3BTKE

The crystal structures of the complexes between bovine beta-trypsin and ten p1 variants of bpti
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
222
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structures of the complexes between bovine beta-trypsin and ten P1 variants of BPTI.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PROTEIN (TRYPSIN)
total genus 53
structure length 222
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3btkE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3btkE02
3P70B 1TGNA 2EEKA 2OXSA 3AW1A 3ZZ5A 4UFEH 1D3QB 3SJOA 3V7TA 4FVBA 3T26A 1EXFA 2ZDLA 3ODFA 2ZEBA 4JYVH 4B75A 4X1NU 3AAUA 4YLQH 3ZVCA 1EOJA 1GHAG 3UWIA 1HAIH 3IITA 5B6OA 1C5LH 2FEQH 3CS7A 3TH4H 1NROH 3LDXH 4HGCA 5T3HA 5FBIA 1QB9A 3STIA 1GMHG 1C5XB 1A0HB 5J4QA 1SI5H 1GMCG 4A1TA 4OS6A 3OY6U 2ZCKP 3A81A 1V2MT 2FTMA 3RXFA 2A4OA 2FX4A 1DXPA 2PUQH 1MKXK 1IAUA 1ZHMA 3S0NA 2A32A 1C1QA 4AN7A 1GWAA 1YGCH 1JXPA 2P59A 2XBXA 4IMQA 5JDUB 2PKAA 3E3TA 3BTQE 5A8XA 2QCYA 1ETTH 1DXWA 4UONA 5DP9A 1TB6H 2C8XB 3T25A 3Q77A 1T8LA 1DX5M 4A6LA 3BTKE 4O9VA 1BCUH 2Z9GA 2P16A 3ZZ9A 2BDAA 2Z9JA 4MPVA 1NTPA 1GHAF 2XRCA 1NPMA 3H7TA 1O5EH 1HJ9A 3TJUA 1GBMA 2VH6A 3UPEA 4GVUA 1OKXA 4ISNA 4BTTB 3PYHA 9LPRA 3S69A 1C5OH 3QZRA 3GYLB 2TGAA 1GHYH 3PROA 1F0TA 1ZPZA 1VITH 1OWEA 4I7YH 4ABIA 3A89A 1AO5A 4KELA 4J2YB 1BTWA 4DW2U 1YP9A 1UTJA 2CHAC 3GY2A 2OP9A 1KSNA 1HAGE 1S5SA 5EODA 3KN2A 3L3TA 1PQ5A 4YOIA 4X6NA 1T4VH 5G4BA 2PTCE 1LVMA 1SLVB 5GPIB 1TPPA 3OY5U 5TCCA 2EI8A 3PB1E 1YKTA 1AUTC 1TX6A 2AMPA 2J94A 1O3FA 2BVSH 3LKWA 3ATMA 1HAVA 3TITA 1WTGH 3MHWU 3SU5A 3ZVEA 1FQ3A 3MMGA 4JYUH 3M7TA 1GJBB 2ZPSA 2KAIB 3M3SA 1BRCE 4HFPB 1SGNE 3KF2A 2SGFE 1DWDH 3PLKA 5F8TA 1N6XA 2BLWA 3BG4B 3MNBA 3KQBA 2BD8A 1HAVB 4KKDA 1SC8U 3DFJA 4D7FA 1FJSA 1Y3YA 1O3JA 4YO9A 1GBTA 2VVCA 2W7UA 2O8WA 3LC5A 4Y10E 2FOBA 4IN1A 2PSXA 1UK4A 2W26A 2QXJA 5FBEA 4GAWA 4BAKB 3A85A 1IQFA 2BY6X 4JK5A 2A7CA 2G4TA 1PPFE 5DG6A 1CHOG 5CE1A 1MAYA 2GCTC 3A87A 3LT3A 2XW9A 5GXPA 1P03A 5GJ4B 2YOLA 3RXKA 4AX9H 3A88A 2WPHS 2EA3A 4NFEA 4AFSA 2SGAA 3K9XB 1C2MA 3K6ZA 4X0WU 4HZHA 2SNWA 1K1IA 1HJ8A 4D9RA 4BAOB 4ABFA 3PTNA 1TNIA 4I8HA 2FI4E 3SU4A 1C1MA 3FVFB 2HLCA 1V2OT 5EW1H 1DANH 1TX7A 3M5NA 1AE8H 3ZVBA 5PTPA 4LZ1H 3RMNH 1HJAB 1CT2E 3E1XB 1G3BA 1TLDA 4DG4A 5C1UA 3S9CA 1XUGA 2WPIS 3SU6A 2THFB 4E7RG 1QTFA 3F9HA 2BQ6B 4YT6H 3UUZA 2QXHA 2ODYB 3B8JA 4ZKSU 3SQHE 1DWBH 1O36A 1DY8A 3UR6A 2ZCHP 1EKBB 4WWYA 2GCHG 4Y11E 2BXUH 3SNAA 2G51A 4BAMB 5LPFA 5JBAS 4Y76A 2Y6TA 5CHAC 5DGJA 4BTIB 1MKWK 3SI3H 1SHHB 1VITF 2SGDE 4NIWA 5EG4A 2ZQ1A 4Y6DA 2B9LA 2QXGA 1A7SA 1ORFA 1Z8IB 1ACBE 1GG6B 4JZ1A 1SHYA 2HRVA 4R0IA 4NA9H 1PPBH 2WPLS 4AGKA 1BDAA 4X2XA 4WF8A 1MU8B 1NFUA 4GSOA 4I33A 1FIZA 2Z9LA 3VB3A 1OOKB 1ZLRA 1QHRB 4I8LA 1HXFH 1O2VA 1QBNA 2B5TB 2IJOB 3P17H 1C4U2 3V3MA 1DM4B 1GI4A 1N8OB 2QA9E 1ELTA 1A61H 1GHBF 1Y5UT 2JETB 1P9SA 1ARBA 4SGBE 1D6RA 1WUNH 1LCYA 3SNBA 2YNAA 1C5PA 2AYWA 3A86A 4X2VA 2BD3A 2HOBA 2Y5FA 1B5GH 3ZYDA 2BZ6H 1D4PB 1UCYE 2EI6A 2ZFFH 1LVYA 2J34A 4FUDA 5DP8A 3PWBA 5DPAA 2ZG0H 3RXOA 1SQOA 1P2QA 1C5MD 2VWNA 1PFXC 3LGVA 1PYTD 4KGAA 1D3DB 1V3XA 2VWLA 2GV6A 1TOCB 2ZPRA 3ATWA 1N1LA 2ZWLH 3EE0B 4OS4A 1XX9A 4Z0KA 1C5RA 3L33A 2BLQA 2TIOA 4JZIA 1LHDH 4ZHAA 2W5EA 3KCGH 1HFDA 1KXAA 3F9EA 1GJ5H 1S81A 2QXIA 2XBWA 2F3CE 3VEQB 2ZGXH 3QX5H 1EASA 2XC5A 2Z3CA 2G52A 3PV4A 2XTTB 4DVAU 2I6QA 4MPXA 1E34B 3MH5A 3ELAH 1T31A 1F92A 2OBOA 1T8MA 4JZFH 2BY7X 1LVOA 2R3YA 1K22H 1SOTA 4O97A 6GCHG 2O9QA 2FM2A 1EAXA 1THSH 3ATKA 4UE7H 1GVLA 1UVSH 2F9UA 1W12U 1O2IA 4XE4A 3MH7A 1Y59T 5T6FA 3QGNB 3E91A 3LGWA 3SJ8A 1O2ZA 1CO7E 4XFQA 1Y3VA 2DE8A 3FFGA 3MU1A 1ZPBA 3OTJE 4CH8B 1YF4A 4JMYA 3M37A 3TJOA 3SN8A 5C20A 1MBMA 2FOHA 3M36A 3NUMA 1AVGH 1SPJA 1ZMNA 3LC3A 3QLPH 1BOQA 5EPYA 1NESE 1SOZA 1CA0B 1AQ7A 4PROA 3ODDA 2ZU1A 3O8DA 1UTMA 1HXEH 1T7CA 1BTPA 1AGJA 3RC6A 1LHFH 1G37A 1AWHB 1TRMA 2H6MA 2Z9KA 1S83A 2R2MB 1OSSA 1MAXA 4NCYA 4CREA 1OP8A 4X6MA 5EGMA 4MTBA 3TVJB 1VGCB 2FS8A 5EXMA 1E0FD 1O2RA 1ZJKA 1IQHA 1Y5BT 4GCHF 4CBOA 1EUFA 1W3CA 3P8NA 1O2YA 2HPQH 1GMCF 4Y8ZA 2AFQB 2BD2A 3U8RH 2FXRA 5F6MA 2ASUB 2VJ1A 4LZ4B 4OS5A 3LU9B 2PKAB 4YESB 1HAXB 1C5QA 1UVOA 4WVPE 2FP7B 4U30A 5CHAB 3TU7H 4YLUA 2ZZUH 2F9NA 2RDLA 3MH4A 3SV7A 2AMDA 4UFGH 3T27A 1A0LA 3ZZ3A 2ZTXA 1VR1H 2F9OA 2ANWA 2VU8E 3RM0H 1EJNA 1SLXB 2PGBB 1RJXB 1AI8H 2B8OH 4K8BA 2A45B 2VNTA 4DJZB 1G3DA 4BOHA 1MCTA 4K69A 3M5LA 5HXFA 1PPZA 1C1UH 1U6QA 2VH0A 5GCHF 2ZGCA 4XDEA 1YPJH 3M5MA 2FLRH 1QL7A 1IHSH 3GY8A 1C2HA 4U2WA 1ANCA 2H1UA 1O5DH 1O3PB 1XUKA 4ABAA 1ARCA 1LDTT 3BG8A 3NWUA 3F68H 4CRGA 2ZHQH 4B76A 3HGNA 3LONA 4DIIH 2V3OH 1PQAA 1EZQA 4FUBA 4XBBA 1EZXC 1TMUH 5ESTE 1D3PB 1EOLA 3RXQA 1C1RA 1AZZA 3PLBA 4AOQA 1KTTB 3PTBA 4RSPA 4DOQA 1HGTH 1LPKB 4K3JA 1EPTC 1HAHH 1NT1A 2FI3E 4MQAA 2HNTC 2G81E 1ESBA 2PSYA 4CHAC 2BB4A 4SGAE 2Y5HA 4NG9H 4K8YA 1QRWA 2ANKH 1P2MA 1QNJA 4K1TA 1ELBA 1O5GH 3Q3KA 1EZUC 4Y71A 3SJ9A 4B74A 1MQ5A 1ZJDA 2BOKA 1C9TA 1GBKA 1HPGA 3UOPA 2LPRA 4D7GA 2VIWA 4TYDA 2H9EH 1FIWA 1DSUA 2UWOA 1FMGA 1GCDA 1OP0A 4Y79A 5CMXH 2P8OC 1GJAB 3O8BA 1TPAE 3ZZBA 1A5IA 1AWFH 8ESTE 2Y81A 4JK6A 3MU8A 1P09A 2VGCB 5C2ZA 4DCDA 1C1WH 1AFQC 2ZECA 2LNCA 2ZNKH 1O3OA 4Y8XA 5ESBA 1ZSLA 4B71A 3KQCA 4ZROA 2ANYA 3MNXA 1UHBA 1THRH 1NY22 2A5AA 2GMTB 4ZUHA 1BMNH 2ZTZA 1O2NA 2NU4E 1DE7H 4MPWA 3ZZ7A 4U32A 4WXVA 2FTLE 5DP4A 2FOAA 2GX4A 2FPZA 4WH6A 4H6TA 3LGTA 1BTUA 3TH3H 5FAHA 3W95A 2BZAA 2O8MA 4HTCH 1SGFA 2FIRH 2P3TB 1QR3E 2FI5E 2CV3A 2IOTA 3NK8A 2R0LA 1C5NH 2GZ9A 3RMMH 4JZDH 3GCTF 4MNXA 1G36A 1Z6JH 3GY6A 1CVWH 1V2NT 2G00A 3VGCC 3QTOH 1OXGA 3IWMA 3HPTB 1KDQA 2O8LA 2XWAA 3UFAA 1AFEH 2SNVA 1C1SA 2P95A 4IMZA 4Q2KA 1Y3XA 2GCTB 1GJ8B 2F9VA 1ZPCA 3BTTE 2FOGA 5DP6A 5DJ7A 3CENA 2ZCLP 2QY0B 1G3CA 3GISB 3U98H 1HAYB 1S0QA 2ZU5A 1FN8A 1XUHA 3RU4T 1GGDC 4AYVB 3MWIU 1L4ZA 4BTUB 2PLXA 1ID5H 1TBRH 1A3EH 3SQEE 4YM9A 1LHEH 1AFQB 1YPLH 2ESTE 3SUGA 1CE5A 1WU1A 5GWZA 4NFFA 4ZH8A 1LTOA 1UTPA 1TPOA 2VVUA 2Z3EA 2FODA 1PQ8A 1FUJA 3LGIA 1A1RA 3P6ZB 1SGDE 2FOCA 2I6SA 1WBGB 4ABJA 2ZHDA 2ZO3H 2ANMH 1AU8A 5DP5A 1GGDB 2HNTE 2BTCE 6GCHF 3OSYA 2QC2A 1NRRH 1UHBB 2BDIA 1GBEA 1BBRH 1G3EA 5FHTA 1C1OA 3BSQA 3L6PA 2BDBA 4E7NA 1OS8A 4X8TH 6LPRA 3A8DA 1H4WA 5IYTA 3PMHB 4Y7BA 3LOXA 3MU4A 2KAIA 5EPNA 1CT0E 1BB0B 2AMQA 3CP7A 2GDEH 3KNXA 1C5YB 1P05A 4X6PA 1GBIA 2RA3A 1AD8H 4I8GA 1ZMJA 1AE5A 2FWWA 5LPRA 5LPEA 2ILNA 2R2WU 1O3LA 3URDA 1QB6A 2FO9A 2B7DH 3MOCA 1V2UT 1EQ9A 4OS1A 2W3KA 1HIAB 5ETXA 1CU1A 1DLKB 1GMDF 2A5IA 1WYKA 3KL6A 3U1IB 3A7VA 1OWIA 3TK9A 3BF6H 2EI7A 1V6DA 4MVNA 3FP6E 1G30B 2O8UA 4FU7A 1OYTH 3GY7A 1P2OA 2A5KA 4WMFA 5T6GA 1BTHH 1LVBA 1RXPA 4TY6A 5FX6A 7GCHG 3GCHC 3HK6B 3VXEH 1GMDG 1P10A 2QN5T 1C2LA 2WPJS 2OC7A 1K2I1 2ZFRH 1TGTA 1WSSH 3UY9A 1GL1A 1SGRE 3A83A 1L0ZA 4IBLH 1BRBE 1S85A 1O35A 2ZPQA 1DPOA 1GBAA 1L2EA 4ISIH 4NGAH 1JOUB 2ZFQH 1O32A 1C2EA 2HPPH 5A8ZA 1SQTA 4AGJA 1UMAH 5HYOA 3T5FH 4B1TA 2A2QH 4UFDH 3MI4A 4GLYA 8LPRA 4F4OC 4INHA 1W10U 2PR3A 1FONA 1O3NA 1G32B 1V2QT 3NZIA 1ZRBA 4D76A 1IQEA 3DD2H 3QZQA 1BBRK 1O38A 1QCPA 1NRNH 3RXGA 3S7KB 2ZP0H 3TLOA 1EX3A 1HB0B 2GD4B 2BY8X 2ZI2H 2GMTC 5GDSH 3SUFA 1C1VH 3TIUA 3OU0A 3UTUH 4DY7B 3RMOH 4CRAA 3RUOA 1TNGA 2VWMA 3TJNA 2FOMB 1RS0A 5JYIA 7GCHF 1CGJE 1ZGIA 1LHCH 3UWJH 4ASHA 1Z6EA 1QBOA 5TCAA 1RD3B 1KXFA 2BDYA 3VB7A 1OX1A 1OWHA 5AFYH 3RMLH 1PQ7A 2ZA5A 4ZAEA 3GDUA 2JKHA 1AZ8A 3ZZDA 3PMJA 4M7GA 4O03A 1MU6B 1DITH 1IQJA 1CGHA 1GBCA 1XVMA 5AVDA 4BXWA 1J16A 1O3GA 1VJ9U 2A7HA 3PM3A 3BTGE 3R0FA 1HAPH 2FLBH 3QTVH 1EB2A 3DUXH 1O2UA 3UR9A 3SOSA 5JBCS 1ABIH 1S6HA 2QF3A 1W7XH 1P06A 1O31A 2OQ5A 4H4FA 1D6WA 4NA8A 5L6NH 5FCRA 1DUAA 2W3IA 1ETSH 1O33A 2C8WB 1WCZA 3RXDA 2PUXB 3LJOA 4A7IB 1INCA 3UIRA 1QA0A 2C3SA 2ZC9H 1F0SA 3ZVGA 2XBVA 1FV9A 1PYTC 1GJDB 2ALVA 3D23A 1DT2A 1UTNA 2V0BA 1BJVA 1PPCE 2GT7A 3TGKE 1KXEA 2BM2A 4NSYA 1B0FA 1Z1IA 4LK4A 2BQ7B 1A0JA 3Q76A 6CHAB 3U8OH 3RXVA 2O8TA 2V3HH 2ZTYA 3MTYA 2GTBA 1SBWA 1CT4E 2BDHA 2TGPZ 1O2GH 1DICA 2R0KA 1TA2A 3WY8A 1EZSC 1GJ9B 3A82A 1RTFB 5FPTA 1EP6A 4ABBA 4Y0ZE 1QGFA 1Z8GA 1KYNA 3Q3YA 1AVWA 1C2DA 1TFXA 1P12E 3B9FH 1H9HE 1GI0A 3RLYH 1W7GH 1F5KU 3N7OA 3M3TA 5DO4H 2XCFA 5BPEA 3TPIZ 5LH8A 4O3TA 1IQIA 2C4FH 3A7XA 1RTKA 1Q31A 2BVRH 2H5DA 1C2GA 1GBJA 1O30A 3JZ2B 4X2YA 3R3GB 3QDZB 2QIQA 1MQ6A 1TGCA 3E0NB 1C5UA 4GCHG 2M5TA 3GYMA 3BEFB 1S84A 1W14U 1LMWB 1C2IA 1V2ST 1VITG 5HM9A 5L30H 2OD3B 1P2KA 1V2KT 1V2PT 2Y82A 3M7QA 5SGAE 1AY6H 1MZDA 4K2YA 4TWYA 1ANBA 1F5LA 1SGPE 1EATA 1TQ0B 1ELDE 3ZVDA 2R9PA 1UJ1A 1AHTH 3GCHB 4Q7YA 1HUTH 1LHGH 1P3EA 2A4RA 2EC9H 3PO1B 2G5VA 1LPGB 1BA8B 4NWKA 1B0EA 2H9HA 1N8OC 1TRNA 4MLFB 5C67A 1Z8RA 1SGFG 1TWXB 1IQNA 1O34A 1GHBG 2AIQA 1ZSJA 2A1DB 1A2CH 1J14A 1P2NA 2ZHEH 1BMLA 1MKXH 2OQUA 2Z6BD 5AHGH 3UOUA 7ESTE 3S9BA 1C5ZB 4Q80A 2XC0A 1BTXA 1H9LB 4FU8A 2CXVA 1OWDA 2XNIA 3AVZA 1TIOA 4KTUA 2PKSB 2AGIX 1K21H 5E0JA 1XKAC 2ZGJA 1X7AC 1P11E 2ODPA 3TK6A 4TWWA 1YC0A 3SZNA 2IPHA 1UCYH 1NFWA 1J17T 3TGJE 1IQKA 2BVXH 3BEIB 1G2LA 3AAVA 1F7ZA 1A5HA 3LGYA 4DURA 5TJXA 2AGEX 2JETC 1XVOA 2FX6A 3E6PH 1DLEA 2ZU2A 1GBHA 3LJJA 4WH8A 3E8LA 1ZTJA 2BQWB 1EPTB 1SGEE 1G2MA 4RN6A 1QFKH 1VCWA 1RIWC 1GHWH 1BIOA 1CBWB 1ZTLA 1DOJA 1JRTA 1SGCA 4MNVA 3SV6A 1ZZZA 3P8OA 2CJIA 2GZ7A 2ZF0H 4ZKOU 1H8IH 2VIPA 3SUEA 1HBTH 1O5AB 3P8GA 2C8YB 1B7XB 3BTME 4B2BA 2P94A 2HNTF 3TK5A 4HI3A 3I78A 1MD7A 1GBDA 1BJUA 1NFXA 1EJMA 2TGDA 3EAJA 1O3IA 1GI6A 3GY4A 4AZ2B 2HWLB 2J38A 1SMFE 1XUFA 4WY3A 3AASA 3SNCA 3QWCH 1BT7A 1GJCB 1O5BB 1LKAA 3RXAA 7KMEH 2TPIZ 1KIGH 1YLDA 3O8RA 4FUFA 1YCPK 1ZMLA 2BX3A 3RXRA 2XWBI 2OBQA 1CSOE 1UCYK 1O2LA 1QQUA 1TONA 1VCPA 3SO3A 2CHAB 1HJAC 2G4UA 3FZDA 3HK3B 2AEIH 4AG2A 2ZDNA 1O3BA 4WJG2 4AB8A 3U69H 1YCPM 4INLA 1SFQB 1P57B 4FUHA 1P0SH 2Y7ZA 2NU2E 4A5TS 1HLTH 1Z7KA 4ISLA 5HGGA 1CHGA 3M35A 2BY5X 1SLUB 2H9TH 1RIWB 4LOYH 1M9UA 1BTYA 1HCGA 1GI9B 1ZSKA 4TY7A 1ELFA 4IW4E 1C2JA 2RG3A 2FYRA 2CGAA 2SFAA 1ZOMA 1TABE 1A46H 1TPSA 5EXNA 4ZHMU 1NN6A 1GCTC 4Y0YE 5DKMA 9ESTA 1V2JT 3ESTA 2YNBA 5E0HA 1F2SE 4IC6A 3RXBA 1AKSB 4WXIA 1NO9H 4ESTE 4OGYA 1F0RA 1O2JA 2QV1A 2QGRA 4ABHA 1AVXA 1UTLM 3V0XA 3RU4D 1YPKH 3ENSB 4ABEA 1MUEB 1KXDA 3MU0A 5A0CA 3LIWA 1EP5A 3C1KA 2BLVA 2BD4A 1TA6A 4AG1A 3RC4A 3F9FA 2VIOA 1TE0A 4FUGA 3RU4E 1HV7A 1FZZA 3ATLA 1XKBC 1YLCA 1UTKA 1BMAA 3MYWA 1RTLA 1TNLA 1F5RA 1DVAH 1GI1A 2AGGX 3O8CA 3VFEA 3FANA 1GJ4H 1THPB 2Z9IA 1MTNC 1ZHRA 4Q7ZA 3ZVAA 1O0DH 4QT8C 1O2SA 3QUMP 2Q6GA 1GI7B 1HDTH 2GGVB 5A0AE 2ZDAH 5EQRA 2RA0A 1JMOH 3BEUA 1D9IA 1GJ6A 4K1EA 1GBFA 1FAKH 2ZFTA 1C1TA 1FAXA 2H2ZA 4NZLA 1NU7B 1O2HA 1O5FH 2BMGB 1P3CA 1SFIA 2CF9H 2J9NA 1QL8A 4CH2B 1YPMH 1FY8E 3EYDA 4KP0A 3UNQA 2PW8H 1P02A 1RGQA 3MO3A 3VB5A 3SU0A 3P8FA 4H6SB 5JPMH 5C5OA 1BUIA 3P92A 1MTWA 1PJPA 3RXIA 3A7TA 3OX7U 3TJVA 4NZQA 3RDZA 4YTAA 2G8TA 1MTVA 1HRTH 2FDAA 1E37B 2XCNA 2G55A 2QAAA 2VWOA 3RXUA 3I29A 3ZV9A 3LH3A 1KDQB 2BYAX 3NCLA 1QJ7B 1YYY1 4I8JA 4WMEA 1HIAA 4Y7AA 4X8VH 5HM2A 5FX5A 2F9BH 1A4WH 2FMJA 3BTEE 1JRSA 3A7WA 3RXCA 1F0UA 2OC1A 4UD9H 1MD8A 1N6YA 3RXLA 3EGKH 4TPYA 4X6OA 3DA9B 5A2MH 1O3EA 1P04A 3ZZAA 4WMDA 3VXFH 1UK2A 1O5CB 1BRUP 1GHZA 2ULLA 2PV9B 2STBE 1S0RA 1DS2E 1BZXE 4R8TB 4U01A 2DUCA 1GDNA 2A7JA 1E35B 2NWNA 1NFYA 3D62A 4X8UH 3F9GA 4IGDA 3PMBB 1HNEE 1C4V2 4MDSA 5E8EH 1QQ4A 3CS0A 6CHAC 3E16B 3AW0A 4ABDA 8GCHG 1Y3WA 1GVZA 1C5WB 3SU3A 1Y3UA 1HYLA 4X1RU 2OUAA 3S9AA 1ELAA 3F1SB 1BRAA 2J95A 5FCKA 1HAOH 4VGCB 4I8KA 4MG3A 5EW2H 2WYGA 4X8SH 4AB9A 3BTFE 1LKBA 3U1JB 3T2NA 2IN2A 5FXLA 1BQYA 3UQOA 5IDKA 8GCHF 2V35A 1K1PA 3BTHE 1GHVH 1EAIA 2BY9X 2P3FH 1TMBH 2RCEA 3TNTA 1YBWA 3EA7A 2GZ8A 3QGJA 1ETRH 2V6NA 2OLGA 4GHQA 1ZRKA 2R3UA 1DUEA 2ZU3A 1SGIB 4A92A 4BXSA 2SGEE 1NC6A 1ANDA 1GJ7B 3M61U 2BD7A 1TNKA 3QO6A 5F8XA 1K1JA 1ESTA 4ZXXH 4IC5A 2HGTH 1LPZB 5C1YA 4GHTA 1V2VT 1O3AA 3SGQE 2D26C 1TX8A 1JIRA 3F6UH 3ZZ4A 1W8BH 2TGTA 3RXTA 4OS2A 2OCVB 1GVKB 2FYQA 4ABGA 3P95A 5EQSA 1SGYE 2FESH 2NU0E 4FUCA 3GCTG 1UO6A 2CMYA 1QA7A 1NRSH 1YPGH 1Z1JA 2TRMA 1CHOF 4XBDA 2GDDA 3HKIB 1J8AA 1P8VC 3GY5A 4F49A 2OC8A 5F8ZA 4CHAB 5ABWA 3SV9A 1DWEH 3A7ZA 1IQMA 2ZDVH 1XUIA 3A7YA 2BDCA 2NU1E 1AIXH 1ZGVA 2BOHB 1FY1A 1FDPA 1C1PA 3GCOA 1MTUA 3RC5A 5EOKA 1QL9A 1MBQA 4NSVA 2Y7XA 2BHGA 5AF9H 1O2WA 1Z71A 3DHKH 2TBSA 1BHXB 1OWKA 2JH0D 2ZKSA 1P9UA 3VB4A 1O3CA 1VZQH 1GMHF 1WTHD 2GP9B 2P8OB 4FUJA 5EQQA 3RXMA 3BTDE 2WV5A 3EA8A 1YPHC 1DSTA 1DY9A 3GCNA 1VJAU 3RXPA 1C1NA 1QURH 2BLOA 1NRPH 5A09A 3EA9A 1W0ZU 3A8AA 5I46H 3S7HB 1EJAA 3ZZ8A 4NIXA 2F91A 1BHXF 1OYQA 1O2KA 1XM1A 4GPGA 3RXHA 1W11U 1W2KH 3TH2H 1CGIE 3A84A 1BMMH 1UVTH 3HATH 4X1PU 3LGUA 1MCVA 4CR5A 4CRDA 3D65E 3RP2A 2A4GA 1JIMA 1O2OA 1IHTH 1UTQA 2QF0A 1AKSA 1LO6A 2GV7A 4AORA 2VIQA 3B23B 1SVPA 1Z8JB 4XBCA 1UK3A 1AN1E 1ELEE 3MH6A 5JBTA 3EQ0H 1P2JA 1KTSB 1O3MA 4OS7A 2VGCC 1QBVH 1BITA 2BD9A 3VGCB 1L4DA 1MH0A 4CBNA 4XSKU 3ZYEA 2B0FA 1TGBA 1SLWB 3RM2H 2WPMS 3FP8E 1EB1H 3LPRA 2BXTH 2BD5A 3FP7E 1DDJA 1TNHA 4NIVA 1C5VA 3BN9A 1AUJA 1ANEA 1Q2WA 2BDGA 5EXLA 1K28D 3A80A 2ALPA 2BX4A 1QRZA 2OC0A 3QN7A 2WV4A 3MFJA 1SGTA 2WYJA 4YOGA 4FXGH 1TAWA 2DE9A 3SJIA 3DT0H 2Z7FE 4BANB 3NKKA 1GPZA 1JWTA 3KGPA 1L1JA 5FPYA 2C93B 2UUFB 1C9PA 2ODQA 4AYYB 4B2CA 1FPHH 1SR5C 3GY3A 2PGQB 3ZZ6A 5DK1A 1C5SA 2AERH 1FY5A 1FY4A 4JZEH 1YPEH 2QYIA 1ZYOA 4INKA 3SNDA 4NIYA 4TPIZ 2P93A 4GUXA 4ZHLU 1GHXH 4RKJB 4KTCA 3EDXB 3SU2A 2WPKS 3UNSA 4VGCC 2PKSC 1O2PA 2JH5D 1SGQE 5JB8S 2VINA 1KLJH 1C2FA 2Z3DA 1ELGA 4E06H 2GKVE 3C27B 1WOFA 2ZDMA 1SB1H 2ZHFH 3K65B 2UWLA 1K1LA 4UDWH 4D8NA 3A8BA 3SHAH 3RXEA 4RKOB 5AFZH 1C2KA 1QRXA 4AFZA 3Q3XA 4Y8YA 1FNIA 3RLWH 4FVDA 4DT7B 2ZQ2A 3RXSA 1Y5AT 1T8NA 3JZ1B 3IG6B 2FS9A 2VIVA 2NU3E 2HALA 1WV7H 1DWCH 4BNRA 3TNSA 1CBWC 1KLIH 1SSXA 5A8YA 5LGOA 1AB9C 4DGJA 4A1XA 4LXBH 4AFUA 4YZUA 3QK1A 2ZDKA 3KQEA 3LH1A 3SGAE 5L2YH 4X1SU 3V13A 2XBYA 1WAYB 2XXLA 3FAOA 3STJA 3U9AH 1O39A 1GDUA 2PTNA 2FOFA 1SG8B 2PWXA 3ITIA 3E0PB 2F9PA 1CA0C 1HAZB 1S6FA 3K2UA 1FY3A 5K0HA 4XOJA 3SJKA 3SHCH 4B73A 1VCQA 4MNWA 1V2LT 2UUYA 4A1VA 2UUKB 3NXPA 2STAE 4Q7XA 1XMNB 3DFLA 4FUIA 1TBZH 2ZGHA 1KY9A 2VIDA 2A31A 1G9IE 2P3UB 5I25A 3KHVA 1JBUH 3U8TH 2GCHF 1CA8B 3D49H 4ZKNU 2C90B 2HVXA 3BG4C 4KTSA 4CRFA 3HGPA 3ATIA 1H9IE 2GVFA 4THNH 2JH6D 1V2TT 1KXCA 3MU5A 4O3UA 1ESAA 1YPHE 5DP7A 3SGBE 1P2IA 1W0YH 1GI8B 2AIPA 1O3DA 3FZZA 4ZMAH 4ZKRU 4IS5A 1O2TA 1BTZA 2WINI 1V2RT 2H5CA 5JBBS 3I77A 1T32A 1T4UH 2Q6FA 1TYNA 2WUBA 1AMHA 1W13U 3GDSA 1MTSA 1SL3A 3SBKA 1IQLA 1TBQH 4ISHH 3SV2H 3SI4H 1KXBA 3PMAB 1LQDB 3PO1C 2CF8H 3UREA 3M3VA 1MTNB 1GBBA 1OP2A 2J2UA 3H5CB 5GCHG 4CRCA 4NWLA 2A0QB 1FXYA 3PLPA 1A3BH 4K1SA 4E05H 2Y80A 4D9QA 2ZGBH 1UVUH 2A4QA 1FN6A 3T29A 4BAHB 4Z6AH 1CQQA 2A2XH 2Q6DA 1TNJA 1TQ7B 1XXFA 2C8ZB 1O3KA 1QIXB 2D8WA 3VPKA 2W7SA 4X1QU 1OPHB 1LQEA 1QB1A 1E36B 4CR9A 6ESTA 3VB6A 4ZXYH 3PWCA 2XC4A 1SQAA 3HKJB 2FOEA 1T8OA 1TALA 4NA7A 1NU9A 4YT7H 4FU9A 4OGXA 2WUCA 1TGSZ 1TOMH 3GICB 3T62A 1XXDA 3MNCA 1J15A 1GDQA 5K7RA 3SORA 1NM6A 2ZIQH 4ISOA 2PFEA 1K9OE 3BIUH 1K1MA 4MPUA 1C4Y2 5T6DA 2AS9A 1O2QA 1EAWA 2OTVA 4H42U 1K1OA 2VB0A 4I31A 5DP3A 3ZV8A 1BBRE 3GOVB 3KEEA 3SV8A 3SUDA 3TGIE 1GG6C 1K1NA 1IQGA 1GBLA 1TMTH 3A8CA 1QJ1B 3OYPA 2ZHWH 5HMAA 1GI3A 1Y8TA 4IN2A 1DFPA 4K60A 1RRKA 3NPSA 4CRBA 1UTOA 2VVVA 3M7UA 1O2XA 1VGCC 1ELCA 3KQDA 1O37A 1S82A 2FZZA 3BIVH 3MNSA 2AH4X 2PHBA 4AFQA 1A5GH 1XUJA 5C5NA 5BRRE 1ZHPA 1Q3XA 5A0BA 5EU8A 4UEHH 5L2ZH 1O2MA 4JYTA 2K1QA 3BTWE 1PPEE 1AB9B 1FI8A 1D3TB 3E90B 3SU1A 4JCNA 1YCPH 1PPHE 3T28A 1NS3A 4YOJA 5JB9S 2J92A 2F83A 8KME2 1ZTKA 5J4SA 2Y5GA 3V12A 1WQVH 4DIHH 4FUEA 1O3HA 1TRYA 1GCTB 1GI5A 2CN0H 1L1GA 1FPCH 1GI2A 5FPSA 4J1YA 2ZFPH 3RXJA 1E38B 1QY6A 3SW2B 3K6YA 3GDVA 1RFNA 1ABJH 5H4IB 2D1JA 1J9CH 1MZAA 1NZQH 1YM0A 2ZU4A 3G01A 4B2AA 5C3NA 4K5ZA 4I32A 3H7OA 1H1BA 2Z94A 4BAQB 2Q1JA 1MMJN 4X2WA 3W94A 4UFFH 1MKWH 1UVPA 3MO9A 5E2PA 1FLEE 2GT8A 5GIBA 1ELVA 2SGPE 2UWPA 1EAUA 1P01A 1NRQH 3URCA 1QJ6B 2OINA 3UNRA 1GL0E 1PPGE 2UUJB 1KLTA 3UQVA 5F03A 1C5TA 5C1XA 3ZVFA 4MNYA 1L1NA 3SNEA 1IOEA 3MO6A 2SGQE 3KIDU 2D2DA 3Q00A 2XYAA 5E0GA 1WQSA 1ZR0A 3ZZCA 2J4IA 7LPRA 1H8DH 1EPTA 3M5OA 1OWJA 5E2OA 2G5NA 1V2WT 3BV9B 2ZFSA
chains in the Genus database with same CATH superfamily
3P70B 1TGNA 2EEKA 2OXSA 3AW1A 3ZZ5A 4UFEH 1WDIA 1D3QB 3SJOA 3V7TA 4FVBA 3T26A 1EXFA 2ZDLA 3ODFA 2ZEBA 4JYVH 3OE7D 4X1NU 4B75A 3AAUA 3F3BA 4YLQH 3ZVCA 1EOJA 1GHAG 3UWIA 1HAIH 4RT0A 3IITA 5B6OA 1C5LH 2FEQH 3CS7A 3TH4H 1NROH 3LDXH 4HGCA 5T3HA 5FBIA 1QB9A 3STIA 1GMHG 1C5XB 1A0HB 5J4QA 1SI5H 1GMCG 4A1TA 4OS6A 3OY6U 2ZCKP 3A81A 1V2MT 2FTMA 3RXFA 2A4OA 2FX4A 1DXPA 2PUQH 4RI0A 1MKXK 1IAUA 1ZHMA 3S0NA 2A32A 1C1QA 4AN7A 1GWAA 1YGCH 1JXPA 2P59A 2XBXA 4IMQA 5JDUB 2PKAA 3E3TA 3BTQE 5A8XA 2QCYA 1ETTH 1DXWA 4UONA 5DP9A 1TB6H 2C8XB 3T25A 3Q77A 1T8LA 1DX5M 4A6LA 3BTKE 4O9VA 1BCUH 2Z9GA 2P16A 3ZZ9A 2EY4C 2BDAA 2Z9JA 4MPVA 1NTPA 1GHAF 2XRCA 1NPMA 3H7TA 1O5EH 1HJ9A 3TJUA 1GBMA 2VH6A 3UPEA 4GVUA 1OKXA 1YWUA 4ISNA 4BTTB 3PYHA 9LPRA 3S69A 1C5OH 3QZRA 3GYLB 2TGAA 1GHYH 2JJ2D 1F0TA 3PROA 1ZPZA 1VITH 1OWEA 4I7YH 4ABIA 3WWFA 3A89A 1AO5A 4KELA 4J2YB 1BTWA 4DW2U 1YP9A 1UTJA 2CHAC 3GY2A 2OP9A 5B6LA 1KSNA 1HAGE 1S5SA 5EODA 3KN2A 3L3TA 1PQ5A 4YOIA 4X6NA 1T4VH 5G4BA 2PTCE 1LVMA 1SLVB 5GPIB 1TPPA 3OY5U 5TCCA 2EI8A 3PB1E 1YKTA 1AUTC 1TX6A 2AMPA 2J94A 1O3FA 2BVSH 3LKWA 3ATMA 1HAVA 3TITA 1WTGH 3MHWU 3SU5A 3ZVEA 1FQ3A 3MMGA 4JYUH 3M7TA 1GJBB 2ZPSA 2KAIB 3M3SA 2VBCA 1BRCE 4HFPB 1SGNE 3KF2A 2SGFE 1DWDH 3PLKA 5F8TA 1N6XA 2BLWA 3AK5A 3BG4B 3MNBA 3KQBA 2BD8A 1HAVB 4KKDA 1SC8U 3DFJA 4D7FA 1FJSA 1Y3YA 1O3JA 4XRNA 4YO9A 1GBTA 2VVCA 2W7UA 2O8WA 3LC5A 4Y10E 2FOBA 4IN1A 2PSXA 1UK4A 2W26A 2QXJA 5FBEA 4GAWA 4BAKB 3A85A 1IQFA 2BY6X 4JK5A 2A7CA 2G4TA 1PPFE 5DG6A 1CHOG 5CE1A 1MAYA 2GCTC 3A87A 3LT3A 3PRDA 2XW9A 5GXPA 1P03A 2RDEA 5GJ4B 2YOLA 4DT4A 3H09A 3RXKA 4AX9H 3A88A 2WPHS 2EA3A 4NFEA 4AFSA 2SGAA 3K9XB 1C2MA 1UW7A 3K6ZA 4X0WU 4HZHA 2SNWA 1K1IA 1HJ8A 4D9RA 4BAOB 4ABFA 2V3MA 3PTNA 1TNIA 4I8HA 2FI4E 3SU4A 1C1MA 3FVFB 2HLCA 1V2OT 5EW1H 1DANH 3DSPA 1TX7A 3M5NA 1AE8H 3ZVBA 5PTPA 4LZ1H 3RMNH 1HJAB 1CT2E 3E1XB 1G3BA 1TLDA 4DG4A 5C1UA 3S9CA 1XUGA 2WPIS 3SU6A 2THFB 4E7RG 1QTFA 3F9HA 2BQ6B 4YT6H 3UUZA 2QXHA 2ODYB 3B8JA 4ZKSU 3SQHE 1DWBH 1O36A 1DY8A 3UR6A 5KGOA 2ZCHP 1EKBB 4WWYA 2GCHG 4Y11E 2BXUH 3SNAA 2G51A 4BAMB 5LPFA 3W1EA 5JBAS 4Y76A 2Y6TA 5CHAC 5DGJA 4BTIB 1MKWK 3SI3H 1SHHB 1VITF 2SGDE 4NIWA 5EG4A 2ZQ1A 4Y6DA 2B9LA 2QXGA 1A7SA 1ORFA 1Z8IB 1ACBE 1GG6B 4JZ1A 1SHYA 2HRVA 4R0IA 4NA9H 1PPBH 2WPLS 4AGKA 1BDAA 4X2XA 4WF8A 1MU8B 1NFUA 4GSOA 4I33A 1FIZA 2Z9LA 3VB3A 1OOKB 1ZLRA 1QHRB 4I8LA 1HXFH 1O2VA 2M2AA 1QBNA 2B5TB 2IJOB 3P17H 3NRLA 1C4U2 3V3MA 1DM4B 1GI4A 1N8OB 2QA9E 1ELTA 1A61H 1GHBF 1Y5UT 2JETB 1P9SA 2EQNA 1ARBA 4SGBE 1D6RA 1WUNH 1LCYA 3SNBA 2YNAA 1C5PA 2AYWA 3A86A 4X2VA 2BD3A 2HOBA 2Y5FA 1B5GH 3ZYDA 2BZ6H 1D4PB 1UCYE 2EI6A 2ZFFH 1LVYA 2J34A 4FUDA 5DP8A 3PWBA 5DPAA 2ZG0H 3RXOA 1SQOA 1P2QA 1C5MD 2VWNA 1PFXC 2YMSB 3LGVA 1PYTD 4KGAA 1D3DB 1V3XA 2VWLA 2GV6A 4ACAA 1TOCB 2ZPRA 3ATWA 1N1LA 2ZWLH 3EE0B 4OS4A 1XX9A 4Z0KA 1C5RA 3L33A 2BLQA 2TIOA 4JZIA 1LHDH 4ZHAA 2W5EA 1E1RD 3KCGH 1HFDA 1KXAA 3F9EA 1GJ5H 1S81A 2WSSD 2QXIA 2XBWA 2HVYB 2F3CE 3VEQB 2ZGXH 3QX5H 1EASA 2XC5A 2Z3CA 4ZCNA 2G52A 3PV4A 2XTTB 4DVAU 2I6QA 4MPXA 1E34B 3MH5A 3ELAH 1T31A 1F92A 2OBOA 1T8MA 4JZFH 2BY7X 1LVOA 2R3YA 1K22H 1SOTA 4O97A 6GCHG 2O9QA 2FM2A 1EAXA 1THSH 3ATKA 4UE7H 1GVLA 1UVSH 2F9UA 1W12U 1O2IA 4XE4A 3MH7A 1Y59T 3F0PA 5T6FA 3QGNB 3E91A 3LGWA 3SJ8A 1O2ZA 1CO7E 4XFQA 1Y3VA 2DE8A 3FFGA 3MU1A 1ZPBA 3OTJE 4CH8B 1YF4A 4JMYA 3M37A 3TJOA 3SN8A 5C20A 1MBMA 2FOHA 3M36A 3NUMA 1AVGH 1SPJA 1ZMNA 3LC3A 3QLPH 1BOQA 5EPYA 1NESE 1SOZA 1CA0B 1AQ7A 4PROA 3ODDA 2ZU1A 3O8DA 1UTMA 1HXEH 1T7CA 1BTPA 1AGJA 3RC6A 1LHFH 1G37A 1AWHB 1TRMA 2H6MA 2Z9KA 1S83A 2R2MB 3UB0A 1OSSA 1MAXA 4NCYA 4CREA 4XD7D 1OP8A 2JDID 4X6MA 5EGMA 5KEDA 5CHBA 4MTBA 3TVJB 1VGCB 2FS8A 5EXMA 1E0FD 1O2RA 1ZJKA 1IQHA 1Y5BT 4GCHF 4CBOA 1EUFA 1W3CA 3P8NA 1O2YA 2HPQH 1GMCF 4Y8ZA 2AFQB 2BD2A 3U8RH 2FXRA 5F6MA 2ASUB 2VJ1A 4LZ4B 4OS5A 3LU9B 2PKAB 4YESB 1HAXB 1C5QA 1UVOA 4WVPE 2FP7B 4U30A 5CHAB 3TU7H 4YLUA 2ZZUH 2F9NA 2RDLA 3MH4A 3SV7A 2AMDA 3OTPA 4UFGH 3T27A 1A0LA 3ZZ3A 2ZTXA 1VR1H 2F9OA 2ANWA 2VU8E 3RM0H 1EJNA 1SLXB 2PGBB 1RJXB 1AI8H 2B8OH 4K8BA 2A45B 2VNTA 4DJZB 1G3DA 1COWD 4BOHA 1MCTA 4K69A 3M5LA 2YMSD 1PPZA 5HXFA 1C1UH 1U6QA 2VH0A 5GCHF 2ZGCA 4XDEA 1YPJH 2WV9A 3M5MA 2FLRH 1QL7A 1IHSH 3GY8A 3VG8A 1C2HA 4U2WA 1ANCA 2H1UA 1O5DH 1O3PB 1XUKA 4ABAA 1ARCA 1LDTT 3BG8A 3NWUA 3F68H 4CRGA 2ZHQH 4B76A 3HGNA 3LONA 4DIIH 2V3OH 1PQAA 1EZQA 4FUBA 4XBBA 1EZXC 1TMUH 5ESTE 1D3PB 1EOLA 3RXQA 1C1RA 1AZZA 3PLBA 4AOQA 1KTTB 3PTBA 4RSPA 4DOQA 1HGTH 2K8IA 1LPKB 4K3JA 1EPTC 1HAHH 1NT1A 2FI3E 3CNRA 4MQAA 2HNTC 2G81E 1ESBA 2PSYA 4CHAC 2BB4A 4SGAE 2Y5HA 4NG9H 4K8YA 5T1VA 1QRWA 3DSGA 2ANKH 1P2MA 1QNJA 4K1TA 1ELBA 1O5GH 3Q3KA 1EZUC 4Y71A 3DSOA 3SJ9A 4B74A 1MQ5A 1ZJDA 2BOKA 1C9TA 1GBKA 1HPGA 3UOPA 2LPRA 3ZIAD 4D7GA 2VIWA 2KCOA 4TYDA 2H9EH 1FIWA 1DSUA 2UWOA 1FMGA 1GCDA 1OP0A 4Y79A 5CMXH 2P8OC 1GJAB 3O8BA 1TPAE 3ZZBA 1A5IA 1AWFH 8ESTE 2Y81A 4JK6A 4B6EA 3MU8A 1E1QD 1P09A 2VGCB 5C2ZA 4DCDA 1C1WH 1AFQC 2KFWA 2ZECA 2LNCA 2ZNKH 1O3OA 4Y8XA 5ESBA 1ZSLA 4B71A 3KQCA 4ZROA 2ANYA 3MNXA 1UHBA 1THRH 1NY22 2A5AA 2GMTB 4ZUHA 1BMNH 2ZTZA 1O2NA 2NU4E 1DE7H 4MPWA 3ZZ7A 4U32A 4WXVA 2FTLE 5DP4A 2FOAA 2GX4A 2FPZA 4WH6A 4H6TA 3LGTA 1BTUA 3TH3H 5FAHA 3W95A 2BZAA 2O8MA 4HTCH 1SGFA 2FIRH 2P3TB 1QR3E 2FI5E 2CV3A 2IOTA 5C17A 3NK8A 1C5NH 2R0LA 2GZ9A 3RMMH 4JZDH 3GCTF 4MNXA 1G36A 1Z6JH 5F53A 3GY6A 1CVWH 1V2NT 2G00A 3VGCC 3QTOH 1OXGA 3IWMA 3HPTB 1KDQA 2O8LA 2WZQA 2XWAA 3UFAA 1AFEH 2SNVA 1C1SA 2P95A 4IMZA 4Q2KA 1Y3XA 2GCTB 1GJ8B 2F9VA 3N7DA 1ZPCA 3BTTE 2FOGA 5DP6A 5DJ7A 3CENA 2ZCLP 2QY0B 1G3CA 3GISB 3U98H 1HAYB 1S0QA 2ZU5A 1FN8A 1XUHA 4FETA 3RU4T 1GGDC 4AYVB 3F2HA 3MWIU 3FO8D 1L4ZA 4BTUB 2PLXA 1ID5H 1SQRA 1TBRH 1A3EH 3SQEE 4YM9A 1LHEH 1AFQB 1YPLH 2ESTE 3SUGA 1CE5A 1WU1A 5GWZA 4NFFA 4ZH8A 1LTOA 1UTPA 1TPOA 2VVUA 2Z3EA 2FODA 1PQ8A 1WXRA 1FUJA 3LGIA 1A1RA 3P6ZB 1SGDE 3MQKC 2FOCA 2I6SA 1WBGB 4ABJA 2ZHDA 2ZO3H 2ANMH 1AU8A 5DP5A 1GGDB 2HNTE 2BTCE 6GCHF 3OSYA 2J98B 2QC2A 1NRRH 1UHBB 2BDIA 1GBEA 1BBRH 1G3EA 5FHTA 1C1OA 3BSQA 3L6PA 2BDBA 2J97A 4E7NA 2CK3D 1OS8A 1SKYE 4X8TH 6LPRA 3A8DA 1H4WA 5IYTA 3PMHB 4Y7BA 3LOXA 3MU4A 2KAIA 4TT3D 5EPNA 1CT0E 1NBMD 1BB0B 2AMQA 3CP7A 1H8HD 2GDEH 3KNXA 1C5YB 1P05A 4X6PA 1GBIA 2RA3A 3WW7A 1AD8H 2L6OA 4I8GA 2XNDD 1ZMJA 1AE5A 2FWWA 5LPRA 5LPEA 2ILNA 2R2WU 1O3LA 3URDA 4TSFD 1QB6A 2FO9A 2B7DH 3MOCA 1V2UT 1EQ9A 4OS1A 2W3KA 1HIAB 5ETXA 1CU1A 1DLKB 1GMDF 2A5IA 1WYKA 3KL6A 3U1IB 3A7VA 1OWIA 3TK9A 3BF6H 2EI7A 1V6DA 4MVNA 3FP6E 1G30B 2O8UA 4FU7A 1OYTH 4P00A 3GY7A 2KM0A 1P2OA 3FKSD 2A5KA 4WMFA 5T6GA 1BTHH 1LVBA 1RXPA 4TY6A 5FX6A 7GCHG 3GCHC 3HK6B 3VXEH 1GMDG 5EJZA 1P10A 2QN5T 1C2LA 2WPJS 2OC7A 1K2I1 2ZFRH 1TGTA 1WSSH 3UY9A 1GL1A 4AC9A 1SGRE 3A83A 1L0ZA 4IBLH 1BRBE 1S85A 2KZ4A 1O35A 2ZPQA 1DPOA 1GBAA 1L2EA 1OHHD 4ISIH 4NGAH 1JOUB 2ZFQH 1O32A 1C2EA 2HPPH 5A8ZA 1SQTA 2F4LA 4AGJA 1UMAH 5HYOA 3T5FH 4B1TA 2A2QH 4UFDH 3MI4A 4GLYA 8LPRA 4F4OC 4INHA 1W10U 2PR3A 1FONA 1O3NA 1G32B 1V2QT 3NZIA 1ZRBA 4D76A 1IQEA 2KCAA 3DD2H 2JIZD 1BBRK 3QZQA 1O38A 1QCPA 1NRNH 3RXGA 3S7KB 2ZP0H 3TLOA 1EX3A 1HB0B 2GD4B 2BY8X 2ZI2H 2GMTC 5GDSH 3SUFA 1C1VH 1KMHB 3TIUA 3OU0A 3UTUH 4DY7B 3RMOH 4CRAA 3RUOA 1TNGA 2VWMA 3TJNA 2FOMB 1RS0A 5JYIA 7GCHF 1CGJE 1ZGIA 1LHCH 3UWJH 4ASHA 1Z6EA 1QBOA 5TCAA 1RD3B 1KXFA 2BDYA 3VB7A 1OX1A 1OWHA 5AFYH 3RMLH 1PQ7A 2ZA5A 4ZAEA 3GDUA 2JKHA 1AZ8A 3ZZDA 3PMJA 4M7GA 4O03A 1MU6B 1DITH 1IQJA 1CGHA 1GBCA 1XVMA 5AVDA 4BXWA 1J16A 1O3GA 1VJ9U 2A7HA 1W0KD 3PV2A 3PM3A 3BTGE 3R0FA 1HAPH 2FLBH 3QTVH 1EB2A 3DUXH 1O2UA 3UR9A 3SOSA 5JBCS 1ABIH 1S6HA 2QF3A 1W7XH 1P06A 1O31A 2OQ5A 4H4FA 1D6WA 4NA8A 5L6NH 5FCRA 1DUAA 1ETSH 2C8WB 1O33A 2W3IA 1WCZA 3RXDA 2PUXB 3LJOA 4A7IB 1INCA 3UIRA 1QA0A 2C3SA 2ZC9H 1F0SA 3ZVGA 2XBVA 1FV9A 1PYTC 1GJDB 2ALVA 3D23A 1DT2A 1UTNA 2V0BA 1BJVA 1PPCE 2GT7A 3TGKE 1KXEA 2BM2A 4NSYA 5EJLA 1B0FA 1Z1IA 3OFND 2BQ7B 4LK4A 5C0UA 1A0JA 3Q76A 6CHAB 3U8OH 3RXVA 2O8TA 2V3HH 5GNDA 2ZTYA 3MTYA 2GTBA 1SBWA 1CT4E 2BDHA 2TGPZ 1O2GH 1DICA 2R0KA 1TA2A 3WY8A 1EZSC 1GJ9B 3A82A 1RTFB 5FPTA 1EP6A 4ABBA 4Y0ZE 1QGFA 2F43B 1Z8GA 1KYNA 3Q3YA 1AVWA 4P02A 1C2DA 1TFXA 1P12E 3B9FH 1H9HE 1GI0A 3RLYH 2RFKC 1W7GH 1F5KU 3N7OA 3M3TA 5DO4H 2XCFA 5BPEA 3TPIZ 5LH8A 4O3TA 1IQIA 2C4FH 3A7XA 1RTKA 1Q31A 2BVRH 2H5DA 1C2GA 1GBJA 1O30A 3JZ2B 4X2YA 3R3GB 3QDZB 2QIQA 1MQ6A 1TGCA 3E0NB 1C5UA 4GCHG 2M5TA 3GYMA 3BEFB 1S84A 1W14U 1LMWB 1C2IA 1V2ST 1VITG 5HM9A 5L30H 2OD3B 1P2KA 1V2KT 1V2PT 2Y82A 3M7QA 5SGAE 1AY6H 1MZDA 4K2YA 4TWYA 1ANBA 1F5LA 3EE7A 1SGPE 1EATA 1TQ0B 1ELDE 3ZVDA 2R9PA 1FX0B 1UJ1A 1AHTH 3GCHB 4Q7YA 1HUTH 2WHXA 1LHGH 1P3EA 2A4RA 2EC9H 3PO1B 2G5VA 1LPGB 1BA8B 4NWKA 1B0EA 2H9HA 1N8OC 1TRNA 4MLFB 5C67A 1Z8RA 1SGFG 1TWXB 1IQNA 1O34A 1GHBG 2AIQA 1ZSJA 2A1DB 1A2CH 1J14A 1P2NA 2ZHEH 1K0HA 1BMLA 1MKXH 2OQUA 2Z6BD 5AHGH 3UOUA 7ESTE 2PP6A 3S9BA 1C5ZB 4Q80A 2XC0A 1BTXA 1H9LB 4FU8A 2CXVA 1OWDA 2XNIA 3AVZA 1TIOA 4KTUA 2PKSB 2AGIX 1K21H 5E0JA 1XKAC 2ZGJA 1X7AC 1P11E 2ODPA 3TK6A 4TWWA 1YC0A 3SZNA 2IPHA 1UCYH 1NFWA 1J17T 3TGJE 1IQKA 2BVXH 3BEIB 1G2LA 3AAVA 1F7ZA 1A5HA 3LGYA 4DURA 5IK2D 2YMSC 5TJXA 2AGEX 2JETC 1XVOA 2FX6A 3E6PH 1DLEA 2ZU2A 1GBHA 3LJJA 4WH8A 3E8LA 1ZTJA 2BQWB 1EPTB 1SGEE 1G2MA 4RN6A 1QFKH 1VCWA 1RIWC 1GHWH 1BIOA 1CBWB 4HG6A 1ZTLA 1DOJA 1JRTA 1SGCA 4MNVA 3SV6A 1ZZZA 3P8OA 2CJIA 2GZ7A 4FOUC 2XOKD 2ZF0H 1H8IH 4ZKOU 2VIPA 3SUEA 1HBTH 1O5AB 3P8GA 2C8YB 1B7XB 3BTME 4B2BA 2P94A 2HNTF 3TK5A 4HI3A 3I78A 1MD7A 1GBDA 1BJUA 1NFXA 1EJMA 2TGDA 3EAJA 1O3IA 1GI6A 3GY4A 4AZ2B 5KECA 2HWLB 2J38A 1SMFE 1XUFA 4WY3A 3AASA 2WPDD 3SNCA 3QWCH 1BT7A 1GJCB 1O5BB 1LKAA 3RXAA 7KMEH 2TPIZ 1KIGH 1YLDA 3O8RA 4FUFA 1YCPK 1ZMLA 2BX3A 3RXRA 2XWBI 2OBQA 1CSOE 1UCYK 1O2LA 1QQUA 1TONA 1VCPA 3SO3A 2CHAB 1HJAC 2G4UA 3FZDA 3HK3B 2AEIH 4AG2A 2ZDNA 1O3BA 4WJG2 4AB8A 3U69H 1YCPM 4INLA 1SFQB 1P57B 4FUHA 1P0SH 2Y7ZA 2NU2E 4A5TS 1HLTH 1Z7KA 4ISLA 5HGGA 1CHGA 3M35A 2BY5X 1SLUB 2H9TH 1RIWB 3FOAA 4LOYH 1M9UA 5HIZA 1BTYA 1HCGA 1GI9B 1ZSKA 4TY7A 1ELFA 4IW4E 1C2JA 2RG3A 2FYRA 2CGAA 2SFAA 1ZOMA 1TABE 1A46H 1TPSA 5EXNA 4ZHMU 1NN6A 1GCTC 4Y0YE 5DKMA 9ESTA 1V2JT 3ESTA 2YNBA 5E0HA 1F2SE 4IC6A 3RXBA 1AKSB 4WXIA 1NO9H 4ESTE 4OGYA 1F0RA 1O2JA 3KQ5A 2QV1A 2QGRA 4ABHA 1AVXA 4Z1MD 1UTLM 3F2GA 3V0XA 3RU4D 1YPKH 3ENSB 4ABEA 1MUEB 1KXDA 3MU0A 5A0CA 3LIWA 1EP5A 3C1KA 2BLVA 2BD4A 1TA6A 4AG1A 2OK5A 3F9FA 3RC4A 2VIOA 1TE0A 1W0JD 4FUGA 3RU4E 1HV7A 1FZZA 3ATLA 1XKBC 1YLCA 1UTKA 1BMAA 3MYWA 1RTLA 1TNLA 1F5RA 1DVAH 1GI1A 2AGGX 3O8CA 3VFEA 3FANA 1EFRD 1GJ4H 1THPB 2Z9IA 1MTNC 1ZHRA 4Q7ZA 3ZVAA 1O0DH 4QT8C 1O2SA 2GJGA 2J5UA 3QUMP 2Q6GA 1GI7B 1HDTH 2GGVB 2LP6A 5A0AE 2ZDAH 5EQRA 2RA0A 1JMOH 3BEUA 1D9IA 1GJ6A 4K1EA 1GBFA 1FAKH 2ZFTA 1C1TA 1FAXA 2H2ZA 2KX4A 4NZLA 1NU7B 1O2HA 1O5FH 2BMGB 1P3CA 1SFIA 2CF9H 2J9NA 1QL8A 4CH2B 1YPMH 4B6FA 1FY8E 3EYDA 4KP0A 3UAIC 3UNQA 2PW8H 1P02A 1RGQA 3MO3A 3VB5A 3SU0A 3P8FA 4H6SB 5JPMH 5C5OA 1BUIA 3P92A 1MTWA 1PJPA 3RXIA 3A7TA 3OX7U 1MABB 3TJVA 4NZQA 3RDZA 4YTAA 2G8TA 1MTVA 1HRTH 2FDAA 1E37B 2XCNA 2G55A 2QAAA 2VWOA 3RXUA 3I29A 3ZV9A 3LH3A 1KDQB 2BYAX 3NCLA 1QJ7B 1YYY1 2KR7A 4I8JA 2QF4A 4WMEA 1HIAA 4Y7AA 4X8VH 5HM2A 5FX5A 2F9BH 4RT1A 1A4WH 2FMJA 3BTEE 1JRSA 3A7WA 1YLNA 3RXCA 1F0UA 2OC1A 4UD9H 1MD8A 1N6YA 3RXLA 3EGKH 4TPYA 4X6OA 3DA9B 5A2MH 2LELA 1O3EA 3F0OA 1P04A 3ZZAA 4WMDA 3VXFH 1UK2A 1O5CB 1BRUP 1GHZA 2ULLA 2PV9B 2STBE 1S0RA 1DS2E 1BZXE 4R8TB 4U01A 2DUCA 1GDNA 2A7JA 1E35B 2NWNA 1NFYA 3D62A 4X8UH 3F9GA 4IGDA 3PMBB 5C0TA 1HNEE 1C4V2 4MDSA 5E8EH 1QQ4A 3CS0A 6CHAC 2W6ID 3E16B 1S6LA 4F55A 3AW0A 4ABDA 8GCHG 1Y3WA 1GVZA 1C5WB 3SU3A 1Y3UA 1HYLA 4X1RU 2OUAA 3S9AA 1ELAA 3F1SB 1BRAA 2J95A 5FCKA 1HAOH 4VGCB 4I8KA 4MG3A 5EW2H 2WYGA 4X8SH 4I86A 4AB9A 3BTFE 1LKBA 3U1JB 3T2NA 2IN2A 5FXLA 1BQYA 3UQOA 5IDKA 8GCHF 2V35A 2QF5A 1K1PA 3BTHE 1GHVH 1EAIA 2BY9X 2P3FH 1TMBH 2RCEA 3TNTA 3OAAD 1YBWA 3EA7A 2GZ8A 3QGJA 1ETRH 2V6NA 2OLGA 4GHQA 1ZRKA 2R3UA 1DUEA 2ZU3A 1SGIB 4A92A 4BXSA 2SGEE 1NC6A 1ANDA 1GJ7B 3M61U 2BD7A 1TNKA 3QO6A 5F8XA 2L74A 1K1JA 1ESTA 4ZXXH 4IC5A 2HGTH 1LPZB 5C1YA 4GHTA 1V2VT 1O3AA 3SGQE 2J98A 2D26C 1TX8A 1JIRA 3F6UH 3ZZ4A 1W8BH 2TGTA 3RXTA 4OS2A 2OCVB 1GVKB 2FYQA 4ABGA 3P95A 5EQSA 1SGYE 2FESH 2NU0E 4FUCA 3GCTG 1UO6A 2CMYA 1QA7A 1NRSH 1YPGH 3N7EA 1Z1JA 2TRMA 4YXWD 1CHOF 4XBDA 2GDDA 4ASUD 3HKIB 1J8AA 1P8VC 3GY5A 2HLDD 2OC8A 4F49A 5F8ZA 4CHAB 5ABWA 3SV9A 1DWEH 3A7ZA 1IQMA 2ZDVH 1XUIA 3A7YA 2BDCA 2NU1E 5DSFA 1AIXH 3F2FA 5FL7D 1ZGVA 2BOHB 3WWBA 1FY1A 1FDPA 1C1PA 3GCOA 3U28C 1MTUA 3RC5A 5EOKA 1QL9A 1MBQA 4NSVA 2Y7XA 2BHGA 5AF9H 1O2WA 4Q4LA 1Z71A 3DHKH 2TBSA 1BHXB 1OWKA 2JH0D 2ZKSA 1P9UA 3VB4A 1O3CA 1VZQH 1GMHF 1WTHD 2GP9B 2P8OB 4FUJA 5EQQA 3RXMA 3BTDE 2WV5A 3EA8A 1YPHC 1DSTA 1DY9A 3GCNA 3N99A 1VJAU 3RXPA 1C1NA 1QURH 2BLOA 1NRPH 5A09A 3EA9A 1E79D 1W0ZU 3A8AA 5I46H 3S7HB 1EJAA 3ZZ8A 4NIXA 2F91A 1BHXF 1OYQA 1O2KA 1XM1A 4GPGA 3RXHA 1W11U 1W2KH 3TH2H 1CGIE 3A84A 1BMMH 5EJ1A 1UVTH 3HATH 4X1PU 3LGUA 1MCVA 4CR5A 5EIYA 4CRDA 3D65E 3RP2A 2A4GA 1JIMA 1O2OA 1IHTH 1UTQA 2QF0A 2W6JD 1AKSA 1LO6A 2GV7A 4AORA 2VIQA 3B23B 1SVPA 1Z8JB 4XBCA 1UK3A 1AN1E 1ELEE 3MH6A 5JBTA 3EQ0H 1P2JA 1KTSB 1O3MA 4OS7A 2VGCC 1QBVH 1BITA 2BD9A 3VGCB 1L4DA 1MH0A 4CBNA 4XSKU 3ZYEA 2B0FA 1TGBA 1SLWB 3RM2H 2WPMS 3FP8E 1EB1H 3LPRA 2BXTH 2BD5A 3FP7E 1DDJA 1TNHA 4NIVA 1C5VA 3BN9A 1AUJA 1ANEA 1Q2WA 2BDGA 5EXLA 1K28D 3A80A 2ALPA 2BX4A 1QRZA 2OC0A 3QN7A 2WV4A 3MFJA 1SGTA 2WYJA 4YOGA 4FXGH 1TAWA 2DE9A 3SJIA 3DT0H 2Z7FE 4BANB 3NKKA 1GPZA 1JWTA 3KGPA 1L1JA 5FPYA 2C93B 2UUFB 1C9PA 2ODQA 4AYYB 4B2CA 1FPHH 1SR5C 3GY3A 2PGQB 3ZZ6A 5DK1A 1C5SA 2AERH 1FY5A 1FY4A 4M9FA 4JZEH 1YPEH 2QYIA 4Q63A 1ZYOA 2K0QA 4INKA 4NIYA 3SNDA 4TPIZ 2P93A 4GUXA 4ZHLU 1GHXH 4RKJB 4KTCA 3EDXB 3SU2A 2WPKS 3UNSA 4VGCC 2PKSC 1O2PA 2JH5D 1SGQE 5JB8S 2VINA 1KLJH 1C2FA 1H8ED 2Z3DA 1ELGA 4E06H 2GKVE 3GS9A 3C27B 1WOFA 2ZDMA 1SB1H 2ZHFH 3K65B 2UWLA 1K1LA 4UDWH 4D8NA 3A8BA 3SHAH 3RXEA 4RKOB 5AFZH 5HKKD 1C2KA 1QRXA 4AFZA 3Q3XA 4Y8YA 1FNIA 3RLWH 4FVDA 4DT7B 2ZQ2A 3KYFA 1Y5AT 3RXSA 1T8NA 3JZ1B 3IG6B 2FS9A 2VIVA 2NU3E 3KYGA 2HALA 1WV7H 1DWCH 4BNRA 1YY3A 1CBWC 3TNSA 1KLIH 1SSXA 5A8YA 5LGOA 1AB9C 4DGJA 4A1XA 4LXBH 4AFUA 4YZUA 3QK1A 2ZDKA 3KQEA 3LH1A 3SGAE 4F48B 5L2YH 4X1SU 3V13A 2XBYA 3SYJA 1WAYB 2XXLA 3FAOA 3STJA 3U9AH 1O39A 1GDUA 3PV5A 2PTNA 2FOFA 1SG8B 2PWXA 3ITIA 3E0PB 2F9PA 1CA0C 1HAZB 1S6FA 3K2UA 1FY3A 5K0HA 4XOJA 3SJKA 3SHCH 4B73A 1VCQA 4MNWA 1V2LT 2UUYA 4A1VA 2UUKB 3NXPA 2STAE 4Q7XA 1XMNB 3DFLA 4FUIA 1TBZH 2ZGHA 1KY9A 2VIDA 2A31A 1G9IE 2P3UB 5I25A 3KHVA 1JBUH 3U8TH 2GCHF 1CA8B 3D49H 4ZKNU 2C90B 2HVXA 3BG4C 4KTSA 4CRFA 3HGPA 3ATIA 1H9IE 2GVFA 4THNH 2JH6D 1V2TT 1KXCA 3MU5A 4O3UA 1ESAA 1YPHE 5DP7A 3SGBE 1QZ8A 1P2IA 1W0YH 5HIYA 1GI8B 2AIPA 1O3DA 3FZZA 4ZMAH 4ZKRU 4IS5A 1O2TA 1BTZA 2WINI 1V2RT 2H5CA 5JBBS 3I77A 1T32A 1T4UH 2IJD1 2Q6FA 1TYNA 2WUBA 1AMHA 1W13U 3GDSA 1BMFD 1MTSA 1SL3A 3SBKA 1IQLA 1TBQH 4ISHH 3SV2H 3OEHD 3SI4H 1KXBA 3PMAB 1LQDB 3PO1C 2CF8H 3UREA 3M3VA 1MTNB 1GBBA 1OP2A 2J2UA 3H5CB 5GCHG 4CRCA 4NWLA 2A0QB 1FXYA 3PLPA 1A3BH 4K1SA 3SZEA 4E05H 2Y80A 4D9QA 2ZGBH 1UVUH 2A4QA 1FN6A 3T29A 4BAHB 4Z6AH 1CQQA 2A2XH 2Q6DA 1TNJA 1TQ7B 1XXFA 2C8ZB 1O3KA 1QIXB 2D8WA 3VPKA 2W7SA 4X1QU 1OPHB 1LQEA 1QB1A 1E36B 4CR9A 6ESTA 3VB6A 4ZXYH 3PRBA 3PWCA 2XC4A 1SQAA 3HKJB 2FOEA 1T8OA 1TALA 4NA7A 5CDFE 1NU9A 4YT7H 4FU9A 4OGXA 2WUCA 1TGSZ 1TOMH 3GICB 3T62A 1XXDA 3MNCA 1J15A 3FN8A 1GDQA 5K7RA 3SORA 1NM6A 2ZIQH 4ISOA 2PFEA 1K9OE 3BIUH 1K1MA 4MPUA 1C4Y2 5T6DA 2AS9A 1O2QA 1EAWA 2OTVA 4H42U 1K1OA 2VB0A 4OM9A 2KCYA 4I31A 5DP3A 3ZV8A 1BBRE 3GOVB 3KEEA 3SV8A 3SUDA 3TGIE 1GG6C 1K1NA 1IQGA 1GBLA 1TMTH 3A8CA 1QJ1B 3OYPA 2ZHWH 5HMAA 1GI3A 1Y8TA 4IN2A 1DFPA 2KCPA 1NBME 4K60A 1RRKA 3NPSA 4CRBA 1UTOA 2VVVA 3M7UA 1O2XA 1VGCC 1ELCA 3KQDA 1O37A 1S82A 2FZZA 3BIVH 3MNSA 2AH4X 2IPQX 2PHBA 4AFQA 1A5GH 1XUJA 5C5NA 5BRRE 1ZHPA 1Q3XA 3DCLA 5A0BA 5EU8A 4UEHH 5L2ZH 1O2MA 4JYTA 2K1QA 3BTWE 1PPEE 1AB9B 1FI8A 1D3TB 3E90B 3SU1A 4JCNA 1YCPH 1PPHE 2QE7D 3T28A 1NS3A 4YOJA 5JB9S 2J92A 2AHME 2F83A 8KME2 1ZTKA 1VKYA 5J4SA 2Y5GA 3V12A 1WQVH 4DIHH 4FUEA 1O3HA 1TRYA 1GCTB 1GI5A 2CN0H 1L1GA 5C94A 1FPCH 1GI2A 5FPSA 4J1YA 2ZFPH 3OEED 3RXJA 1E38B 1QY6A 3SW2B 3K6YA 3GDVA 1RFNA 1ABJH 5H4IB 2D1JA 1J9CH 1MZAA 1NZQH 1YM0A 2ZU4A 3G01A 4B2AA 5C3NA 4K5ZA 4I32A 3H7OA 1H1BA 2Z94A 4BAQB 2Q1JA 4ACBA 1MMJN 4X2WA 3W94A 4UFFH 1MKWH 1UVPA 3MO9A 5E2PA 1FLEE 2GT8A 5GIBA 1ELVA 2SGPE 2UWPA 1EAUA 1P01A 1NRQH 3URCA 1QJ6B 2OINA 3UNRA 2V7QD 1GL0E 1PPGE 2UUJB 1KLTA 3UQVA 5F03A 1C5TA 5C1XA 3ZVFA 4MNYA 1L1NA 3SNEA 1IOEA 3MO6A 2SGQE 3KIDU 2D2DA 3Q00A 2XYAA 5E0GA 1WQSA 1ZR0A 3ZZCA 2J4IA 7LPRA 1H8DH 5DN6D 1EPTA 3M5OA 1OWJA 2JJ1D 5E2OA 2G5NA 1V2WT 3BV9B 2ZFSA
chains in the Genus database with same CATH topology
3P70B 1TGNA 2EEKA 2OXSA 3AW1A 3ZZ5A 4UFEH 1D3QB 3SJOA 3V7TA 4FVBA 3T26A 1EXFA 2ZDLA 3ODFA 2ZEBA 4JYVH 4B75A 4X1NU 3AAUA 4YLQH 3ZVCA 1EOJA 1GHAG 3UWIA 1HAIH 3IITA 5B6OA 1C5LH 2FEQH 3CS7A 3TH4H 1NROH 3LDXH 4HGCA 5T3HA 5FBIA 1QB9A 3STIA 1GMHG 1C5XB 1A0HB 5J4QA 1SI5H 1GMCG 4A1TA 4OS6A 3OY6U 2ZCKP 3A81A 1V2MT 2FTMA 3RXFA 2A4OA 2FX4A 1DXPA 2PUQH 1MKXK 1IAUA 1ZHMA 3S0NA 2A32A 1C1QA 4AN7A 1GWAA 1YGCH 1JXPA 2P59A 2XBXA 4IMQA 5JDUB 2PKAA 3E3TA 3BTQE 5A8XA 2QCYA 1ETTH 1DXWA 4UONA 5DP9A 1TB6H 2C8XB 3T25A 3Q77A 1T8LA 1DX5M 4A6LA 3BTKE 4O9VA 1BCUH 2Z9GA 2P16A 3ZZ9A 2BDAA 2Z9JA 4MPVA 1NTPA 1GHAF 2XRCA 1NPMA 3H7TA 1O5EH 1HJ9A 3TJUA 1GBMA 2VH6A 3UPEA 4GVUA 1OKXA 4ISNA 4BTTB 3PYHA 9LPRA 3S69A 1C5OH 3QZRA 3GYLB 2TGAA 1GHYH 3PROA 1F0TA 1ZPZA 1VITH 1OWEA 4I7YH 4ABIA 3A89A 1AO5A 4KELA 4J2YB 1BTWA 4DW2U 1YP9A 1UTJA 2CHAC 3GY2A 2OP9A 1KSNA 1HAGE 1S5SA 5EODA 3KN2A 3L3TA 1PQ5A 4YOIA 4X6NA 1T4VH 5G4BA 2PTCE 1LVMA 1SLVB 5GPIB 1TPPA 3OY5U 5TCCA 2EI8A 3PB1E 1YKTA 1AUTC 1TX6A 2AMPA 2J94A 1O3FA 2BVSH 3LKWA 3ATMA 1HAVA 3TITA 1WTGH 3MHWU 3SU5A 3ZVEA 1FQ3A 3MMGA 4JYUH 3M7TA 1GJBB 2ZPSA 2KAIB 3M3SA 1BRCE 4HFPB 1SGNE 3KF2A 2SGFE 1DWDH 3PLKA 5F8TA 1N6XA 2BLWA 3BG4B 3MNBA 3KQBA 2BD8A 1HAVB 4KKDA 1SC8U 3DFJA 4D7FA 1FJSA 1Y3YA 1O3JA 4YO9A 1GBTA 2VVCA 2W7UA 2O8WA 3LC5A 4Y10E 2FOBA 4IN1A 2PSXA 1UK4A 2W26A 2QXJA 5FBEA 4GAWA 4BAKB 3A85A 1IQFA 2BY6X 4JK5A 2A7CA 2G4TA 1PPFE 5DG6A 1CHOG 5CE1A 1MAYA 2GCTC 3A87A 3LT3A 2XW9A 5GXPA 1P03A 5GJ4B 2YOLA 3RXKA 4AX9H 3A88A 2WPHS 2EA3A 4NFEA 4AFSA 2SGAA 3K9XB 1C2MA 3K6ZA 4X0WU 4HZHA 2SNWA 1K1IA 1HJ8A 4D9RA 4BAOB 4ABFA 3PTNA 1TNIA 4I8HA 2FI4E 3SU4A 1C1MA 3FVFB 2HLCA 1V2OT 5EW1H 1DANH 1TX7A 3M5NA 1AE8H 3ZVBA 5PTPA 4LZ1H 3RMNH 1HJAB 1CT2E 3E1XB 1G3BA 1TLDA 4DG4A 5C1UA 3S9CA 1XUGA 2WPIS 3SU6A 2THFB 4E7RG 1QTFA 3F9HA 2BQ6B 4YT6H 3UUZA 2QXHA 2ODYB 3B8JA 4ZKSU 3SQHE 1DWBH 1O36A 1DY8A 3UR6A 2ZCHP 1EKBB 4WWYA 2GCHG 4Y11E 2BXUH 3SNAA 2G51A 4BAMB 5LPFA 5JBAS 4Y76A 2Y6TA 5CHAC 5DGJA 4BTIB 1MKWK 3SI3H 1SHHB 1VITF 2SGDE 4NIWA 5EG4A 2ZQ1A 4Y6DA 2B9LA 2QXGA 1A7SA 1ORFA 1Z8IB 1ACBE 1GG6B 4JZ1A 1SHYA 2HRVA 4R0IA 4NA9H 1PPBH 2WPLS 4AGKA 1BDAA 4X2XA 4WF8A 1MU8B 1NFUA 4GSOA 4I33A 1FIZA 2Z9LA 3VB3A 1OOKB 1ZLRA 1QHRB 4I8LA 1HXFH 1O2VA 1QBNA 2B5TB 2IJOB 3P17H 1C4U2 3V3MA 1DM4B 1GI4A 1N8OB 2QA9E 1ELTA 1A61H 1GHBF 1Y5UT 2JETB 1P9SA 1ARBA 4SGBE 1D6RA 1WUNH 1LCYA 3SNBA 2YNAA 1C5PA 2AYWA 3A86A 4X2VA 2BD3A 2HOBA 2Y5FA 1B5GH 3ZYDA 2BZ6H 1D4PB 1UCYE 2EI6A 2ZFFH 1LVYA 2J34A 4FUDA 5DP8A 3PWBA 5DPAA 2ZG0H 3RXOA 1SQOA 1P2QA 1C5MD 2VWNA 1PFXC 3LGVA 1PYTD 4KGAA 1D3DB 1V3XA 2VWLA 2GV6A 1TOCB 2ZPRA 3ATWA 1N1LA 2ZWLH 3EE0B 4OS4A 1XX9A 4Z0KA 1C5RA 3L33A 2BLQA 2TIOA 4JZIA 1LHDH 4ZHAA 2W5EA 3KCGH 1HFDA 1KXAA 3F9EA 1GJ5H 1S81A 2QXIA 2XBWA 2F3CE 3VEQB 2ZGXH 3QX5H 1EASA 2XC5A 2Z3CA 2G52A 3PV4A 2XTTB 4DVAU 2I6QA 4MPXA 1E34B 3MH5A 3ELAH 1T31A 1F92A 2OBOA 1T8MA 4JZFH 2BY7X 1LVOA 2R3YA 1K22H 1SOTA 4O97A 6GCHG 2O9QA 2FM2A 1EAXA 1THSH 3ATKA 4UE7H 1GVLA 1UVSH 2F9UA 1W12U 1O2IA 4XE4A 3MH7A 1Y59T 5T6FA 3QGNB 3E91A 3LGWA 3SJ8A 1O2ZA 1CO7E 4XFQA 1Y3VA 2DE8A 3FFGA 3MU1A 1ZPBA 3OTJE 4CH8B 1YF4A 4JMYA 3M37A 3TJOA 3SN8A 5C20A 1MBMA 2FOHA 3M36A 3NUMA 1AVGH 1SPJA 1ZMNA 3LC3A 3QLPH 1BOQA 5EPYA 1NESE 1SOZA 1CA0B 1AQ7A 4PROA 3ODDA 2ZU1A 3O8DA 1UTMA 1HXEH 1T7CA 1BTPA 1AGJA 3RC6A 1LHFH 1G37A 1AWHB 1TRMA 2H6MA 2Z9KA 1S83A 2R2MB 1OSSA 1MAXA 4NCYA 4CREA 1OP8A 4X6MA 5EGMA 4MTBA 3TVJB 1VGCB 2FS8A 5EXMA 1E0FD 1O2RA 1ZJKA 1IQHA 1Y5BT 4GCHF 4CBOA 1EUFA 1W3CA 3P8NA 1O2YA 2HPQH 1GMCF 4Y8ZA 2AFQB 2BD2A 3U8RH 2FXRA 5F6MA 2ASUB 2VJ1A 4LZ4B 4OS5A 3LU9B 2PKAB 4YESB 1HAXB 1C5QA 1UVOA 4WVPE 2FP7B 4U30A 5CHAB 3TU7H 4YLUA 2ZZUH 2F9NA 2RDLA 3MH4A 3SV7A 2AMDA 4UFGH 3T27A 1A0LA 3ZZ3A 2ZTXA 1VR1H 2F9OA 2ANWA 2VU8E 3RM0H 1EJNA 1SLXB 2PGBB 1RJXB 1AI8H 2B8OH 4K8BA 2A45B 2VNTA 4DJZB 1G3DA 4BOHA 1MCTA 4K69A 3M5LA 5HXFA 1PPZA 1C1UH 1U6QA 2VH0A 5GCHF 2ZGCA 4XDEA 1YPJH 3M5MA 2FLRH 1QL7A 1IHSH 3GY8A 1C2HA 4U2WA 1ANCA 2H1UA 1O5DH 1O3PB 1XUKA 4ABAA 1ARCA 1LDTT 3BG8A 3NWUA 3F68H 4CRGA 2ZHQH 4B76A 3HGNA 3LONA 4DIIH 2V3OH 1PQAA 1EZQA 4FUBA 4XBBA 1EZXC 1TMUH 5ESTE 1D3PB 1EOLA 3RXQA 1C1RA 1AZZA 3PLBA 4AOQA 1KTTB 3PTBA 4RSPA 4DOQA 1HGTH 1LPKB 4K3JA 1EPTC 1HAHH 1NT1A 2FI3E 4MQAA 2HNTC 2G81E 1ESBA 2PSYA 4CHAC 2BB4A 4SGAE 2Y5HA 4NG9H 4K8YA 1QRWA 2ANKH 1P2MA 1QNJA 4K1TA 1ELBA 1O5GH 3Q3KA 1EZUC 4Y71A 3SJ9A 4B74A 1MQ5A 1ZJDA 2BOKA 1C9TA 1GBKA 1HPGA 3UOPA 2LPRA 4D7GA 2VIWA 4TYDA 2H9EH 1FIWA 1DSUA 2UWOA 1FMGA 1GCDA 1OP0A 4Y79A 5CMXH 2P8OC 1GJAB 3O8BA 1TPAE 3ZZBA 1A5IA 1AWFH 8ESTE 2Y81A 4JK6A 3MU8A 1P09A 2VGCB 5C2ZA 4DCDA 1C1WH 1AFQC 2ZECA 2LNCA 2ZNKH 1O3OA 4Y8XA 5ESBA 1ZSLA 4B71A 3KQCA 4ZROA 2ANYA 3MNXA 1UHBA 1THRH 1NY22 2A5AA 2GMTB 4ZUHA 1BMNH 2ZTZA 1O2NA 2NU4E 1DE7H 4MPWA 3ZZ7A 4U32A 4WXVA 2FTLE 5DP4A 2FOAA 2GX4A 2FPZA 4WH6A 4H6TA 3LGTA 1BTUA 3TH3H 5FAHA 3W95A 2BZAA 2O8MA 4HTCH 1SGFA 2FIRH 2P3TB 1QR3E 2FI5E 2CV3A 2IOTA 3NK8A 2R0LA 1C5NH 2GZ9A 3RMMH 4JZDH 3GCTF 4MNXA 1G36A 1Z6JH 3GY6A 1CVWH 1V2NT 2G00A 3VGCC 3QTOH 1OXGA 3IWMA 3HPTB 1KDQA 2O8LA 2XWAA 3UFAA 1AFEH 2SNVA 1C1SA 2P95A 4IMZA 4Q2KA 1Y3XA 2GCTB 1GJ8B 2F9VA 1ZPCA 3BTTE 2FOGA 5DP6A 5DJ7A 3CENA 2ZCLP 2QY0B 1G3CA 3GISB 3U98H 1HAYB 1S0QA 2ZU5A 1FN8A 1XUHA 3RU4T 1GGDC 4AYVB 3MWIU 1L4ZA 4BTUB 2PLXA 1ID5H 1TBRH 1A3EH 3SQEE 4YM9A 1LHEH 1AFQB 1YPLH 2ESTE 3SUGA 1CE5A 1WU1A 5GWZA 4NFFA 4ZH8A 1LTOA 1UTPA 1TPOA 2VVUA 2Z3EA 2FODA 1PQ8A 1FUJA 3LGIA 1A1RA 3P6ZB 1SGDE 2FOCA 2I6SA 1WBGB 4ABJA 2ZHDA 2ZO3H 2ANMH 1AU8A 5DP5A 1GGDB 2HNTE 2BTCE 6GCHF 3OSYA 2QC2A 1NRRH 1UHBB 2BDIA 1GBEA 1BBRH 1G3EA 5FHTA 1C1OA 3BSQA 3L6PA 2BDBA 4E7NA 1OS8A 4X8TH 6LPRA 3A8DA 1H4WA 5IYTA 3PMHB 4Y7BA 3LOXA 3MU4A 2KAIA 5EPNA 1CT0E 1BB0B 2AMQA 3CP7A 2GDEH 3KNXA 1C5YB 1P05A 4X6PA 1GBIA 2RA3A 1AD8H 4I8GA 1ZMJA 1AE5A 2FWWA 5LPRA 5LPEA 2ILNA 2R2WU 1O3LA 3URDA 1QB6A 2FO9A 2B7DH 3MOCA 1V2UT 1EQ9A 4OS1A 2W3KA 1HIAB 5ETXA 1CU1A 1DLKB 1GMDF 2A5IA 1WYKA 3KL6A 3U1IB 3A7VA 1OWIA 3TK9A 3BF6H 2EI7A 1V6DA 4MVNA 3FP6E 1G30B 2O8UA 4FU7A 1OYTH 3GY7A 1P2OA 2A5KA 4WMFA 5T6GA 1BTHH 1LVBA 1RXPA 4TY6A 5FX6A 7GCHG 3GCHC 3HK6B 3VXEH 1GMDG 1P10A 2QN5T 1C2LA 2WPJS 2OC7A 1K2I1 2ZFRH 1TGTA 1WSSH 3UY9A 1GL1A 1SGRE 3A83A 1L0ZA 4IBLH 1BRBE 1S85A 1O35A 2ZPQA 1DPOA 1GBAA 1L2EA 4ISIH 4NGAH 1JOUB 2ZFQH 1O32A 1C2EA 2HPPH 5A8ZA 1SQTA 4AGJA 1UMAH 5HYOA 3T5FH 4B1TA 2A2QH 4UFDH 3MI4A 4GLYA 8LPRA 4F4OC 4INHA 1W10U 2PR3A 1FONA 1O3NA 1G32B 1V2QT 3NZIA 1ZRBA 4D76A 1IQEA 3DD2H 3QZQA 1BBRK 1O38A 1QCPA 1NRNH 3RXGA 3S7KB 2ZP0H 3TLOA 1EX3A 1HB0B 2GD4B 2BY8X 2ZI2H 2GMTC 5GDSH 3SUFA 1C1VH 3TIUA 3OU0A 3UTUH 4DY7B 3RMOH 4CRAA 3RUOA 1TNGA 2VWMA 3TJNA 2FOMB 1RS0A 5JYIA 7GCHF 1CGJE 1ZGIA 1LHCH 3UWJH 4ASHA 1Z6EA 1QBOA 5TCAA 1RD3B 1KXFA 2BDYA 3VB7A 1OX1A 1OWHA 5AFYH 3RMLH 1PQ7A 2ZA5A 4ZAEA 3GDUA 2JKHA 1AZ8A 3ZZDA 3PMJA 4M7GA 4O03A 1MU6B 1DITH 1IQJA 1CGHA 1GBCA 1XVMA 5AVDA 4BXWA 1J16A 1O3GA 1VJ9U 2A7HA 3PM3A 3BTGE 3R0FA 1HAPH 2FLBH 3QTVH 1EB2A 3DUXH 1O2UA 3UR9A 3SOSA 5JBCS 1ABIH 1S6HA 2QF3A 1W7XH 1P06A 1O31A 2OQ5A 4H4FA 1D6WA 4NA8A 5L6NH 5FCRA 1DUAA 2W3IA 1ETSH 1O33A 2C8WB 1WCZA 3RXDA 2PUXB 3LJOA 4A7IB 1INCA 3UIRA 1QA0A 2C3SA 2ZC9H 1F0SA 3ZVGA 2XBVA 1FV9A 1PYTC 1GJDB 2ALVA 3D23A 1DT2A 1UTNA 2V0BA 1BJVA 1PPCE 2GT7A 3TGKE 1KXEA 2BM2A 4NSYA 1B0FA 1Z1IA 4LK4A 2BQ7B 1A0JA 3Q76A 6CHAB 3U8OH 3RXVA 2O8TA 2V3HH 2ZTYA 3MTYA 2GTBA 1SBWA 1CT4E 2BDHA 2TGPZ 1O2GH 1DICA 2R0KA 1TA2A 3WY8A 1EZSC 1GJ9B 3A82A 1RTFB 5FPTA 1EP6A 4ABBA 4Y0ZE 1QGFA 1Z8GA 1KYNA 3Q3YA 1AVWA 1C2DA 1TFXA 1P12E 3B9FH 1H9HE 1GI0A 3RLYH 1W7GH 1F5KU 3N7OA 3M3TA 5DO4H 2XCFA 5BPEA 3TPIZ 5LH8A 4O3TA 1IQIA 2C4FH 3A7XA 1RTKA 1Q31A 2BVRH 2H5DA 1C2GA 1GBJA 1O30A 3JZ2B 4X2YA 3R3GB 3QDZB 2QIQA 1MQ6A 1TGCA 3E0NB 1C5UA 4GCHG 2M5TA 3GYMA 3BEFB 1S84A 1W14U 1LMWB 1C2IA 1V2ST 1VITG 5HM9A 5L30H 2OD3B 1P2KA 1V2KT 1V2PT 2Y82A 3M7QA 5SGAE 1AY6H 1MZDA 4K2YA 4TWYA 1ANBA 1F5LA 1SGPE 1EATA 1TQ0B 1ELDE