3ESTA

Structure of native porcine pancreatic elastase at 1.65 angstroms resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(serine proteinase)
molecule keywords PORCINE PANCREATIC ELASTASE
publication title Structure of native porcine pancreatic elastase at 1.65 A resolutions.
pubmed doi rcsb
source organism Sus scrofa
total genus 61
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1987-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3estA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3estA01
5J4SA 3Q77A 3VXEH 3SJIA 4FU9A 2FM2A 1DLKB 2C93B 4JZIA 4NA9H 1Z8GA 2ZFQH 4FXGH 3M3TA 1UTOA 5LPFA 4CRBA 2FEQH 2WPMS 1EASA 1BOQA 2ANKH 1WOFA 1O3NA 4INHA 4B73A 2P3FH 4B71A 2TRMA 2PLXA 1QY6A 1TPSA 1SI5H 5E2PA 4CREA 2ZGHA 1B0FA 1O3LA 3UR9A 1RGQA 1BMAA 4Q2KA 1TNJA 1W3CA 1MCVA 1PQ8A 2WYJA 2UWOA 3EDXB 1XUFA 1QBNA 4H6SB 4B2CA 2CN0H 1ARCA 5ABWA 1O2QA 3GCTF 1C5ZB 1TMBH 3SUEA 4BAHB 2FLRH 3G01A 1IQLA 1QRXA 2H9HA 1K1PA 1OP8A 2F9BH 4A92A 2FOEA 5LGOA 1P02A 2Z3EA 1P11E 3RXMA 1BTYA 1C5VA 1GGDC 3UQOA 1PQAA 3TITA 4AFSA 1O5BB 1C1SA 3GY6A 4K8YA 5L30H 3A82A 2FO9A 1C4Y2 1GBHA 4XE4A 1CHOF 5GXPA 3FFGA 4X1PU 5E8EH 2TPIZ 3FANA 6ESTA 1WAYB 1AUJA 1XUJA 3SUDA 2Y7ZA 3SNCA 4NG9H 1EJNA 3BTFE 5LPEA 1TGCA 1XKBC 1MKWH 5AHGH 3PLKA 4ISIH 1INCA 1TYNA 1E38B 5AFYH 4KP0A 4YT6H 2Y80A 4AGKA 2QYIA 1G2MA 2OC1A 4MPXA 4NIXA 2KAIA 3LC5A 1O37A 1EATA 1RFNA 3SU5A 1EJMA 1GGDB 1P2QA 1ORFA 2BQWB 1BDAA 2O8UA 1AZZA 1T4VH 1TGBA 3KF2A 4NCYA 4I8GA 2AIQA 1IQJA 2BY7X 5DP9A 3LGTA 3T25A 1FPHH 1V2NT 4Y7AA 4CRDA 4XDEA 1LHGH 3PMHB 1UCYH 1ANCA 2F91A 4X6MA 1O39A 1VGCC 1T8NA 1V2VT 1W7GH 5A0CA 1ZMLA 1DWDH 1NRNH 1MZDA 1MU6B 3ESTA 3K65B 2PKAB 1Q31A 1BMNH 3SV7A 1SG8B 3K6ZA 4RKJB 4ZHLU 4YOGA 5LH8A 1O3EA 2AFQB 2C8XB 1ACBE 4RN6A 5FX5A 1BHXB 2AGIX 2XRCA 4I8HA 1JOUB 4MPWA 1H9HE 4Y8ZA 1FN6A 3LT3A 1F2SE 3LC3A 3ZZ9A 2PKSB 1AE5A 1W7XH 1A3BH 3TJOA 2A7JA 1MKXH 3A80A 1JWTA 5CMXH 1H9IE 1D3DB 4CRGA 1D4PB 1GBFA 2BDIA 2FS9A 1GMHF 4Y7BA 3A85A 3OY6U 5T3HA 3RXCA 1A2CH 3F9EA 1GHZA 1YM0A 2BVXH 1FAKH 1TX7A 1HRTH 1TFXA 1FLEE 1V2MT 1MTSA 1GI9B 1KIGH 2G4UA 3P8OA 2FWWA 5EOKA 3A7ZA 4K1TA 2HVXA 5A09A 3TGJE 1BBRH 3CENA 1QBVH 1C1VH 3UUZA 2ZPSA 1KTTB 3M36A 4CR9A 1TNKA 1NPMA 1O2JA 1X7AC 4X1SU 1LCYA 2V3OH 5DP5A 1J16A 1WCZA 3ZZ3A 3U8RH 1C2EA 1JBUH 3LH1A 2FMJA 3URDA 1W0YH 4OGYA 1O30A 2ZQ1A 1YPJH 1UTMA 1C1TA 2HNTC 2ZP0H 1E34B 1O3HA 1XXDA 2NU2E 3SV2H 1TB6H 1PPCE 2ZU1A 1PPHE 1OWDA 1O5AB 4IS5A 2SNVA 2J94A 1GDUA 5FAHA 2XC5A 2A32A 1BTHH 2HNTE 1L2EA 4NIYA 1PPEE 2FOMB 5A2MH 4I7YH 4MNXA 1VZQH 4BAOB 1SGPE 1V3XA 1AO5A 1O3CA 1P2IA 2Y5FA 1HXFH 2BOKA 3RXSA 1O3DA 1HAIH 1CVWH 2ULLA 1AVXA 1RIWC 2OBOA 2OCVB 3K9XB 1DS2E 2FI3E 1SOZA 1C1UH 1WV7H 4GCHG 3ZZ7A 3SJKA 1RTLA 1LHCH 1F5KU 3LGUA 3PO1C 5SGAE 3ZVGA 1XVOA 4IC6A 1QRWA 1GHWH 2IN2A 4XBDA 2QF3A 3JZ2B 1GL0E 2GDDA 1VCPA 4HTCH 4I32A 1NFXA 2OD3B 5EPYA 4ZXXH 1CU1A 3TNTA 1Y3WA 5A0BA 1H4WA 4IN1A 1AWFH 1KXCA 3T2NA 5K0HA 1FPCH 1EB1H 2ZHQH 2PW8H 1H9LB 2XXLA 1Z8IB 3OU0A 2B9LA 2GV6A 3OTJE 1BIOA 4ISHH 3DFJA 2ZDVH 4HGCA 1S82A 1SR5C 1BTXA 2VIVA 1OWHA 1GHAF 3PO1B 4X1RU 2GZ9A 3TNSA 2VWLA 3MH7A 3GY2A 1MAYA 4E7NA 4DVAU 1SC8U 4KTCA 1EPTC 1DXWA 4YZUA 1DM4B 2HPPH 1QFKH 2OTVA 2VIPA 3ZZAA 4H42U 1DWCH 2EI8A 3STJA 1MMJN 2GZ7A 1ELAA 2SGAA 1LVMA 4B75A 1QCPA 1Z7KA 4NZLA 2AGEX 1HUTH 1V2WT 2F9OA 1A5IA 2I6SA 2GCTC 1AQ7A 1VJ9U 5GDSH 3TU7H 2O8LA 4Y79A 1TONA 2P94A 1HIAB 4BAQB 5A8YA 3S7HB 1GBKA 3EA8A 2JKHA 1ZYOA 1GDQA 1P57B 3MWIU 2JH0D 2F9UA 1EUFA 1AB9B 2RA3A 1PPBH 3E3TA 3UFAA 2SGPE 3MU5A 1PQ5A 2AERH 1H1BA 1EQ9A 2CGAA 3RXOA 1V6DA 2BVRH 3A8DA 4JZFH 1A5HA 4VGCC 2GTBA 3NUMA 5JDUB 5JBBS 3DD2H 2WYGA 1TNGA 1ZJDA 2B8OH 1EP6A 1QL7A 1AI8H 1YGCH 2UWPA 3T28A 4ABGA 5GWZA 1EAWA 1LPGB 1UTLM 3OY5U 5E2OA 2B7DH 1O5EH 1FQ3A 2GCTB 2PR3A 1C1RA 1ZHRA 3LPRA 3PMBB 3SV6A 4ZXYH 5C1XA 2FOBA 4YLUA 3UIRA 1SGYE 1KXBA 2BD9A 2Z9LA 3M7QA 4Z6AH 3RC4A 3MU8A 1O3GA 1UHBB 1YBWA 5AFZH 2VWOA 2ZECA 2BY9X 1A0HB 1F92A 2GCHF 3GY7A 4DY7B 4INLA 4LZ1H 1ZOMA 5JBAS 2PGQB 2BZAA 1GBMA 3UREA 1HAVA 1Y8TA 1GBDA 1A0LA 2TGAA 1DY8A 1T8LA 3ZYEA 1OYTH 2HALA 1BCUH 1YF4A 4J2YB 1FUJA 1QL8A 1Z6JH 3RLYH 7KMEH 2PSXA 3SV9A 4ABJA 4ZHMU 1K2I1 2AMQA 1W11U 1GMHG 2BY5X 3LONA 1UVTH 1K1IA 1EKBB 1WQSA 1ETRH 9LPRA 4WJG2 3A7YA 1GPZA 1ZHMA 2NU3E 2P8OC 3QK1A 2HWLB 1SFIA 1S0QA 4RSPA 3RU4E 3RXPA 5C5OA 3LKWA 1VR1H 3SHAH 1AIXH 1UCYE 1SGIB 1P01A 2V35A 4UFDH 5CE1A 1ZMJA 2ZTZA 2ZGCA 1HV7A 2XBVA 2ZDMA 4ISLA 3TJVA 4MNYA 2FYRA 1GCDA 1JRSA 1WTHD 2BD5A 2OC8A 1ANEA 4XFQA 1XUGA 1F5RA 1P9SA 1BMMH 4MNWA 1UVPA 6LPRA 3GY4A 1DANH 1FY4A 2EA3A 3F9HA 5AF9H 1ZR0A 1ZPBA 1UTKA 1XKAC 1NC6A 1EZXC 1ZTKA 1Y3VA 2P8OB 1C2IA 2ALPA 1IQKA 5C5NA 1DSTA 1QB1A 2FI4E 5TCCA 4B74A 3QO6A 1CQQA 4JZDH 3SN8A 3KEEA 2BZ6H 2XC0A 1O5DH 2YOLA 2J95A 1FAXA 4DG4A 3VB7A 4ZHAA 2H5DA 3PYHA 2QXIA 1O3KA 1IAUA 1WU1A 1OP2A 1PPGE 1BJUA 1ELVA 2PTNA 2H2ZA 1V2UT 1MKWK 4Z0KA 1CT2E 4ZKNU 4AFZA 2GMTB 2PHBA 2ZCKP 1WQVH 2A31A 3MNBA 4B76A 3GCNA 2XBYA 1O2ZA 2ZU4A 1Z8RA 5ESTE 5DP7A 1J8AA 4AORA 1V2ST 1YPGH 3EYDA 1P2JA 3B8JA 1P8VC 3NKKA 4WXIA 1D6WA 1PYTD 3TIUA 5IDKA 1NROH 1BHXF 1AGJA 4LK4A 1KLJH 4TY6A 1QTFA 2PKAA 4CR5A 5FCKA 3HK6B 3RXLA 4WH6A 1UCYK 3SQHE 1GBLA 5F8XA 2D1JA 2ZQ2A 7ESTE 3BTEE 4XOJA 3A81A 3P92A 1GHAG 5C20A 1S83A 2R0LA 1V2TT 1B5GH 3DT0H 3T26A 1DT2A 4BNRA 1HCGA 3E0PB 2GZ8A 3SNEA 1GWAA 4I8KA 1TGSZ 2W26A 4CHAC 3GCHB 3ZVBA 3F9FA 5EPNA 3LU9B 1GBAA 1NFWA 2OINA 1GBIA 3AAUA 1GJ7B 1O2GH 4A7IB 1FIZA 2BDAA 1GJ8B 1D3QB 4BXSA 4IGDA 1MKXK 4FVDA 3SGQE 1ELEE 2WPIS 1VJAU 4X2VA 4O9VA 3MNSA 4AGJA 1QIXB 1SLXB 2QGRA 1K28D 1QURH 3A7XA 1GI1A 3UNSA 4CBOA 1SGNE 1JMOH 1HJAB 1P2NA 1C2LA 3SORA 1F0RA 1TE0A 3O8DA 1ELFA 1PPFE 4FUBA 1Q3XA 1D9IA 2VIDA 2TIOA 1GI0A 1LTOA 3RXEA 1CE5A 3UR6A 1C5RA 4LZ4B 1KTSB 1RRKA 1W12U 5K7RA 1S6HA 3URCA 4DIHH 4GVUA 1LQDB 3RXHA 3RM0H 4A6LA 2DUCA 2R2WU 1EZQA 1GBBA 3OSYA 3E16B 2A2XH 5A8XA 2EI6A 3LGIA 1P3EA 4Y6DA 2VNTA 3P6ZB 1OX1A 4ABHA 1KXDA 5EU8A 5EGMA 2UWLA 3SU4A 9ESTA 1EOLA 4JYUH 1G3EA 2FLBH 2BY8X 1O2WA 1GCTC 4FUIA 1YYY1 2A5IA 1C2JA 2STBE 2BD3A 3A8AA 1C2KA 2GCHG 1O2OA 3BSQA 3UWJH 3GOVB 2ZIQH 5ETXA 1P2OA 2Y7XA 3I29A 4E05H 1ESTA 3KQBA 4CH2B 1NN6A 2BM2A 1RD3B 1GI4A 1ZGVA 1MTNC 3PV4A 5HGGA 1LO6A 1TALA 3M5NA 1SLUB 1LKBA 1GJAB 3ELAH 2R0KA 1Z1IA 2QIQA 1OSSA 5HMAA 3SNAA 2A0QB 4UE7H 1MBQA 4Y8XA 1C5MD 1XX9A 1AZ8A 1GCTB 3A84A 4YO9A 4F4OC 4MLFB 1HGTH 1O31A 3PWCA 4WVPE 4Y71A 5GIBA 2XNIA 3DFLA 2P59A 1TOMH 3ZZDA 5DO4H 1G32B 2UUFB 4BTUB 2W7UA 3I77A 1NFYA 3F6UH 1HAGE 1XXFA 2QV1A 2QY0B 2CXVA 4FUDA 2XWBI 4AFQA 3RU4T 1MTNB 1O33A 2ZDLA 3ZVCA 1JIMA 5HYOA 1C1WH 1UK3A 3QX5H 1GG6C 1CGHA 4TPYA 2ANYA 4ISOA 2ZFSA 2OBQA 1NESE 1C5PA 2V0BA 2FX4A 3FZDA 1K1NA 2GP9B 2EEKA 4HZHA 1GVKB 1L1GA 1WYKA 3TH4H 2SGFE 3MO3A 1BRBE 1O3BA 3MNCA 1ELTA 1HIAA 5J4QA 3UNRA 2P16A 2TGDA 4JCNA 4H4FA 4I8JA 1GBEA 1J15A 4OS1A 1QA7A 1TRYA 3GY5A 3ODFA 1ZZZA 1ZHPA 5C67A 1YCPH 4AB9A 5GJ4B 3HK3B 1OWEA 4E7RG 2A5AA 2O9QA 1GG6B 1W8BH 2I6QA 5EXLA 1VGCB 1FIWA 3CS0A 1EAUA 2VIQA 4JK6A 2XBWA 5I25A 1A46H 3B23B 4LOYH 4O03A 4TYDA 3M5OA 1HJ9A 3VGCC 2Y5HA 3Q3YA 1QR3E 3V0XA 1XUHA 2BX4A 1DWEH 1OKXA 2VH0A 1AKSB 2QXJA 4FU8A 2Z3CA 4X8UH 4I8LA 1EZUC 1UTPA 2O8WA 3SNBA 3ZZCA 1FXYA 2VINA 2J9NA 1C5SA 3ZZ6A 1P03A 1AY6H 2ZG0H 1SGTA 3BEIB 5F8ZA 3FAOA 3TGKE 2BDHA 5EXMA 3RXJA 2FOFA 1ZTLA 3ZZBA 2R9PA 1K22H 3ATIA 1O3JA 4Y76A 3SNDA 2VU8E 4ABEA 4X2XA 1GVLA 5JYIA 4DW2U 4NFEA 2WV4A 1AFQC 4ABIA 4GHQA 1SGQE 2HRVA 4WH8A 2W7SA 8ESTE 1MZAA 2V6NA 1L4ZA 2M5TA 2Z9IA 1JXPA 5LPRA 2AEIH 3QWCH 4FVBA 1O35A 4LXBH 1QJ6B 1A1RA 1Q2WA 2HLCA 4J1YA 1ANDA 1RTKA 4A1XA 4YOIA 1ZRBA 4YOJA 1IHSH 3RXUA 1P10A 3QLPH 5F6MA 2V3HH 2BVSH 3TVJB 1D3TB 3QUMP 3S7KB 1LVYA 3ENSB 3MU4A 3SU3A 5EW1H 4ESTE 5EW2H 1UO6A 2ZU2A 3P8NA 1PFXC 1KSNA 2Y81A 1T7CA 1SB1H 1ZSJA 4JYVH 1F5LA 4KGAA 5E0GA 2FTLE 3SJ8A 1DOJA 1SGCA 3SHCH 4Y10E 2QF0A 3NK8A 3RXBA 1O2MA 1IQGA 1C1OA 4DGJA 2TGTA 3H7TA 2IOTA 2ZGBH 3L3TA 3SUGA 1GMDF 1H8IH 1K1JA 4FU7A 3SOSA 3MOCA 1MQ6A 4ISNA 3A83A 4YESB 4AFUA 1GJ5H 1UTNA 2OC0A 2BXTH 1O3IA 1HFDA 2LPRA 3RP2A 1RIWB 1ABIH 3IWMA 3LGYA 2F9PA 3SJOA 3ZZ5A 1SMFE 5DPAA 1TNIA 3AAVA 2ALVA 1FN8A 4FUHA 2B0FA 3AVZA 2R3YA 2G8TA 3GCTG 3MI4A 4BXWA 2PGBB 3RM2H 4KKDA 1TMUH 5T6DA 3SUFA 2A1DB 1T31A 1FONA 4DOQA 5GPIB 3AW1A 4UD9H 3SV8A 5L6NH 2ZPQA 3TGIE 1J14A 1HAYB 4GAWA 2J38A 3D62A 3P95A 3S9BA 5CHAC 2G51A 2W3IA 2ZNKH 3RU4D 3GY8A 1G37A 3VEQB 2P93A 3U1JB 3ZYDA 5DP4A 1CHOG 4MTBA 1TQ7B 5TJXA 3PWBA 2GKVE 2VIOA 2BB4A 1DE7H 5EG4A 1V2QT 4K3JA 2ZHDA 3O8RA 4YLQH 5FX6A 4M7GA 1BRCE 1FY5A 2CF8H 3MHWU 3RMMH 3VB5A 1GBJA 1C5YB 4SGAE 1TA2A 4GLYA 1B0EA 1SGEE 4I31A 2ZTXA 2ZPRA 1BTUA 1C2HA 2UUYA 1EPTB 4CBNA 4D9RA 2O8MA 1S0RA 3V12A 2G81E 1O2IA 2Z94A 1GJ9B 5CHAB 2A2QH 2R3UA 1ZSKA 4OS6A 2XCFA 1IQFA 1B7XB 4GUXA 4K69A 3O8CA 3K2UA 3S0NA 1A5GH 1QQUA 3OX7U 4UFGH 1FNIA 2XW9A 1TX6A 2ZU3A 1UK4A 2Y5GA 1DX5M 3A8CA 2VVUA 5DP6A 3SI3H 5DJ7A 3KGPA 1G3DA 2VWMA 3WY8A 2Z7FE 1HYLA 1MH0A 1GL1A 1O5GH 3A7VA 3E90B 2BLQA 4NIWA 3RC6A 3D65E 1LPZB 1MU8B 1GJCB 4WF8A 2GV7A 3P8FA 3DA9B 4VGCB 1G2LA 1Y5UT 2CHAC 4DCDA 5JB8S 1K1LA 3BTGE 3F1SB 2FOHA 1CHGA 2C8WB 3QZRA 1RS0A 4B1TA 3H5CB 1FY8E 3D49H 1TNHA 3SO3A 4JK5A 3DHKH 4AN7A 2D2DA 2ZWLH 4OS4A 1V2PT 3AASA 4TPIZ 1SFQB 4WY3A 4X8VH 4TWYA 2O8TA 1DUEA 2ZDAH 1NTPA 4CRAA 3L33A 1L1JA 2AS9A 4X2WA 2AIPA 4ASHA 3V3MA 1KDQB 3DUXH 1YC0A 2Y82A 1OS8A 3SU2A 1C9PA 1DXPA 1BA8B 2PV9B 1GI5A 2ZU5A 3RMLH 2G00A 4O3TA 1HLTH 3MTYA 3S9CA 1GHYH 5E0JA 2OLGA 2BMGB 2PUQH 2GT7A 1G30B 1BUIA 1NO9H 1MQ5A 5F8TA 1P2KA 1P05A 3E6PH 2G52A 1TGTA 1DWBH 5EQSA 4GHTA 2H9TH 1MTUA 3V13A 1L4DA 2AYWA 1ZPZA 2BD7A 1NT1A 1ZSLA 8LPRA 1ELDE 4JYTA 2BD4A 8GCHF 1LHFH 4AYVB 1FY1A 3TH3H 1Z8JB 2BLWA 1GJ6A 3ZVAA 1LQEA 1HNEE 6GCHF 1HJ8A 3SU0A 1TABE 1SLVB 4IMZA 4MNVA 3TK9A 1O3OA 2BOHB 5EXNA 1EZSC 2FPZA 2ZFTA 3KIDU 2Q6GA 3RLWH 4RKOB 1E0FD 1SGDE 1W14U 2J4IA 3HKJB 2FI5E 3MFJA 4YT7H 4DURA 1SVPA 1NM6A 4Y0YE 1RXPA 1N1LA 1GI2A 1HAHH 3JZ1B 3KQCA 1TNLA 3C27B 2AGGX 1BT7A 2BLVA 2G55A 2XBXA 4MVNA 4UDWH 3B9FH 2JH6D 3OYPA 1NRRH 2OP9A 4PROA 1CBWC 1YPKH 1T8OA 1FMGA 3VB3A 2WPKS 5C3NA 5G4BA 2D8WA 1WBGB 4BTTB 3QDZB 3RXTA 4ZKRU 1Y3XA 2J34A 1KLIH 2EI7A 1UMAH 4D7GA 4DT7B 5DP3A 5T6FA 2FODA 4CRFA 1TBRH 3TK6A 3PLBA 1BBRE 1NU7B 4OS7A 2BDGA 4OS2A 4ZAEA 2G5NA 1W2KH 2DE8A 1MTVA 3VFEA 1O38A 5FPTA 4AG1A 2A5KA 4AZ2B 3ZVEA 1AWHB 2Z6BD 1GMDG 1Y3UA 1V2LT 4JZ1A 1NZQH 4A1VA 2P3TB 1S6FA 3AW0A 3KL6A 1Z1JA 1F7ZA 3PROA 1GVZA 4FUJA 1Y59T 5T6GA 2R2MB 2OC7A 2G4TA 2K1QA 1GHBF 4NSYA 2SGQE 2TGPZ 1DLEA 3RDZA 3A87A 4K1EA 3RXFA 2ZTYA 2A4OA 4D7FA 1ZPCA 2PFEA 1GJ4H 2ZC9H 3T27A 4XBBA 5FHTA 4THNH 4IW4E 1GJDB 1YCPM 3UOUA 1ESAA 1DICA 3BG4C 2C90B 1QRZA 2LNCA 5DG6A 2C4FH 1AFEH 1QJ7B 1JRTA 2UUKB 2ZFPH 1QHRB 5FBEA 4WMDA 3LDXH 2Y6TA 1HAZB 3BN9A 1TPAE 1TQ0B 1A61H 2ZGJA 2C8YB 1IOEA 1IHTH 1EAXA 1O3FA 3KQDA 1LVOA 3BEFB 1LHDH 3FVFB 1G3CA 1SGRE 1YCPK 3UOPA 3P8GA 4X2YA 2ANWA 3U8TH 3SW2B 5EQQA 3SU1A 1AKSA 3EGKH 5JBCS 1CT0E 3U98H 1DFPA 3RXKA 1LMWB 1SQTA 1QL9A 2IPHA 1O2NA 1W0ZU 4CRCA 1L1NA 1TX8A 3F9GA 1K9OE 2ZEBA 1Z71A 5A0AE 1EJAA 2A7CA 2BYAX 1O2LA 4CHAB 1TBZH 5ESBA 2WUBA 1RTFB 2WV5A 3A88A 4OS5A 1O5CB 1BBRK 2VB0A 1RJXB 5JPMH 5JBTA 4X8TH 1CT4E 2ILNA 1VITH 2Q6DA 3MU1A 2GT8A 1J9CH 5HXFA 2ZF0H 1P06A 1O2VA 2FS8A 1SQOA 1BTPA 1FJSA 4HI3A 2AMPA 1C5LH 3Q3XA 4SGBE 4A5TS 2F9NA 2HNTF 3QTVH 1ID5H 2CF9H 4F49A 2BXUH 3N7OA 3SJ9A 4BAMB 3QTOH 1ELCA 1FV9A 4U2WA 1ZJKA 2J2UA 2SGEE 2AH4X 5FPYA 3SU6A 5HM2A 1QA0A 1YPMH 3MH4A 4U30A 3A7TA 2VGCC 1AUTC 1MUEB 2F83A 4X0WU 3TJUA 1PYTC 1ZTJA 2HOBA 4IBLH 1QB6A 4H6TA 4Q80A 3UY9A 1O2PA 1E35B 4WMEA 1WUNH 3ITIA 1CO7E 1YPEH 1YPLH 1CA0C 2EC9H 2FIRH 2VIWA 1C9TA 1XM1A 3EA9A 1HB0B 2ZGXH 2BQ6B 1GI6A 3E0NB 4NGAH 1IQMA 3BTTE 2BHGA 3MO6A 4R8TB 1C2FA 1KXEA 1F0TA 2BQ7B 3Q3KA 2BLOA 2Z3DA 2XCNA 1ARBA 3M3SA 3RC5A 1FI8A 1E37B 1LHEH 1O5FH 3UQVA 4CH8B 2BD2A 2QCYA 1BMLA 2VGCB 7LPRA 4IN2A 1AVGH 4O97A 8GCHG 3KNXA 2GD4B 3TK5A 3TH2H 1BZXE 1W10U 6GCHG 1IQHA 4Q7ZA 1SSXA 1GMCF 3RXRA 4DIIH 4BANB 1AD8H 2XTTB 3QGNB 2C8ZB 4ZMAH 2CMYA 3GISB 3KQEA 3M37A 1CA0B 3UNQA 1V2JT 4GPGA 1AVWA 2PKSC 2ZDKA 1ANBA 2ZI2H 1U6QA 6CHAC 1O3AA 3K6YA 3O8BA 1TRNA 4HFPB 1YLCA 3BTQE 2ZFRH 1MD7A 4ABDA 1BTWA 1H8DH 3PMJA 5FBIA 4FUEA 3LIWA 1C5XB 1VITF 1AMHA 3MYWA 4WXVA 1Y5BT 2FXRA 3ZVFA 1LDTT 1S85A 2ZO3H 3L6PA 1EPTA 3A7WA 2A4GA 3M61U 1TRMA 1HAOH 1BJVA 1OOKB 2TBSA 1WTGH 4WMFA 2H9EH 3GDVA 1ETSH 4BAKB 2P3UB 1ESBA 2YNAA 4U32A 1O2SA 4E06H 1O2KA 6CHAB 7GCHF 4MPUA 2ZCLP 3UWIA 3ZV8A 2BY6X 5FCRA 1CSOE 3W94A 1S81A 2QAAA 2A4RA 1FY3A 3M35A 3M3VA 4YTAA 3T5FH 4WWYA 1FZZA 1K1MA 2XWAA 1A3EH 1UHBA 3M5MA 1MBMA 3ODDA 1P9UA 3ATWA 4YM9A 4UFFH 1GHBG 1AN1E 2H1UA 2IJOB 2Q6FA 4AB8A 3HATH 1GBTA 2FOGA 1D3PB 1O2UA 1O36A 1TMTH 5F03A 3NZIA 1SQAA 2VVVA 4UONA 1Y3YA 1G36A 3VGCB 3PLPA 1UTQA 1HAXB 4ZKSU 3UTUH 1IQNA 3GICB 3F68H 1QQ4A 1S84A 1UK2A 1DITH 4X6PA 4FUFA 3FP7E 2ZDNA 2F9VA 2SGDE 3FP8E 2UUJB 2Z9KA 4UFEH 2BTCE 1KDQA 1A4WH 4K8BA 1O2TA 2H5CA 1CGJE 4Y0ZE 4X1NU 1AE8H 1IQEA 1ZRKA 1IQIA 2P95A 1DSUA 5E0HA 1E36B 1N8OC 2BDYA 3PM3A 3MO9A 4B2BA 3LH3A 1OWJA 1OXGA 3MMGA 1MTWA 3RXVA 3LOXA 3GDUA 1LPKB 1AFQB 3CP7A 1QBOA 1THRH 4GSOA 3BIUH 2HPQH 4AG2A 3SQEE 1BRAA 1PJPA 1NRQH 1TPPA 3BTDE 5C1YA 2VH6A 1GI3A 2RCEA 1HBTH 3U1IB 3BG8A 2W5EA 2A7HA 2CV3A 1C4V2 1GI7B 5A8ZA 5EODA 3BTME 1DY9A 1NU9A 1L0ZA 1PQ7A 1C5QA 4X6NA 3LGVA 4KTUA 3RXIA 5GCHF 4INKA 4MG3A 3P17H 2ZFFH 1AU8A 4B2AA 3A89A 2XYAA 3MH6A 3SI4H 2PTCE 1QB9A 1OYQA 1ELGA 2QC2A 3R3GB 1N8OB 3GCOA 1C1NA 3TLOA 1V2KT 2H6MA 1O3PB 4I33A 1TIOA 2VJ1A 2FDAA 1SGFA 1GI8B 3SZNA 3W95A 5JB9S 2KAIB 3BF6H 1WSSH 4FUGA 1EOJA 2W3KA 1A0JA 2ZZUH 4AOQA 1P12E 4XSKU 3PMAB 3STIA 1C5NH 1BTZA 3FP6E 4NFFA 1Y5AT 1AB9C 2BD8A 2FOCA 4JMYA 2ZKSA 2FX6A 2FOAA 3P70B 2QN5T 1YLDA 3GYMA 4D8NA 3MU0A 3ATKA 4XBCA 2OXSA 1ABJH 5DK1A 1W13U 2VVCA 1Z6EA 1P3CA 1THSH 3T62A 3TJNA 1J17T 1C5UA 1C1PA 1O2RA 1DUAA 3BEUA 3EQ0H 1EAIA 2BDCA 2BDBA 2ZHFH 1MD8A 2Q1JA 1P04A 2XC4A 4BOHA 4AX9H 1QGFA 4K2YA 4NA8A 4X1QU 3QZQA 1VCWA 4ZKOU 4ZUHA 1CGIE 2RG3A 4ZH8A 3MH5A 3D23A 1K1OA 4A1TA 1KYNA 1XMNB 4ABFA 4K5ZA 5B6OA 1C5WB 1C2GA 3HGPA 1GJBB 3IG6B 1TWXB 1O0DH 3NPSA 2VWNA 1F0SA 2THFB 3LJOA 8KME2 1HXEH 2ANMH 4X8SH 1YP9A 1O2XA 3KHVA 3T29A 1GMCG 1QJ1B 5L2ZH 5FXLA 1PPZA 2OUAA 2PSYA 3M5LA 4X6OA 1EXFA 3Q76A 3QN7A 1TA6A 4Q7XA 3M7TA 1GBCA 3C1KA 1SOTA 3R0FA 2HGTH 1N6XA 3PTNA 5PTPA 1EX3A 3GY3A 2JETC 1KLTA 1P2MA 1C1QA 2OQ5A 1BB0B 1CA8B 3CS7A 3NCLA 3I78A 1NFUA 1ZLRA 3SBKA 1VITG 2ZCHP 2J92A 2AMDA 1C2MA 2GVFA 4MDSA 1A7SA 4U01A 1C5OH 1BITA 1OWIA 5C2ZA 5H4IB 3RMOH 2WPJS 3ATLA 4IC5A 3ZV9A 5HM9A 1KXAA 4IMQA 1AHTH 4Q7YA 2WPLS 2FESH 1OWKA 1YPHC 3GYLB 1UVOA 1THPB 1C1MA 2NU4E 1VCQA 2GGVB 7GCHG 4FUCA 2CHAB 1UJ1A 1YPHE 2JETB 1HAPH 1TLDA 4TWWA 1TBQH 2CJIA 1OP0A 1XUIA 1T4UH 3IITA 3VB4A 1V2RT 3PTBA 1O3MA 1EP5A 3VXFH 1JIRA 1MAXA 1O2YA 3HGNA 4Y8YA 3RXQA 2YNBA 1NY22 1O2HA 1D6RA 2PWXA 1HPGA 1T8MA 3NXPA 3M7UA 1TOCB 5EQRA 2ODPA 4MPVA 5BRRE 1XUKA 3ZZ4A 3LJJA 4KELA 4ABBA 3E8LA 2C3SA 4O3UA 2Z9GA 2FZZA 2SNWA 1MCTA 2FTMA 3U9AH 1DPOA 4K60A 1UVSH 2RDLA 4R0IA 1GHVH 1KXFA 2PUXB 3ZZ8A 1UTJA 2QXGA 3H7OA 3LGWA 1G3BA 2A4QA 2D26C 1NRPH 2WINI 3FZZA 4NIVA 4NSVA 1ELBA 2GMTC 2DE9A 3VB6A 1LKAA 1O34A 2B5TB 4TY7A 1K21H 3BTWE 3QGJA 4DJZB 3BTKE 3EAJA 4KTSA 1EB2A 4Y11E 3RXDA 1DDJA 1SPJA 1XVMA 5I46H 3ZVDA 1C4U2 3BIVH 3S9AA 2F3CE 3GDSA 2FYQA 4OGXA 3TPIZ 5AVDA 4NWLA 2NU1E 4D9QA 3V7TA 1OPHB 1S5SA 2GDEH 3U8OH 2JH5D 4MQAA 5TCAA 4UEHH 2OQUA 2WUCA 3BV9B 3EA7A 1C5TA 4K1SA 1UVUH 3U69H 2WPHS 3RUOA 1G9IE 4NA7A 1N6YA 2G5VA 2QA9E 3HPTB 5C1UA 4D76A 3NWUA 2ESTE 1TPOA 5DGJA 1CBWB 5GCHG 1P0SH 5FPSA 1SGFG 1KY9A 1T32A 1C2DA 3GCHC 1QNJA 2ZHEH 5DP8A 2ODQA 1SHYA 3UPEA 1YKTA 1NRSH 4AYYB 1LVBA 4BTIB 1V2OT 2SFAA 1ETTH 1M9UA 1FDPA 3HKIB 3VPKA 1ZGIA 3A86A 4JZEH 2ASUB 3KN2A 2FP7B 1GHXH 1NS3A 3E91A 3SGBE 3PB1E 4ZROA 2ZA5A 2ZHWH 3Q00A 1P09A 4QT8C 3RMNH 1TAWA 5L2YH 1HJAC 3RXAA 2RA0A 1GDNA 1O32A 3MNXA 2BX3A 3KCGH 4ABAA 1TGNA 5IYTA 2NU0E 1BQYA 1BRUP 3SGAE 2STAE 4NWKA 3RXGA 1F0UA 1SLWB 3S69A 2A45B 2Z9JA 3BTHE 2GX4A 5BPEA 4NZQA 1DVAH 3A8BA 3EE0B 2QXHA 5DKMA 1SL3A 2NWNA 1SBWA 3BG4B 1SHHB 1HDTH 3E1XB 2ODYB 4GCHF 1ZMNA 1HAVB 3ATMA
chains in the Genus database with same CATH superfamily
5J4SA 3Q77A 3VXEH 3SJIA 4XRNA 4FU9A 2FM2A 1DLKB 2C93B 4JZIA 4NA9H 1Z8GA 2ZFQH 4ASUD 4FXGH 3FN8A 3W1EA 3M3TA 1UTOA 5LPFA 4CRBA 2FEQH 2WPMS 1EASA 1BOQA 2ANKH 1WOFA 1O3NA 4INHA 4B73A 2P3FH 4B71A 2TRMA 2PLXA 1QY6A 1TPSA 1SI5H 5E2PA 4CREA 2ZGHA 1B0FA 1O3LA 3UR9A 1RGQA 1BMAA 4Q2KA 1TNJA 1W3CA 1MCVA 1PQ8A 2WYJA 2UWOA 3EDXB 1XUFA 1QBNA 4H6SB 4B2CA 2CN0H 1ARCA 5ABWA 1O2QA 3GCTF 1C5ZB 1TMBH 2EQNA 3SUEA 4BAHB 2FLRH 3G01A 1IQLA 1QRXA 2H9HA 1K1PA 1OP8A 2F9BH 4A92A 2FOEA 5LGOA 1P02A 2Z3EA 1P11E 3RXMA 1BTYA 1C5VA 1GGDC 3UQOA 1PQAA 3TITA 4AFSA 1O5BB 1C1SA 3GY6A 4K8YA 5L30H 3A82A 2FO9A 1C4Y2 1GBHA 4XE4A 1CHOF 5GXPA 3FFGA 4X1PU 5E8EH 4I86A 2TPIZ 3EE7A 3FANA 6ESTA 1WAYB 1AUJA 1XUJA 3SUDA 2Y7ZA 3SNCA 1H8HD 4NG9H 1EJNA 3BTFE 5LPEA 1TGCA 1XKBC 1MKWH 5AHGH 3PLKA 4ISIH 1INCA 1TYNA 1E38B 5AFYH 4KP0A 4YT6H 2Y80A 4AGKA 2CK3D 4Q63A 2QYIA 1VKYA 1G2MA 2OC1A 4MPXA 4NIXA 2KAIA 3LC5A 1O37A 1EATA 1RFNA 3SU5A 1EJMA 1GGDB 1P2QA 1ORFA 2BQWB 1BDAA 4M9FA 2O8UA 1AZZA 1T4VH 1TGBA 3KF2A 4NCYA 4I8GA 2AIQA 1IQJA 2BY7X 5DP9A 3LGTA 3T25A 1FPHH 1V2NT 4Y7AA 5GNDA 4CRDA 4XDEA 1LHGH 3PMHB 3N7DA 1UCYH 1ANCA 2F91A 5IK2D 4X6MA 1O39A 1VGCC 1T8NA 1V2VT 1W7GH 5A0CA 1ZMLA 1DWDH 1NRNH 1MZDA 1MU6B 3ESTA 3K65B 5F53A 2PKAB 1Q31A 1BMNH 3SV7A 1SG8B 3K6ZA 4RKJB 4ZHLU 4YOGA 2K0QA 5LH8A 4B6FA 1O3EA 2AFQB 2C8XB 1ACBE 4RN6A 5FX5A 1BHXB 2AGIX 2XRCA 4I8HA 1JOUB 4MPWA 1H9HE 1NBME 4Y8ZA 1FN6A 3LT3A 1F2SE 3LC3A 3ZZ9A 2PKSB 1AE5A 1W7XH 1A3BH 3TJOA 2A7JA 1MKXH 3A80A 1JWTA 5CMXH 1H9IE 1OHHD 1QZ8A 1D3DB 4CRGA 2J97A 1D4PB 1GBFA 2BDIA 2FS9A 1GMHF 4Y7BA 3A85A 3OY6U 5T3HA 3RXCA 1A2CH 3F9EA 1GHZA 1YM0A 2BVXH 1FAKH 1TX7A 1HRTH 1TFXA 1FLEE 1V2MT 1MTSA 1GI9B 1KIGH 2G4UA 3P8OA 2FWWA 5EOKA 3A7ZA 4K1TA 2HVXA 5A09A 3TGJE 1BBRH 3CENA 1QBVH 2XNDD 1C1VH 3UUZA 2ZPSA 1KTTB 3M36A 4CR9A 1TNKA 1NPMA 1O2JA 5C17A 1X7AC 4X1SU 1LCYA 2V3OH 5DP5A 1J16A 1WCZA 3ZZ3A 3U8RH 1C2EA 1JBUH 3LH1A 2FMJA 3URDA 1W0YH 4OGYA 1O30A 2ZQ1A 1YPJH 1UTMA 1C1TA 2HNTC 2ZP0H 1E34B 1O3HA 1XXDA 2NU2E 3SV2H 1TB6H 1PPCE 2ZU1A 1PPHE 1OWDA 1O5AB 4IS5A 2SNVA 2J94A 1GDUA 5FAHA 2XC5A 2A32A 1BTHH 2HNTE 1L2EA 4NIYA 1PPEE 2FOMB 5A2MH 4I7YH 4MNXA 1VZQH 4BAOB 1SGPE 1V3XA 2L6OA 1AO5A 1O3CA 2K8IA 1P2IA 2Y5FA 1HXFH 2BOKA 3RXSA 1O3DA 1HAIH 1CVWH 2ULLA 1AVXA 1RIWC 2OBOA 2OCVB 3K9XB 1DS2E 2FI3E 1SOZA 1C1UH 1WV7H 4GCHG 3ZZ7A 3SJKA 2WV9A 1RTLA 4RT1A 1LHCH 1F5KU 3LGUA 3PO1C 5SGAE 3ZVGA 1XVOA 4IC6A 1QRWA 1GHWH 2IN2A 3OEHD 2QF3A 3JZ2B 4XBDA 1GL0E 2GDDA 2KCAA 1VCPA 4HTCH 4I32A 1NFXA 2OD3B 5EPYA 4ZXXH 1CU1A 3TNTA 1Y3WA 5A0BA 1H4WA 4IN1A 1AWFH 1KXCA 3T2NA 5K0HA 1FPCH 1EB1H 2ZHQH 2PW8H 1H9LB 2XXLA 1Z8IB 3OU0A 2B9LA 2GV6A 3OTJE 1BIOA 4ISHH 3DFJA 2ZDVH 4HGCA 1S82A 1SR5C 1BTXA 2VIVA 1OWHA 1GHAF 3PO1B 4X1RU 2GZ9A 3TNSA 2VWLA 3MH7A 3GY2A 1MAYA 4E7NA 4DVAU 1SC8U 4FOUC 4KTCA 1EPTC 2LELA 1DXWA 4YZUA 1DM4B 2HPPH 1QFKH 2OTVA 2VIPA 3ZZAA 4H42U 5CHBA 1DWCH 2EI8A 3F0OA 3STJA 1MMJN 2GZ7A 1ELAA 2SGAA 1LVMA 4B75A 1QCPA 1Z7KA 4NZLA 2AGEX 1HUTH 1V2WT 2F9OA 1A5IA 2KM0A 2I6SA 2GCTC 1AQ7A 1VJ9U 5GDSH 3TU7H 2O8LA 4Y79A 1TONA 2P94A 1HIAB 4BAQB 5A8YA 3S7HB 1GBKA 3EA8A 2JKHA 1ZYOA 1GDQA 1E79D 1P57B 3MWIU 2JH0D 2F9UA 1EUFA 1AB9B 2RA3A 1PPBH 3E3TA 3UFAA 2SGPE 3MU5A 1PQ5A 2AERH 1H1BA 1EQ9A 2CGAA 3RXOA 1V6DA 2BVRH 3A8DA 4JZFH 1A5HA 4VGCC 2GTBA 3NUMA 5JDUB 5JBBS 3DD2H 2WYGA 1TNGA 1ZJDA 2B8OH 1KMHB 1EP6A 1QL7A 1AI8H 1YGCH 2UWPA 3T28A 4ABGA 3DSOA 5GWZA 1EAWA 1LPGB 1UTLM 3OY5U 5E2OA 2HVYB 2B7DH 1O5EH 1FQ3A 2GCTB 2PR3A 1C1RA 1ZHRA 3LPRA 3PMBB 3SV6A 4ZXYH 5C1XA 2FOBA 4YLUA 3UIRA 1SGYE 1KXBA 5KEDA 2BD9A 2Z9LA 3M7QA 4Z6AH 3RC4A 3MU8A 1WDIA 1O3GA 1UHBB 1YBWA 5AFZH 2VWOA 4TSFD 2ZECA 2BY9X 1A0HB 5C0UA 1F92A 2GCHF 3GY7A 4DY7B 4INLA 4LZ1H 1ZOMA 5JBAS 2PGQB 2BZAA 1GBMA 3UREA 1HAVA 1Y8TA 1GBDA 1A0LA 2TGAA 1DY8A 1T8LA 3ZYEA 1OYTH 2HALA 1BCUH 1YF4A 4J2YB 1FUJA 1QL8A 1Z6JH 3RLYH 7KMEH 2PSXA 3N7EA 3SV9A 4ABJA 4ZHMU 1K2I1 2AMQA 1W11U 1GMHG 2BY5X 3LONA 1UVTH 1K1IA 4TT3D 4FETA 1EKBB 1WQSA 1ETRH 9LPRA 4WJG2 3A7YA 1GPZA 1ZHMA 2NU3E 2P8OC 4Q4LA 2IPQX 3QK1A 2HWLB 1SFIA 3ZIAD 1S0QA 4RSPA 3OE7D 3RU4E 3RXPA 5C5OA 3LKWA 1VR1H 3SHAH 1AIXH 1UCYE 1SGIB 1P01A 2V35A 4UFDH 5CE1A 1ZMJA 2ZTZA 2ZGCA 3DCLA 1HV7A 2XBVA 2ZDMA 4ISLA 3TJVA 4MNYA 2FYRA 1GCDA 1JRSA 1WTHD 2BD5A 2OC8A 1E1QD 1ANEA 4XFQA 1XUGA 1F5RA 1P9SA 1BMMH 4MNWA 1UVPA 6LPRA 3GY4A 1DANH 1FY4A 2EA3A 3F9HA 5AF9H 1ZR0A 1ZPBA 1UTKA 1XKAC 1NC6A 1EZXC 1ZTKA 2YMSC 2JIZD 1Y3VA 2P8OB 1C2IA 2QF4A 2ALPA 1COWD 1IQKA 5C5NA 1DSTA 1QB1A 2FI4E 5TCCA 4B74A 3QO6A 1CQQA 4JZDH 3SN8A 3KEEA 2BZ6H 2XC0A 1O5DH 2YOLA 2J95A 1FAXA 4DG4A 3VB7A 4ZHAA 2H5DA 3PYHA 2QXIA 1O3KA 1IAUA 1WU1A 1OP2A 1PPGE 1BJUA 1ELVA 2PTNA 4Z1MD 2H2ZA 1V2UT 1MKWK 4Z0KA 1CT2E 4ZKNU 4AFZA 2GMTB 2PHBA 2ZCKP 1WQVH 2A31A 3MNBA 4B76A 3GCNA 2YMSB 2XBYA 1O2ZA 2ZU4A 2KCYA 1Z8RA 2RDEA 5ESTE 5DP7A 1J8AA 4AORA 1V2ST 5T1VA 1YPGH 3EYDA 1P2JA 3B8JA 1P8VC 3NKKA 4WXIA 1D6WA 1PYTD 3TIUA 5EJ1A 5IDKA 1NROH 1BHXF 1AGJA 4LK4A 1KLJH 4TY6A 1QTFA 2PKAA 4CR5A 5FCKA 3HK6B 3RXLA 4WH6A 1UCYK 3SQHE 1GBLA 5F8XA 2D1JA 2ZQ2A 7ESTE 3BTEE 4XOJA 3A81A 3P92A 1GHAG 5C20A 1S83A 2R0LA 1V2TT 1B5GH 3DT0H 3T26A 1K0HA 1DT2A 4BNRA 1HCGA 3E0PB 2GZ8A 3SNEA 1GWAA 4I8KA 1TGSZ 2W26A 4CHAC 3GCHB 3ZVBA 3F9FA 5EPNA 3LU9B 1GBAA 1NFWA 2OINA 1GBIA 3AAUA 3F2FA 1GJ7B 1O2GH 4A7IB 1FIZA 2BDAA 1GJ8B 1D3QB 4BXSA 4IGDA 1MKXK 4FVDA 3SGQE 1ELEE 2WPIS 1VJAU 4X2VA 4O9VA 3MNSA 4AGJA 1QIXB 1SLXB 2QGRA 1K28D 1QURH 3A7XA 1GI1A 3UNSA 3WW7A 4CBOA 1SGNE 1JMOH 1HJAB 1P2NA 1C2LA 3SORA 1F0RA 1TE0A 3O8DA 5DN6D 1ELFA 1PPFE 4FUBA 1Q3XA 1D9IA 2VIDA 2TIOA 1GI0A 1LTOA 3RXEA 1CE5A 3UR6A 1C5RA 4LZ4B 1KTSB 1RRKA 1W12U 5K7RA 1S6HA 3URCA 4DIHH 4GVUA 1LQDB 3RXHA 3RM0H 4A6LA 2DUCA 2R2WU 5HIZA 1YWUA 3PRBA 1EZQA 1GBBA 3OSYA 3E16B 2A2XH 2V7QD 2EI6A 3LGIA 5A8XA 1P3EA 4Y6DA 2VNTA 3P6ZB 1OX1A 4ABHA 1KXDA 5EU8A 5EGMA 2UWLA 3SU4A 9ESTA 1EOLA 4JYUH 1G3EA 2FLBH 2BY8X 1O2WA 1GCTC 4FUIA 1YYY1 3OFND 2A5IA 1C2JA 2STBE 3PV5A 2BD3A 3A8AA 1C2KA 2GCHG 1O2OA 3BSQA 3UWJH 3GOVB 2ZIQH 5ETXA 1P2OA 2Y7XA 3I29A 4E05H 1ESTA 3KQBA 4CH2B 1NN6A 2BM2A 2IJD1 1RD3B 1GI4A 2JJ2D 1ZGVA 1MTNC 3PV4A 5HGGA 1LO6A 1TALA 3M5NA 1SLUB 1LKBA 1GJAB 3ELAH 2R0KA 1Z1IA 2QIQA 1OSSA 5HMAA 3SNAA 2A0QB 4UE7H 1MBQA 4Y8XA 1C5MD 1XX9A 1AZ8A 1GCTB 3A84A 4YO9A 4F4OC 4MLFB 1HGTH 1O31A 3PWCA 4WVPE 4Y71A 5GIBA 2XNIA 3DFLA 1YLNA 2P59A 1TOMH 2F43B 3ZZDA 5DO4H 1G32B 2UUFB 4BTUB 2W7UA 3I77A 1NFYA 3F6UH 1HAGE 1XXFA 3F3BA 2QV1A 2QY0B 2CXVA 4FUDA 2KZ4A 2XWBI 4AFQA 3RU4T 1MTNB 1O33A 2ZDLA 3ZVCA 1JIMA 5HYOA 1C1WH 1UK3A 3QX5H 1GG6C 1CGHA 4TPYA 2ANYA 4ISOA 2ZFSA 2OBQA 1NESE 1C5PA 2V0BA 2FX4A 3FZDA 1K1NA 2GP9B 2EEKA 4HZHA 1GVKB 1L1GA 1WYKA 3TH4H 2SGFE 3MO3A 1BRBE 1O3BA 3MNCA 1ELTA 1HIAA 5J4QA 3UNRA 2P16A 3UAIC 2TGDA 3OAAD 4JCNA 4H4FA 4I8JA 1GBEA 1J15A 4OS1A 1QA7A 1TRYA 3GY5A 3ODFA 1ZZZA 1ZHPA 5C67A 1SQRA 1YCPH 4AB9A 5GJ4B 3HK3B 3H09A 1OWEA 4E7RG 3PV2A 2A5AA 2O9QA 1GG6B 1W8BH 2I6QA 5EXLA 1VGCB 1FIWA 3CS0A 1EAUA 2VIQA 4JK6A 2XBWA 5I25A 1A46H 3B23B 4LOYH 4O03A 4TYDA 3M5OA 1HJ9A 3VGCC 2Y5HA 3Q3YA 1QR3E 3V0XA 1XUHA 2BX4A 1DWEH 5FL7D 1OKXA 2VH0A 1AKSB 2QXJA 4FU8A 2Z3CA 4X8UH 4I8LA 1EZUC 1UTPA 2O8WA 3SNBA 3ZZCA 1FXYA 2VINA 2J9NA 1C5SA 3ZZ6A 1P03A 1AY6H 1W0JD 2ZG0H 1SGTA 3BEIB 5F8ZA 3FAOA 3TGKE 2BDHA 5EXMA 3RXJA 2FOFA 1ZTLA 3ZZBA 2R9PA 1K22H 3ATIA 1O3JA 4Y76A 3SNDA 2VU8E 4ABEA 4X2XA 1GVLA 5JYIA 4DW2U 4NFEA 2WV4A 1AFQC 4ABIA 4OM9A 2WHXA 2KFWA 4GHQA 1SGQE 2HRVA 4WH8A 2W7SA 8ESTE 1MZAA 2V6NA 1L4ZA 2M5TA 2Z9IA 1JXPA 5LPRA 2AEIH 3QWCH 5EJZA 4FVBA 1O35A 4LXBH 1QJ6B 1A1RA 1Q2WA 2HLCA 4J1YA 1ANDA 1RTKA 4A1XA 4YOIA 1ZRBA 4YOJA 1IHSH 3RXUA 1P10A 3QLPH 5F6MA 2V3HH 2BVSH 3TVJB 1D3TB 3QUMP 3S7KB 1LVYA 3ENSB 3MU4A 3SU3A 5EW1H 4ESTE 5EW2H 1UO6A 2ZU2A 3P8NA 1PFXC 1KSNA 2Y81A 1T7CA 1SB1H 1ZSJA 4JYVH 1F5LA 4KGAA 5E0GA 2FTLE 3SJ8A 1DOJA 1SGCA 3SHCH 4Y10E 2QF0A 3NK8A 3RXBA 1O2MA 1IQGA 1C1OA 4DGJA 2TGTA 3H7TA 2IOTA 2ZGBH 3L3TA 3SUGA 1GMDF 1H8IH 1K1JA 4FU7A 3SOSA 3MOCA 1MQ6A 4ISNA 3A83A 4YESB 4AFUA 1GJ5H 1UTNA 2OC0A 5C0TA 2BXTH 1O3IA 1HFDA 2LPRA 3RP2A 3KQ5A 1RIWB 1ABIH 3IWMA 3LGYA 2F9PA 3SJOA 4ACAA 3ZZ5A 1SMFE 5DPAA 1TNIA 3AAVA 2ALVA 1FN8A 4FUHA 2W6ID 2B0FA 3AVZA 2R3YA 2G8TA 3GCTG 3MI4A 4BXWA 2PGBB 3RM2H 4KKDA 1TMUH 1FX0B 5T6DA 3SUFA 2A1DB 1T31A 1FONA 4DOQA 5GPIB 3AW1A 4UD9H 3SV8A 5L6NH 2J98A 2ZPQA 3TGIE 1J14A 1HAYB 4GAWA 2J38A 3D62A 3P95A 3S9BA 5CHAC 2G51A 2W3IA 2ZNKH 3RU4D 1H8ED 3GY8A 1G37A 3VEQB 2P93A 2JJ1D 5C94A 3U1JB 3ZYDA 5DP4A 1CHOG 4MTBA 1TQ7B 5TJXA 3PWBA 2GKVE 2VIOA 2BB4A 1DE7H 5EG4A 5HKKD 1V2QT 4K3JA 2KCOA 2ZHDA 2HLDD 3O8RA 4YLQH 5FX6A 4M7GA 1BRCE 1FY5A 2CF8H 3MHWU 3RMMH 3VB5A 1GBJA 1C5YB 4SGAE 1TA2A 4GLYA 1B0EA 1SGEE 4I31A 2ZTXA 2ZPRA 1BTUA 1C2HA 2UUYA 1EPTB 4CBNA 4D9RA 2O8MA 1S0RA 2L74A 3V12A 2G81E 1O2IA 2Z94A 1GJ9B 5CHAB 2A2QH 2R3UA 1ZSKA 4OS6A 2XCFA 1IQFA 2YMSD 1B7XB 4GUXA 4K69A 3O8CA 3K2UA 3S0NA 1A5GH 1QQUA 3OX7U 4UFGH 1FNIA 2XW9A 1TX6A 2ZU3A 1UK4A 2Y5GA 1DX5M 3A8CA 1S6LA 2VVUA 5DP6A 3SI3H 5DJ7A 3KGPA 1G3DA 5B6LA 2VWMA 3WY8A 2Z7FE 1HYLA 1MH0A 1GL1A 1O5GH 3A7VA 3E90B 2BLQA 2WPDD 4NIWA 3RC6A 3D65E 1LPZB 1MU8B 1GJCB 4WF8A 2GV7A 3P8FA 3DA9B 4VGCB 1G2LA 1Y5UT 2CHAC 4DCDA 5JB8S 1K1LA 3BTGE 3F1SB 2FOHA 1CHGA 2C8WB 3QZRA 1RS0A 4B1TA 3FO8D 3H5CB 1FY8E 3D49H 1TNHA 3SO3A 4JK5A 3DHKH 4AN7A 2D2DA 2ZWLH 4OS4A 1V2PT 3AASA 4TPIZ 1SFQB 4WY3A 4X8VH 4TWYA 2O8TA 1DUEA 2ZDAH 1NTPA 4CRAA 3L33A 1L1JA 2AS9A 4X2WA 2AIPA 4ASHA 3V3MA 1KDQB 3DUXH 1YC0A 3KYFA 2Y82A 1OS8A 2KCPA 3SU2A 1C9PA 1DXPA 1BA8B 2PV9B 1GI5A 2ZU5A 3RMLH 2G00A 4RT0A 4O3TA 1HLTH 1MABB 3MTYA 3S9CA 1GHYH 5E0JA 2OLGA 2BMGB 2PUQH 2GT7A 1G30B 1BUIA 1NO9H 1MQ5A 5F8TA 1P2KA 1P05A 3E6PH 2G52A 1TGTA 1DWBH 5EQSA 4GHTA 2H9TH 1MTUA 3V13A 1L4DA 2AYWA 1ZPZA 2BD7A 1NT1A 1SKYE 1ZSLA 8LPRA 1ELDE 4JYTA 2BD4A 8GCHF 1LHFH 4AYVB 1FY1A 3TH3H 1Z8JB 2BLWA 1GJ6A 3ZVAA 1LQEA 1HNEE 2WSSD 1HJ8A 3SU0A 6GCHF 1TABE 1SLVB 4IMZA 4MNVA 3TK9A 1O3OA 2BOHB 5EXNA 1EZSC 2FPZA 2ZFTA 3KIDU 2Q6GA 3RLWH 4RKOB 1E0FD 1SGDE 1W14U 2J4IA 3HKJB 2FI5E 2M2AA 3MFJA 4YT7H 4DURA 1SVPA 1NM6A 4Y0YE 1RXPA 1N1LA 1GI2A 3KYGA 1HAHH 2QE7D 3JZ1B 3KQCA 1TNLA 3C27B 2AGGX 1BT7A 2BLVA 2G55A 2XBXA 4MVNA 4UDWH 3B9FH 2JH6D 1WXRA 3OYPA 1NRRH 2OP9A 4PROA 1CBWC 1YPKH 1T8OA 1FMGA 3VB3A 2WPKS 5C3NA 5G4BA 2D8WA 1WBGB 4HG6A 3QDZB 4BTTB 3RXTA 4ZKRU 1Y3XA 2J34A 1KLIH 2EI7A 1UMAH 4D7GA 4DT7B 5DP3A 2AHME 5T6FA 2FODA 4CRFA 1TBRH 3TK6A 3PLBA 1BBRE 1NU7B 4OS7A 2BDGA 4OS2A 4ZAEA 2G5NA 1W2KH 2DE8A 1MTVA 3VFEA 1O38A 5FPTA 4AG1A 2A5KA 1BMFD 4AZ2B 3ZVEA 1AWHB 4ACBA 2Z6BD 1GMDG 1Y3UA 1V2LT 4JZ1A 1NZQH 4A1VA 2P3TB 1S6FA 2GJGA 3AW0A 3KL6A 1Z1JA 1F7ZA 3PROA 1GVZA 4FUJA 1Y59T 5T6GA 4AC9A 2R2MB 2OC7A 2G4TA 2K1QA 1GHBF 4NSYA 2SGQE 3SYJA 2TGPZ 1DLEA 3RDZA 3A87A 4K1EA 3RXFA 2ZTYA 2A4OA 4D7FA 1ZPCA 2PFEA 1GJ4H 2ZC9H 3T27A 4XBBA 5FHTA 4THNH 4IW4E 1GJDB 1YCPM 3UOUA 1ESAA 1DICA 3BG4C 2C90B 1QRZA 2LNCA 5DG6A 2C4FH 1AFEH 1QJ7B 1JRTA 2UUKB 2ZFPH 1QHRB 5FBEA 4WMDA 3LDXH 2Y6TA 1HAZB 3BN9A 1TPAE 3AK5A 4B6EA 1TQ0B 1A61H 2ZGJA 2C8YB 1IOEA 1IHTH 1EAXA 1O3FA 3KQDA 1LVOA 3BEFB 1LHDH 3FVFB 1G3CA 1SGRE 1YCPK 3UOPA 3P8GA 4X2YA 2ANWA 3U8TH 3SW2B 5EQQA 3SU1A 1AKSA 3EGKH 5JBCS 1CT0E 3U98H 1DFPA 3RXKA 1LMWB 1SQTA 1QL9A 2IPHA 1O2NA 1W0ZU 3SZEA 4CRCA 1L1NA 1TX8A 3F9GA 1K9OE 2ZEBA 1Z71A 5A0AE 1EJAA 2A7CA 2BYAX 1O2LA 4CHAB 1TBZH 5ESBA 2WUBA 1RTFB 2WV5A 3A88A 4OS5A 1O5CB 1BBRK 2VB0A 1RJXB 5JPMH 5JBTA 4X8TH 1CT4E 2ILNA 1NBMD 1VITH 2Q6DA 3MU1A 3U28C 2GT8A 1J9CH 5HXFA 2ZF0H 3OTPA 2OK5A 1P06A 1O2VA 2FS8A 1SQOA 3VG8A 1BTPA 1FJSA 4HI3A 2AMPA 1C5LH 3Q3XA 4SGBE 4A5TS 2F9NA 2HNTF 3QTVH 1ID5H 2CF9H 4F49A 2BXUH 3N7OA 3SJ9A 4BAMB 3QTOH 1ELCA 1FV9A 4U2WA 1ZJKA 2J2UA 2RFKC 2SGEE 3UB0A 2AH4X 5FPYA 3SU6A 5HM2A 1QA0A 1YPMH 2JDID 3MH4A 4U30A 2V3MA 3A7TA 2VGCC 1AUTC 1MUEB 2F83A 4X0WU 3TJUA 1PYTC 1ZTJA 2HOBA 4IBLH 1QB6A 4H6TA 4Q80A 3UY9A 1O2PA 1E35B 4WMEA 1WUNH 3ITIA 1CO7E 1YPEH 1YPLH 1CA0C 2EC9H 2FIRH 2VIWA 1C9TA 1XM1A 3F0PA 3EA9A 1HB0B 2ZGXH 2BQ6B 1GI6A 3E0NB 4NGAH 1IQMA 3BTTE 2BHGA 3MO6A 4R8TB 1C2FA 1KXEA 1F0TA 2BQ7B 3Q3KA 2BLOA 2Z3DA 2XCNA 1ARBA 3M3SA 3RC5A 1FI8A 1E37B 1LHEH 2KX4A 1O5FH 3UQVA 4CH8B 2BD2A 2QCYA 1BMLA 2VGCB 3OEED 7LPRA 4IN2A 1AVGH 4O97A 2XOKD 8GCHG 3KNXA 2GD4B 3TK5A 3TH2H 1BZXE 1W10U 6GCHG 1IQHA 4Q7ZA 1SSXA 1GMCF 3RXRA 4DIIH 4BANB 1AD8H 2XTTB 3QGNB 2C8ZB 4ZMAH 2CMYA 3GISB 3KQEA 3M37A 1CA0B 3UNQA 1V2JT 4GPGA 1AVWA 2PKSC 2ZDKA 1ANBA 2ZI2H 3FKSD 1U6QA 6CHAC 1O3AA 3K6YA 3O8BA 1TRNA 4HFPB 1YLCA 3BTQE 3F2GA 2ZFRH 1MD7A 4ABDA 1BTWA 1H8DH 4F48B 3FOAA 3PMJA 5FBIA 4FUEA 3LIWA 1C5XB 1VITF 1AMHA 3MYWA 4WXVA 1Y5BT 2FXRA 3ZVFA 1LDTT 1S85A 2ZO3H 3L6PA 1EPTA 3A7WA 2A4GA 3M61U 3N99A 1TRMA 1HAOH 1BJVA 1OOKB 2TBSA 1WTGH 4WMFA 2H9EH 3GDVA 1ETSH 4BAKB 2P3UB 1ESBA 2YNAA 4U32A 1O2SA 4E06H 1O2KA 6CHAB 7GCHF 4MPUA 2ZCLP 3UWIA 3PRDA 5KGOA 3ZV8A 2BY6X 5FCRA 1CSOE 3W94A 4P02A 1S81A 2QAAA 2A4RA 1FY3A 3M35A 3M3VA 4YTAA 3T5FH 4WWYA 1FZZA 1K1MA 2XWAA 1A3EH 1UHBA 3M5MA 1MBMA 3ODDA 1P9UA 3ATWA 4YM9A 4UFFH 1GHBG 1AN1E 2H1UA 2IJOB 2KR7A 2Q6FA 4AB8A 3HATH 1GBTA 2FOGA 1D3PB 1O2UA 1O36A 1TMTH 5F03A 3NZIA 1SQAA 2VVVA 4UONA 4XD7D 1Y3YA 1G36A 3VGCB 3PLPA 1UTQA 1HAXB 4ZKSU 3UTUH 1IQNA 3GICB 2J5UA 2LP6A 3F68H 1QQ4A 1S84A 1UK2A 1DITH 4X6PA 4FUFA 3FP7E 2ZDNA 2F9VA 2SGDE 3FP8E 2UUJB 2Z9KA 4UFEH 2BTCE 1KDQA 1A4WH 4K8BA 1O2TA 2H5CA 1CGJE 4Y0ZE 4X1NU 1AE8H 1IQEA 3WWFA 1ZRKA 1IQIA 2P95A 1DSUA 5E0HA 1E36B 1N8OC 2BDYA 3PM3A 3MO9A 4B2BA 3LH3A 1OWJA 1OXGA 3MMGA 1MTWA 3RXVA 3LOXA 3GDUA 1LPKB 1AFQB 3CP7A 1QBOA 1THRH 4GSOA 3BIUH 2EY4C 2HPQH 4AG2A 3SQEE 1BRAA 1PJPA 1NRQH 1TPPA 3BTDE 5C1YA 2VH6A 1GI3A 2RCEA 1HBTH 3U1IB 3BG8A 2W5EA 2A7HA 2CV3A 1C4V2 1GI7B 5A8ZA 5EODA 3BTME 1DY9A 1NU9A 1L0ZA 1PQ7A 1C5QA 4X6NA 5EIYA 3LGVA 4KTUA 3RXIA 1EFRD 5GCHF 4INKA 4MG3A 3P17H 2ZFFH 1AU8A 4B2AA 3A89A 2XYAA 3MH6A 3SI4H 2PTCE 1QB9A 5HIYA 1OYQA 1ELGA 2QC2A 3R3GB 1N8OB 3GCOA 1C1NA 3TLOA 1V2KT 2H6MA 1O3PB 4I33A 1TIOA 2VJ1A 2FDAA 1SGFA 1GI8B 3SZNA 3WWBA 3W95A 5JB9S 2KAIB 3BF6H 1WSSH 4FUGA 1EOJA 2W3KA 1A0JA 2ZZUH 4AOQA 1P12E 4XSKU 5CDFE 3PMAB 3STIA 1C5NH 1BTZA 3FP6E 4NFFA 1Y5AT 1AB9C 2BD8A 2FOCA 4JMYA 2ZKSA 2FX6A 2FOAA 3P70B 2QN5T 1YLDA 3GYMA 4D8NA 3GS9A 3MU0A 3ATKA 4XBCA 2OXSA 1W0KD 1ABJH 5DK1A 1W13U 2VVCA 1Z6EA 1P3CA 1THSH 3T62A 3TJNA 1J17T 1C5UA 1C1PA 1O2RA 1DUAA 3BEUA 3EQ0H 1EAIA 2BDCA 2BDBA 2ZHFH 1MD8A 2Q1JA 1P04A 2XC4A 4BOHA 4AX9H 1QGFA 4K2YA 4NA8A 4X1QU 3QZQA 1VCWA 4ZKOU 5KECA 4ZUHA 1CGIE 2RG3A 4ZH8A 4F55A 3MH5A 3D23A 2W6JD 3MQKC 1K1OA 4A1TA 1KYNA 4DT4A 1XMNB 4ABFA 4K5ZA 5B6OA 1C5WB 1C2GA 3HGPA 1GJBB 3IG6B 2PP6A 1TWXB 1O0DH 3CNRA 3NPSA 2VWNA 1F0SA 2THFB 3LJOA 1YY3A 8KME2 1HXEH 2ANMH 4X8SH 1YP9A 1O2XA 3KHVA 3T29A 1GMCG 1QJ1B 5L2ZH 5FXLA 1PPZA 2OUAA 2PSYA 3M5LA 4X6OA 1EXFA 3Q76A 3QN7A 1TA6A 4Q7XA 3M7TA 1GBCA 3C1KA 1SOTA 3R0FA 2HGTH 1N6XA 3PTNA 5PTPA 1EX3A 3GY3A 2JETC 5DSFA 1KLTA 1P2MA 1C1QA 2OQ5A 1BB0B 1CA8B 3CS7A 3DSGA 3NCLA 4P00A 3I78A 1NFUA 1ZLRA 3SBKA 1VITG 2ZCHP 2J92A 2AMDA 1C2MA 2GVFA 4MDSA 1A7SA 4U01A 1C5OH 1BITA 1OWIA 5C2ZA 5H4IB 3RMOH 2WPJS 3ATLA 4IC5A 3ZV9A 5HM9A 1KXAA 4IMQA 1AHTH 4Q7YA 2WPLS 2FESH 1OWKA 1YPHC 3GYLB 1UVOA 1THPB 1C1MA 2NU4E 1VCQA 2GGVB 7GCHG 4FUCA 2CHAB 1UJ1A 1YPHE 2JETB 1HAPH 1TLDA 4TWWA 1TBQH 2CJIA 1OP0A 1XUIA 1T4UH 3IITA 3VB4A 1V2RT 3PTBA 1O3MA 1EP5A 3VXFH 1JIRA 1MAXA 1O2YA 3HGNA 4Y8YA 3RXQA 2YNBA 1NY22 1O2HA 1D6RA 2F4LA 2PWXA 1HPGA 1T8MA 3NXPA 3M7UA 1TOCB 5EQRA 2ODPA 4MPVA 5BRRE 1XUKA 3ZZ4A 3LJJA 4KELA 4ABBA 3E8LA 2C3SA 4O3UA 2Z9GA 2FZZA 2SNWA 1MCTA 2FTMA 3U9AH 1DPOA 4K60A 1UVSH 2RDLA 4R0IA 1GHVH 1KXFA 2PUXB 3ZZ8A 1UTJA 2QXGA 3H7OA 3LGWA 1G3BA 2A4QA 2D26C 1NRPH 2WINI 3FZZA 4NIVA 4NSVA 1ELBA 2QF5A 2GMTC 2DE9A 3VB6A 1LKAA 1O34A 2B5TB 4TY7A 1K21H 3BTWE 3QGJA 4DJZB 3BTKE 3EAJA 4KTSA 1EB2A 4Y11E 4ZCNA 3RXDA 1DDJA 1SPJA 1XVMA 5I46H 3ZVDA 1C4U2 3BIVH 3S9AA 2F3CE 3GDSA 2FYQA 4OGXA 3TPIZ 5AVDA 4NWLA 2NU1E 4D9QA 3V7TA 1E1RD 1OPHB 1S5SA 2GDEH 3U8OH 2JH5D 4MQAA 5TCAA 2J98B 2WZQA 4UEHH 4RI0A 2OQUA 2WUCA 3BV9B 3EA7A 1C5TA 2VBCA 4K1SA 1UVUH 3U69H 2WPHS 3RUOA 1G9IE 4NA7A 1N6YA 2G5VA 2QA9E 3HPTB 5C1UA 4D76A 3NWUA 2ESTE 1TPOA 5DGJA 1CBWB 5GCHG 1P0SH 5FPSA 1SGFG 1KY9A 1T32A 1C2DA 3GCHC 1QNJA 2ZHEH 5DP8A 2ODQA 1SHYA 3NRLA 3UPEA 1YKTA 1NRSH 4AYYB 1LVBA 4BTIB 1V2OT 2SFAA 1ETTH 1M9UA 1FDPA 3HKIB 3VPKA 1ZGIA 3A86A 4JZEH 2ASUB 3KN2A 4YXWD 2FP7B 1GHXH 1NS3A 3E91A 3SGBE 3PB1E 4ZROA 2ZA5A 2ZHWH 3Q00A 1P09A 4QT8C 3RMNH 1TAWA 5L2YH 1HJAC 3RXAA 2RA0A 1GDNA 1O32A 3MNXA 2BX3A 3KCGH 4ABAA 1TGNA 5IYTA 2NU0E 1BQYA 1BRUP 3SGAE 5EJLA 2STAE 3DSPA 4NWKA 3RXGA 1F0UA 1SLWB 3S69A 2A45B 2Z9JA 3BTHE 2GX4A 5BPEA 4NZQA 1UW7A 1DVAH 3A8BA 3EE0B 2QXHA 5DKMA 1SL3A 3F2HA 2NWNA 1SBWA 3BG4B 1SHHB 1HDTH 3E1XB 2ODYB 4GCHF 1ZMNA 1HAVB 3ATMA
chains in the Genus database with same CATH topology
5J4SA 3Q77A 3VXEH 3SJIA 4FU9A 2FM2A 1DLKB 2C93B 4JZIA 4NA9H 1Z8GA 2ZFQH 4FXGH 3M3TA 1UTOA 5LPFA 4CRBA 2FEQH 2WPMS 1EASA 1BOQA 2ANKH 1WOFA 1O3NA 4INHA 4B73A 2P3FH 4B71A 2TRMA 2PLXA 1QY6A 1TPSA 1SI5H 5E2PA 4CREA 2ZGHA 1B0FA 1O3LA 3UR9A 1RGQA 1BMAA 4Q2KA 1TNJA 1W3CA 1MCVA 1PQ8A 2WYJA 2UWOA 3EDXB 1XUFA 1QBNA 4H6SB 4B2CA 2CN0H 1ARCA 5ABWA 1O2QA 3GCTF 1C5ZB 1TMBH 3SUEA 4BAHB 2FLRH 3G01A 1IQLA 1QRXA 2H9HA 1K1PA 1OP8A 2F9BH 4A92A 2FOEA 5LGOA 1P02A 2Z3EA 1P11E 3RXMA 1BTYA 1C5VA 1GGDC 3UQOA 1PQAA 3TITA 4AFSA 1O5BB 1C1SA 3GY6A 4K8YA 5L30H 3A82A 2FO9A 1C4Y2 1GBHA 4XE4A 1CHOF 5GXPA 3FFGA 4X1PU 5E8EH 2TPIZ 3FANA 6ESTA 1WAYB 1AUJA 1XUJA 3SUDA 2Y7ZA 3SNCA 4NG9H 1EJNA 3BTFE 5LPEA 1TGCA 1XKBC 1MKWH 5AHGH 3PLKA 4ISIH 1INCA 1TYNA 1E38B 5AFYH 4KP0A 4YT6H 2Y80A 4AGKA 2QYIA 1G2MA 2OC1A 4MPXA 4NIXA 2KAIA 3LC5A 1O37A 1EATA 1RFNA 3SU5A 1EJMA 1GGDB 1P2QA 1ORFA 2BQWB 1BDAA 2O8UA 1AZZA 1T4VH 1TGBA 3KF2A 4NCYA 4I8GA 2AIQA 1IQJA 2BY7X 5DP9A 3LGTA 3T25A 1FPHH 1V2NT 4Y7AA 4CRDA 4XDEA 1LHGH 3PMHB 1UCYH 1ANCA 2F91A 4X6MA 1O39A 1VGCC 1T8NA 1V2VT 1W7GH 5A0CA 1ZMLA 1DWDH 1NRNH 1MZDA 1MU6B 3ESTA 3K65B 2PKAB 1Q31A 1BMNH 3SV7A 1SG8B 3K6ZA 4RKJB 4ZHLU 4YOGA 5LH8A 1O3EA 2AFQB 2C8XB 1ACBE 4RN6A 5FX5A 1BHXB 2AGIX 2XRCA 4I8HA 1JOUB 4MPWA 1H9HE 4Y8ZA 1FN6A 3LT3A 1F2SE 3LC3A 3ZZ9A 2PKSB 1AE5A 1W7XH 1A3BH 3TJOA 2A7JA 1MKXH 3A80A 1JWTA 5CMXH 1H9IE 1D3DB 4CRGA 1D4PB 1GBFA 2BDIA 2FS9A 1GMHF 4Y7BA 3A85A 3OY6U 5T3HA 3RXCA 1A2CH 3F9EA 1GHZA 1YM0A 2BVXH 1FAKH 1TX7A 1HRTH 1TFXA 1FLEE 1V2MT 1MTSA 1GI9B 1KIGH 2G4UA 3P8OA 2FWWA 5EOKA 3A7ZA 4K1TA 2HVXA 5A09A 3TGJE 1BBRH 3CENA 1QBVH 1C1VH 3UUZA 2ZPSA 1KTTB 3M36A 4CR9A 1TNKA 1NPMA 1O2JA 1X7AC 4X1SU 1LCYA 2V3OH 5DP5A 1J16A 1WCZA 3ZZ3A 3U8RH 1C2EA 1JBUH 3LH1A 2FMJA 3URDA 1W0YH 4OGYA 1O30A 2ZQ1A 1YPJH 1UTMA 1C1TA 2HNTC 2ZP0H 1E34B 1O3HA 1XXDA 2NU2E 3SV2H 1TB6H 1PPCE 2ZU1A 1PPHE 1OWDA 1O5AB 4IS5A 2SNVA 2J94A 1GDUA 5FAHA 2XC5A 2A32A 1BTHH 2HNTE 1L2EA 4NIYA 1PPEE 2FOMB 5A2MH 4I7YH 4MNXA 1VZQH 4BAOB 1SGPE 1V3XA 1AO5A 1O3CA 1P2IA 2Y5FA 1HXFH 2BOKA 3RXSA 1O3DA 1HAIH 1CVWH 2ULLA 1AVXA 1RIWC 2OBOA 2OCVB 3K9XB 1DS2E 2FI3E 1SOZA 1C1UH 1WV7H 4GCHG 3ZZ7A 3SJKA 1RTLA 1LHCH 1F5KU 3LGUA 3PO1C 5SGAE 3ZVGA 1XVOA 4IC6A 1QRWA 1GHWH 2IN2A 4XBDA 2QF3A 3JZ2B 1GL0E 2GDDA 1VCPA 4HTCH 4I32A 1NFXA 2OD3B 5EPYA 4ZXXH 1CU1A 3TNTA 1Y3WA 5A0BA 1H4WA 4IN1A 1AWFH 1KXCA 3T2NA 5K0HA 1FPCH 1EB1H 2ZHQH 2PW8H 1H9LB 2XXLA 1Z8IB 3OU0A 2B9LA 2GV6A 3OTJE 1BIOA 4ISHH 3DFJA 2ZDVH 4HGCA 1S82A 1SR5C 1BTXA 2VIVA 1OWHA 1GHAF 3PO1B 4X1RU 2GZ9A 3TNSA 2VWLA 3MH7A 3GY2A 1MAYA 4E7NA 4DVAU 1SC8U 4KTCA 1EPTC 1DXWA 4YZUA 1DM4B 2HPPH 1QFKH 2OTVA 2VIPA 3ZZAA 4H42U 1DWCH 2EI8A 3STJA 1MMJN 2GZ7A 1ELAA 2SGAA 1LVMA 4B75A 1QCPA 1Z7KA 4NZLA 2AGEX 1HUTH 1V2WT 2F9OA 1A5IA 2I6SA 2GCTC 1AQ7A 1VJ9U 5GDSH 3TU7H 2O8LA 4Y79A 1TONA 2P94A 1HIAB 4BAQB 5A8YA 3S7HB 1GBKA 3EA8A 2JKHA 1ZYOA 1GDQA 1P57B 3MWIU 2JH0D 2F9UA 1EUFA 1AB9B 2RA3A 1PPBH 3E3TA 3UFAA 2SGPE 3MU5A 1PQ5A 2AERH 1H1BA 1EQ9A 2CGAA 3RXOA 1V6DA 2BVRH 3A8DA 4JZFH 1A5HA 4VGCC 2GTBA 3NUMA 5JDUB 5JBBS 3DD2H 2WYGA 1TNGA 1ZJDA 2B8OH 1EP6A 1QL7A 1AI8H 1YGCH 2UWPA 3T28A 4ABGA 5GWZA 1EAWA 1LPGB 1UTLM 3OY5U 5E2OA 2B7DH 1O5EH 1FQ3A 2GCTB 2PR3A 1C1RA 1ZHRA 3LPRA 3PMBB 3SV6A 4ZXYH 5C1XA 2FOBA 4YLUA 3UIRA 1SGYE 1KXBA 2BD9A 2Z9LA 3M7QA 4Z6AH 3RC4A 3MU8A 1O3GA 1UHBB 1YBWA 5AFZH 2VWOA 2ZECA 2BY9X 1A0HB 1F92A 2GCHF 3GY7A 4DY7B 4INLA 4LZ1H 1ZOMA 5JBAS 2PGQB 2BZAA 1GBMA 3UREA 1HAVA 1Y8TA 1GBDA 1A0LA 2TGAA 1DY8A 1T8LA 3ZYEA 1OYTH 2HALA 1BCUH 1YF4A 4J2YB 1FUJA 1QL8A 1Z6JH 3RLYH 7KMEH 2PSXA 3SV9A 4ABJA 4ZHMU 1K2I1 2AMQA 1W11U 1GMHG 2BY5X 3LONA 1UVTH 1K1IA 1EKBB 1WQSA 1ETRH 9LPRA 4WJG2 3A7YA 1GPZA 1ZHMA 2NU3E 2P8OC 3QK1A 2HWLB 1SFIA 1S0QA 4RSPA 3RU4E 3RXPA 5C5OA 3LKWA 1VR1H 3SHAH 1AIXH 1UCYE 1SGIB 1P01A 2V35A 4UFDH 5CE1A 1ZMJA 2ZTZA 2ZGCA 1HV7A 2XBVA 2ZDMA 4ISLA 3TJVA 4MNYA 2FYRA 1GCDA 1JRSA 1WTHD 2BD5A 2OC8A 1ANEA 4XFQA 1XUGA 1F5RA 1P9SA 1BMMH 4MNWA 1UVPA 6LPRA 3GY4A 1DANH 1FY4A 2EA3A 3F9HA 5AF9H 1ZR0A 1ZPBA 1UTKA 1XKAC 1NC6A 1EZXC 1ZTKA 1Y3VA 2P8OB 1C2IA 2ALPA 1IQKA 5C5NA 1DSTA 1QB1A 2FI4E 5TCCA 4B74A 3QO6A 1CQQA 4JZDH 3SN8A 3KEEA 2BZ6H 2XC0A 1O5DH 2YOLA 2J95A 1FAXA 4DG4A 3VB7A 4ZHAA 2H5DA 3PYHA 2QXIA 1O3KA 1IAUA 1WU1A 1OP2A 1PPGE 1BJUA 1ELVA 2PTNA 2H2ZA 1V2UT 1MKWK 4Z0KA 1CT2E 4ZKNU 4AFZA 2GMTB 2PHBA 2ZCKP 1WQVH 2A31A 3MNBA 4B76A 3GCNA 2XBYA 1O2ZA 2ZU4A 1Z8RA 5ESTE 5DP7A 1J8AA 4AORA 1V2ST 1YPGH 3EYDA 1P2JA 3B8JA 1P8VC 3NKKA 4WXIA 1D6WA 1PYTD 3TIUA 5IDKA 1NROH 1BHXF 1AGJA 4LK4A 1KLJH 4TY6A 1QTFA 2PKAA 4CR5A 5FCKA 3HK6B 3RXLA 4WH6A 1UCYK 3SQHE 1GBLA 5F8XA 2D1JA 2ZQ2A 7ESTE 3BTEE 4XOJA 3A81A 3P92A 1GHAG 5C20A 1S83A 2R0LA 1V2TT 1B5GH 3DT0H 3T26A 1DT2A 4BNRA 1HCGA 3E0PB 2GZ8A 3SNEA 1GWAA 4I8KA 1TGSZ 2W26A 4CHAC 3GCHB 3ZVBA 3F9FA 5EPNA 3LU9B 1GBAA 1NFWA 2OINA 1GBIA 3AAUA 1GJ7B 1O2GH 4A7IB 1FIZA 2BDAA 1GJ8B 1D3QB 4BXSA 4IGDA 1MKXK 4FVDA 3SGQE 1ELEE 2WPIS 1VJAU 4X2VA 4O9VA 3MNSA 4AGJA 1QIXB 1SLXB 2QGRA 1K28D 1QURH 3A7XA 1GI1A 3UNSA 4CBOA 1SGNE 1JMOH 1HJAB 1P2NA 1C2LA 3SORA 1F0RA 1TE0A 3O8DA 1ELFA 1PPFE 4FUBA 1Q3XA 1D9IA 2VIDA 2TIOA 1GI0A 1LTOA 3RXEA 1CE5A 3UR6A 1C5RA 4LZ4B 1KTSB 1RRKA 1W12U 5K7RA 1S6HA 3URCA 4DIHH 4GVUA 1LQDB 3RXHA 3RM0H 4A6LA 2DUCA 2R2WU 1EZQA 1GBBA 3OSYA 3E16B 2A2XH 5A8XA 2EI6A 3LGIA 1P3EA 4Y6DA 2VNTA 3P6ZB 1OX1A 4ABHA 1KXDA 5EU8A 5EGMA 2UWLA 3SU4A 9ESTA 1EOLA 4JYUH 1G3EA 2FLBH 2BY8X 1O2WA 1GCTC 4FUIA 1YYY1 2A5IA 1C2JA 2STBE 2BD3A 3A8AA 1C2KA 2GCHG 1O2OA 3BSQA 3UWJH 3GOVB 2ZIQH 5ETXA 1P2OA 2Y7XA 3I29A 4E05H 1ESTA 3KQBA 4CH2B 1NN6A 2BM2A 1RD3B 1GI4A 1ZGVA 1MTNC 3PV4A 5HGGA 1LO6A 1TALA 3M5NA 1SLUB 1LKBA 1GJAB 3ELAH 2R0KA 1Z1IA 2QIQA 1OSSA 5HMAA 3SNAA 2A0QB 4UE7H 1MBQA 4Y8XA 1C5MD 1XX9A 1AZ8A 1GCTB 3A84A 4YO9A 4F4OC 4MLFB 1HGTH 1O31A 3PWCA 4WVPE 4Y71A 5GIBA 2XNIA 3DFLA 2P59A 1TOMH 3ZZDA 5DO4H 1G32B 2UUFB 4BTUB 2W7UA 3I77A 1NFYA 3F6UH 1HAGE 1XXFA 2QV1A 2QY0B 2CXVA 4FUDA 2XWBI 4AFQA 3RU4T 1MTNB 1O33A 2ZDLA 3ZVCA 1JIMA 5HYOA 1C1WH 1UK3A 3QX5H 1GG6C 1CGHA 4TPYA 2ANYA 4ISOA 2ZFSA 2OBQA 1NESE 1C5PA 2V0BA 2FX4A 3FZDA 1K1NA 2GP9B 2EEKA 4HZHA 1GVKB 1L1GA 1WYKA 3TH4H 2SGFE 3MO3A 1BRBE 1O3BA 3MNCA 1ELTA 1HIAA 5J4QA 3UNRA 2P16A 2TGDA 4JCNA 4H4FA 4I8JA 1GBEA 1J15A 4OS1A 1QA7A 1TRYA 3GY5A 3ODFA 1ZZZA 1ZHPA 5C67A 1YCPH 4AB9A 5GJ4B 3HK3B 1OWEA 4E7RG 2A5AA 2O9QA 1GG6B 1W8BH 2I6QA 5EXLA 1VGCB 1FIWA 3CS0A 1EAUA 2VIQA 4JK6A 2XBWA 5I25A 1A46H 3B23B 4LOYH 4O03A 4TYDA 3M5OA 1HJ9A 3VGCC 2Y5HA 3Q3YA 1QR3E 3V0XA 1XUHA 2BX4A 1DWEH 1OKXA 2VH0A 1AKSB 2QXJA 4FU8A 2Z3CA 4X8UH 4I8LA 1EZUC 1UTPA 2O8WA 3SNBA 3ZZCA 1FXYA 2VINA 2J9NA 1C5SA 3ZZ6A 1P03A 1AY6H 2ZG0H 1SGTA 3BEIB 5F8ZA 3FAOA 3TGKE 2BDHA 5EXMA 3RXJA 2FOFA 1ZTLA 3ZZBA 2R9PA 1K22H 3ATIA 1O3JA 4Y76A 3SNDA 2VU8E 4ABEA 4X2XA 1GVLA 5JYIA 4DW2U 4NFEA 2WV4A 1AFQC 4ABIA 4GHQA 1SGQE 2HRVA 4WH8A 2W7SA 8ESTE 1MZAA 2V6NA 1L4ZA 2M5TA 2Z9IA 1JXPA 5LPRA 2AEIH 3QWCH 4FVBA 1O35A 4LXBH 1QJ6B 1A1RA 1Q2WA 2HLCA 4J1YA 1ANDA 1RTKA 4A1XA 4YOIA 1ZRBA 4YOJA 1IHSH 3RXUA 1P10A 3QLPH 5F6MA 2V3HH 2BVSH 3TVJB 1D3TB 3QUMP 3S7KB 1LVYA 3ENSB 3MU4A 3SU3A 5EW1H 4ESTE 5EW2H 1UO6A 2ZU2A 3P8NA 1PFXC 1KSNA 2Y81A 1T7CA 1SB1H 1ZSJA 4JYVH 1F5LA 4KGAA 5E0GA 2FTLE 3SJ8A 1DOJA 1SGCA 3SHCH 4Y10E 2QF0A 3NK8A 3RXBA 1O2MA 1IQGA 1C1OA 4DGJA 2TGTA 3H7TA 2IOTA 2ZGBH 3L3TA 3SUGA 1GMDF 1H8IH 1K1JA 4FU7A 3SOSA 3MOCA 1MQ6A 4ISNA 3A83A 4YESB 4AFUA 1GJ5H 1UTNA 2OC0A 2BXTH 1O3IA 1HFDA 2LPRA 3RP2A 1RIWB 1ABIH 3IWMA 3LGYA 2F9PA 3SJOA 3ZZ5A 1SMFE 5DPAA 1TNIA 3AAVA 2ALVA 1FN8A 4FUHA 2B0FA 3AVZA 2R3YA 2G8TA 3GCTG 3MI4A 4BXWA 2PGBB 3RM2H 4KKDA 1TMUH 5T6DA 3SUFA 2A1DB 1T31A 1FONA 4DOQA 5GPIB 3AW1A 4UD9H 3SV8A 5L6NH 2ZPQA 3TGIE 1J14A 1HAYB 4GAWA 2J38A 3D62A 3P95A 3S9BA 5CHAC 2G51A 2W3IA 2ZNKH 3RU4D 3GY8A 1G37A 3VEQB 2P93A 3U1JB 3ZYDA 5DP4A 1CHOG 4MTBA 1TQ7B 5TJXA 3PWBA 2GKVE 2VIOA 2BB4A 1DE7H 5EG4A 1V2QT 4K3JA 2ZHDA 3O8RA 4YLQH