBWA 4YLQH 1Y8TA 2WPKS 1COWD 3A7WA 4CBOA 1TBQH 1B0EA 4B2CA 1H8HD 4CREA 1O30A 1WV7H 2A4QA 1O2MA 1DITH 2BY6X 1P09A 3SHCH 1A0HB 1GI7B 4OS1A 5FCKA 5LPFA 3QWCH 2AS9A 2Y5HA 3K9XB 4Z0KA 4ABEA 2LELA 2BD8A 2B9LA 1QRWA 4MNVA 1O3EA 1XKAC 1GBKA 3AAUA 4NWLA 1ZSJA 1BRAA 3SJIA 1C1VH 2Y81A 2FS8A 1O3IA 1H9IE 3SNEA 3QLPH 3SQHE 2ASUB 3MQKC 1BRCE 4ZKSU 3GCOA 4H6SB 5GWZA 3VB6A 1XVMA 3RC5A 1B0FA 1NBMD 1TGBA 4FUIA 2GTBA 5T6FA 4FXGH 1GHZA 2ALVA 3NKKA 1O2LA 1WTHD 2BD9A 4IBLH 2SNVA 4ZKRU 1QR3E 1A5GH 1W0KD 2QE7D 5HXFA 3SGBE 2IPHA 2XRCA 1KLJH 4KTSA 1QIXB 1BA8B 2OP9A 2P59A 3BG4B 4XD7D 1ZJDA 1E34B 3TGIE 1GMHG 4X2XA 4TY6A 5C94A 2FO9A 4X1PU 1HIAA 2AYWA 1DT2A 2B8OH 3SJ9A 2YNAA 3ZZ6A 1C5ZB 1MKWH 3ZVBA 1AD8H 1W7GH 1ANDA 3V0XA 1W0ZU 2Y7ZA 2KCAA 4AX9H 1JRTA 1O37A 4NG9H 4A1TA 1THRH 5CE1A 3M35A 2ZFRH 3TK5A 1SI5H 2A5AA 1EAIA 1QURH 1WQVH 1PFXC 3DT0H 4Z1MD 1EXFA 1C1PA 3ZVDA 1AWHB 5GXPA 2PTCE 1CA8B 1S5SA 1GJ7B 2QF5A 4MNYA 1TONA 3MOCA 3SGAE 1IQMA 4HG6A 1QB6A 4BOHA 1XUGA 4X6NA 1FIWA 1BTXA 3GYLB 1C5RA 1S82A 4Y8ZA 4BAKB 1LHGH 6GCHF 1TX6A 2STBE 4X8UH 1LHCH 3L6PA 3ATKA 4Q4LA 1IQNA 5H4IB 1UTQA 2D2DA 3HK3B 1MZAA 3I29A 2G81E 2A7CA 4MNWA 1O2UA 2FDAA 3ZZ9A 1JMOH 2YMSD 1CVWH 5ESBA 4K8BA 1GJ4H 4I31A 2ZU4A 1FONA 2F4LA 5EOKA 2ODYB 4OGYA 1A0LA 3MH7A 1HAVB 3F9GA 2HGTH 1DSUA 2GCHG 1GMHF 3S0NA 1ZHRA 3GICB 1ZPCA 2PSXA 1AB9B 1PQ7A 3TVJB 2G52A 5BPEA 1V2RT 2B5TB 1GBTA 1PQAA 4I8GA 1ANBA 4WWYA 1C5OH 1SHHB 2W7UA 1MUEB 1YYY1 2FX4A 3TH3H 2XNDD 1W0JD 2D26C 1P2NA 2OLGA 2EI6A 1SVPA 2W5EA 1HAYB 1IAUA 4AG2A 1S84A 3RU4D 2HNTF 2QCYA 3F2HA 1EJAA 1YPJH 3GDUA 3P8NA 5EQRA 1TQ0B 3OFND 5B6LA 3SU4A 2WPDD 2OINA 3BTQE 5FX6A 1THPB 3RXVA 1EP5A 2B0FA 4X2YA 4FOUC 1ZGVA 1GI2A 2UWLA 4JCNA 5PTPA 1CQQA 1ZTKA 3PRBA 2F83A 1E37B 2SGAA 4AFSA 3SNCA 4X2VA 3AASA 1V2UT 5FPTA 5T3HA 1BBRE 1QRXA 4U2WA 3FAOA 2FS9A 1EAXA 4HI3A 1IQLA 1C1TA 2PUXB 1QL8A 1MCTA 3P17H 4IC5A 2W6ID 4FUHA 4OM9A 2CF8H 3BTEE 3A88A 4AFUA 1L1GA 1UVSH 5TCCA 3NK8A 1C5SA 1A46H 1VZQH 5I25A 1HDTH 1BMAA 1EPTC 1PYTD 4ZROA 1UK2A 2NU1E 3A8CA 1WCZA 4YOJA 3E16B 3W95A 2BY9X 2CK3D 1QBNA 3B9FH 3GY6A 4O3UA 5A8YA 2BZ6H 1P3CA 4ZKOU 3GDSA 3DD2H 1BRBE 4I7YH 3LH3A 2WV4A 2G55A 1G3DA 1CGJE 4DW2U 1VITH 1AFEH 1FLEE 1GBHA 1J16A 1Z8JB 2SGFE 1P12E 1P2JA 2FOBA 4X1RU 1TRNA 5J4SA 1JIRA 3BTFE 1BZXE 5L2ZH 1O3MA 5JB9S 1SMFE 4J1YA 2ZG0H 2A32A 1CE5A 1BMLA 3S9BA 3A7TA 1YCPK 1YBWA 4Y8YA 1T8NA 2WV9A 1HLTH 1P2QA 4GHTA 1C2HA 1DPOA 2Q6DA 1XUFA 1YLCA 1FNIA 3M7UA 3RU4E 1MH0A 1DLKB 4DOQA 2L74A 3MH4A 4J2YB 4E06H 1DVAH 3RXCA 4MNXA 1DANH 1LMWB 3H7OA 1XM1A 2V3OH 3UFAA 5FXLA 3E1XB 4A7IB 1O3DA 3VFEA 3GS9A 3E8LA 1GVLA 3MU5A 3RU4T 1GJ6A 1AZZA 1HJAB 1ZOMA 2K0QA 3F0PA 1TE0A 1E0FD 1GVKB 4AZ2B 2NU2E 1P2KA 1YWUA 2GCTB 2C90B 1YPKH 3LDXH 2ZCLP 3JZ2B 3PLPA 1NROH 2FWWA 4RT1A 1E1QD 1DUAA 1AE8H 1O3HA 1ABJH 2OBOA 1L4ZA 2QYIA 1N8OC 6ESTA 1GDQA 3PLBA 2VIOA 4BXWA 2C8XB 1W11U 1EP6A 1TX7A 1SGEE 3RXPA 3NWUA 2DE8A 3HKJB 2JJ1D 1AE5A 4A1VA 1ZLRA 3M5OA 3RC6A 1FAXA 1K28D 3ZZAA 3MNCA 1W0YH 2ZFSA 3OEED 2HLDD 2ZTZA 1MBQA 3PMHB 4D76A 4Q7ZA 1XKBC 3ATMA 1EB2A 1JOUB 1T8OA 4BNRA 3URDA 4JZEH 3FO8D 4D9QA 1RIWB 1NESE 2ZECA 1TB6H 3P8FA 4I8HA 3M36A 3E90B 3O8CA 1HAVA 3EAJA 5DN6D 1C4Y2 2CN0H 1WSSH 3IG6B 1SOZA 1QTFA 2YMSC 2P16A 2J97A 1P9SA 4ISLA 5I46H 1SGIB 1OHHD 2VWMA 3D65E 1BCUH 2HRVA 2R0KA 2ZNKH 3E6PH 4OS6A 3F9HA 2BB4A 3F9EA 2ZHDA 4YESB 5K7RA 2RG3A 2WSSD 2FX6A 1AQ7A 1DWEH 2OK5A 3LJJA 4UE7H 5C1XA 5A0AE 2GD4B 2HVXA 1O3NA 1O3LA 1W12U 4GCHF 6LPRA 1V6DA 2ZPQA 3S7KB 4BAMB 4RKJB 1KLTA 3P6ZB 1AN1E 1IQEA 5DP5A 4JK5A 3SUGA 1K1OA 1NS3A 2VIVA 2PW8H 4BTIB 3E0NB 5C0UA 3VG8A 2PV9B 2JIZD 2A4OA 4K5ZA 2IOTA 1P03A 4AB9A 2ZQ1A 1W3CA 4NWKA 5DO4H 1HXEH 3EA9A 3PB1E 3MO9A 1T32A 1GGDC 1AY6H 2CHAB 3Q76A 4LZ1H 2Z9KA 2ZCHP 3QUMP 3GCHC 1A5HA 3OEHD 4ZXYH 3ZYDA 1D3TB 3SNDA 2QA9E 3BG4C 1C2JA 3ZV9A 1HJ8A 3E3TA 1HB0B 1K22H 1LKBA 3GY5A 1FY4A 1MMJN 4JYVH 1QA7A 1W13U 4IN2A 1XVOA 1O2PA 2P3TB 4B1TA 3M37A 4TYDA 1ESBA 2BQ6B 4ZMAH 4NGAH 1QGFA 1V2VT 5HMAA 4Y0YE 1AVXA 1GCTB 4H4FA 3RUOA 1Q2WA 1AVGH 4CR9A 1UK4A 1Z8IB 2J95A 3T26A 1LPZB 1SL3A 2F9OA 1V2KT 1EZQA 1QB1A 2O8MA 1SGFG 1JRSA 3VGCB 5DP9A 1G3BA 2AERH 3OX7U 2FLBH 1C5UA 1ID5H 3RXOA 1ZMJA 5A8XA 2QXHA 2ULLA 1PPZA 2CJIA 2VBCA 2BDBA 3AVZA 2EI7A 4DGJA 2FIRH 1ELGA 1K1IA 3UUZA 2VU8E 3BTWE 5ESTE 1DOJA 1GBEA 1VCWA 5AHGH 1D3QB 5EXLA 1ZMNA 5CMXH 1KLIH 3LGUA 2O9QA 3WY8A 3M61U 5HM2A 1LO6A 2O8UA 2BM2A 1OYQA 3ZZDA 5DG6A 1TLDA 1C5LH 4GPGA 2JDID 4K2YA 1GJDB 1FY5A 3GCTG 1DM4B 4Y10E 2ANKH 1GHVH 2UUKB 1QJ7B 1TA2A 2HPQH 2I6SA 2FEQH 3WWFA 1LHDH 3TJNA 2PUQH 1P0SH 3OYPA 3LC3A 2PFEA 4XSKU 3ZIAD 1E79D 2AMPA 1O3KA 1CBWC 3GY7A 5EIYA 2VWLA 4RSPA 4X6MA 4XBCA 2FTMA 1EOJA 4CH8B 4U01A 4AC9A 1QFKH 1MBMA 2KCPA 1ARBA 2BVSH 1OWKA 4UFGH 2UWOA 3GCTF 3RXIA 1GHAF 2Z9LA 1O31A 2H2ZA 2J38A 3U8TH 1S0QA 2GDEH 3SI4H 3BTME 1JWTA 3EA8A 5F8XA 1GI5A 2ODPA 2Y7XA 1RFNA 1C5VA 1J15A 5EXMA 2ZU1A 1TAWA 4X1QU 1RIWC 1NRSH 4K1TA 1TALA 2ZDAH 1HBTH 3QZQA 1UCYK 4ZKNU 4NIYA 1BDAA 1RS0A 2EC9H 2AGIX 1UCYE 4I8JA 2NWNA 2ZGBH 1FN6A 4TT3D 1PQ8A 1SGYE 2AIPA 3GOVB 1WTGH 2AGGX 4IW4E 3UY9A 3A87A 1AWFH 2DUCA 2ZGXH 4RKOB 1SLUB 2ZZUH 3Q3XA 4B71A 1EJMA 2XC0A 1H4WA 3P8GA 1C1WH 4UD9H 1MTVA 4TWWA 1J9CH 2ZHFH 2BVXH 3U1JB 2ZDKA 2J5UA 1A2CH 2SGPE 4ISHH 3ZZBA 1SQAA 3BIVH 1MTWA 4YZUA 7ESTE 4MQAA 2C8ZB 2ZPRA 1BOQA 3NPSA 2OC7A 5IDKA 4AGJA 4AYYB 3LONA 1HAXB 1GMCF 4MLFB 7GCHF 2V3MA 1N6YA 5EW1H 2HPPH 2AMDA 1Z1JA 4M9FA 1C2MA 1HAHH 1HAOH 2PWXA 2RFKC 3NRLA 4DT7B 2R9PA 1EUFA 1AI8H 2GDDA 4FVDA 3GCNA 1QCPA 4HTCH 3STIA 1Z8RA 1O32A 2XOKD 5EG4A 5HIYA 1UMAH 3LGVA 1WOFA 1KXAA 3A7VA 1EJNA 3LGYA 1SGPE 4THNH 1IQHA 1TOCB 4JMYA 1EFRD 3CENA 4A92A 4XOJA 1DY9A 8KME2 2QF4A 3LGTA 1WU1A 3MU8A 1K21H 1FXYA 2BD3A 1Q31A 1GCDA 1NFWA 2QV1A 2BMGB 1GG6C 3PMBB 3MMGA 2GX4A 1IQKA 1MU6B 1OWIA 2FOMB 5EU8A 2THFB 5JPMH 5ABWA 3DUXH 3SV8A 1Y3WA 3LGWA 1CBWB 3RXSA 4AOQA 2K1QA 3UAIC 1EZSC 1ANEA 2F9PA 3RDZA 1NRPH 1VJ9U 1YGCH 5EQSA 3TGKE 1LPKB 2C8WB 5C5OA 2KZ4A 2ZA5A 2PGBB 5GDSH 1AKSA 1O3FA 1NU7B 3DA9B 3S7HB 3VPKA 1C1MA 3FN8A 1LVMA 4AFZA 1LTOA 1EPTB 1YKTA 1TFXA 1DXPA 4I8KA 4FU9A 1P02A 1F0RA 1GWAA 1KIGH 1SKYE 3BSQA 3PROA 1O0DH 1FQ3A 2VIDA 3DHKH 3V12A 5G4BA 2Z9IA 5C20A 3SV6A 1E1RD 2Y82A 1IQIA 3N7DA 3TJVA 2BQWB 1CA0B 1BHXF 3P95A 1NTPA 3EYDA 1ZPBA 1ZYOA 4WXVA 4BXSA 1GBBA 1NT1A 3SUEA 4AB8A 1GHBG 2ZEBA 2P8OB 4XE4A 1YPLH 4CRAA 1GHWH 2A2XH 1AIXH 2QY0B 2FOAA 5JYIA 2WPHS 1NY22 2FOGA 4FETA 5C2ZA 1G3EA 2AEIH 3ZVFA 1D6WA 4YLUA 3RXHA 4UFDH 3SW2B 1ELBA 3TGJE 3FANA 2KFWA 1O2XA 4B74A 1TGNA 1D4PB 3DSPA 3PLKA 4WMFA 4E7RG 4U30A 1EQ9A 3RXTA 1VR1H 1C5TA 3KN2A 1QBOA 1SQTA 1TMUH 4GHQA 1O3OA 1O33A 2TGAA 3A85A 3UWJH 4MPXA 4YOGA 2ZGHA 1GBFA 5E0JA 1KXEA 1Y3VA 3O8DA 3T25A 2IPQX 2Y80A 3Q3YA 4JZIA 2XBYA 3FKSD 2VNTA 4OS7A 4ESTE 2PLXA 4FUGA 4E7NA 6CHAC 1KY9A 2GCHF 1KSNA 4DVAU 2FI4E 1S6LA 4B6EA 3SU3A 1V2LT 3UREA 4ISOA 1VKYA 1HFDA 5ETXA 2C4FH 2VVCA 1F2SE 2M5TA 2DE9A 5GIBA 5T6GA 3TU7H 3UTUH 3SNBA 1EOLA 4D9RA 1C1NA 3WW7A 4TSFD 1UCYH 1ZHMA 3LPRA 1DWDH 2GCTC 4ABFA 1GHXH 1QNJA 1F5KU 3FP6E 1MTSA 5EJ1A 3EQ0H 1UJ1A 2A31A 3D23A 5EQQA 4SGAE 1PPBH 3M5LA 3K2UA 2GV6A 4ABAA 1NM6A 6GCHG 1CHGA 2BD4A 2VIPA 4TPYA 2JKHA 1MKXK 3OSYA 1FJSA 1P04A 1TX8A 1F0SA 3OU0A 4INKA 3V13A 3I78A 1HAZB 4NFEA 4RT0A 2A7HA 1O5FH 1OX1A 3ZZ7A 1VGCB 5GNDA 2GVFA 3AK5A 3UNSA 4IN1A 1SB1H 2BDGA 1ZMLA 3O8RA 3QK1A 1P06A 5C5NA 5A0BA 3MU1A 4GVUA 3SI3H 2J2UA 1O5DH 1OYTH 2CMYA 4NIVA 1BT7A 4R8TB 2C93B 3TJOA 5BRRE 3T29A 1O2SA 2BHGA 3HPTB 3LGIA 3RXMA 4ASUD 2KAIB 1O3JA 2OC0A 3RP2A 2J34A 1ZR0A 1ZTJA 2HALA 2O8WA 3BTGE 4I32A 1TNLA 4CRCA 4H6TA 4AN7A 3EE7A 3IITA 4DURA 1SGFA 3A83A 1WYKA 1MKWK 3AAVA 5CHBA 3UWIA 3WWBA 1FY3A 1BQYA 4MG3A 1YPEH 1UVOA 1NC6A 4LXBH 1GDNA 3UB0A 2XBXA 5A8ZA 2R2WU 2J98B 1HIAB 3URCA 1PJPA 1LHFH 2BD7A 3IWMA 3SN8A 4Q7XA 3SGQE 1MKXH 2P8OC 3ZVGA 1H8IH 5IYTA 1OXGA 3VXFH 1Y5BT 3QDZB 3S69A 2GMTB 2ZDVH 1HRTH 1ELAA 1N1LA 1A5IA 3C27B 3TNSA 5J4QA 2H9HA 3KIDU 3QGNB 1ANCA 2CV3A 5F53A 2Z7FE 3SOSA 2QGRA 3GY4A 1A4WH 3BTDE 1NBME 1H9HE 5F8ZA 1K9OE 1UTOA 1CGIE 4WF8A 2P94A 4BAOB 3SU2A 1D3PB 1HGTH 1SOTA 2FI3E 1HAGE 2XBVA 2PHBA 2IJOB 4MTBA 2HLCA 1H9LB 3R0FA 2H1UA 2FZZA 2WINI 5EODA 5LH8A 1BJVA 1HUTH 3TLOA 2A0QB 1ORFA 5DP8A 1QQUA 1QJ1B 1F0TA 1CHOG 1ELFA 1BTWA 5IK2D 1GI1A 1D3DB 1UK3A 2GP9B 1WUNH 2OC1A 3STJA 5GCHG 1C4U2 1DLEA 1VITF 1YM0A 3ZV8A 3PV2A 3U1IB 4Q63A 5HIZA 2R3YA 3PMAB 3BEFB 2SFAA 1OS8A 2RDEA 2GKVE 3K6ZA 1FI8A 3UPEA 7LPRA 1O36A 1MQ6A 3KF2A 3BG8A 4HGCA 1TGTA 2EY4C 3Q3KA 4NIXA 1PPEE 2OBQA 1FUJA 2W26A 1FY1A 2WYGA 3LKWA 4KGAA 3KCGH 1HNEE 1XUJA 2HOBA 2ZHQH 2W7SA 3QX5H 3M3TA 1O2WA 1EKBB 1BBRH 2ZU2A 1V2JT 2HNTE 1GI6A 2D8WA 3M3VA 1TMTH 1A3BH 1P11E 3R3GB 5C1UA 2STAE 3M5NA 3QTOH 3SQEE 1HYLA 1DS2E 1C1OA 2ZTXA 1P8VC 1V2TT 3DFJA 2BYAX 1TPPA 4UFEH 1OOKB 4CRGA 1CU1A 1HJ9A 2H9EH 5E2PA 1KXBA 4UEHH 4VGCB 1OSSA 1ARCA 1ELEE 2YMSB 1ACBE 4LK4A 2P95A 4I33A 4ISNA 1ZRKA 1DDJA 1PPGE 2JJ2D 3VGCC 1P3EA 2A5IA 4QT8C 1JBUH 1NN6A 1C2DA 2WUBA 1YY3A 4MPUA 3RLWH 1LVOA 2TGDA 2XTTB 4U32A 5DJ7A 1ZGIA 2OQ5A 1SLVB 4B73A 5L6NH 5F8TA 1ELDE 5C67A 2OQUA 3PM3A 3KEEA 1KTTB 1G3CA 1A0JA 2EQNA 2GJGA 1DY8A 4X6OA 1ZSLA 1O34A 2FOEA 2J9NA 7GCHG 8ESTE 3MWIU 2Z9JA 4AG1A 3A84A 1Z1IA 1IOEA 2ZC9H 1KDQA 2VIWA 4FUEA 2QC2A 2BQ7B 5A09A 1HPGA 1FX0B 1SGDE 1F92A 2GMTC 4Y0ZE 4ZAEA 1NPMA 3F1SB 2XC4A 2EA3A 5EPYA 3GYMA 2Q6FA 2RDLA 5AVDA 1E38B 1LDTT 1MD8A 1TNHA 2JETB 4X8TH 1NRQH 1O3PB 1QL9A 4WH6A 2SGDE 3CNRA 1S83A 2ZP0H 2BOKA 3ENSB 4OS2A 1G37A 3MO6A 2GT8A 1ABIH 2AFQB 2BXUH 9LPRA 2D1JA 1BUIA 3EDXB 2BDAA 3GY2A 2F91A 2FLRH 1TQ7B 1ZSKA 3OY6U 3C1KA 3LOXA 1BMMH 1TNIA 1O5GH 1T31A 1UHBB 5FAHA 1YPGH 5JDUB 1O2QA 1FIZA 1VITG 1ZRBA 2H9TH 1INCA 2FOFA 2VH0A 2WPJS 3ZVCA 4CBNA 1GL1A 1QA0A 2H5DA 3ZYEA 4KTUA 4IMQA 3AW1A 3ZZ4A 1NO9H 1FPCH 1V2MT 1RD3B 4KKDA 3ZZCA 4KELA 1GJ8B 2WPLS 3RM2H 2XCFA 1S6FA 1GVZA 1B7XB 1H8DH 2A45B 4TY7A 2O8LA 2WYJA 4YO9A 1BTHH 1C5PA 2XW9A 4INLA 1EATA 4HZHA 2WPMS 4Y76A 3O8BA 6CHAB 1K1JA 2NU3E 3VB3A 1C2IA 2ANMH 2ZTYA 1UVTH 1T8LA 1DX5M 1SGNE 3I77A 3MH6A 1YP9A 5CHAC 3PWCA 1D9IA 2UUYA 1GG6B 4ABHA 1O3GA 3RXUA 1TRYA 2ZCKP 1C2FA 2XC5A 4SGBE 3RXQA 2QN5T 1WDIA 2UUFB 2NU0E 4UFFH 2AIQA 3ODDA 3UQOA 5FBEA 3B23B 4B75A 4OS5A 3RMOH 3QTVH 3BTHE 4ZXXH 4M7GA 4FUDA 1TPOA 4WH8A 2W3IA 1Y3UA 2HNTC 5E0GA 2ZIQH 2ZKSA 3FP7E 5EGMA 5LPEA 4JYUH 3G01A 1A61H 1DE7H 1SHYA 2QXIA 5GPIB 1W14U 2ZPSA 2F9UA 1OP0A 1VCQA 1QHRB 1ZTLA 1DWBH 3EA7A 5JBBS 1WBGB 3SV2H 2FI5E 1GI3A 3PO1B 1P9UA 2HWLB 3OTJE 8GCHG 4MPWA 3SUFA 1C5NH 4Y11E 1LQEA 3GISB 5HM9A 2LNCA 3NZIA 1EZXC 3RXLA 2OCVB 4ASHA 2BLOA 2FM2A 3W1EA 2WPIS 1DXWA 1CA0C 2KX4A 2OXSA 4WJG2 4ZUHA 3LH1A 2R2MB 2H5CA 3SUDA 1TIOA 2Z3EA 2WZQA 1GCTC 2H6MA 4DJZB 2HVYB 2AGEX 3ELAH 2OD3B 1H8ED 3DSGA 4FUCA 1BRUP 2ALPA 2BLWA 2BX3A 2PP6A 2FP7B 2A4GA 9ESTA 4XFQA 3SV7A 2BDCA 2XWAA 4X8SH 3RXJA 3A7YA 2G5VA 3UNQA 1ZZZA 3RLYH 1GJBB 1O2NA 5AF9H 2FOHA 3U9AH 2ZFPH 1Y3YA 4YT6H 5E2OA 1PYTC 1SBWA 3ITIA 5DPAA 2V35A 1Y5UT 3H09A 1GJCB 4GCHG 2KM0A 3OY5U 2ZFQH 1T7CA 1YLNA 3A8BA 1EPTA 1M9UA 2GT7A 4ZH8A 1N6XA 1D6RA 1E36B 1KXDA 1UHBA 3ATWA 2BD5A 3SU1A 5KEDA 3A7XA 3K65B 2BDYA 2BVRH 4NZQA 3PTNA 1Z6EA 2FYRA 4GLYA 1SR5C 1O3CA 2A7JA 4Y71A 2F43B 2WUCA 2PSYA 5JB8S 2GZ8A 1EX3A 1TNGA 3F0OA 4Y8XA 4ISIH 1A3EH 1AZ8A 2BTCE 1XMNB 2XNIA 3UR6A 1Y3XA 1J14A 5DK1A 4RN6A 5DP3A 2W6JD 4I8LA 2GV7A 4Q7YA 4FU8A 2JH0D 4B2AA 2RCEA 4INHA 2BDHA 3VB4A 2V3HH 3BEIB 1HCGA 3D49H 2GGVB 1J17T 1V2PT 4O9VA 1XXDA 4ZHAA 5L30H 3UR9A 1F0UA 2BDIA 1RGQA 1S81A 1C2GA 1BB0B 3DFLA 1C9TA 4ABGA 1LVBA 5LPRA 1U6QA 3PTBA 1TBRH 3U69H 3RMLH 1KYNA 3DSOA 3E91A 3ZZ5A 4XBBA 1O2TA 3TITA 1ETRH 1V2NT 4CHAC 2R3UA 1TGSZ 1HV7A 3P70B 4AYVB 1W2KH 4NIWA 2ZO3H 4XRNA 4XDEA 3PMJA 4CRBA 4ACAA 1GPZA 1V2WT 3HGNA 5CDFE 3MI4A 1ETSH 4KP0A 3MNXA 2F9VA 2BLQA 2G51A 3HGPA 3RXAA 2RA0A 1O2YA 1L1NA 1FMGA 2Z94A 1RRKA 1AUJA 4F55A 1N8OB 5DP4A 3P92A 5FPSA 1PPFE 1LCYA 3SNAA 3TIUA 1O2HA 3KGPA 3KQDA 4AGKA 1X7AC 2BLVA 3UIRA 5C1YA 1LKAA 4DT4A
chains in the Genus database with same CATH topology
1RTFB 2EEKA 1KXFA 1KDQB 2XXLA 1IQFA 1P05A 1F7ZA 3A86A 1UVUH 3TH4H 3SV9A 1MAYA 4FVBA 1ESAA 1RTLA 7KMEH 2Z6BD 2A5KA 3EGKH 1LVYA 3Q00A 4X1NU 3Q77A 1TMBH 3V7TA 3PV4A 1O5EH 4O97A 1DSTA 1P01A 4KTCA 4CH2B 4BAHB 4R0IA 1GBDA 1TABE 1ELCA 1GBIA 1FY8E 1Z7KA 1NRNH 1ZPZA 3MTYA 3GY8A 2GZ7A 2ZHEH 1WQSA 1W7XH 2PR3A 4F49A 3QZRA 1MQ5A 1O2GH 1IHSH 1C2EA 5AFYH 4CR5A 3PYHA 1AUTC 4BTTB 3ODFA 4JYTA 2ANWA 1A7SA 1XX9A 2TPIZ 4X0WU 1VJAU 3HK6B 1T4UH 5B6OA 2O8TA 3VXEH 5FBIA 2WV5A 1HJAC 1GMCG 1C2KA 1NU9A 2CHAC 2JH6D 1GBCA 1CO7E 4WVPE 2BY5X 4Q80A 3HATH 2GZ9A 1IQJA 3T2NA 1JXPA 3KQEA 2I6QA 3TPIZ 4WY3A 2C3SA 1NFXA 1NZQH 2ILNA 4JK6A 4Y79A 1UTJA 3BF6H 1DWCH 4K60A 4MDSA 3BN9A 1K2I1 2P93A 1T8MA 5A2MH 3MHWU 1UTMA 1TPAE 1QRZA 1O35A 2BY8X 1YC0A 5LGOA 2JH5D 2TGTA 1EZUC 1ZHPA 1Z8GA 2FXRA 4X2WA 1O2VA 3A8DA 5DP6A 5JBAS 2SNWA 1G2MA 3RMNH 1Z6JH 2VVVA 1HAPH 1BITA 2Z3CA 3BIUH 2B7DH 2YOLA 3B8JA 4UONA 1BBRK 1P2IA 1GI8B 2ZDMA 2TGPZ 4PROA 2ZGCA 3ATIA 1SSXA 1TA6A 1MU8B 2VWOA 1C5WB 1O3BA 3BTKE 4IS5A 3TH2H 1AFQC 1K1PA 3CS0A 1GJ5H 2LPRA 1CT4E 4D8NA 2FPZA 4FUBA 2Q6GA 1L2EA 5A0CA 1FZZA 1AVWA 1F5LA 1IHTH 3ZZ3A 3TJUA 3LC5A 3GY3A 5FHTA 2A1DB 1L0ZA 2AMQA 2V6NA 3NUMA 2XYAA 2G8TA 4K69A 2BXTH 2Y6TA 4CRFA 1G32B 3K6YA 1OP8A 1BTZA 1TGCA 3BEUA 1TNJA 4GSOA 4H42U 1S6HA 3RMMH 4DIIH 2SGEE 2QXGA 3SJ8A 1GHBF 1Y59T 4MPVA 2VGCC 3A81A 5T6DA 2PTNA 1C1QA 5FX5A 4WXIA 1OWJA 1P57B 2PKSB 2JETC 1OWHA 5K0HA 2G4UA 2PKAB 1VCPA 3L3TA 1MTNB 8GCHF 3TK6A 5E8EH 1NFYA 3CP7A 3RXEA 3MYWA 4YT7H 1ETTH 1RTKA 2G00A 5F03A 4ABBA 1FDPA 3ZVAA 1YF4A 2ANYA 1TOMH 1GDUA 2P3UB 4JZDH 1MTUA 1OKXA 3H5CB 4JZFH 1BMNH 3FVFB 2IN2A 5CHAB 3MU0A 1THSH 4XBDA 1HXFH 3T27A 1MTNC 1SLXB 3PO1C 2J4IA 1O2IA 4K8YA 2ZWLH 4GAWA 5TCAA 3FZDA 3T28A 1O5BB 2VINA 4NSVA 3RXKA 3MFJA 5EW2H 1S85A 3SU5A 4DCDA 1AKSB 1GI9B 1SGRE 1AB9C 1GJAB 1CT2E 1W10U 1C9PA 3D62A 1AGJA 2G5NA 2F3CE 1E35B 4D7GA 1WAYB 1BHXB 1DICA 1FAKH 1F5RA 2FTLE 1EAWA 1J8AA 4IC6A 2V0BA 3S9AA 1GJ9B 3JZ1B 1G2LA 2OC8A 1O38A 5JBTA 4ZHMU 1BJUA 4WMEA 1SGTA 1XXFA 2J92A 1BTUA 5SGAE 2KAIA 3TNTA 4BAQB 3UNRA 2CF9H 1UO6A 1LPGB 4IGDA 4Q2KA 3LIWA 3NCLA 4X1SU 3RXBA 3SU0A 3V3MA 3SHAH 3LT3A 4D7FA 4A1XA 4MVNA 1FPHH 3SJOA 4TPIZ 2W3KA 2QAAA 4FU7A 1CT0E 2F9NA 5F6MA 2XCNA 3A8AA 1QY6A 1C5XB 2CGAA 3U8RH 5GJ4B 4UDWH 2QIQA 2FESH 3UQVA 1EB1H 1P2OA 3FP8E 1KTSB 3M3SA 2TBSA 2PKAA 4X6PA 1TYNA 1FV9A 3MO3A 1OP2A 4WMDA 1MCVA 1B5GH 2ZGJA 2J94A 3KQBA 2ZF0H 1GBAA 2EI8A 2VB0A 3M7TA 4CHAB 1YCPM 4B2BA 2Y5GA 1OWEA 3EE0B 1V3XA 1L1JA 4ABIA 4LOYH 3ATLA 5DP7A 3A7ZA 4LZ4B 1O2RA 1DUEA 4CRDA 1RXPA 3MNBA 4NCYA 2ZU5A 5HGGA 2AH4X 1YCPH 1V2QT 2YNBA 2VWNA 3T62A 1FN8A 4A6LA 1O2JA 2ZDNA 2VVUA 1Z71A 4Y6DA 2VJ1A 4NA9H 1O5CB 3SBKA 1MD7A 1YPHC 1V2ST 3BTTE 4O03A 2FMJA 3MNSA 5C3NA 3L33A 4YOIA 1O2ZA 2ZI2H 2BOHB 1T4VH 5AFZH 1IQGA 2QF3A 2A4RA 1G36A 3FZZA 1YPMH 4JZ1A 3KL6A 1TPSA 3MH5A 3VEQB 2C8YB 1BTYA 2PGQB 2BZAA 1OPHB 1UTNA 4ZHLU 1SGQE 1PPCE 4F4OC 3A80A 5JBCS 3KQCA 1UVPA 1QL7A 1UTPA 2QXJA 3A89A 3U8OH 4TWYA 1MZDA 1VGCC 4O3TA 1TWXB 1L4DA 2VGCB 1AHTH 1AU8A 1SGCA 2G4TA 1K1NA 4ABJA 1C2LA 1LHEH 3VB7A 1TRMA 4DIHH 3VB5A 5L2YH 1GMDG 2PKSC 2OTVA 5TJXA 5HYOA 1O3AA 1K1MA 4FUJA 1QQ4A 1PQ5A 1GHYH 3ZVEA 1C5MD 1CGHA 5EPNA 3SU6A 1AO5A 4OGXA 4NA7A 4Z6AH 2P3FH 3SORA 3H7TA 3RXRA 1NFUA 1C4V2 2RA3A 1BIOA 1QBVH 1YLDA 3LU9B 4K1SA 5GCHF 2OUAA 2ODQA 1ELTA 2FYQA 1SPJA 3E0PB 3HKIB 1HAIH 1O39A 3QGJA 2UWPA 4HFPB 3RXGA 2QF0A 3F68H 3UOUA 1PPHE 1QB9A 1NRRH 1GMDF 1XUKA 2FOCA 4NFFA 2R0LA 4DG4A 1K1LA 1G9IE 1SFQB 1Q3XA 2ZFTA 1RJXB 3M7QA 3F6UH 1XUIA 1MAXA 1C5QA 1O2KA 1XUHA 3N7OA 2BY7X 1GHAG 1GI0A 1SQOA 3RC4A 2ESTE 1CHOF 2Y5FA 1P10A 5EXNA 1TNKA 1A1RA 2CXVA 3SZNA 3LJOA 3U98H 1C5YB 1GBMA 2UUJB 3UOPA 2A2QH 4K3JA 1Y5AT 4FUFA 4X8VH 3SJKA 3F9FA 4GUXA 1EAUA 1O5AB 3T5FH 4Y7AA 1CSOE 4OS4A 1GBLA 4IMZA 2ZQ2A 1LQDB 1V2OT 3RXFA 1JIMA 1SLWB 3RM0H 4BTUB 4DY7B 5FCRA 1QJ6B 4VGCC 3W94A 3AW0A 3ESTA 2F9BH 1ESTA 1SFIA 4NA8A 1H1BA 1W8BH 3BV9B 3A82A 3FFGA 3M5MA 1C1RA 1BTPA 4ABDA 2SGQE 3SO3A 3RXDA 2XWBI 2ZDLA 4YTAA 3GCHB 4YM9A 3KNXA 4AFQA 1GGDB 1AFQB 4NSYA 1DFPA 2FODA 3KHVA 4E05H 1KXCA 2TIOA 3QN7A 3GDVA 1UTLM 4AORA 4BANB 3S9CA 2ZHWH 2TRMA 4B76A 2Z9GA 1P2MA 1OWDA 4A5TS 1C1UH 1EASA 3TK9A 3CS7A 3QO6A 3MU4A 1C1SA 4NZLA 3P8OA 3NXPA 8LPRA 2Z3DA 1AMHA 1ELVA 5FPYA 2BX4A 2ZU3A 2ZFFH 2VH6A 3PWBA 1UTKA 1O2OA 1SC8U 3ZZ8A 1G30B 5E0HA 2Q1JA 5DKMA 2NU4E 1TBZH 1ZJKA 1SG8B 1S0RA 4Y7BA 4K1EA 1GI4A 5DGJA 2BD2A 1GL0E 1YPHE 1GBJA 2VIQA 2XBWA 4YLQH 1Y8TA 2WPKS 3A7WA 4CBOA 1TBQH 1B0EA 4B2CA 4CREA 1O30A 1WV7H 2A4QA 1O2MA 1DITH 2BY6X 1P09A 3SHCH 1A0HB 1GI7B 4OS1A 5FCKA 5LPFA 3QWCH 2AS9A 2Y5HA 3K9XB 4Z0KA 4ABEA 2BD8A 2B9LA 1QRWA 4MNVA 1O3EA 1XKAC 1GBKA 3AAUA 4NWLA 1ZSJA 1BRAA 3SJIA 1C1VH 2Y81A 2FS8A 1O3IA 1H9IE 3SNEA 3QLPH 3SQHE 2ASUB 1BRCE 4ZKSU 3GCOA 4H6SB 5GWZA 3VB6A 1XVMA 3RC5A 1B0FA 1TGBA 4FUIA 2GTBA 5T6FA 4FXGH 1GHZA 2ALVA 3NKKA 1O2LA 1WTHD 2BD9A 4IBLH 2SNVA 4ZKRU 1QR3E 1A5GH 5HXFA 3SGBE 2IPHA 2XRCA 1KLJH 4KTSA 1QIXB 1BA8B 2OP9A 2P59A 3BG4B 1ZJDA 1E34B 3TGIE 1GMHG 4X2XA 4TY6A 2FO9A 4X1PU 1HIAA 2AYWA 1DT2A 2B8OH 3SJ9A 2YNAA 3ZZ6A 1C5ZB 1MKWH 3ZVBA 1AD8H 1W7GH 1ANDA 3V0XA 1W0ZU 2Y7ZA 4AX9H 1JRTA 1O37A 4NG9H 4A1TA 1THRH 5CE1A 3M35A 2ZFRH 3TK5A 1SI5H 2A5AA 1EAIA 1QURH 1WQVH 1PFXC 3DT0H 1EXFA 1C1PA 3ZVDA 1AWHB 5GXPA 2PTCE 1CA8B 1S5SA 1GJ7B 4MNYA 1TONA 3MOCA 3SGAE 1IQMA 1QB6A 4BOHA 1XUGA 4X6NA 1FIWA 1BTXA 3GYLB 1C5RA 1S82A 4Y8ZA 4BAKB 1LHGH 6GCHF 1TX6A 2STBE 4X8UH 1LHCH 3L6PA 3ATKA 1IQNA 5H4IB 1UTQA 2D2DA 3HK3B 1MZAA 3I29A 2G81E 2A7CA 4MNWA 1O2UA 2FDAA 3ZZ9A 1JMOH 5ESBA 1CVWH 4K8BA 1GJ4H 4I31A 2ZU4A 1FONA 5EOKA 2ODYB 4OGYA 1A0LA 3MH7A 1HAVB 3F9GA 2HGTH 1DSUA 2GCHG 1GMHF 3S0NA 1ZHRA 3GICB 1ZPCA 2PSXA 1AB9B 1PQ7A 3TVJB 2G52A 5BPEA 1V2RT 2B5TB 1GBTA 1PQAA 4I8GA 1ANBA 4WWYA 1C5OH 2W7UA 1SHHB 1MUEB 1YYY1 2FX4A 3TH3H 2D26C 1P2NA 2OLGA 2EI6A 1SVPA 2W5EA 1HAYB 1IAUA 4AG2A 1S84A 3RU4D 2HNTF 2QCYA 1EJAA 1YPJH 3GDUA 3P8NA 5EQRA 1TQ0B 3SU4A 2OINA 3BTQE 5FX6A 1THPB 3RXVA 1EP5A 2B0FA 4X2YA 1ZGVA 1GI2A 2UWLA 4JCNA 5PTPA 1CQQA 1ZTKA 2F83A 1E37B 2SGAA 4AFSA 3SNCA 4X2VA 3AASA 1V2UT 5FPTA 5T3HA 1BBRE 1QRXA 4U2WA 3FAOA 2FS9A 1EAXA 4HI3A 1IQLA 1C1TA 2PUXB 1QL8A 1MCTA 3P17H 4IC5A 4FUHA 2CF8H 3BTEE 3A88A 4AFUA 1L1GA 1UVSH 5TCCA 3NK8A 1C5SA 1A46H 1VZQH 5I25A 1HDTH 1BMAA 1EPTC 1PYTD 4ZROA 1UK2A 2NU1E 3A8CA 1WCZA 4YOJA 3E16B 3W95A 2BY9X 1QBNA 3B9FH 3GY6A 4O3UA 5A8YA 2BZ6H 1P3CA 4ZKOU 3GDSA 3DD2H 1BRBE 4I7YH 3LH3A 2WV4A 2G55A 1G3DA 1CGJE 4DW2U 1VITH 1AFEH 1FLEE 1GBHA 1J16A 1Z8JB 2SGFE 1P12E 1P2JA 2FOBA 4X1RU 1TRNA 5J4SA 1JIRA 3BTFE 1BZXE 5L2ZH 1O3MA 5JB9S 1SMFE 4J1YA 2ZG0H 2A32A 1CE5A 1BMLA 3S9BA 3A7TA 1YCPK 1YBWA 4Y8YA 1T8NA 1HLTH 1P2QA 4GHTA 1C2HA 1DPOA 2Q6DA 1XUFA 1YLCA 1FNIA 3M7UA 3RU4E 1MH0A 1DLKB 4DOQA 3MH4A 4E06H 4J2YB 1DVAH 3RXCA 4MNXA 1DANH 1LMWB 3H7OA 1XM1A 2V3OH 3UFAA 5FXLA 3E1XB 4A7IB 1O3DA 3VFEA 3E8LA 1GVLA 3MU5A 3RU4T 1GJ6A 1AZZA 1HJAB 1ZOMA 1TE0A 1E0FD 1GVKB 4AZ2B 2NU2E 1P2KA 2GCTB 2C90B 1YPKH 3LDXH 2ZCLP 3JZ2B 3PLPA 1NROH 2FWWA 1DUAA 1AE8H 1O3HA 1ABJH 2OBOA 1L4ZA 2QYIA 1N8OC 6ESTA 1GDQA 3PLBA 2VIOA 4BXWA 2C8XB 1W11U 1EP6A 1TX7A 1SGEE 3RXPA 3NWUA 2DE8A 3HKJB 4A1VA 1AE5A 1ZLRA 3M5OA 3RC6A 1FAXA 1K28D 3ZZAA 3MNCA 1W0YH 2ZFSA 2ZTZA 1MBQA 3PMHB 4D76A 4Q7ZA 1XKBC 3ATMA 1EB2A 1JOUB 1T8OA 4BNRA 3URDA 4JZEH 4D9QA 1RIWB 1NESE 2ZECA 1TB6H 3P8FA 4I8HA 3M36A 3E90B 3O8CA 1HAVA 3EAJA 1C4Y2 2CN0H 1WSSH 3IG6B 1SOZA 1QTFA 2P16A 1P9SA 4ISLA 5I46H 1SGIB 2VWMA 3D65E 1BCUH 2HRVA 2R0KA 2ZNKH 3E6PH 4OS6A 3F9HA 2BB4A 3F9EA 2ZHDA 4YESB 5K7RA 2RG3A 2FX6A 1AQ7A 1DWEH 3LJJA 4UE7H 5C1XA 5A0AE 2GD4B 2HVXA 1O3NA 1O3LA 1W12U 4GCHF 6LPRA 1V6DA 2ZPQA 3S7KB 4BAMB 4RKJB 1KLTA 3P6ZB 1AN1E 1IQEA 5DP5A 4JK5A 3SUGA 1K1OA 1NS3A 2VIVA 2PW8H 4BTIB 3E0NB 2PV9B 2A4OA 4K5ZA 2IOTA 1P03A 4AB9A 2ZQ1A 1W3CA 4NWKA 5DO4H 1HXEH 3EA9A 3PB1E 3MO9A 1T32A 1GGDC 1AY6H 2CHAB 3Q76A 4LZ1H 2Z9KA 2ZCHP 3QUMP 3GCHC 1A5HA 4ZXYH 3ZYDA 1D3TB 3SNDA 2QA9E 3BG4C