1DUEA

Crystal structure of exfoliative toxin a s195a mutant
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
242
structure length
242
Chain Sequence
EVSAEEIKKHEEKWNKYYGVNAFNLPKELFSKVDEKDRQKYPYNTIGNVFVKGQTSATGVLIGKNTVLTNRHIAKFANGDPSKVSFRPSINTDDNGNTETPYGEYEVKEILQEPFGAGVDLALIRLKPDQNGVSLGDKISPAKIGTSNDLKDGDKLELIGYPFDHKVNQMHRSEIELTTLSRGLRYYGFTVPGNAGSGIFNSNGELVGIHSSKVSHLDREHQINYGVGIGNYVKRIINEKNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin, hydrolase
molecule keywords EXFOLIATIVE TOXIN A
publication title Structural similarities and differences in Staphylococcus aureus exfoliative Toxins A and B as revealed by their crystal structures
pubmed rcsb
source organism Staphylococcus aureus
total genus 69
structure length 242
sequence length 242
ec nomenclature ec 3.4.21.-:
pdb deposition date 2000-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1dueA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1dueA01
1GI3A 2Z9KA 1FY8E 4MTBA 1TA2A 2D8WA 2G51A 1NZQH 1EZUC 1LVOA 1B5GH 3U69H 1EAIA 2FM2A 2XXLA 1GDQA 1TBZH 1HV7A 1LMWB 2BVXH 1C2LA 2ZFPH 5T6FA 4NA7A 2ZKSA 3PV4A 1UK3A 1UO6A 1BUIA 4AG1A 1UTPA 1IQLA 1W12U 1MCTA 1SB1H 1FDPA 2WYJA 1TX6A 1C5QA 2PSYA 4D76A 1GHWH 1RTFB 2BDIA 4IMQA 4INHA 1BRAA 1LPGB 4NWKA 4IC5A 3BEUA 4DG4A 2GZ9A 5IYTA 1HAPH 1GJ6A 2W7UA 4AYYB 3H5CB 1FLEE 4X2XA 3JZ2B 2ESTE 2ZGHA 3D65E 4D9QA 2PHBA 3STJA 3BG4B 4HI3A 3URCA 2OLGA 3ATIA 1QTFA 3GY3A 2BVSH 4K8BA 1FI8A 1O5CB 1HAZB 1TMTH 1PYTC 2QGRA 3SGAE 1TGTA 2BY8X 1O3PB 4YOGA 3RMNH 1P2OA 2HALA 3SGBE 2ZTZA 2Z7FE 4X8SH 2Y81A 5C2ZA 3E1XB 3BTME 4M7GA 1C1MA 4BANB 1TNIA 4UDWH 4YLUA 1NT1A 1D9IA 2PUXB 2BDGA 3MNXA 1O30A 3S69A 1FAKH 3ZZ9A 1LKBA 3TH3H 5DP4A 1ELAA 1UVSH 4LK4A 1NO9H 4JZFH 3SU3A 1QBVH 3U1IB 1ANCA 4ZMAH 4XBBA 2PGQB 3PM3A 3LGVA 3A83A 5K7RA 1QCPA 1FZZA 3RU4D 3UQVA 1MUEB 1U6QA 2VIVA 1CA8B 1Y3VA 2F91A 3IWMA 1FAXA 4AZ2B 2ZFSA 1EB1H 1PPGE 4J1YA 2BLQA 2ZI2H 1RRKA 1ANBA 1K1IA 5E0GA 3LU9B 1O5DH 1F7ZA 4LZ4B 1TGBA 1H4WA 2OXSA 4ZKNU 1AUJA 1C9PA 4U01A 3QGJA 3RXLA 1TAWA 1SGQE 4H6TA 1QR3E 3EA9A 3KHVA 2QC2A 1AVGH 1H8DH 1YPJH 3P8FA 4NFFA 4X6NA 1O3FA 2NWNA 4JMYA 4CRGA 1O5BB 1WV7H 2ODQA 4E06H 3PROA 5HXFA 1W0ZU 4RKJB 1AZ8A 5JYIA 1ZR0A 3BTFE 2ZU4A 2BVRH 2GV6A 1HNEE 4ZXXH 3MO9A 1EASA 5DGJA 2J9NA 2BM2A 4I32A 5HYOA 1ESTA 3BTEE 3STIA 4YT6H 3RMMH 2FDAA 4BNRA 1RD3B 4XOJA 1C5VA 1Q3XA 3UNQA 1CT4E 1V2RT 4UD9H 5JBAS 3SV9A 1FUJA 2HNTC 1GCDA 2ASUB 3BTGE 1HPGA 1ZTKA 2VIDA 1UTOA 3TNSA 2NU0E 1SLVB 4R8TB 1V2OT 1LTOA 1V2LT 4GLYA 4ISOA 4Y6DA 4Y71A 2GT8A 4WH6A 1C1QA 3ITIA 1GBDA 1M9UA 2AYWA 3TK9A 1Q31A 1ELCA 2VGCB 1DSTA 4JK6A 3K6YA 1RGQA 3RUOA 3GYMA 4IN2A 3RC6A 2XNIA 2IJOB 1D3PB 5BRRE 1P3CA 1BT7A 1FNIA 1V2QT 1MTNB 2Z3CA 1C4V2 1KTSB 2A4GA 2TGTA 1K2I1 1ZGIA 2BYAX 1S82A 3SV6A 3BV9B 4RKOB 3LIWA 1O3LA 2XRCA 5DJ7A 1AZZA 3EA7A 5AFYH 1JRSA 3MNCA 3W95A 5DP6A 4MNVA 1AFQB 3RU4T 2XBYA 1H8IH 1JMOH 2VGCC 4MNXA 5AHGH 5F8ZA 1DUEA 1TGSZ 3HPTB 1KYNA 3PO1B 3MU8A 1TNKA 4X6MA 1HAXB 3BEIB 2ULLA 1GHBF 1OYQA 1A5IA 3RXQA 1MTNC 1YPHC 1ZHPA 1D6WA 3FZDA 3GDVA 4XSKU 3UR9A 1ETRH 1QRXA 1O3DA 5DG6A 5FBEA 5HM2A 2V0BA 4X0WU 2Q6GA 1G3EA 1MTWA 4K60A 5E0HA 3SOSA 2FOCA 3UWIA 1O2SA 1S6FA 2LPRA 2PLXA 3BTWE 4Q80A 1LPKB 2ZZUH 2RA3A 1V2VT 4OS5A 1E36B 4FUDA 3PO1C 2BDBA 3IG6B 4HZHA 1GBEA 1G3BA 1P11E 1P02A 3KN2A 5G4BA 3LOXA 3FFGA 4H6SB 3VXFH 3SU6A 3SBKA 2A5IA 4D9RA 1O38A 3ATWA 4AFZA 1O0DH 4MPUA 3F9FA 2BX4A 1MKWH 3B8JA 1HCGA 3GY5A 1GVZA 1NFYA 3LDXH 2VVCA 3ZV8A 4B73A 1A0LA 1NTPA 2SGPE 3UNSA 1YPEH 4JYUH 3UTUH 1SBWA 2AMQA 3M5OA 3TITA 5FPSA 1GL1A 1C2FA 1VCQA 4Y10E 1BITA 2ZU1A 1GJ4H 3ZYDA 4ZROA 3RXTA 4FXGH 3M7TA 2F9BH 4GHQA 1V2UT 5A0AE 2OUAA 4NFEA 4TPYA 2P3FH 2W3KA 1UVPA 1PYTD 3P8GA 3P6ZB 1E34B 3HK3B 3NCLA 2VIWA 1TOCB 3GCTG 1C5NH 1NU7B 4YOIA 4K8YA 2A2XH 1CGHA 2FI3E 2G4UA 1A61H 4AORA 3E91A 5FCRA 1ZSLA 1Z71A 2H5DA 1UTLM 1GI1A 4GUXA 1ACBE 2ZDKA 8GCHF 3HKIB 1HAIH 4TY7A 2HPPH 2C90B 1KXAA 1THSH 1GG6C 1SPJA 2QXJA 1YCPM 2STBE 3T26A 1A1RA 5CMXH 3F1SB 4X6OA 3MOCA 4VGCB 1GHBG 2VIPA 5E0JA 3UY9A 1G3CA 1RTKA 4JYTA 2BD7A 1Q2WA 1KY9A 3RXRA 5A0CA 3T27A 3P17H 3A88A 1Y8TA 1SLUB 4AFSA 3CENA 1QRZA 1S85A 3OYPA 2SGFE 1P2JA 1AGJA 1P2NA 1FJSA 4AB9A 2NU2E 2BMGB 3KNXA 3SV7A 1MBMA 2CHAB 2QCYA 2BD8A 3SQEE 2F9NA 2BLVA 2F9UA 3LGIA 3QWCH 4ABJA 1ZOMA 1MH0A 2G8TA 4NCYA 4OS1A 4Q2KA 5A8ZA 2EA3A 2TGDA 3MO6A 1LQDB 1EATA 1Z8IB 1XUGA 3RXIA 2GT7A 2QN5T 2Y5GA 1SSXA 4U2WA 3HK6B 4VGCC 4DURA 1MAXA 5C1XA 2GZ8A 3PTBA 5C67A 3SUGA 1O2ZA 1NC6A 3UUZA 1C5ZB 4NSYA 1HGTH 4X8UH 1AO5A 1UTKA 3EQ0H 3RXAA 3BTKE 1ETSH 1GHZA 2XYAA 1XUHA 4BXSA 1RJXB 5JB9S 3KEEA 4WF8A 1ARBA 1V2PT 4U30A 4UE7H 1SMFE 2BB4A 2IPHA 4JZEH 1PQ7A 1WSSH 1FY5A 3VFEA 2HNTE 4Y76A 2ZGCA 4I8HA 2UUFB 4MDSA 1XUKA 2FI5E 3LC5A 1C1VH 1V2TT 4YESB 4CH8B 3AW1A 4JZDH 3E0NB 1GPZA 4AGKA 4INKA 2SGQE 4NGAH 3SQHE 2J34A 1MQ5A 1O3CA 1UVOA 2UWPA 2VWMA 5GDSH 1F0UA 3QTVH 2JH0D 4A1VA 1FQ3A 3GDUA 2P59A 1KXFA 4HGCA 1PJPA 5L2YH 3E90B 4I8KA 3MU1A 4ESTE 1GI6A 5C3NA 1XKAC 3KGPA 1C5OH 1TGNA 1MZDA 1NN6A 3RMLH 1C1TA 1S6HA 2WUBA 1O31A 1LO6A 4PROA 1P2MA 1UTNA 3AVZA 3LGTA 1O5GH 1D3TB 3ZV9A 2FTLE 1TNLA 1ELGA 1C2IA 2CMYA 1IHSH 1RS0A 1XMNB 2Y80A 1HRTH 1O3HA 5K0HA 3U98H 3QO6A 4OS2A 2VH6A 2XBWA 2WV4A 3BG8A 4E7NA 3P70B 1YPHE 3RXPA 5CE1A 1KXBA 3OTJE 1J15A 2VWNA 5AFZH 1E35B 2BQ7B 4GHTA 2VNTA 2RA0A 3TK6A 3ATKA 1SGFA 3BTQE 4KTUA 3PMJA 4AFUA 4KTSA 1BHXB 2OC1A 1P10A 3SU2A 2HPQH 2OBOA 5TJXA 1JIMA 1O36A 1AE5A 1PPFE 3EDXB 1FV9A 4CR9A 1SGDE 5HMAA 1EAUA 1NRQH 4KKDA 5FX6A 3V0XA 2PR3A 1DS2E 1GL0E 5JPMH 1GBFA 2A5AA 3A7ZA 1BBRE 1MBQA 1ZRKA 3ZVGA 5LPFA 3SHAH 3SU5A 1YLDA 2FPZA 2ANKH 2CJIA 2XWBI 2ZECA 1FN6A 1LHFH 1K28D 4Y11E 5GPIB 1CA0B 1CBWC 3LGUA 4OS4A 3RXDA 3MU5A 1BTHH 3I77A 2EEKA 1TMUH 3ZZDA 3ZVDA 3U8TH 3NK8A 4WMEA 1BMMH 1HBTH 2PUQH 4NSVA 1FPCH 3CP7A 4O9VA 5EW2H 3SZNA 4ABIA 1GJ9B 1IQFA 1YP9A 4ISHH 1ESBA 1O3KA 1VJ9U 3JZ1B 3SNBA 1IQHA 4IC6A 2QIQA 4AFQA 2VVUA 1P9SA 2HWLB 3M35A 4WWYA 3RXEA 1IHTH 2PFEA 2GVFA 1A0HB 1CA0C 1DOJA 3D62A 3TJVA 2W7SA 1YKTA 3UWJH 2ZHFH 1NFXA 1LHDH 5A0BA 4IBLH 5AF9H 4Y0YE 2TGPZ 1BMAA 4DIHH 3SJ9A 2NU1E 1ELBA 1IQIA 1TQ7B 3MMGA 2B5TB 4B76A 2OP9A 3VEQB 1SFIA 2F9VA 1P57B 4K3JA 1C2HA 1ABJH 4IS5A 5I25A 1F2SE 3KL6A 2TRMA 5EQQA 1MD8A 2A4QA 1FY1A 5DP5A 5E2OA 3A7TA 2AGGX 3TGIE 2EI8A 3BTHE 3O8DA 1BBRH 1QQUA 1HYLA 4BAKB 1C5MD 2BZAA 1LPZB 2WPMS 4JYVH 4DGJA 3TJOA 1O5AB 2KAIB 1P2IA 1JRTA 1NU9A 3PLBA 4ZKRU 2W5EA 3LH1A 3NKKA 3VB4A 4YLQH 1SGCA 1C1SA 1W13U 2GDDA 1Y59T 3FP6E 5JDUB 4YT7H 3SORA 1CGJE 3RXVA 4B75A 4CRDA 1O2XA 1T7CA 2ZDLA 4GSOA 1OWJA 4BXWA 1TA6A 1RXPA 1SI5H 1W3CA 1C2JA 1NS3A 4AYVB 1J16A 4NZLA 2ZWLH 1MTUA 1ZHMA 2BOKA 5FX5A 3WY8A 1MQ6A 4MG3A 1F5LA 2PTNA 7LPRA 4NA9H 3GY7A 5FPYA 1FONA 1TX8A 2DUCA 1T4UH 1OXGA 3Q76A 1QB6A 3SU1A 1GI2A 3SV2H 1KLJH 1SG8B 2ZGXH 1F92A 1GMHF 5EXLA 2F9OA 2ZQ1A 3M36A 4KP0A 2BDAA 3RXJA 5FAHA 2A4OA 1ZTLA 2WPJS 1OWEA 1S81A 4NIYA 1G9IE 4X1NU 4B1TA 3HGPA 1OX1A 3RU4E 6GCHF 4ABFA 3BTTE 2FXRA 1DICA 1O3BA 1PQ5A 4R0IA 4A1XA 2V3OH 2G5NA 4MPXA 4ZAEA 1A3EH 1MMJN 1AUTC 3LGYA 1NRRH 3AAVA 1S0RA 1OSSA 2UWLA 1TB6H 2D2DA 4ZXYH 3SI3H 1O3MA 1T31A 2BX3A 3SNCA 1QJ7B 1BBRK 4LOYH 7KMEH 1GI4A 2AGEX 1DANH 1MZAA 2GCHF 3LPRA 3P8OA 4XE4A 1KIGH 4BAHB 3RXHA 1EPTC 3HATH 4SGAE 1ELDE 1V2WT 1SGRE 1QQ4A 3H7OA 1BQYA 5J4SA 2ALPA 1BRCE 1V2NT 2DE9A 1AI8H 2FZZA 1SQAA 2AGIX 3CS0A 3F9GA 2C3SA 1ABIH 4Y8ZA 1TBRH 3VXEH 2GP9B 1C5LH 4DT7B 3MFJA 4U32A 3SJ8A 2WUCA 2C8ZB 5ESBA 3SU0A 3FP8E 2WV5A 1IAUA 1K1JA 3UOPA 3E16B 4CBNA 2A31A 2A2QH 3T28A 1F0TA 1ZPCA 1HJ9A 2Y82A 1UVUH 1X7AC 3F6UH 2SGAA 2HVXA 5B6OA 1CT0E 4Y7AA 1SC8U 4O97A 4KELA 2FOGA 1OWKA 1H9HE 1W2KH 4WH8A 2BXTH 1O2KA 1KXCA 4TPIZ 4ABDA 1YPLH 1QL9A 1SVPA 5DP3A 1DX5M 1RTLA 1A2CH 1YC0A 3EA8A 3QDZB 2HLCA 1GBIA 4X8VH 3OY5U 5DK1A 1SR5C 4Q7YA 1NY22 3RC5A 1GMHG 1QA7A 1Z8RA 2FOFA 3GCTF 4O3UA 3U9AH 2ZFRH 1O2VA 5LPEA 1TYNA 2ZCKP 1O2LA 1TE0A 2ZPQA 1TABE 4K1TA 2OQUA 1G2LA 6GCHG 3BSQA 5C20A 3SO3A 4CH2B 1P9UA 3M3VA 3A85A 3DFJA 3OX7U 1JXPA 4I8JA 4YZUA 1P01A 2YNAA 1A0JA 2AEIH 4YM9A 1FN8A 3MU0A 5A8XA 2OCVB 1GJAB 4I8GA 3UR6A 1GBCA 1BJVA 4ABEA 2EC9H 5EU8A 2ZP0H 1PQAA 1ANDA 2GCHG 5JBTA 4WMFA 1TIOA 2O8WA 1ZMJA 4LXBH 1GBKA 3IITA 2I6SA 5EGMA 1K1OA 1UHBA 3UNRA 1GBMA 1LHGH 3TVJB 1KLIH 3RP2A 1TNJA 1AKSB 2B9LA 2G00A 1SGFG 1TOMH 1C5XB 2O9QA 4AOQA 1EZXC 1XUJA 4FVDA 2OINA 1T4VH 1Y5AT 1SGPE 3D23A 1PPBH 1C2KA 2I6QA 1Y3YA 1IQGA 1IQEA 3A8CA 5GWZA 1F0SA 2A5KA 1L1GA 1L4DA 1CVWH 1GDUA 1O2OA 3LT3A 2TPIZ 1SQOA 1GBBA 3KQDA 1C1NA 1VZQH 2BTCE 3PLKA 2A7JA 4Z0KA 2FYQA 4BTUB 3RXMA 1LQEA 4MPWA 2FIRH 5DPAA 4X1SU 2DE8A 6CHAB 1GVLA 1GG6B 1AHTH 8KME2 2PKAB 3ATLA 2A4RA 1VITH 2Z94A 5LPRA 3UQOA 5H4IB 4X8TH 1HAVB 3Q77A 2TGAA 1O39A 1V2JT 1AQ7A 1BRUP 1UMAH 1YYY1 1B0FA 4AG2A 1B7XB 4I7YH 3HKJB 5TCCA 2Y6TA 2B0FA 2CV3A 3KQBA 5EQRA 3SNDA 3S9BA 2ZCLP 1EOJA 1QJ1B 2BY7X 1GJCB 7GCHG 1NROH 1AIXH 1LHEH 1SFQB 1UJ1A 2VIOA 2ZGJA 3BN9A 1LVYA 2FOHA 1N8OC 2ANWA 2GX4A 3PB1E 1NRSH 4Q7XA 1IQMA 3BF6H 1DFPA 1IOEA 1BCUH 4MNWA 6CHAC 3VB6A 1AFEH 1K1NA 3B9FH 4YOJA 2ZDAH 2VWOA 2WPHS 2ZU5A 4DOQA 1L0ZA 1NM6A 1F5RA 1HDTH 4ABGA 1LVBA 3M3SA 3ZZCA 3RLYH 2IOTA 1QIXB 1O2QA 1AN1E 2A0QB 4FUHA 3GY8A 1ELVA 2R0LA 2GKVE 1XXDA 2ZO3H 2PGBB 2KAIA 4DY7B 3BTDE 1XUIA 2NU4E 1K22H 2R0KA 4IN1A 1NRPH 3UREA 1C4U2 1BTZA 1HFDA 4O3TA 1QHRB 3SV8A 1CT2E 3L3TA 1UTMA 1OWHA 2H1UA 4KTCA 2FX6A 4BAMB 2A32A 1ID5H 5DO4H 1DM4B 2CN0H 1A7SA 1GBLA 1KDQB 8LPRA 1SGEE 2VWLA 1C2DA 3T2NA 5LH8A 2QXHA 2P3TB 4ZKOU 1Z1JA 4Y79A 3RXFA 2O8MA 1BJUA 1TALA 4Y0ZE 1HXFH 3ZZ4A 1CO7E 1ZPBA 4MQAA 1S5SA 1CQQA 1S84A 3SHCH 2J92A 4D7GA 1C5RA 3RLWH 1GCTB 3A84A 4XFQA 2OTVA 2BDHA 1A3BH 2FOMB 4K2YA 3S7HB 3T25A 1UCYE 3QLPH 2ZIQH 2Y5FA 1E38B 2FX4A 3UPEA 4ABBA 3TGJE 1BZXE 3MU4A 2YOLA 1XX9A 4FUGA 1MCVA 4A7IB 5DKMA 4CHAB 2D1JA 2A7HA 2V3HH 1Y3WA 2XBVA 2BZ6H 1EKBB 4WY3A 5E2PA 4AGJA 1AWHB 4UFFH 1WQVH 4ABAA 1QRWA 3M5NA 4BTTB 3T62A 3NXPA 1EOLA 4XBDA 5EPNA 2ZFFH 3FP7E 5LGOA 2C8XB 3MH7A 1BOQA 4X6PA 1D3DB 3Q3KA 1QBNA 4TYDA 1C2MA 2XC0A 1TPOA 1GCTC 3ZZ3A 4I33A 1RFNA 2ODYB 1LHCH 2F9PA 3GICB 3ZVBA 2ILNA 2P95A 3MH5A 5HGGA 1VITF 1Z8GA 1TONA 3LC3A 3K9XB 2QXIA 3QTOH 1ELTA 2VIQA 4CHAC 1BHXF 4LZ1H 1J17T 3QX5H 4FVBA 3UFAA 2UUYA 1C5WB 5T6GA 4Y7BA 1HIAB 2QAAA 2VU8E 1WBGB 2R2WU 3A89A 3CS7A 2ALVA 2GMTC 2GCTC 3A8DA 1DUAA 3S9CA 2VB0A 1KLTA 1DE7H 2BY5X 4UFDH 1AB9C 2ZDMA 2ZFQH 1C2EA 1CBWB 3M5MA 2J94A 2W3IA 3A8BA 1P09A 3AASA 3DA9B 1OYTH 1A5HA 3SW2B 1ZPZA 2TIOA 2ZPRA 2YNBA 1L1NA 3QGNB 1O2UA 1A4WH 3EGKH 3UIRA 1GMDG 3DFLA 1TPSA 2W26A 1MKXK 1GBHA 1ZMLA 1S83A 2GV7A 3PWBA 2H9TH 1GHYH 1UVTH 1GJ8B 1P0SH 3ZZ6A 3TK5A 1S0QA 4BAOB 4XDEA 1XVMA 3GCNA 2XBXA 2QY0B 1WQSA 4GVUA 4XBCA 4GPGA 3PMBB 1V2ST 4OGXA 1HJAB 1BMLA 1DLKB 1ELFA 2EI7A 3FANA 3D49H 1JOUB 1L1JA 1O3EA 1C5YB 4GAWA 4WXIA 3RM2H 3K65B 1FXYA 4NA8A 2FESH 1F0RA 1P3EA 5ABWA 2G55A 3TJUA 1O34A 1J8AA 2ZA5A 5EOKA 2Q6FA 1MTSA 1XKBC 3DD2H 4DJZB 4CRBA 4SGBE 2ZDVH 2FS8A 2BXUH 1NFWA 1UK2A 2CGAA 2FOAA 2SNVA 2AMDA 2IN2A 3F68H 1OS8A 1VCWA 5IDKA 2K1QA 2UUKB 3UOUA 1AE8H 5E8EH 2BDYA 5T6DA 1YPGH 1ZTJA 1O2TA 5A2MH 2BD2A 1DWCH 2C8YB 2GD4B 4F49A 4K69A 5C5OA 5ESTE 4BAQB 1IQKA 4MNYA 1HJAC 3SJIA 3MHWU 3ZZ7A 1PQ8A 3GY2A 1AKSA 1VITG 4OS7A 4UFGH 2CF8H 2WYGA 3F9HA 5FBIA 1FPHH 1SQTA 1ANEA 4FU9A 1TBQH 1O32A 1DXPA 4FUCA 3RXKA 3L33A 5L2ZH 1P2QA 4QT8C 2V6NA 2GDEH 1G30B 3LH3A 1O2GH 3ZVAA 1UCYK 3SUEA 3LJJA 4ABHA 1AU8A 1CSOE 2Z9IA 2BQ6B 3MI4A 4X1PU 1CHOG 5L30H 1O2HA 1ZZZA 3ESTA 1ZLRA 3ZVCA 5TCAA 1OP0A 1ARCA 1LKAA 1O2YA 1BRBE 2C4FH 2FLRH 4FU8A 3TGKE 4RN6A 1DWDH 2FP7B 3LONA 1O35A 3KCGH 3RMOH 5BPEA 1WTHD 1DXWA 1TLDA 2PKAA 1AWFH 2BY6X 1SOTA 4MLFB 3L6PA 4H4FA 2STAE 4WJG2 3BIVH 1HAVA 1EQ9A 5FXLA 2BOHB 6LPRA 3KQCA 2QYIA 3FVFB 1GDNA 1P06A 2Z3DA 1YM0A 1E37B 2SGDE 1GVKB 3RM0H 1DVAH 1ZMNA 2FLBH 4B2AA 3MTYA 3ATMA 1JBUH 2RG3A 1MTVA 2F3CE 5JBCS 1DWBH 4HFPB 3A87A 1K21H 3SUFA 3KF2A 2TBSA 2Z6BD 5GIBA 1O2JA 1AVWA 4K5ZA 4ASHA 3NWUA 1J9CH 2ZG0H 3TJNA 1QB1A 2ZCHP 1IQNA 2HNTF 3SN8A 2EI6A 3Q3YA 5L6NH 1BTYA 2Y7XA 4CR5A 2ZDNA 2VH0A 1DWEH 1EPTB 2FOBA 4NWLA 3S7KB 1FY4A 5F03A 4CBOA 4UFEH 1GHAG 2XCFA 2Z9GA 1EJMA 4K1EA 1YBWA 2JETB 1RIWB 2THFB 5GCHF 1HXEH 3VPKA 3ZZAA 3PMHB 4I8LA 4DW2U 4Q7ZA 1DLEA 1O33A 2PW8H 1DITH 2P94A 3EE0B 1F5KU 4NIVA 5CHAB 1OKXA 2C8WB 1BIOA 4FUEA 1Z6JH 4CRFA 2J38A 1GJ5H 1E0FD 1LCYA 4ZKSU 3RXCA 4HTCH 4ISIH 1GI7B 2VVVA 1KDQA 2QF0A 1ELEE 3SJOA 1CE5A 9ESTA 1O2WA 5GXPA 1ZJKA 1TPPA 1T32A 2QA9E 3BG4C 5C1UA 1GBTA 2J95A 2ANYA 1SGNE 1A5GH 1TX7A 3QZQA 1GI9B 1HAOH 4NG9H 3DHKH 1K1LA 7ESTE 3Q00A 5ETXA 3ZVEA 1PPZA 1FY3A 1C5SA 2JETC 1RIWC 2Z9JA 3GCOA 3S9AA 3ZYEA 3U1JB 1W8BH 1TRYA 5FPTA 2ZTXA 1V6DA 1WOFA 3ODFA 4E7RG 1ZGVA 1D3QB 4JZ1A 3VGCB 3PYHA 5CHAC 2AERH 1OPHB 1O3AA 1XVOA 3A7VA 5A8YA 1HJ8A 1QA0A 1G36A 2CF9H 1MD7A 2ZNKH 3O8RA 1CGIE 1SGIB 1V3XA 1XXFA 4CRCA 3A81A 2J2UA 2FS9A 3FZZA 3PLPA 4NZQA 2ZPSA 3SI4H 1GI8B 3E3TA 3GYLB 3TH4H 3MH4A 2FWWA 1HAGE 4ZHMU 4Y8YA 2BD4A 2QF3A 2FMJA 5C1YA 4Y8XA 3N7OA 1BTUA 1KXDA 1O2IA 2ZU2A 3ELAH 1W11U 5EW1H 3Q3XA 2ZQ2A 3KIDU 1K1PA 5PTPA 1HLTH 2Y7ZA 3VGCC 5F8TA 4MVNA 2JH5D 3I78A 3VB5A 2XC5A 2HOBA 1SOZA 1Y5BT 2RCEA 4DVAU 1QURH 2G5VA 1TGCA 1ZSKA 1PPCE 1TRMA 1YPMH 1O2NA 1PFXC 4DIIH 6ESTA 1J14A 7GCHF 1HIAA 1WYKA 5GCHG 2B8OH 1WCZA 1XUFA 2O8TA 3OU0A 3ZZ8A 3G01A 1BDAA 2XW9A 2ZF0H 2HGTH 4UEHH 3FAOA 1H9IE 1IQJA 3W94A 1ZYOA 3OY6U 1BTPA 1SHYA 1EJAA 2R3UA 4AN7A 1C5PA 2AFQB 5F8XA 2BD5A 2FYRA 1C1RA 4UONA 2QXGA 1G32B 3MYWA 1EB2A 2A7CA 4IMZA 3SU4A 4YTAA 1C1WH 1YCPH 1QB9A 2RDLA 2BD3A 1SLWB 3TIUA 2ZHEH 3M7UA 1QBOA 5I46H 3M37A 1KXEA 3O8BA 1O2PA 5SGAE 5GJ4B 4JZIA 2OC8A 1D6RA 4E05H 1HAYB 4J2YB 2AMPA 1DT2A 2ZHWH 4CREA 2SFAA 3NUMA 1ETTH 2FO9A 1DPOA 1YGCH 3VB7A 1EAXA 2P16A 2P3UB 1ZRBA 1UK4A 1O37A 2VINA 1W14U 2BHGA 3H7TA 1KTTB 1SL3A 2PWXA 5A09A 4MPVA 4A6LA 3EYDA 3QN7A 1N6XA 2OQ5A 1TRNA 1AFQC 3OSYA 1QL7A 1KSNA 1C1PA 3TLOA 3ZZ5A 2BDCA 1YPKH 1N8OB 2WPKS 1P05A 4TWWA 2BQWB 1YF4A 1ZJDA 4INLA 2FTMA 1BMNH 3V7TA 4D8NA 1LVMA 3BIUH 3RDZA 4JCNA 2J4IA 3V3MA 1Z6EA 2WINI 1O3OA 2O8LA 1TMBH 4OGYA 1CU1A 1GMCF 3TU7H 5FHTA 3GDSA 2V35A 3NZIA 5EXNA 3A8AA 1ZHRA 4X2VA 2JKHA 3QZRA 1DSUA 2H5CA 3A7XA 2C93B 2NU3E 3RXSA 4TY6A 1GWAA 1T8MA 5FCKA 1L4ZA 1LDTT 1DY9A 1AY6H 3M5LA 1QGFA 1O3GA 1OWDA 3C1KA 3GISB 3A82A 2OD3B 3U8RH 4ISNA 4ZHLU 1TQ0B 2D26C 3SGQE 3SUDA 3AAUA 2Q6DA 2GTBA 2XWAA 5EODA 4DCDA 4Z6AH 2ODPA 2GGVB 5DP9A 1YCPK 4FUBA 1W7XH 1UTQA 1Z7KA 1C4Y2 3MNBA 2G4TA 3LGWA 1N6YA 1EP6A 1H9LB 3MO3A 4FUFA 1P12E 1P8VC 4WVPE 2FOEA 1C5UA 1OP2A 3P95A 4FUJA 1DDJA 3GY6A 3RXGA 1SGTA 5HM9A 3KQEA 2FEQH 3A86A 3ODDA 2ZFTA 3GY4A 4B71A 1YLCA 1DY8A 3RXOA 4B2CA 1Z8JB 3TPIZ 2AIQA 1AVXA 1G37A 2H2ZA 5EPYA 1O3NA 2ZEBA 5JBBS 3DT0H 5DP8A 1P04A 2XCNA 3GOVB 1NESE 3T29A 1JWTA 4THNH 1FMGA 9LPRA 1ORFA 1FIZA 2XTTB 5AVDA 1INCA 3V12A 4A5TS 1HB0B 1NFUA 3M3TA 3V13A 1GMDF 2ZTYA 4IW4E 1VR1H 2AS9A 1O3JA 2BLWA 3EAJA 1O2RA 1GHXH 2QV1A 2HRVA 3QK1A 2Z3EA 2H6MA 2OC0A 1MKWK 1SHHB 1WTGH 1K1MA 5F6MA 3I29A 1EPTA 3RC4A 1BA8B 1MU8B 1QFKH 2ZC9H 3BEFB 1GGDB 2SNWA 4B74A 1SGYE 4X1QU 2WPIS 1QY6A 1GMCG 1MKXH 1C5TA 1GJBB 2B7DH 2XC4A 3E0PB 1V2KT 4ISLA 1P03A 3A80A 2AH4X 1MU6B 1O3IA 1EP5A 4B2BA 1VGCB 4I31A 3SNEA 3ZZBA 4ZH8A 4F4OC 1SLXB 1EUFA 4GCHF 2PTCE 3NPSA 2R9PA 4WXVA 2CHAC 4X2WA 2GMTB 1BTWA 2GCTB 1TNHA 3S0NA 2ANMH 1XM1A 2H9EH 1AB9B 4A1TA 1EJNA 1EXFA 3F9EA 2P93A 5JB8S 2OBQA 3MH6A 2G81E 3C27B 4NIWA 1GGDC 1UTJA 1Y3UA 1MAYA 1T8NA 1W10U 2JH6D 3P92A 3O8CA 1THPB 1QJ6B 2G52A 1W7GH 2R3YA 4AB8A 1GI5A 1W0YH 2R2MB 4RSPA 1N1LA 3HGNA 2F83A 5C5NA 1TWXB 4AX9H 3A7WA 1C1OA 1PPEE 2ZU3A 1VGCC 8GCHG 1HUTH 1NPMA 4BTIB 4OS6A 3ZVFA 1Z1IA 1GBAA 2LNCA 2PV9B 3QUMP 4H42U 5EXMA 1CHOF 1NRNH 4KGAA 5EQSA 2O8UA 2WPLS 8ESTE 2FI4E 3K6ZA 1O5FH 4BOHA 3PWCA 1Y5UT 2BY9X 2UUJB 1OOKB 2SGEE 1WU1A 1K9OE 1UCYH 2PKSB 4WMDA 2GZ7A 5T3HA 5J4QA 4FUIA 1QNJA 4FU7A 1GJDB 1A46H 3PMAB 1O5EH 1T8LA 2FODA 3E6PH 1C2GA 1OWIA 3R0FA 1V2MT 1BTXA 3AW0A 1G2MA 1ESAA 1L2EA 2H9HA 1TFXA 3RXUA 4ZHAA 2CXVA 4D7FA 2BLOA 4CRAA 1P2KA 1JIRA 1WAYB 2A45B 4X1RU 2Z9LA 4TWYA 2P8OB 1EZQA 1C9TA 1AMHA 1C1UH 1UHBB 5EG4A 3VB3A 4K1SA 3TH2H 1BB0B 2A1DB 1TNGA 4YO9A 3SNAA 1PPHE 1D4PB 1THRH 3GCHB 1EX3A 1GHVH 2PKSC 3MNSA 3M7QA 1AD8H 4GCHG 1ZSJA 2Q1JA 2M5TA 1O2MA 2UWOA 1T8OA 3R3GB 3LKWA 2BD9A 3RXBA 2ZGBH 1FIWA 5DP7A 2VJ1A 2OC7A 1GHAF 3MWIU 3P8NA 4X2YA 1TPAE 1VJAU 1HAHH 1G3DA 3E8LA 3T5FH 4JK5A 1WUNH 3SJKA 2P8OC 1OP8A 1VCPA 3K2UA 1B0EA 1GBJA 3U8OH 2PSXA 3DUXH 4A92A 3LJOA 2Y5HA 4O03A 3GCHC 1QL8A 3A7YA 1Y3XA 1GJ7B 3URDA 3B23B 2ZHDA 1EZSC 1EAWA 3TNTA 2ZHQH 4IGDA 3M61U 1CHGA 4ZUHA 2AIPA 3ENSB 3PTNA 4NIXA 1H1BA 1GI0A
chains in the Genus database with same CATH superfamily
1GI3A 2Z9KA 1FY8E 4MTBA 1TA2A 2D8WA 2G51A 1NZQH 1EZUC 1LVOA 1B5GH 3U69H 1EAIA 3F3BA 2FM2A 2XXLA 1GDQA 1TBZH 1HV7A 1LMWB 2BVXH 1C2LA 2ZFPH 5T6FA 4NA7A 2ZKSA 3PV4A 1UK3A 1UO6A 1BUIA 4AG1A 1UTPA 1IQLA 1W12U 1MCTA 1SB1H 1FDPA 2WYJA 1TX6A 1C5QA 2PSYA 4D76A 1GHWH 1RTFB 2BDIA 4IMQA 4INHA 1BRAA 1LPGB 4NWKA 4IC5A 3BEUA 4XRNA 4DG4A 4RI0A 2GZ9A 5IYTA 1HAPH 1GJ6A 2W7UA 4AYYB 3H5CB 1FLEE 4X2XA 3JZ2B 2ESTE 2ZGHA 3D65E 2XNDD 4D9QA 2PHBA 3STJA 3BG4B 4HI3A 3URCA 2OLGA 3ATIA 1QTFA 3GY3A 2BVSH 4K8BA 1FI8A 1O5CB 1HAZB 1TMTH 1PYTC 2QGRA 3SGAE 1TGTA 2BY8X 1O3PB 4P02A 4YOGA 3RMNH 1P2OA 2HALA 3SGBE 2ZTZA 2Z7FE 4X8SH 2Y81A 5C2ZA 3E1XB 3BTME 4M7GA 1C1MA 4BANB 1TNIA 4UDWH 4YLUA 1NT1A 1D9IA 2PUXB 2BDGA 3MNXA 1O30A 3S69A 1FAKH 3ZZ9A 1LKBA 3TH3H 5DP4A 1ELAA 1UVSH 4LK4A 1NO9H 4JZFH 3SU3A 1QBVH 3U1IB 1ANCA 4ZMAH 4XBBA 2PGQB 3PM3A 3LGVA 3A83A 5K7RA 1QCPA 1FZZA 3RU4D 3UQVA 1H8ED 1MUEB 1U6QA 2VIVA 1CA8B 1Y3VA 2F91A 3IWMA 1FAXA 4AZ2B 2ZFSA 3KYFA 1EB1H 1PPGE 4J1YA 2BLQA 2ZI2H 1RRKA 1ANBA 1K1IA 5E0GA 5B6LA 3LU9B 1O5DH 1F7ZA 4LZ4B 1TGBA 1H4WA 2OXSA 4ZKNU 1AUJA 1C9PA 4U01A 3QGJA 3RXLA 1TAWA 1SGQE 4H6TA 1QR3E 3U28C 3EA9A 3KHVA 2QC2A 1AVGH 1H8DH 1YPJH 3P8FA 4NFFA 4X6NA 1O3FA 2NWNA 4JMYA 4CRGA 1O5BB 1WV7H 2ODQA 4E06H 3PROA 5HXFA 1W0ZU 5FL7D 2IJD1 4RKJB 1AZ8A 5JYIA 5CHBA 1ZR0A 3BTFE 2ZU4A 2BVRH 2GV6A 1HNEE 4ZXXH 3MO9A 1EASA 5DGJA 2J9NA 2HVYB 2BM2A 4I32A 5HYOA 1ESTA 3BTEE 3STIA 4YT6H 3RMMH 2FDAA 4BNRA 1RD3B 4XOJA 1C5VA 1Q3XA 3UNQA 1CT4E 1V2RT 4UD9H 5JBAS 3SV9A 1FUJA 2K0QA 2HNTC 1GCDA 2ASUB 3BTGE 1HPGA 1ZTKA 2VIDA 1UTOA 3TNSA 2NU0E 1SLVB 4R8TB 1V2OT 1LTOA 1V2LT 4GLYA 4ISOA 4Y6DA 4Y71A 2GT8A 4WH6A 1C1QA 3ITIA 1GBDA 1M9UA 2AYWA 3TK9A 3AK5A 1Q31A 1KMHB 1ELCA 2VGCB 1DSTA 4JK6A 3K6YA 1RGQA 3RUOA 3GYMA 4IN2A 3RC6A 2XNIA 2IJOB 1D3PB 2HLDD 5BRRE 1P3CA 1BT7A 1FNIA 1V2QT 1MTNB 2Z3CA 1C4V2 1KTSB 2A4GA 2TGTA 1K2I1 3UB0A 1ZGIA 2BYAX 1S82A 3NRLA 3BV9B 3SV6A 4RKOB 3LIWA 4XD7D 1O3LA 2XRCA 5DJ7A 1AZZA 3EA7A 5AFYH 1JRSA 3MNCA 3W95A 5DP6A 4MNVA 1AFQB 3RU4T 2XBYA 1H8IH 1JMOH 2VGCC 4MNXA 5AHGH 5F8ZA 1DUEA 1TGSZ 2KCAA 3HPTB 1YY3A 1KYNA 3PO1B 3MU8A 1TNKA 4X6MA 1HAXB 3BEIB 2ULLA 1GHBF 1OYQA 1A5IA 3RXQA 1MTNC 1YPHC 1ZHPA 1D6WA 4F48B 3FZDA 3GDVA 4XSKU 3UR9A 1ETRH 1QRXA 2V3MA 1O3DA 5DG6A 5FBEA 5HM2A 2V0BA 4TT3D 4X0WU 2Q6GA 1G3EA 1MTWA 4K60A 5E0HA 3PRDA 3SOSA 2FOCA 3UWIA 1O2SA 1S6FA 2LPRA 2PLXA 3BTWE 4Q80A 1LPKB 2ZZUH 2RA3A 1V2VT 2KX4A 4OS5A 1E36B 4FUDA 1COWD 3PO1C 2BDBA 3IG6B 4HZHA 1GBEA 1G3BA 1P11E 1P02A 3KN2A 5G4BA 3LOXA 5EIYA 3FFGA 4H6SB 3VXFH 3SU6A 3SBKA 2A5IA 4D9RA 1O38A 4P00A 3ATWA 4AFZA 1O0DH 4MPUA 3F9FA 2BX4A 1MKWH 3B8JA 1HCGA 3GY5A 1GVZA 1NFYA 3LDXH 2VVCA 3ZV8A 4B73A 1A0LA 1NTPA 2SGPE 3UNSA 1YPEH 4JYUH 3UTUH 1SBWA 2AMQA 3M5OA 3TITA 5FPSA 1GL1A 1C2FA 1VCQA 4Y10E 1BITA 2ZU1A 1GJ4H 3ZYDA 4ZROA 3RXTA 4FXGH 3M7TA 2F9BH 4GHQA 1V2UT 5A0AE 2OUAA 4NFEA 4TPYA 2P3FH 2W3KA 1UVPA 1PYTD 3P8GA 3PV2A 3P6ZB 1E34B 3HK3B 2XOKD 3NCLA 2VIWA 1TOCB 3GCTG 1C5NH 1NU7B 1E1RD 3OAAD 4YOIA 4K8YA 2A2XH 1CGHA 2FI3E 2G4UA 1A61H 4AORA 3E91A 5FCRA 1ZSLA 1Z71A 2H5DA 1UTLM 1GI1A 4GUXA 1ACBE 2ZDKA 8GCHF 3HKIB 1HAIH 4TY7A 2HPPH 2C90B 1KXAA 1THSH 1GG6C 1SPJA 2QXJA 1YCPM 2STBE 3T26A 1A1RA 5CMXH 3F1SB 4X6OA 3MOCA 4VGCB 1GHBG 2VIPA 5E0JA 3UY9A 1G3CA 1RTKA 4JYTA 2BD7A 1Q2WA 1KY9A 3RXRA 5A0CA 3T27A 3P17H 3A88A 1Y8TA 1SLUB 4AFSA 3CENA 1QRZA 1S85A 3OYPA 2SGFE 2KCYA 1P2JA 1AGJA 1P2NA 1FJSA 4AB9A 2NU2E 2BMGB 3KNXA 3SV7A 1MBMA 2CHAB 2QCYA 2BD8A 3SQEE 2F9NA 2BLVA 2F9UA 3LGIA 3QWCH 4ABJA 1ZOMA 1MH0A 2G8TA 4NCYA 4OS1A 4Q2KA 5A8ZA 2EA3A 2TGDA 3MO6A 1LQDB 1EATA 1Z8IB 1XUGA 3RXIA 2GT7A 2QN5T 2Y5GA 1SSXA 4U2WA 3HK6B 4VGCC 4DURA 1MAXA 5C1XA 2GZ8A 3PTBA 5C67A 3SUGA 1O2ZA 1NC6A 3UUZA 1C5ZB 4NSYA 1HGTH 4X8UH 1AO5A 1UTKA 3EQ0H 3RXAA 3BTKE 1ETSH 1GHZA 2XYAA 1XUHA 4BXSA 1RJXB 5JB9S 3KEEA 4WF8A 1ARBA 1V2PT 1NBME 1NBMD 4U30A 4UE7H 1SMFE 2BB4A 2IPHA 4JZEH 1PQ7A 3KYGA 1WSSH 1FY5A 3VFEA 2HNTE 4Y76A 2ZGCA 2KM0A 4I8HA 2UUFB 4MDSA 1XUKA 2FI5E 2W6JD 3LC5A 1C1VH 1V2TT 4YESB 4CH8B 3AW1A 2F4LA 4JZDH 3E0NB 1GPZA 4AGKA 4INKA 2SGQE 3KQ5A 4NGAH 3SQHE 2J34A 1MQ5A 1O3CA 1UVOA 2UWPA 2VWMA 2KZ4A 2L74A 5GDSH 1F0UA 3QTVH 2JH0D 4A1VA 1FQ3A 2WSSD 3GDUA 2P59A 1KXFA 4HGCA 1PJPA 5L2YH 3E90B 4I8KA 3MU1A 4ESTE 1GI6A 5C3NA 1XKAC 3KGPA 1C5OH 1TGNA 1MZDA 1NN6A 3RMLH 1C1TA 1S6HA 2WUBA 1O31A 1LO6A 4PROA 1P2MA 1UTNA 3AVZA 3LGTA 1O5GH 1D3TB 3ZV9A 2FTLE 1TNLA 1ELGA 1C2IA 2CMYA 1IHSH 1RS0A 1XMNB 2Y80A 1HRTH 1O3HA 5K0HA 3U98H 3QO6A 4OS2A 2VH6A 2XBWA 2WV4A 3BG8A 4E7NA 3P70B 2JIZD 1YPHE 3RXPA 5CE1A 1KXBA 3OTJE 1J15A 2VWNA 5AFZH 1E35B 2KR7A 2BQ7B 4GHTA 2VNTA 2RA0A 3TK6A 3ATKA 1SGFA 3BTQE 4KTUA 3UAIC 3PMJA 4AFUA 4KTSA 1BHXB 2OC1A 1P10A 3SU2A 2HPQH 2OBOA 5TJXA 1JIMA 1O36A 1AE5A 1PPFE 3EDXB 1FV9A 4CR9A 1SGDE 5HMAA 1EAUA 1NRQH 4KKDA 5FX6A 3V0XA 2PR3A 1DS2E 1GL0E 5JPMH 1GBFA 2A5AA 3A7ZA 1BBRE 1MBQA 3PV5A 1ZRKA 3ZVGA 5LPFA 3SHAH 3SU5A 1YLDA 2FPZA 4DT4A 2ANKH 2CJIA 2XWBI 2ZECA 1FN6A 1LHFH 1K28D 4Y11E 5GPIB 1CA0B 2QE7D 1CBWC 3LGUA 4OS4A 3RXDA 3MU5A 1BTHH 3I77A 2EEKA 1TMUH 3ZZDA 3ZVDA 3U8TH 3NK8A 4WMEA 1BMMH 1HBTH 2PUQH 4NSVA 1FPCH 3CP7A 4O9VA 5EW2H 3SZNA 2VBCA 4ABIA 1GJ9B 1IQFA 1YP9A 4ISHH 1ESBA 1O3KA 1VJ9U 3JZ1B 3SNBA 1IQHA 4IC6A 4FETA 2QIQA 4AFQA 2VVUA 1P9SA 2J5UA 2HWLB 4AC9A 3M35A 4WWYA 3RXEA 1IHTH 2PFEA 2GVFA 1A0HB 1CA0C 1DOJA 3D62A 3TJVA 2W7SA 1YKTA 3UWJH 2ZHFH 1NFXA 5C17A 1LHDH 5A0BA 4IBLH 5AF9H 4Y0YE 2TGPZ 1BMAA 4DIHH 3DSGA 3SJ9A 2NU1E 1ELBA 1IQIA 1TQ7B 3MMGA 2B5TB 4B76A 2OP9A 3VEQB 1SFIA 2F9VA 1P57B 4K3JA 1C2HA 1ABJH 4IS5A 5I25A 1F2SE 3KL6A 2TRMA 3EE7A 5EQQA 1MD8A 2A4QA 1FY1A 5DP5A 5E2OA 3A7TA 2AGGX 3TGIE 2EI8A 3BTHE 3O8DA 1BBRH 4B6EA 1QQUA 1BMFD 1HYLA 4BAKB 1C5MD 2BZAA 3N99A 1LPZB 2WPMS 4JYVH 4DGJA 3TJOA 1O5AB 2KAIB 1E1QD 1P2IA 1JRTA 1NU9A 3PLBA 4ZKRU 2W5EA 3LH1A 3NKKA 3VB4A 4YLQH 1SGCA 1C1SA 1W13U 2GDDA 1Y59T 3FP6E 5JDUB 4YT7H 3SORA 1CGJE 3RXVA 4B75A 4CRDA 3N7DA 1O2XA 1T7CA 2ZDLA 4GSOA 1OWJA 4BXWA 2YMSD 1TA6A 1RXPA 1SI5H 1W3CA 3F2FA 1C2JA 1NS3A 4AYVB 1J16A 4NZLA 2ZWLH 1MTUA 1ZHMA 2BOKA 5FX5A 3WY8A 1MQ6A 4MG3A 4ZCNA 1F5LA 2PTNA 7LPRA 4NA9H 3GY7A 5FPYA 1FONA 1TX8A 2DUCA 1T4UH 1OXGA 4I86A 3Q76A 1QB6A 3SU1A 1GI2A 3SV2H 1KLJH 1SG8B 2ZGXH 1F92A 1GMHF 5EXLA 4Q4LA 2F9OA 2ZQ1A 3M36A 4KP0A 2BDAA 3RXJA 5FAHA 2A4OA 1ZTLA 2WPJS 5IK2D 1OWEA 1S81A 4NIYA 1G9IE 4X1NU 3VG8A 4B1TA 3HGPA 1OX1A 3RU4E 6GCHF 3ZIAD 4ABFA 3BTTE 2FXRA 1DICA 1O3BA 3GS9A 1PQ5A 4R0IA 4A1XA 2V3OH 2G5NA 4MPXA 4ZAEA 1A3EH 1MMJN 1AUTC 3LGYA 1NRRH 3AAVA 4TSFD 1S0RA 1OSSA 2UWLA 1TB6H 2D2DA 4ZXYH 3SI3H 1O3MA 1T31A 2BX3A 3SNCA 1QJ7B 1BBRK 4LOYH 7KMEH 1GI4A 2AGEX 1DANH 1MZAA 2GCHF 3LPRA 3P8OA 4YXWD 4XE4A 1KIGH 4BAHB 3RXHA 1EPTC 2KFWA 3HATH 4SGAE 1ELDE 1V2WT 1SGRE 1QQ4A 3H7OA 1BQYA 5J4SA 2ALPA 1BRCE 1V2NT 2DE9A 1AI8H 2FZZA 1SQAA 2AGIX 3CS0A 3F9GA 2C3SA 1ABIH 4Y8ZA 1TBRH 3VXEH 2GP9B 1C5LH 4DT7B 2KCOA 3MFJA 4U32A 3SJ8A 5HKKD 2WUCA 2C8ZB 5ESBA 3SU0A 3FP8E 2WV5A 1IAUA 1K1JA 3UOPA 3E16B 5C0UA 4CBNA 2A31A 2A2QH 3T28A 2IPQX 1F0TA 1ZPCA 1HJ9A 2Y82A 1UVUH 1X7AC 2EY4C 3F6UH 2SGAA 2HVXA 5B6OA 1CT0E 4Y7AA 1SC8U 4O97A 4KELA 2FOGA 3OEED 1OWKA 1VKYA 1H9HE 1W2KH 4WH8A 2BXTH 1O2KA 1KXCA 4TPIZ 4ABDA 1YPLH 1QL9A 1SVPA 5DP3A 1DX5M 1RTLA 1A2CH 1YC0A 3EA8A 3QDZB 2HLCA 5GNDA 1GBIA 4X8VH 3OY5U 5DK1A 1SR5C 4Q7YA 1NY22 3RC5A 1GMHG 1QA7A 5EJZA 1Z8RA 2FOFA 3GCTF 4O3UA 3U9AH 2ZFRH 1O2VA 5LPEA 1TYNA 3WWFA 2ZCKP 1O2LA 1TE0A 2WV9A 2ZPQA 1TABE 4K1TA 2OQUA 1G2LA 6GCHG 3BSQA 5C20A 3SO3A 4CH2B 1P9UA 3M3VA 3A85A 3DFJA 3OX7U 1JXPA 4I8JA 4YZUA 1P01A 2YNAA 1A0JA 2AEIH 4YM9A 1FN8A 3MU0A 5A8XA 2OCVB 1GJAB 4I8GA 3UR6A 1GBCA 1BJVA 4ABEA 2EC9H 5EU8A 2ZP0H 1PQAA 1ANDA 2GCHG 5JBTA 4WMFA 1TIOA 2RDEA 2O8WA 1ZMJA 4LXBH 1GBKA 3IITA 2I6SA 5EGMA 1K1OA 1UHBA 4B6FA 3UNRA 1GBMA 1LHGH 3TVJB 1KLIH 3RP2A 1TNJA 2J98B 1AKSB 5C0TA 2B9LA 2G00A 1SGFG 1TOMH 1C5XB 2O9QA 4AOQA 1EZXC 1XUJA 4FVDA 2OINA 1T4VH 1Y5AT 1SGPE 3D23A 1PPBH 1C2KA 2I6QA 1Y3YA 1IQGA 1IQEA 3A8CA 3OE7D 5GWZA 3FN8A 1F0SA 2A5KA 1L1GA 1L4DA 1CVWH 1GDUA 1O2OA 3LT3A 2TPIZ 1SQOA 1GBBA 3KQDA 1C1NA 2W6ID 1VZQH 2BTCE 3PLKA 1H8HD 2A7JA 4Z0KA 2FYQA 4BTUB 3RXMA 1LQEA 4MPWA 2FIRH 5DPAA 4X1SU 2DE8A 2QF5A 6CHAB 1GVLA 1GG6B 1AHTH 8KME2 2PKAB 3ATLA 2A4RA 1VITH 2PP6A 2Z94A 5LPRA 3UQOA 5H4IB 4X8TH 1HAVB 3Q77A 2TGAA 1O39A 1V2JT 1AQ7A 1BRUP 5EJLA 1UMAH 1YYY1 1B0FA 4AG2A 1B7XB 4I7YH 3HKJB 4OM9A 5DN6D 5TCCA 2Y6TA 2B0FA 2CV3A 3KQBA 5EQRA 3SNDA 3S9BA 2ZCLP 1EOJA 1QJ1B 2BY7X 1WDIA 1GJCB 7GCHG 1NROH 1AIXH 1LHEH 1SFQB 1UJ1A 2VIOA 2ZGJA 3BN9A 1LVYA 2FOHA 1N8OC 2ANWA 2GX4A 3PB1E 1NRSH 4Q7XA 1IQMA 3BF6H 1DFPA 1IOEA 1BCUH 4MNWA 6CHAC 3VB6A 1AFEH 1K1NA 3B9FH 4YOJA 2ZDAH 2VWOA 2WPHS 2ZU5A 4DOQA 1L0ZA 1NM6A 1F5RA 1HDTH 4ABGA 1LVBA 3M3SA 3ZZCA 2YMSB 3RLYH 2IOTA 1QIXB 1O2QA 1AN1E 2A0QB 4FUHA 3GY8A 1EFRD 1ELVA 2R0LA 2GKVE 1XXDA 2ZO3H 2PGBB 2KAIA 4DY7B 3BTDE 4F55A 1XUIA 2NU4E 1K22H 1W0JD 2R0KA 4IN1A 1NRPH 3UREA 1C4U2 1BTZA 1HFDA 4O3TA 1QHRB 3SV8A 1CT2E 3L3TA 1MABB 1OWHA 1UTMA 2H1UA 4KTCA 2FX6A 4BAMB 2A32A 1ID5H 3F0PA 2K8IA 5DO4H 1DM4B 2CN0H 1A7SA 1GBLA 1KDQB 8LPRA 1SGEE 2VWLA 1C2DA 3T2NA 5LH8A 2QXHA 2P3TB 4ZKOU 1Z1JA 4Y79A 3RXFA 2O8MA 1BJUA 1TALA 4Y0ZE 1HXFH 2YMSC 3ZZ4A 1CO7E 1ZPBA 4MQAA 1S5SA 1CQQA 1S84A 3SHCH 2J92A 4D7GA 1C5RA 3RLWH 1GCTB 3A84A 4XFQA 2OTVA 2BDHA 1A3BH 2FOMB 4K2YA 3S7HB 3T25A 1UCYE 3QLPH 2ZIQH 2Y5FA 1E38B 2FX4A 3UPEA 4ABBA 3TGJE 1BZXE 3MU4A 2YOLA 1QZ8A 1XX9A 4FUGA 1MCVA 4A7IB 5DKMA 4CHAB 2D1JA 2A7HA 2V3HH 1Y3WA 5EJ1A 2XBVA 2BZ6H 1EKBB 4WY3A 1SKYE 5E2PA 4AGJA 1AWHB 3F0OA 4UFFH 1WQVH 4ABAA 1QRWA 3M5NA 4BTTB 3T62A 3NXPA 1EOLA 4XBDA 5EPNA 2ZFFH 3FP7E 5LGOA 2C8XB 3MH7A 1BOQA 4X6PA 1D3DB 3Q3KA 3FKSD 1QBNA 4TYDA 1C2MA 2XC0A 1TPOA 1GCTC 3ZZ3A 4I33A 4RT0A 1RFNA 2ODYB 1LHCH 2F9PA 3GICB 3ZVBA 2ILNA 2P95A 3MH5A 5HGGA 1VITF 1Z8GA 1TONA 3LC3A 3K9XB 2QXIA 3QTOH 1ELTA 2VIQA 4CHAC 1BHXF 4LZ1H 1J17T 3QX5H 4FVBA 3UFAA 2UUYA 1C5WB 5T6GA 4Y7BA 1HIAB 2QAAA 2VU8E 1WBGB 2R2WU 3A89A 3CS7A 2ALVA 2GMTC 2GCTC 3A8DA 1DUAA 2GJGA 3S9CA 2VB0A 1KLTA 1DE7H 2BY5X 4UFDH 1AB9C 2ZDMA 2ZFQH 1C2EA 1CBWB 3M5MA 2J94A 2W3IA 3A8BA 1P09A 3AASA 3DA9B 1OYTH 1A5HA 3SW2B 1ZPZA 4Q63A 2TIOA 2ZPRA 2YNBA 1L1NA 3QGNB 1O2UA 1A4WH 3EGKH 3UIRA 1GMDG 3DFLA 1TPSA 2W26A 1MKXK 5C94A 1GBHA 1ZMLA 1S83A 2GV7A 3PWBA 2H9TH 1GHYH 1UVTH 1GJ8B 1P0SH 3ZZ6A 3TK5A 1S0QA 5DSFA 4BAOB 4XDEA 1XVMA 3GCNA 2XBXA 2QY0B 1WQSA 4GVUA 4XBCA 4GPGA 3PMBB 1V2ST 4OGXA 1HJAB 1BMLA 1DLKB 1ELFA 2EI7A 3FANA 3D49H 1JOUB 1L1JA 1O3EA 1C5YB 2EQNA 4GAWA 4WXIA 3RM2H 3K65B 1FXYA 4NA8A 2FESH 1F0RA 1P3EA 5ABWA 2G55A 3TJUA 1O34A 3DCLA 1J8AA 2ZA5A 5EOKA 2Q6FA 1MTSA 1XKBC 3DD2H 4DJZB 4CRBA 4SGBE 2ZDVH 2FS8A 2BXUH 1NFWA 1UK2A 2CGAA 2FOAA 2SNVA 2AMDA 2IN2A 3F68H 1OS8A 1VCWA 5IDKA 2K1QA 2UUKB 3UOUA 1AE8H 5E8EH 2BDYA 5T6DA 1YPGH 1ZTJA 1O2TA 5A2MH 2BD2A 1DWCH 2CK3D 2C8YB 2GD4B 4F49A 4K69A 5C5OA 5ESTE 4BAQB 1IQKA 4MNYA 1HJAC 3SJIA 2J98A 3MHWU 3ZZ7A 1PQ8A 3GY2A 1AKSA 1VITG 3F2HA 3WW7A 4OS7A 4UFGH 2J97A 2CF8H 2WYGA 3F9HA 3OEHD 5FBIA 4ACAA 1FPHH 1SQTA 1ANEA 4FU9A 1TBQH 1O32A 1DXPA 4FUCA 3RXKA 3L33A 5L2ZH 1P2QA 4QT8C 2V6NA 2GDEH 1G30B 3LH3A 1O2GH 3ZVAA 1UCYK 3SUEA 3LJJA 4ABHA 1AU8A 1CSOE 2Z9IA 2BQ6B 3MI4A 4X1PU 1CHOG 5L30H 1O2HA 1ZZZA 3ESTA 1ZLRA 3ZVCA 1UW7A 5TCAA 1OP0A 1ARCA 1LKAA 1O2YA 5F53A 1BRBE 2C4FH 2FLRH 4FU8A 3TGKE 4RN6A 1DWDH 2FP7B 3LONA 1O35A 3KCGH 3RMOH 5BPEA 1WTHD 1DXWA 1TLDA 2PKAA 1AWFH 2BY6X 1SOTA 4MLFB 3L6PA 4H4FA 2STAE 4WJG2 3BIVH 1HAVA 1EQ9A 5FXLA 2BOHB 6LPRA 3KQCA 2QYIA 3FVFB 1GDNA 1P06A 2Z3DA 2RFKC 1YM0A 1E37B 2SGDE 1GVKB 3RM0H 1DVAH 1ZMNA 2FLBH 4B2AA 3MTYA 3ATMA 1JBUH 2RG3A 1MTVA 2F3CE 5JBCS 1DWBH 4HFPB 2OK5A 3A87A 1K21H 3SUFA 3KF2A 2TBSA 2Z6BD 5GIBA 1O2JA 1AVWA 4K5ZA 4ASHA 3NWUA 3SYJA 1J9CH 2ZG0H 3TJNA 1QB1A 2ZCHP 1IQNA 2HNTF 3SN8A 2EI6A 3Q3YA 5L6NH 1BTYA 2Y7XA 4CR5A 2ZDNA 2VH0A 1DWEH 1EPTB 2FOBA 4NWLA 3S7KB 1FY4A 5F03A 4CBOA 4UFEH 1GHAG 2XCFA 2Z9GA 1EJMA 4Z1MD 4K1EA 1YBWA 1E79D 2JETB 1RIWB 2THFB 4FOUC 1HXEH 5GCHF 3VPKA 3ZZAA 3PMHB 4I8LA 4DW2U 4Q7ZA 1DLEA 1O33A 2PW8H 1DITH 2P94A 3EE0B 1F5KU 4NIVA 5CHAB 1OKXA 2C8WB 1BIOA 4FUEA 1Z6JH 4CRFA 2J38A 1GJ5H 1E0FD 1LCYA 4ZKSU 3RXCA 4HTCH 4ISIH 1GI7B 2VVVA 1KDQA 2QF0A 1ELEE 3SJOA 1CE5A 9ESTA 1O2WA 5GXPA 1ZJKA 1TPPA 1T32A 2QA9E 3BG4C 5C1UA 1GBTA 2J95A 2ANYA 1SGNE 1A5GH 1TX7A 3QZQA 1GI9B 1HAOH 4NG9H 3DHKH 1K1LA 7ESTE 3Q00A 5ETXA 3ZVEA 3DSOA 1PPZA 1FY3A 1C5SA 2JETC 1RIWC 2Z9JA 3GCOA 3S9AA 3ZYEA 3U1JB 1W8BH 5HIYA 1TRYA 5FPTA 2ZTXA 1V6DA 1WOFA 3ODFA 4E7RG 1ZGVA 1D3QB 4JZ1A 3VGCB 3PYHA 5CHAC 3F2GA 2AERH 1OPHB 1O3AA 1XVOA 3A7VA 5A8YA 1HJ8A 1QA0A 1G36A 2CF9H 1MD7A 2ZNKH 3O8RA 1CGIE 1SGIB 1V3XA 1XXFA 4CRCA 3A81A 2J2UA 2FS9A 3FZZA 3PLPA 4NZQA 3WWBA 2ZPSA 3SI4H 1GI8B 3E3TA 3GYLB 3TH4H 3MH4A 2FWWA 1HAGE 4ZHMU 4Y8YA 2BD4A 2QF3A 2FMJA 5C1YA 4Y8XA 3N7OA 1BTUA 1KXDA 1O2IA 2ZU2A 3ELAH 3OFND 1W11U 3CNRA 3Q3XA 5EW1H 2ZQ2A 3KIDU 1K1PA 5PTPA 1HLTH 2Y7ZA 3VGCC 5F8TA 4MVNA 2JH5D 3I78A 3VB5A 2XC5A 2HOBA 1SOZA 1Y5BT 2RCEA 4DVAU 1QURH 2G5VA 1TGCA 1ZSKA 1PPCE 1TRMA 1YPMH 1O2NA 1PFXC 4DIIH 6ESTA 1J14A 7GCHF 1HIAA 1WYKA 1W0KD 5GCHG 2B8OH 1WCZA 1XUFA 2O8TA 3OU0A 5CDFE 3ZZ8A 3G01A 1BDAA 2XW9A 2ZF0H 2HGTH 4UEHH 3FAOA 1H9IE 1SQRA 1IQJA 3W94A 1ZYOA 3OY6U 1BTPA 1SHYA 1EJAA 2R3UA 4AN7A 1C5PA 2AFQB 5F8XA 2BD5A 2FYRA 3H09A 1C1RA 4UONA 2QXGA 5HIZA 1G32B 3MYWA 1EB2A 2A7CA 4IMZA 3SU4A 4YTAA 1C1WH 2JJ2D 1YCPH 1QB9A 2RDLA 2BD3A 1SLWB 3TIUA 2ZHEH 3M7UA 1QBOA 5I46H 3M37A 1KXEA 3O8BA 1O2PA 5SGAE 5GJ4B 4JZIA 2OC8A 1D6RA 4E05H 1HAYB 4J2YB 2AMPA 1DT2A 2ZHWH 4CREA 2SFAA 3NUMA 1ETTH 2FO9A 1DPOA 2LELA 1YGCH 3VB7A 1EAXA 2P16A 2P3UB 1ZRBA 1UK4A 1O37A 2VINA 1W14U 2BHGA 3H7TA 1KTTB 1SL3A 2PWXA 5A09A 4MPVA 4A6LA 3EYDA 3QN7A 1N6XA 1TRNA 2OQ5A 1AFQC 3OSYA 1QL7A 1KSNA 1C1PA 3TLOA 3ZZ5A 2BDCA 1YPKH 1N8OB 2WPKS 1P05A 4TWWA 2BQWB 2WHXA 1YF4A 1ZJDA 3OTPA 4INLA 2FTMA 1BMNH 3V7TA 4D8NA 1LVMA 3BIUH 3RDZA 4JCNA 2J4IA 3V3MA 1Z6EA 2WINI 1O3OA 2O8LA 1TMBH 4OGYA 1CU1A 1GMCF 3TU7H 5FHTA 3GDSA 2V35A 3NZIA 5EXNA 3A8AA 1ZHRA 4X2VA 2JKHA 3QZRA 1DSUA 2H5CA 3A7XA 2C93B 2NU3E 3RXSA 4TY6A 1GWAA 1T8MA 5FCKA 1L4ZA 1LDTT 1DY9A 1AY6H 3M5LA 1QGFA 1O3GA 1OWDA 3C1KA 3GISB 3A82A 2OD3B 3U8RH 4ISNA 4ZHLU 1TQ0B 2D26C 4RT1A 3SGQE 3SUDA 3AAUA 2Q6DA 2GTBA 2XWAA 3FO8D 3DSPA 5EODA 4DCDA 4Z6AH 2ODPA 4HG6A 2GGVB 5DP9A 1YCPK 4FUBA 1W7XH 1UTQA 1YWUA 1Z7KA 1C4Y2 3MNBA 2G4TA 3LGWA 1N6YA 1EP6A 1H9LB 3MO3A 4FUFA 1P12E 1P8VC 4WVPE 2FOEA 1C5UA 1OP2A 3P95A 2L6OA 4FUJA 1DDJA 3GY6A 5KEDA 3RXGA 1SGTA 5HM9A 3KQEA 2FEQH 3A86A 1OHHD 3ODDA 2ZFTA 3GY4A 4B71A 1YLCA 1DY8A 3RXOA 4B2CA 1Z8JB 3TPIZ 2AIQA 1AVXA 1G37A 2H2ZA 5EPYA 1O3NA 2ZEBA 5JBBS 3DT0H 5DP8A 2V7QD 1P04A 2XCNA 3GOVB 1NESE 3T29A 1JWTA 4THNH 1FMGA 9LPRA 1ORFA 1FIZA 2XTTB 5AVDA 1INCA 3V12A 4A5TS 1HB0B 1NFUA 3M3TA 3SZEA 3V13A 1GMDF 2ZTYA 4IW4E 1VR1H 2AS9A 1O3JA 2BLWA 3EAJA 1O2RA 1GHXH 2QV1A 2HRVA 3QK1A 2Z3EA 2H6MA 1S6LA 2OC0A 1MKWK 1SHHB 1WTGH 1K1MA 5F6MA 3I29A 1EPTA 3RC4A 1YLNA 1BA8B 1MU8B 1QFKH 2ZC9H 3BEFB 1GGDB 2SNWA 4B74A 1SGYE 4X1QU 2WPIS 1QY6A 1FX0B 1GMCG 1MKXH 2AHME 1C5TA 1GJBB 2B7DH 2XC4A 3E0PB 1V2KT 4ISLA 5KGOA 5T1VA 1P03A 3A80A 3PRBA 2AH4X 1MU6B 2JJ1D 1O3IA 1EP5A 3N7EA 4B2BA 1VGCB 4I31A 3SNEA 3ZZBA 4ZH8A 4F4OC 1SLXB 1EUFA 4GCHF 2PTCE 3NPSA 2R9PA 4ASUD 4WXVA 2CHAC 4X2WA 2GMTB 1BTWA 2GCTB 1TNHA 2KCPA 3S0NA 2ANMH 1XM1A 2H9EH 1AB9B 4A1TA 4ACBA 1EJNA 1EXFA 3F9EA 3W1EA 2P93A 5JB8S 2OBQA 3MH6A 2G81E 3C27B 4NIWA 1GGDC 1UTJA 1Y3UA 1MAYA 1T8NA 1W10U 2JH6D 3P92A 3O8CA 1THPB 1QJ6B 2G52A 1W7GH 2R3YA 4AB8A 1GI5A 2M2AA 1W0YH 2R2MB 4RSPA 1N1LA 5KECA 3HGNA 2F83A 5C5NA 1TWXB 4AX9H 3A7WA 1C1OA 1PPEE 2ZU3A 1VGCC 8GCHG 1HUTH 1NPMA 4BTIB 4OS6A 3ZVFA 1Z1IA 1GBAA 2LNCA 1K0HA 2PV9B 3MQKC 3QUMP 4H42U 5EXMA 1CHOF 1NRNH 4KGAA 5EQSA 2O8UA 2WPLS 8ESTE 2FI4E 3K6ZA 1O5FH 4BOHA 3PWCA 1Y5UT 2BY9X 2UUJB 1OOKB 2SGEE 1WU1A 1K9OE 1UCYH 2PKSB 4M9FA 4WMDA 2GZ7A 5T3HA 5J4QA 4FUIA 1QNJA 4FU7A 1GJDB 1A46H 3PMAB 1O5EH 1T8LA 2FODA 3E6PH 1C2GA 1OWIA 3R0FA 1V2MT 1BTXA 3AW0A 1G2MA 1ESAA 1L2EA 2H9HA 1TFXA 3RXUA 4ZHAA 2CXVA 1WXRA 2WZQA 2BLOA 4D7FA 4CRAA 1P2KA 1JIRA 1WAYB 2A45B 4X1RU 2Z9LA 4TWYA 2P8OB 1EZQA 1C9TA 1AMHA 1C1UH 1UHBB 5EG4A 3VB3A 4K1SA 2LP6A 3TH2H 1BB0B 2A1DB 1TNGA 2WPDD 4YO9A 3SNAA 1PPHE 1D4PB 1THRH 3GCHB 1EX3A 1GHVH 2PKSC 3MNSA 3M7QA 1AD8H 4GCHG 1ZSJA 2Q1JA 2M5TA 1O2MA 2UWOA 1T8OA 3R3GB 3LKWA 2BD9A 3RXBA 2JDID 2ZGBH 1FIWA 5DP7A 2VJ1A 2OC7A 1GHAF 3MWIU 3P8NA 4X2YA 1TPAE 1VJAU 1HAHH 1G3DA 3E8LA 3T5FH 4JK5A 1WUNH 3SJKA 2P8OC 1OP8A 1VCPA 3K2UA 1B0EA 1GBJA 3U8OH 2PSXA 3DUXH 4A92A 3LJOA 2Y5HA 4O03A 3GCHC 1QL8A 3FOAA 3A7YA 1Y3XA 2F43B 1GJ7B 3URDA 3B23B 2ZHDA 1EZSC 1EAWA 2QF4A 2ZHQH 4IGDA 3TNTA 3M61U 1CHGA 4ZUHA 2AIPA 3ENSB 3PTNA 4NIXA 1H1BA 1GI0A
chains in the Genus database with same CATH topology
1GI3A 2Z9KA 1FY8E 4MTBA 1TA2A 2D8WA 2G51A 1NZQH 1EZUC 1LVOA 1B5GH 3U69H 1EAIA 2FM2A 2XXLA 1GDQA 1TBZH 1HV7A 1LMWB 2BVXH 1C2LA 2ZFPH 5T6FA 4NA7A 2ZKSA 3PV4A 1UK3A 1UO6A 1BUIA 4AG1A 1UTPA 1IQLA 1W12U 1MCTA 1SB1H 1FDPA 2WYJA 1TX6A 1C5QA 2PSYA 4D76A 1GHWH 1RTFB 2BDIA 4IMQA 4INHA 1BRAA 1LPGB 4NWKA 4IC5A 3BEUA 4DG4A 2GZ9A 5IYTA 1HAPH 1GJ6A 2W7UA 4AYYB 3H5CB 1FLEE 4X2XA 3JZ2B 2ESTE 2ZGHA 3D65E 4D9QA 2PHBA 3STJA 3BG4B 4HI3A 3URCA 2OLGA 3ATIA 1QTFA 3GY3A 2BVSH 4K8BA 1FI8A 1O5CB 1HAZB 1TMTH 1PYTC 2QGRA 3SGAE 1TGTA 2BY8X 1O3PB 4YOGA 3RMNH 1P2OA 2HALA 3SGBE 2ZTZA 2Z7FE 4X8SH 2Y81A 5C2ZA 3E1XB 3BTME 4M7GA 1C1MA 4BANB 1TNIA 4UDWH 4YLUA 1NT1A 1D9IA 2PUXB 2BDGA 3MNXA 1O30A 3S69A 1FAKH 3ZZ9A 1LKBA 3TH3H 5DP4A 1ELAA 1UVSH 4LK4A 1NO9H 4JZFH 3SU3A 1QBVH 3U1IB 1ANCA 4ZMAH 4XBBA 2PGQB 3PM3A 3LGVA 3A83A 5K7RA 1QCPA 1FZZA 3RU4D 3UQVA 1MUEB 1U6QA 2VIVA 1CA8B 1Y3VA 2F91A 3IWMA 1FAXA 4AZ2B 2ZFSA 1EB1H 1PPGE 4J1YA 2BLQA 2ZI2H 1RRKA 1ANBA 1K1IA 5E0GA 3LU9B 1O5DH 1F7ZA 4LZ4B 1TGBA 1H4WA 2OXSA 4ZKNU 1AUJA 1C9PA 4U01A 3QGJA 3RXLA 1TAWA 1SGQE 4H6TA 1QR3E 3EA9A 3KHVA 2QC2A 1AVGH 1H8DH 1YPJH 3P8FA 4NFFA 4X6NA 1O3FA 2NWNA 4JMYA 4CRGA 1O5BB 1WV7H 2ODQA 4E06H 3PROA 5HXFA 1W0ZU 4RKJB 1AZ8A 5JYIA 1ZR0A 3BTFE 2ZU4A 2BVRH 2GV6A 1HNEE 4ZXXH 3MO9A 1EASA 5DGJA 2J9NA 2BM2A 4I32A 5HYOA 1ESTA 3BTEE 3STIA 4YT6H 3RMMH 2FDAA 4BNRA 1RD3B 4XOJA 1C5VA 1Q3XA 3UNQA 1CT4E 1V2RT 4UD9H 5JBAS 3SV9A 1FUJA 2HNTC 1GCDA 2ASUB 3BTGE 1HPGA 1ZTKA 2VIDA 1UTOA 3TNSA 2NU0E 1SLVB 4R8TB 1V2OT 1LTOA 1V2LT 4GLYA 4ISOA 4Y6DA 4Y71A 2GT8A 4WH6A 1C1QA 3ITIA 1GBDA 1M9UA 2AYWA 3TK9A 1Q31A 1ELCA 2VGCB 1DSTA 4JK6A 3K6YA 1RGQA 3RUOA 3GYMA 4IN2A 3RC6A 2XNIA 2IJOB 1D3PB 5BRRE 1P3CA 1BT7A 1FNIA 1V2QT 1MTNB 2Z3CA 1C4V2 1KTSB 2A4GA 2TGTA 1K2I1 1ZGIA 2BYAX 1S82A 3SV6A 3BV9B 4RKOB 3LIWA 1O3LA 2XRCA 5DJ7A 1AZZA 3EA7A 5AFYH 1JRSA 3MNCA 3W95A 5DP6A 4MNVA 1AFQB 3RU4T 2XBYA 1H8IH 1JMOH 2VGCC 4MNXA 5AHGH 5F8ZA 1DUEA 1TGSZ 3HPTB 1KYNA 3PO1B 3MU8A 1TNKA 4X6MA 1HAXB 3BEIB 2ULLA 1GHBF 1OYQA 1A5IA 3RXQA 1MTNC 1YPHC 1ZHPA 1D6WA 3FZDA 3GDVA 4XSKU 3UR9A 1ETRH 1QRXA 1O3DA 5DG6A 5FBEA 5HM2A 2V0BA 4X0WU 2Q6GA 1G3EA 1MTWA 4K60A 5E0HA 3SOSA 2FOCA 3UWIA 1O2SA 1S6FA 2LPRA 2PLXA 3BTWE 4Q80A 1LPKB 2ZZUH 2RA3A 1V2VT 4OS5A 1E36B 4FUDA 3PO1C 2BDBA 3IG6B 4HZHA 1GBEA 1G3BA 1P11E 1P02A 3KN2A 5G4BA 3LOXA 3FFGA 4H6SB 3VXFH 3SU6A 3SBKA 2A5IA 4D9RA 1O38A 3ATWA 4AFZA 1O0DH 4MPUA 3F9FA 2BX4A 1MKWH 3B8JA 1HCGA 3GY5A 1GVZA 1NFYA 3LDXH 2VVCA 3ZV8A 4B73A 1A0LA 1NTPA 2SGPE 3UNSA 1YPEH 4JYUH 3UTUH 1SBWA 2AMQA 3M5OA 3TITA 5FPSA 1GL1A 1C2FA 1VCQA 4Y10E 1BITA 2ZU1A 1GJ4H 3ZYDA 4ZROA 3RXTA 4FXGH 3M7TA 2F9BH 4GHQA 1V2UT 5A0AE 2OUAA 4NFEA 4TPYA 2P3FH 2W3KA 1UVPA 1PYTD 3P8GA 3P6ZB 1E34B 3HK3B 3NCLA 2VIWA 1TOCB 3GCTG 1C5NH 1NU7B 4YOIA 4K8YA 2A2XH 1CGHA 2FI3E 2G4UA 1A61H 4AORA 3E91A 5FCRA 1ZSLA 1Z71A 2H5DA 1UTLM 1GI1A 4GUXA 1ACBE 2ZDKA 8GCHF 3HKIB 1HAIH 4TY7A 2HPPH 2C90B 1KXAA 1THSH 1GG6C 1SPJA 2QXJA 1YCPM 2STBE 3T26A 1A1RA 5CMXH 3F1SB 4X6OA 3MOCA 4VGCB 1GHBG 2VIPA 5E0JA 3UY9A 1G3CA 1RTKA 4JYTA 2BD7A 1Q2WA 1KY9A 3RXRA 5A0CA 3T27A 3P17H 3A88A 1Y8TA 1SLUB 4AFSA 3CENA 1QRZA 1S85A 3OYPA 2SGFE 1P2JA 1AGJA 1P2NA 1FJSA 4AB9A 2NU2E 2BMGB 3KNXA 3SV7A 1MBMA 2CHAB 2QCYA 2BD8A 3SQEE 2F9NA 2BLVA 2F9UA 3LGIA 3QWCH 4ABJA 1ZOMA 1MH0A 2G8TA 4NCYA 4OS1A 4Q2KA 5A8ZA 2EA3A 2TGDA 3MO6A 1LQDB 1EATA 1Z8IB 1XUGA 3RXIA 2GT7A 2QN5T 2Y5GA 1SSXA 4U2WA 3HK6B 4VGCC 4DURA 1MAXA 5C1XA 2GZ8A 3PTBA 5C67A 3SUGA 1O2ZA 1NC6A 3UUZA 1C5ZB 4NSYA 1HGTH 4X8UH 1AO5A 1UTKA 3EQ0H 3RXAA 3BTKE 1ETSH 1GHZA 2XYAA 1XUHA 4BXSA 1RJXB 5JB9S 3KEEA 4WF8A 1ARBA 1V2PT 4U30A 4UE7H 1SMFE 2BB4A 2IPHA 4JZEH 1PQ7A 1WSSH 1FY5A 3VFEA 2HNTE 4Y76A 2ZGCA 4I8HA 2UUFB 4MDSA 1XUKA 2FI5E 3LC5A 1C1VH 1V2TT 4YESB 4CH8B 3AW1A 4JZDH 3E0NB 1GPZA 4AGKA 4INKA 2SGQE 4NGAH 3SQHE 2J34A 1MQ5A 1O3CA 1UVOA 2UWPA 2VWMA 5GDSH 1F0UA 3QTVH 2JH0D 4A1VA 1FQ3A 3GDUA 2P59A 1KXFA 4HGCA 1PJPA 5L2YH 3E90B 4I8KA 3MU1A 4ESTE 1GI6A 5C3NA 1XKAC 3KGPA 1C5OH 1TGNA 1MZDA 1NN6A 3RMLH 1C1TA 1S6HA 2WUBA 1O31A 1LO6A 4PROA 1P2MA 1UTNA 3AVZA 3LGTA 1O5GH 1D3TB 3ZV9A 2FTLE 1TNLA 1ELGA 1C2IA 2CMYA 1IHSH 1RS0A 1XMNB 2Y80A 1HRTH 1O3HA 5K0HA 3U98H 3QO6A 4OS2A 2VH6A 2XBWA 2WV4A 3BG8A 4E7NA 3P70B 1YPHE 3RXPA 5CE1A 1KXBA 3OTJE 1J15A 2VWNA 5AFZH 1E35B 2BQ7B 4GHTA 2VNTA 2RA0A 3TK6A 3ATKA 1SGFA 3BTQE 4KTUA 3PMJA 4AFUA 4KTSA 1BHXB 2OC1A 1P10A 3SU2A 2HPQH 2OBOA 5TJXA 1JIMA 1O36A 1AE5A 1PPFE 3EDXB 1FV9A 4CR9A 1SGDE 5HMAA 1EAUA 1NRQH 4KKDA 5FX6A 3V0XA 2PR3A 1DS2E 1GL0E 5JPMH 1GBFA 2A5AA 3A7ZA 1BBRE 1MBQA 1ZRKA 3ZVGA 5LPFA 3SHAH 3SU5A 1YLDA 2FPZA 2ANKH 2CJIA 2XWBI 2ZECA 1FN6A 1LHFH 1K28D 4Y11E 5GPIB 1CA0B 1CBWC 3LGUA 4OS4A 3RXDA 3MU5A 1BTHH 3I77A 2EEKA 1TMUH 3ZZDA 3ZVDA 3U8TH 3NK8A 4WMEA 1BMMH 1HBTH 2PUQH 4NSVA 1FPCH 3CP7A 4O9VA 5EW2H 3SZNA 4ABIA 1GJ9B 1IQFA 1YP9A 4ISHH 1ESBA 1O3KA 1VJ9U 3JZ1B 3SNBA 1IQHA 4IC6A 2QIQA 4AFQA 2VVUA 1P9SA 2HWLB 3M35A 4WWYA 3RXEA 1IHTH 2PFEA 2GVFA 1A0HB 1CA0C 1DOJA 3D62A 3TJVA 2W7SA 1YKTA 3UWJH 2ZHFH 1NFXA 1LHDH 5A0BA 4IBLH 5AF9H 4Y0YE 2TGPZ 1BMAA 4DIHH 3SJ9A 2NU1E 1ELBA 1IQIA 1TQ7B 3MMGA 2B5TB 4B76A 2OP9A 3VEQB 1SFIA 2F9VA 1P57B 4K3JA 1C2HA 1ABJH 4IS5A 5I25A 1F2SE 3KL6A 2TRMA 5EQQA 1MD8A 2A4QA 1FY1A 5DP5A 5E2OA 3A7TA 2AGGX 3TGIE 2EI8A 3BTHE 3O8DA 1BBRH 1QQUA 1HYLA 4BAKB 1C5MD 2BZAA 1LPZB 2WPMS 4JYVH 4DGJA 3TJOA 1O5AB 2KAIB 1P2IA 1JRTA 1NU9A 3PLBA 4ZKRU 2W5EA 3LH1A 3NKKA 3VB4A 4YLQH 1SGCA 1C1SA 1W13U 2GDDA 1Y59T 3FP6E 5JDUB 4YT7H 3SORA 1CGJE 3RXVA 4B75A 4CRDA 1O2XA 1T7CA 2ZDLA 4GSOA 1OWJA 4BXWA 1TA6A 1RXPA 1SI5H 1W3CA 1C2JA 1NS3A 4AYVB 1J16A 4NZLA 2ZWLH 1MTUA 1ZHMA 2BOKA 5FX5A 3WY8A 1MQ6A 4MG3A 1F5LA 2PTNA 7LPRA 4NA9H 3GY7A 5FPYA 1FONA 1TX8A 2DUCA 1T4UH 1OXGA 3Q76A 1QB6A 3SU1A 1GI2A 3SV2H 1KLJH 1SG8B 2ZGXH 1F92A 1GMHF 5EXLA 2F9OA 2ZQ1A 3M36A 4KP0A 2BDAA 3RXJA 5FAHA 2A4OA 1ZTLA 2WPJS 1OWEA 1S81A 4NIYA 1G9IE 4X1NU 4B1TA 3HGPA 1OX1A 3RU4E 6GCHF 4ABFA 3BTTE 2FXRA 1DICA 1O3BA 1PQ5A 4R0IA 4A1XA 2V3OH 2G5NA 4MPXA 4ZAEA 1A3EH 1MMJN 1AUTC 3LGYA 1NRRH 3AAVA 1S0RA 1OSSA 2UWLA 1TB6H 2D2DA 4ZXYH 3SI3H 1O3MA 1T31A 2BX3A 3SNCA 1QJ7B 1BBRK 4LOYH 7KMEH 1GI4A 2AGEX 1DANH 1MZAA 2GCHF 3LPRA 3P8OA 4XE4A 1KIGH 4BAHB 3RXHA 1EPTC 3HATH 4SGAE 1ELDE 1V2WT 1SGRE 1QQ4A 3H7OA 1BQYA 5J4SA 2ALPA 1BRCE 1V2NT 2DE9A 1AI8H 2FZZA 1SQAA 2AGIX 3CS0A 3F9GA 2C3SA 1ABIH 4Y8ZA 1TBRH 3VXEH 2GP9B 1C5LH 4DT7B 3MFJA 4U32A 3SJ8A 2WUCA 2C8ZB 5ESBA 3SU0A 3FP8E 2WV5A 1IAUA 1K1JA 3UOPA 3E16B 4CBNA 2A31A 2A2QH 3T28A 1F0TA 1ZPCA 1HJ9A 2Y82A 1UVUH 1X7AC 3F6UH 2SGAA 2HVXA 5B6OA 1CT0E 4Y7AA 1SC8U 4O97A 4KELA 2FOGA 1OWKA 1H9HE 1W2KH 4WH8A 2BXTH 1O2KA 1KXCA 4TPIZ 4ABDA 1YPLH 1QL9A 1SVPA 5DP3A 1DX5M 1RTLA 1A2CH 1YC0A 3EA8A 3QDZB 2HLCA 1GBIA 4X8VH 3OY5U 5DK1A 1SR5C 4Q7YA 1NY22 3RC5A 1GMHG 1QA7A 1Z8RA 2FOFA 3GCTF 4O3UA 3U9AH 2ZFRH 1O2VA 5LPEA 1TYNA 2ZCKP 1O2LA 1TE0A 2ZPQA 1TABE 4K1TA 2OQUA 1G2LA 6GCHG 3BSQA 5C20A 3SO3A 4CH2B 1P9UA 3M3VA 3A85A 3DFJA 3OX7U 1JXPA 4I8JA 4YZUA 1P01A 2YNAA 1A0JA 2AEIH 4YM9A 1FN8A 3MU0A 5A8XA 2OCVB 1GJAB 4I8GA 3UR6A 1GBCA 1BJVA 4ABEA 2EC9H 5EU8A 2ZP0H 1PQAA 1ANDA 2GCHG 5JBTA 4WMFA 1TIOA 2O8WA 1ZMJA 4LXBH 1GBKA 3IITA 2I6SA 5EGMA 1K1OA 1UHBA 3UNRA 1GBMA 1LHGH 3TVJB 1KLIH 3RP2A 1TNJA 1AKSB 2B9LA 2G00A 1SGFG 1TOMH 1C5XB 2O9QA 4AOQA 1EZXC 1XUJA 4FVDA 2OINA 1T4VH 1Y5AT 1SGPE 3D23A 1PPBH 1C2KA 2I6QA 1Y3YA 1IQGA 1IQEA 3A8CA 5GWZA 1F0SA 2A5KA 1L1GA 1L4DA 1CVWH 1GDUA 1O2OA 3LT3A 2TPIZ 1SQOA 1GBBA 3KQDA 1C1NA 1VZQH 2BTCE 3PLKA 2A7JA 4Z0KA 2FYQA 4BTUB 3RXMA 1LQEA 4MPWA 2FIRH 5DPAA 4X1SU 2DE8A 6CHAB 1GVLA 1GG6B 1AHTH 8KME2 2PKAB 3ATLA 2A4RA 1VITH 2Z94A 5LPRA 3UQOA 5H4IB 4X8TH 1HAVB 3Q77A 2TGAA 1O39A 1V2JT 1AQ7A 1BRUP 1UMAH 1YYY1 1B0FA 4AG2A 1B7XB 4I7YH 3HKJB 5TCCA 2Y6TA 2B0FA 2CV3A 3KQBA 5EQRA 3SNDA 3S9BA 2ZCLP 1EOJA 1QJ1B 2BY7X 1GJCB 7GCHG 1NROH 1AIXH 1LHEH 1SFQB 1UJ1A 2VIOA 2ZGJA 3BN9A 1LVYA 2FOHA 1N8OC 2ANWA 2GX4A 3PB1E 1NRSH