3BTKE

The crystal structures of the complexes between bovine beta-trypsin and ten p1 variants of bpti
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
222
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PROTEIN (TRYPSIN)
publication title The crystal structures of the complexes between bovine beta-trypsin and ten P1 variants of BPTI.
pubmed doi rcsb
total genus 53
structure length 222
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3btkE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3btkE02
3E6PH 3RU4T 1GHBG 1E35B 2PHBA 2Y5HA 4K1EA 1GBCA 2BM2A 3SJOA 2NU0E 2F9BH 6GCHG 3K9XB 5EXNA 1W3CA 8LPRA 1PYTD 4D9RA 1NESE 1EAWA 1N8OC 1XMNB 4I32A 1UTJA 4FUIA 5GWZA 3P6ZB 2ZU1A 1Y5BT 3SU1A 3M36A 2PFEA 3U69H 2R0KA 3U98H 2QCYA 2XWAA 1PJPA 2PUQH 5F8ZA 3SUEA 2OBOA 2GTBA 2RCEA 3RC5A 1Q2WA 3GY2A 1O33A 1CGHA 7GCHF 1WCZA 1MKWH 1UTNA 1FONA 4X8TH 2TGAA 1TBRH 1MTUA 1FPCH 3LJOA 2BVRH 1BRCE 4JYUH 3T27A 2R2MB 2A2QH 2WUBA 8GCHG 1SGPE 4MTBA 5JPMH 4BOHA 1SOZA 1MKXH 1SHHB 1TAWA 3EA9A 1T4VH 1UVUH 4ZKRU 2BD4A 4YO9A 4NSVA 1OYQA 3SO3A 1NU9A 1CO7E 2FMJA 1ACBE 1CU1A 1SI5H 5BRRE 2V3OH 5C1XA 3VGCC 1G3BA 1HGTH 1O3BA 3HK6B 1IAUA 1HAXB 1BQYA 1K1LA 1ZMJA 1TX7A 5EOKA 5E8EH 3P8GA 4E05H 1QBNA 2F91A 1CHOF 1KLIH 1F2SE 4GVUA 1HBTH 1XKBC 4TYDA 1L4ZA 1YF4A 3EQ0H 1AWFH 3BTWE 3HGNA 1J9CH 1H4WA 3PWCA 3EA7A 3PMAB 1PPCE 2NWNA 2PSXA 4AFQA 1E38B 1DWDH 5AF9H 3PMHB 1C4Y2 1O5GH 1ORFA 1TGCA 2GCTC 1NN6A 2CHAC 3SV6A 4QT8C 1GMHG 1TABE 2GV7A 2J9NA 1ZMLA 2UWLA 1AB9B 1UTOA 3U8RH 2P3UB 3RC6A 2ALVA 2ZIQH 3T62A 1GI9B 2NU3E 2M5TA 1O2WA 3E1XB 1O2YA 1QFKH 2ZCKP 3ATIA 4NIYA 1SSXA 3IG6B 1C2DA 1O2RA 2SGDE 1OS8A 2IJOB 5DGJA 2C90B 2ZGCA 5K0HA 2AIQA 1BMAA 2RG3A 4WF8A 2BX4A 1A46H 4FU7A 4YOGA 4AB9A 1OPHB 1GBKA 1OOKB 3ODDA 3RXHA 1YBWA 4I8HA 4BAOB 1GCTC 2C8YB 1EQ9A 3B23B 3M3SA 1G2MA 4CRGA 2ZHEH 1QNJA 2ZZUH 3M5OA 1TNKA 1HAOH 4E7RG 2TGDA 4DGJA 4AFSA 1GI3A 3NZIA 3TJVA 1AE5A 1UVSH 1RJXB 1TOMH 3TJNA 1IQKA 4D7FA 2ZFTA 1XUKA 2BZ6H 4X8SH 1KXAA 4HGCA 1FY4A 1GHVH 1C5LH 1P2QA 2ZCLP 4X6NA 3H7OA 1UVPA 3ENSB 5EODA 3ZYEA 2CJIA 1TGTA 1P8VC 4ZUHA 1HXEH 3H7TA 1S83A 1ELEE 1JIRA 1TNJA 1HPGA 1W8BH 2PKAB 3DUXH 4MQAA 1P03A 4CHAB 2GX4A 4KKDA 3LH3A 2J38A 2GMTC 1E34B 1K1IA 2ESTE 4XFQA 3GCTG 2TRMA 1WU1A 2BDAA 4Y8ZA 3ZVDA 3A8DA 2QF0A 2BLVA 3EDXB 1T8LA 1GJCB 3N7OA 1B0FA 5FPSA 1Z6EA 3S7KB 1F5RA 4B75A 3AASA 5H4IB 1P01A 5LH8A 3AAVA 1UTKA 2BB4A 4ABJA 4WMDA 5A8YA 3VXEH 1BBRE 2UWOA 2OTVA 3PLKA 2BVXH 3F9FA 2XWBI 1QJ1B 2C8ZB 3E0PB 1V2QT 1IQLA 3I29A 1AY6H 2GCTB 2G55A 3K6ZA 2GT8A 2CHAB 1P57B 3BTHE 3TJUA 3OY5U 4A6LA 2WPJS 2G5NA 2BY9X 4HTCH 3E90B 1P2JA 3ZV9A 1NFWA 3FVFB 1ZR0A 1DWBH 2XC0A 2ZU4A 5EW1H 1SQAA 1QRZA 2FI5E 3VPKA 2XBXA 1SBWA 3L33A 1AKSA 2FOCA 1AUTC 1EOLA 3GYLB 4KP0A 4LXBH 5FPYA 1BTHH 1TLDA 4AYVB 2B9LA 1O2TA 2VNTA 1SGCA 1C5PA 3TGKE 4BAQB 1ZRBA 1ANBA 2EC9H 3A7VA 1GCTB 1O5DH 3ZZDA 3SU5A 1VITG 3SU4A 3F6UH 1GI4A 1KDQB 1BTZA 1TMBH 3TIUA 4A7IB 3GISB 4IN2A 1L2EA 3G01A 5EQQA 1E0FD 1VR1H 1Y3UA 3TLOA 4OS7A 4LZ4B 1AUJA 1HNEE 1TA6A 2GCHG 1SGFA 4LOYH 2AMQA 5FCRA 1O3FA 4A1TA 3CS0A 2V0BA 1O32A 3SBKA 1Z1JA 1YPGH 2ZQ2A 4X1SU 1EB1H 1ETSH 4SGAE 3K65B 2DUCA 1HXFH 1Y59T 1LHEH 2Q6DA 1P9UA 4Y7BA 1BTWA 2W3IA 3UNRA 2XC4A 3RXOA 4K1TA 2AMPA 2G52A 3O8RA 2Y6TA 3T2NA 4AN7A 4LZ1H 2FYQA 1HUTH 1A4WH 4CRDA 3MI4A 4DY7B 1EJMA 3QZQA 4Y8XA 2GZ9A 5FXLA 4IMQA 3TK5A 2BZAA 2SNVA 3ZZ3A 5T3HA 4AYYB 3UOPA 4A92A 4O3UA 1CT0E 1OWEA 1GMCF 1C1QA 1TX8A 2C3SA 2FOGA 2O8WA 1GJ6A 1O2NA 5IYTA 6CHAC 4NFEA 1AIXH 1GBAA 2VGCC 2QF3A 1SGDE 1GJDB 1MCVA 1EJAA 1XUJA 3ZZ6A 3ZZ9A 2B5TB 4K8YA 1HIAA 3SQEE 1THRH 5JBTA 1AFEH 3HPTB 3KEEA 2BDBA 3UNSA 3S0NA 1NRQH 1GVLA 3RXKA 1RTKA 1KYNA 2P3FH 2G51A 4X1RU 4FVDA 1L4DA 2ANWA 2GDDA 4RSPA 3SUFA 1AI8H 3LH1A 2WPLS 4NSYA 2VWMA 2ZDLA 5A0BA 1NFUA 3RXJA 5EPYA 1HYLA 1ZSLA 4E7NA 3P8OA 4X2YA 3RLYH 3M61U 5B6OA 1ELTA 3L3TA 3T28A 3ZZ7A 3CP7A 4IMZA 3RXEA 8ESTE 1FI8A 4XBCA 3EAJA 4UFGH 1TGNA 2HNTC 1O2UA 3BTEE 2CN0H 1SGFG 2UUKB 1B7XB 1FZZA 4ZH8A 3QK1A 3QLPH 5FCKA 3SNEA 1HAHH 2OINA 1DWCH 1QJ6B 3FP6E 1O2MA 1MKWK 1TMTH 3A86A 2AGIX 1UK2A 2FX4A 4Z6AH 1HCGA 4D9QA 2Y82A 5GJ4B 1O2VA 2ZHDA 1ZJKA 1EJNA 1O37A 3TPIZ 2AH4X 5DG6A 1GI5A 1EB2A 1FN6A 1AU8A 3NK8A 5L2YH 2J34A 3W95A 4YZUA 3SNDA 4GAWA 3LU9B 3LT3A 2THFB 3KNXA 3P70B 1BOQA 1TNGA 1O5EH 1C5WB 3GDUA 4CRCA 2Y7XA 1EAIA 1DPOA 1TOCB 1FIWA 3TK9A 1QCPA 1P12E 3T5FH 5DKMA 4JZEH 1MU6B 3RXAA 2P16A 3MNSA 5DP4A 4TPYA 1PPGE 5EW2H 1H9LB 1DSUA 3KQDA 1O3KA 1BMMH 1CA0C 1GMDF 3SV9A 3FAOA 1ZPZA 3TJOA 1CQQA 2R2WU 3SV8A 3MH5A 2BD7A 1P09A 1O2ZA 2EA3A 1UK4A 3M5LA 3A84A 4NWKA 2Y80A 1FIZA 5JB9S 2H9HA 5DP8A 5C3NA 1OWDA 3HATH 4X6MA 2AFQB 3FFGA 3QWCH 5G4BA 4YLQH 2ZTZA 1GHXH 2QXHA 1KXFA 4H6TA 3UR9A 1P11E 3BTQE 2FLRH 1ZZZA 1EKBB 3V12A 1C5SA 1GBHA 1HAZB 1GHWH 2XBWA 1ID5H 1GJ4H 2XNIA 1V2JT 2BQ6B 1AQ7A 2C8WB 1QIXB 3GDSA 1N1LA 1O39A 1AZZA 1NT1A 4K2YA 1PPEE 4MNXA 1HB0B 2VIOA 2ZFQH 5DP6A 1C1NA 1GBIA 2FYRA 4MVNA 2CGAA 1PQ5A 4FUBA 1UCYE 4FVBA 1O35A 2GZ7A 2OC1A 3KQEA 1SLXB 3Q3XA 2C8XB 3I78A 1AVXA 2OUAA 2Y5FA 2TGTA 3RXBA 2QV1A 5A2MH 1CHGA 2NU4E 4R0IA 1INCA 5EGMA 1GJBB 2BHGA 1DXPA 4MPVA 1SFQB 2V3HH 4XOJA 4IS5A 4MNWA 1V3XA 1EZQA 1XM1A 2HLCA 1AMHA 1QA7A 1C5XB 3VEQB 1UTPA 1SLUB 2XRCA 1J14A 3ZVAA 1MAXA 1VGCB 1HRTH 3BIVH 1ZMNA 2A31A 1J15A 4OGXA 1P06A 4ABIA 1NROH 1K1NA 1MQ6A 3ZV8A 2Z3DA 2AS9A 3QO6A 2R9PA 1WOFA 5TJXA 1QR3E 1GCDA 2OBQA 5T6GA 2G81E 3MYWA 3TU7H 3QTOH 1EZSC 2GV6A 3TK6A 1QB6A 1E36B 1NPMA 3KIDU 4ISIH 3UUZA 4NA8A 1P10A 2BD8A 3BN9A 4D7GA 1CA0B 2AIPA 3P92A 5EXLA 1NZQH 1G3EA 1XUHA 1ZTJA 3GCHC 1SLVB 1OP8A 6LPRA 4BTUB 3V0XA 3GICB 4I31A 1RGQA 2OXSA 4UE7H 3SGAE 3SORA 1C2MA 1DICA 3GY5A 4ZKSU 3RXIA 5GPIB 1L1NA 4KELA 2SGEE 2FOAA 4BAKB 1SC8U 2Z9IA 1EPTC 2JETC 4AOQA 1AGJA 1A3EH 1MMJN 1J16A 2LPRA 3RMLH 4BTTB 1P9SA 1IHSH 1ZPBA 3BV9B 5EQSA 4JK6A 3RXQA 4BXSA 4TWWA 1LHGH 2UUYA 3QTVH 1C1SA 4OS4A 1DSTA 3RXRA 4DW2U 5C2ZA 1ZGIA 1FY1A 1SHYA 3TNSA 2QXIA 3HKIB 4WXIA 4CRFA 1O34A 2A32A 1P0SH 1CGIE 2VIPA 1RFNA 1DX5M 4I8JA 3Q77A 1P02A 3UR6A 1ARCA 2FZZA 1C5NH 3E8LA 2PKAA 1YGCH 4ZXYH 1GI8B 1XXFA 3UREA 1Z8GA 3BTKE 1UMAH 3RLWH 4X6OA 2IN2A 1IQMA 3JZ2B 4I8LA 2Q6GA 4I7YH 4GCHG 1NY22 1GBLA 2ZPSA 1FPHH 3PLPA 2H2ZA 2WPKS 2ZHQH 2YNBA 4GSOA 3UIRA 2QGRA 2TIOA 1JRTA 1GHAG 4OS6A 1C5OH 1Y3VA 1C2KA 4I33A 2BDCA 2A0QB 4DCDA 1P3EA 4YESB 1ESBA 4Y76A 2IPHA 3TH4H 1F0TA 3PMJA 1V2LT 2FIRH 1CA8B 2BXUH 3SU2A 1OWJA 2TPIZ 3T25A 1GBBA 1SR5C 1XX9A 2FM2A 3HKJB 2HPQH 4PROA 3ZVCA 1JBUH 5T6FA 2CV3A 5A09A 1C2IA 1DUEA 1L1JA 2HGTH 2OC0A 2FOEA 4IC5A 4X1PU 2DE9A 4UFFH 2EI7A 1PPZA 1GHZA 1TRMA 2Y5GA 1C1MA 2ZEBA 3F1SB 1HAGE 4Q80A 4ABHA 1YC0A 1ETRH 3GCHB 4TY7A 3LIWA 1KTTB 1VJ9U 5E0JA 2VWNA 2A7JA 3ZZBA 2QA9E 1ZHMA 2PTNA 1FLEE 1KXCA 4KTUA 2OQUA 8KME2 5GCHF 3KF2A 1OSSA 2ZGBH 4O03A 1WUNH 1CT4E 1G3CA 2WPIS 4YT7H 1KDQA 5F8XA 1C4V2 1TX6A 3M35A 2BQWB 4ABBA 2BX3A 2P8OC 1F0RA 1GL0E 3SJ9A 1O2LA 1VCPA 3TH3H 1ZSKA 1O2XA 2G5VA 5FBEA 2GP9B 1TBZH 3Q76A 5J4QA 3PTNA 1TPPA 4NFFA 3F68H 1DWEH 1N8OB 1A61H 1Q3XA 4YTAA 1UTMA 2Z9KA 1C4U2 2FWWA 4K1SA 3T26A 1YCPK 1HAIH 3A7XA 3SI4H 1TNLA 1UK3A 2NU1E 4RN6A 4WH6A 2XTTB 4INLA 1TMUH 1EZUC 2ZF0H 3ZVBA 2ODYB 1CVWH 3BTDE 2R3YA 1YPKH 4Y10E 1AO5A 1O2JA 5EG4A 1YPJH 2VINA 3A7YA 1TE0A 4B1TA 3PV4A 8GCHF 5JBAS 2O8LA 1HJ8A 1O5BB 5ESBA 4CH8B 1ARBA 1GI7B 3TH2H 2ZHWH 4O3TA 1S0QA 4I8KA 4MNYA 1EUFA 2VJ1A 4YOIA 4NZLA 3QN7A 3DFJA 1FQ3A 2K1QA 4XSKU 1YCPM 2AYWA 3A82A 3VGCB 2ZC9H 1P2OA 1TPAE 5T6DA 4B2BA 1FV9A 2BD3A 3RU4D 5HM2A 1AHTH 3AW1A 4ISNA 2D26C 1BHXB 2A5AA 4FU9A 1O2HA 1LVOA 2SNWA 3TVJB 3OYPA 3SV2H 2PKSC 4NWLA 5AFYH 5A0AE 4DURA 4YT6H 5C1YA 3GYMA 2ZGXH 4X6PA 1ELDE 1A0JA 3RXDA 1YP9A 1LHFH 3SOSA 1TGSZ 4F49A 3KQCA 3MNXA 3URCA 3UQOA 3SHAH 1TONA 3EE0B 1BTPA 1CBWC 2GD4B 4Y79A 4ISHH 1QQ4A 3UY9A 2Y81A 2F83A 1O3NA 3VB6A 3SZNA 4CR9A 1SGRE 4RKOB 2D8WA 1V2NT 3MU0A 5JYIA 3ZYDA 3PMBB 3UPEA 2H9TH 3ZVGA 1C2GA 1BA8B 3MFJA 1UTQA 1EAXA 3RMNH 4A1VA 2P8OB 1YPHE 4X2VA 3KHVA 3SQHE 3RC4A 1J8AA 3LGVA 3E16B 3S9AA 3SNAA 3UQVA 1DY8A 2WINI 2A1DB 4FUJA 1T31A 1QTFA 2ZU3A 3IITA 2ZA5A 1V6DA 1XUGA 1GJAB 5AVDA 3A7TA 3A7ZA 2RA3A 1TA2A 2BY5X 1O3GA 4FUCA 3VB4A 1ELAA 4AG2A 4XBBA 3OSYA 4FUFA 1LHCH 1AE8H 2Z6BD 3CENA 1DANH 1V2OT 1ZSJA 1EZXC 3PWBA 1F0SA 1O31A 1OXGA 5L2ZH 2A4QA 3BF6H 1QGFA 2BY6X 1RIWC 2CF9H 2A2XH 2GZ8A 3SU0A 5LPEA 1NTPA 1GHYH 4B73A 3S7HB 2BLQA 1D9IA 4Y0YE 3NXPA 3BEUA 1GI2A 2GMTB 3GCTF 2VIWA 1KLJH 3S9CA 1PQAA 3WY8A 3R0FA 1VITH 1LVBA 1JIMA 1GGDC 4Y11E 2ANKH 4JYVH 2AGEX 1QBOA 1PYTC 1W2KH 2G00A 1YPEH 1BMLA 1ZJDA 2CF8H 2ANYA 3F9HA 5DP3A 4K5ZA 4UFDH 2H6MA 2AGGX 4Z0KA 1GBDA 1K1OA 2XCNA 4J1YA 1BUIA 1LTOA 1W7GH 3GY8A 9LPRA 4ESTE 3ESTA 1C9TA 1T8OA 2FI3E 1D3TB 1AVWA 4WXVA 4B76A 1FN8A 5K7RA 1O2SA 3GY6A 1Z8JB 3MU1A 4ZROA 1Q31A 3M3TA 1B5GH 1SB1H 1CBWB 1QA0A 3BTTE 1GL1A 5LPRA 1NRNH 1Z8IB 1WQSA 3M7QA 2QXGA 3NWUA 5SGAE 4ASHA 3LGYA 2SGQE 2XXLA 2FXRA 1P04A 1OKXA 1MTVA 1AVGH 2V6NA 1IQFA 1W10U 4NA9H 4J2YB 3URDA 1A0LA 1O5CB 4ZXXH 3D65E 1RTLA 2VU8E 3M7TA 9ESTA 4DVAU 3SUDA 3A89A 3D62A 4BANB 1P2NA 1GDQA 1DY9A 1P05A 2VH6A 4Y7AA 1RTFB 1EOJA 1VITF 1GWAA 4Q7YA 3O8CA 1ELCA 3AVZA 1EATA 4B2CA 1IHTH 2PW8H 2FX6A 1V2WT 4ZMAH 2BOHB 1W11U 2GCHF 2BY7X 2KAIB 3MU8A 4K3JA 2Z9LA 1YYY1 1KY9A 1XVOA 3RM2H 2J95A 1QRWA 2PUXB 4FUHA 4K69A 2Y7ZA 3SN8A 3ZZAA 1G2LA 2ASUB 3E0NB 2SGPE 1MTWA 3BEFB 3EA8A 1RIWB 1W12U 3STIA 4YLUA 4U01A 1GDUA 1MKXK 4F4OC 3A7WA 3NCLA 1CGJE 1YPMH 4NIVA 2SGAA 1SGQE 3V3MA 1EAUA 3RXCA 1D3PB 3UTUH 2TBSA 1GGDB 1S0RA 1Z8RA 3ITIA 1QQUA 5EU8A 2HVXA 2SGFE 4WMEA 5AHGH 1O2GH 3LOXA 4X1QU 3LJJA 4IN1A 1FXYA 3QDZB 2XW9A 3ZZ5A 1C5QA 1BTUA 1XVMA 3S69A 3MO3A 3VFEA 2PWXA 2ZPRA 5PTPA 5J4SA 2W7SA 6CHAB 2TGPZ 1ZTKA 2VGCB 4Y8YA 1ANDA 2VIQA 1BJUA 3GY7A 1XKAC 1GJ9B 5L6NH 1ELBA 2W26A 1P2KA 5AFZH 3V7TA 2RDLA 2BXTH 1Y3XA 1F92A 3VXFH 1MBQA 1J17T 2NU2E 1O5FH 5JBCS 1D3DB 3FP8E 4AX9H 1KXBA 2HWLB 2PR3A 1ZRKA 1E37B 3RXTA 2ZECA 4INHA 2WV4A 1FY5A 2CMYA 2ZG0H 1O36A 2J92A 1O5AB 1O3DA 2ZO3H 4JZ1A 4KGAA 1THPB 1K1JA 2H9EH 4Y71A 2F9UA 2QAAA 3Q3YA 4GLYA 3U8OH 3BTME 4IC6A 1O3AA 1K28D 1G3DA 3P8NA 4VGCC 2W7UA 4JYTA 3ATMA 1V2RT 2ALPA 1SGTA 1L1GA 1C5UA 5GXPA 2A5KA 5BPEA 1EP6A 3PO1C 3OY6U 4A5TS 3QGJA 4MPXA 1WAYB 3MO9A 4MPWA 4ABGA 2BYAX 4B74A 3TITA 3E3TA 4D8NA 2A5IA 5CHAC 2H1UA 4CBOA 4XE4A 3SU6A 4AZ2B 2PTCE 1UJ1A 1TFXA 5E2PA 3GY3A 3UWJH 2I6QA 4WY3A 1C5RA 2R3UA 3ODFA 2BD9A 1WTHD 2ZQ1A 2V35A 4RKJB 1C2JA 1LVYA 1W0YH 3NUMA 1DT2A 4CBNA 3RM0H 1S81A 1W13U 3LC3A 1ZPCA 1QB1A 3RXMA 1BZXE 4NZQA 1S6HA 1P2IA 1QL9A 5EXMA 1F5LA 4DOQA 4NA7A 7GCHG 5I25A 4CRAA 4BNRA 2AEIH 1TBQH 2F9OA 3FZZA 2ZFPH 4ZHLU 3RU4E 1DXWA 1Y3WA 1BIOA 4UDWH 3UOUA 1BRAA 2A7CA 5HXFA 5F03A 3Q3KA 3C27B 2BTCE 5DJ7A 1BCUH 2UUJB 2FPZA 2FOHA 1A0HB 4FUGA 3SJIA 4BTIB 1UCYH 3TGJE 3MHWU 1G37A 2JH5D 1C1WH 4THNH 3ZZCA 3SU3A 3LDXH 4BXWA 1O3PB 3FZDA 1EPTA 1GJ5H 2ZDMA 3ATLA 1AZ8A 1GDNA 2FS8A 7LPRA 1CHOG 1OP2A 5L30H 1WTGH 2HNTF 2BLWA 3M5MA 5E0HA 2QN5T 1ZHRA 4U2WA 1KLTA 4MDSA 1O3MA 3O8BA 1DFPA 1SGIB 1O3JA 3FP7E 1BTXA 1W14U 1MZAA 2F3CE 1LKBA 4HI3A 3ELAH 4MNVA 2ILNA 4WJG2 2VVUA 2BDGA 4K8BA 3VB7A 1FNIA 4AGJA 1SOTA 1Y8TA 1WBGB 3LGUA 4ZKNU 1AB9C 3A85A 3S9BA 3KN2A 3OTJE 3MOCA 1SG8B 3PO1B 5ESTE 2BD2A 2J4IA 1DVAH 1TQ7B 4O9VA 4GPGA 2BQ7B 1LHDH 1A3BH 2UUFB 1MCTA 5CHAB 5A8XA 3MWIU 3RXGA 2ULLA 2O8UA 5GDSH 1VZQH 1FUJA 2O9QA 1MTNC 1V2UT 2ANMH 3Q00A 2J2UA 1TIOA 1JMOH 5EPNA 4XBDA 1OWIA 2GKVE 2Q1JA 1AD8H 3OX7U 1DUAA 1XUFA 2OQ5A 1O30A 4IGDA 2QC2A 2ZI2H 2B7DH 5TCCA 2BVSH 4X1NU 7ESTE 1T32A 4KTCA 3GOVB 1ABIH 1GBMA 3SW2B 3BG8A 2XBYA 5FX5A 3AW0A 3KL6A 1ELGA 3RXSA 2FLBH 1XUIA 1T8MA 1QL8A 3SGBE 3A87A 3STJA 3QUMP 2Z7FE 1IQEA 1L0ZA 1HV7A 1NRPH 1TWXB 2B8OH 4CHAC 1P3CA 5E0GA 3O8DA 2PV9B 2VIVA 1ANEA 1HFDA 1QY6A 1CSOE 3T29A 4CREA 1LCYA 3DA9B 1GI6A 1OYTH 5FBIA 4O97A 2ZDNA 2P94A 2H5DA 1C5TA 5E2OA 1ABJH 2FTMA 5HM9A 1NFXA 3F9EA 1VCWA 1S6FA 2HPPH 1C2LA 2STAE 4FU8A 4MPUA 1NRSH 3A8CA 3RXLA 2FTLE 3K2UA 3MNCA 1GBJA 2G4TA 3GDVA 1ELFA 1O3EA 2OLGA 3C1KA 2Z3CA 1Z1IA 1EPTB 2JETB 4OS5A 1O0DH 5GIBA 4DIIH 4YOJA 1FY8E 1A1RA 1MU8B 1GHBF 2OCVB 4H4FA 2A4OA 4OS2A 1MD8A 6GCHF 1WSSH 3D23A 4Q7XA 3GCNA 3MO6A 4JMYA 4AG1A 4JK5A 1GBEA 1KIGH 1HAYB 3SHCH 1UVOA 4Q2KA 1NFYA 1H8IH 3EYDA 4FUEA 1ANCA 1MTNB 1D4PB 1ZHPA 1THSH 1O2KA 3LGTA 1JRSA 1IQNA 1TB6H 5C20A 2W5EA 4GCHF 3BTFE 2BDHA 2XBVA 1SQTA 2AMDA 2OC7A 3RMOH 1K21H 3BG4C 1GHAF 2F9PA 1T7CA 1YPHC 2ZU5A 1BTYA 3VB5A 1GPZA 2FODA 1SQOA 1EX3A 3ZZ4A 1LPGB 4NIXA 1ZTLA 3RDZA 2A4GA 2B0FA 4WMFA 2F9NA 2WYJA 2P93A 1TRNA 3TNTA 1O38A 3U9AH 4LK4A 4B2AA 1SGYE 3V13A 4MLFB 1TNHA 4H42U 3DT0H 1QL7A 1C1PA 1H9IE 1OP0A 2D2DA 1CE5A 5F6MA 3SGQE 2P95A 5JBBS 1IQHA 1K22H 4CR5A 2F9VA 1B0EA 2HRVA 5DO4H 3CS7A 1KXDA 2ZU2A 1F7ZA 3RP2A 4INKA 3UFAA 1YKTA 1G9IE 1GMHF 2ZDAH 1GMCG 1C1OA 3I77A 4Y0ZE 1EP5A 2ZHFH 4U32A 5JB8S 1UHBA 1ESAA 3MU5A 1DLEA 1OWHA 3M37A 1LMWB 3ZVFA 3TGIE 3LC5A 4KTSA 2JH6D 1NRRH 1SL3A 3RXPA 3U1IB 3GY4A 5HMAA 4X8UH 2ZGHA 3NPSA 1MBMA 1MZDA 3RXFA 5F8TA 2OD3B 3BIUH 4ZHMU 1N6XA 1K1PA 1V2VT 1OWKA 3PB1E 4ISOA 3KCGH 1G36A 2KAIA 4Y6DA 2FP7B 1NO9H 1MQ5A 1S82A 1LVMA 3LGWA 1LQDB 4X2WA 1IQJA 1BITA 1HJAC 3F9GA 5C67A 1H9HE 1JWTA 4X8VH 3A88A 5JDUB 3P8FA 1ESTA 2CXVA 1BDAA 1AWHB 1Z71A 3PLBA 4GHTA 1V2TT 4FUDA 1BBRH 1RXPA 2VH0A 1M9UA 4TWYA 4HFPB 5ABWA 1C5VA 1YLDA 5CMXH 1BHXF 3MTYA 2EI6A 1W7XH 3B9FH 3QZRA 2FOFA 1ZGVA 4D76A 3FANA 1NU7B 1CT2E 1C9PA 1SGNE 4IBLH 1RD3B 3UWIA 3PTBA 1QHRB 2W3KA 3BG4B 1S85A 1BRUP 1OX1A 1ZOMA 1G30B 1HAVA 1NS3A 1TPSA 2VIDA 1GI1A 4TPIZ 1LDTT 4U30A 2FI4E 2QXJA 4ZKOU 4DG4A 3OU0A 4NIWA 3SI3H 1TNIA 4JZFH 3LPRA 4NCYA 2ZGJA 1G32B 2ZFFH 2PGQB 4AGKA 2ZCHP 4NG9H 1UTLM 1SGEE 1K2I1 3E91A 3A8AA 2PKSB 2QY0B 4DIHH 4ABFA 3EGKH 4ABEA 4WVPE 4UEHH 2P3TB 5LGOA 2RA0A 1UCYK 2Z3EA 1V2KT 1HJ9A 1GI0A 1H8DH 1NM6A 4JCNA 5EQRA 1LKAA 3LONA 3MU4A 1Y3YA 2QIQA 3PM3A 2WPHS 4XDEA 3ZVEA 1ZYOA 2ZFRH 1AFQC 1O2PA 3UNQA 5DP5A 2ZTYA 1BT7A 1C5YB 1RS0A 1O2QA 1A5IA 5C5OA 1XXDA 2ODPA 2ZP0H 2HALA 1PQ7A 2EEKA 4WH8A 3AAUA 4A1XA 3SUGA 1GMDG 1JOUB 3H5CB 4X0WU 1C5ZB 4BAMB 1SLWB 2FESH 1JXPA 3SNBA 2I6SA 3A8BA 2BLOA 5DK1A 1UHBB 2GT7A 1PQ8A 1HJAB 1DM4B 1DS2E 1O3IA 1A7SA 1MTSA 3PROA 1D6RA 1D3QB 1ETTH 1T4UH 1QRXA 1O3OA 2ZWLH 5A0CA 1MH0A 3A80A 1DDJA 2Z9GA 2ZNKH 3NKKA 3W94A 3DHKH 4JZIA 7KMEH 3HGPA 1PPHE 2GGVB 4H6SB 3P17H 2PSYA 3U8TH 3M7UA 1C5MD 5A8ZA 1C1VH 1Y5AT 1YCPH 2SFAA 1AKSB 2PLXA 5C5NA 1HDTH 1N6YA 2GVFA 3M5NA 3SNCA 1YPLH 6ESTA 3DFLA 4WWYA 2BOKA 4R8TB 2YNAA 5DP9A 4E06H 1YLCA 1A5HA 3MH6A 1QB9A 2Q6FA 2O8MA 3QX5H 4ZHAA 1W0ZU 1A5GH 5FX6A 2LNCA 4ABDA 1PPFE 2C93B 1UO6A 1O3LA 2WV5A 1HAPH 1VGCC 1S84A 1LPZB 1D6WA 1HAVB 1SVPA 4OS1A 3U1JB 3GCOA 1T8NA 1O2OA 1S5SA 2GDEH 1QURH 3ZZ8A 1VJAU 1WQVH 1MAYA 3BEIB 1TRYA 2QYIA 2AERH 1AFQB 2ZTXA 3MNBA 1MD7A 4UONA 1FMGA 1KXEA 3DD2H 1GJ7B 2Z9JA 4MG3A 3RMMH 1DOJA 3BSQA 1TQ0B 2HNTE 4JZDH 1QBVH 2BDYA 3MMGA 4UFEH 1GG6C 2G8TA 1DLKB 3JZ1B 3L6PA 4OGYA 3RUOA 1V2ST 1C2EA 1Z6JH 4GUXA 4UD9H 1SMFE 2BD5A 1MUEB 1DE7H 1O3HA 3QGNB 2Z94A 3MH7A 2A45B 4Q7ZA 2WUCA 3KGPA 3RXUA 5FAHA 4DT7B 3A83A 1LPKB 5LPFA 2ODQA 3M3VA 1C1TA 1IQGA 1C2FA 2ZDVH 3LKWA 5FHTA 1BMNH 1ZLRA 2VVCA 1HIAB 2XCFA 1KSNA 2FO9A 2C4FH 2FEQH 3A81A 4X2XA 4NGAH 5ETXA 5C1UA 4DJZB 1WYKA 3HK3B 2EI8A 2DE8A 4AFZA 1TALA 1O3CA 4HZHA 2IOTA 3K6YA 3KQBA 5FPTA 1GVZA 4ISLA 1TYNA 1SFIA 2JH0D 1F0UA 5I46H 2R0LA 2WPMS 4CH2B 1IQIA 5DPAA 1GJ8B 3SV7A 4SGBE 2J94A 1FY3A 4FXGH 2UWPA 2A4RA 1FDPA 2ZFSA 2FDAA 4AFUA 3LGIA 1FAXA 2BDIA 1VCQA 5HGGA 4ZAEA 2O8TA 1Y5UT 3IWMA 1BB0B 4I8GA 3VB3A 1EASA 1GVKB 2HOBA 1FAKH 3ATWA 1IOEA 2A7HA 3ATKA 1C2HA 4YM9A 3R3GB 2BMGB 5DP7A 1PFXC 3SJ8A 2VWLA 1DITH 1SPJA 1GBFA 4BAHB 2ZKSA 3B8JA 2G4UA 4CRBA 1H1BA 5HYOA 4GHQA 3PYHA 2FOBA 3D49H 1QJ7B 1KTSB 3BTGE 1F5KU 1C1RA 5TCAA 4K60A 1FJSA 5IDKA 2FOMB 2STBE 4TY6A 2OP9A 1U6QA 1ELVA 2H5CA 2FS9A 1LO6A 4M7GA 2VVVA 1GBTA 2JKHA 1C1UH 2PGBB 1BJVA 1GG6B 1HLTH 1V2MT 4AORA 1YM0A 3MH4A 2XC5A 1O2IA 3RXVA 3SJKA 1K1MA 1AN1E 4ABAA 4VGCB 2P59A 1EXFA 1TPOA 2BY8X 2ZPQA 5CE1A 1Z7KA 2VB0A 3P95A 1BRBE 1V2PT 2YOLA 5GCHG 2WYGA 1NC6A 1K9OE 1LQEA 1X7AC 4B71A 2OC8A 2ZDKA 4AB8A 1A2CH 1RRKA 2D1JA 2XYAA 1P2MA 1BBRK 2VWOA 1TGBA 1WV7H 1UVTH 4IW4E 1PPBH
chains in the Genus database with same CATH superfamily
3E6PH 3RU4T 1GHBG 1E35B 2PHBA 2Y5HA 4K1EA 1GBCA 2BM2A 3SJOA 2NU0E 2F9BH 6GCHG 3K9XB 5EXNA 1W3CA 8LPRA 1PYTD 4D9RA 1NESE 1EAWA 1N8OC 1XMNB 4I32A 1UTJA 4FUIA 2QE7D 5GWZA 3P6ZB 2ZU1A 1Y5BT 2YMSC 3M36A 3SU1A 2PFEA 3U69H 2R0KA 1EFRD 3U98H 2QCYA 2XWAA 1PJPA 2PUQH 5F8ZA 3SUEA 2OBOA 2GTBA 2RCEA 3RC5A 1W0KD 1Q2WA 3GY2A 1O33A 1CGHA 7GCHF 1WCZA 1MKWH 1UTNA 1FONA 4X8TH 2TGAA 1TBRH 1MTUA 1FPCH 2KM0A 3LJOA 2BVRH 1BRCE 4JYUH 3T27A 3KQ5A 2R2MB 2A2QH 2WUBA 8GCHG 1SGPE 4MTBA 5JPMH 4BOHA 1SOZA 1MKXH 1SHHB 1TAWA 3EA9A 1T4VH 1UVUH 4ZKRU 2BD4A 4YO9A 4NSVA 1OYQA 3SO3A 1NU9A 1CO7E 2FMJA 1ACBE 1CU1A 1SI5H 5BRRE 2V3OH 5C1XA 3VGCC 1G3BA 1HGTH 1O3BA 3HK6B 1IAUA 1HAXB 4FETA 1BQYA 1K1LA 1ZMJA 1TX7A 5EOKA 5E8EH 3P8GA 4E05H 1QBNA 2F91A 4RT0A 1CHOF 1KLIH 1F2SE 4GVUA 1HBTH 1XKBC 4TYDA 1L4ZA 4AC9A 1YF4A 3EQ0H 1AWFH 3BTWE 3HGNA 1J9CH 1H4WA 3FN8A 3EA7A 3PWCA 3PMAB 1PPCE 2NWNA 2PSXA 4AFQA 1E38B 1DWDH 5AF9H 3PMHB 1C4Y2 1O5GH 1ORFA 1TGCA 2GCTC 2WPDD 1NN6A 1BMFD 2CHAC 3SV6A 4QT8C 1GMHG 1TABE 2GV7A 2J9NA 1ZMLA 2UWLA 1AB9B 1UTOA 3U8RH 2P3UB 3RC6A 2ALVA 2ZIQH 3T62A 1GI9B 2NU3E 2M5TA 1O2WA 3E1XB 1O2YA 1QFKH 2ZCKP 3ATIA 4NIYA 1SSXA 3IG6B 1C2DA 1O2RA 2SGDE 1OS8A 2IJOB 5DGJA 2C90B 2ZGCA 5K0HA 4FOUC 2AIQA 1BMAA 2RG3A 5EIYA 4WF8A 2RFKC 2BX4A 1A46H 4FU7A 4YOGA 4AB9A 1OPHB 1GBKA 1OOKB 3ODDA 3RXHA 1YBWA 4I8HA 4BAOB 1GCTC 2C8YB 1EQ9A 3B23B 3M3SA 1G2MA 4CRGA 2ZHEH 1QNJA 2ZZUH 3M5OA 1TNKA 1HAOH 4E7RG 2TGDA 4DGJA 2YMSB 4AFSA 1GI3A 3NZIA 3TJVA 1AE5A 1UVSH 1RJXB 1TOMH 3TJNA 1IQKA 4D7FA 2ZFTA 1XUKA 2BZ6H 4X8SH 1KXAA 4HGCA 1FY4A 1GHVH 1C5LH 1P2QA 2ZCLP 4X6NA 3H7OA 1UVPA 3ENSB 5EODA 3ZIAD 2CJIA 3ZYEA 1TGTA 1P8VC 4ZUHA 1HXEH 3H7TA 1S83A 1ELEE 1JIRA 1TNJA 1HPGA 1W8BH 2PKAB 3DUXH 4MQAA 1P03A 4CHAB 2GX4A 4KKDA 3LH3A 2J38A 2GMTC 1E34B 2XNDD 1K1IA 2ESTE 4XFQA 3GCTG 2TRMA 1WU1A 2BDAA 4Y8ZA 3ZVDA 3A8DA 2QF0A 4F55A 2BLVA 3N7DA 1WXRA 3EDXB 1T8LA 1GJCB 3N7OA 1B0FA 5FPSA 1Z6EA 3S7KB 1F5RA 4B75A 3AASA 5H4IB 1P01A 5LH8A 3AAVA 1UTKA 2BB4A 4HG6A 4WMDA 4ABJA 5A8YA 3VXEH 1BBRE 2UWOA 2OTVA 3PLKA 2BVXH 1NBME 3F9FA 2XWBI 1QJ1B 2C8ZB 3E0PB 2L74A 1V2QT 4P00A 1IQLA 3I29A 1AY6H 2GCTB 2G55A 3K6ZA 2GT8A 2CHAB 1P57B 3BTHE 3TJUA 3OY5U 4A6LA 2WPJS 2G5NA 2BY9X 4HTCH 3DCLA 3E90B 2HLDD 1P2JA 3ZV9A 1NFWA 3FVFB 1ZR0A 1DWBH 2XC0A 2ZU4A 5EW1H 1SQAA 1QRZA 2FI5E 3VPKA 2XBXA 1SBWA 3L33A 1AKSA 2FOCA 1AUTC 1EOLA 3GYLB 4KP0A 4LXBH 5FPYA 1BTHH 1TLDA 4AYVB 2B9LA 1O2TA 2VNTA 1SGCA 1C5PA 3TGKE 4BAQB 1ZRBA 1ANBA 2EC9H 3A7VA 3EE7A 1GCTB 1O5DH 3ZZDA 3SU5A 1VITG 3SU4A 3F6UH 1GI4A 2J98A 1KDQB 1BTZA 1TMBH 3TIUA 4A7IB 3GISB 4IN2A 1L2EA 3G01A 5EQQA 1E0FD 1VR1H 1Y3UA 3TLOA 4OS7A 4LZ4B 1AUJA 1HNEE 1TA6A 2GCHG 1SGFA 4LOYH 2AMQA 5FCRA 1O3FA 4A1TA 3CS0A 2V0BA 1O32A 3SBKA 1Z1JA 1YPGH 2ZQ2A 4X1SU 1EB1H 1ETSH 3U28C 4SGAE 3K65B 2DUCA 1HXFH 1Y59T 1LHEH 2Q6DA 1P9UA 4Y7BA 1BTWA 2W3IA 3UNRA 2XC4A 3RXOA 4K1TA 2AMPA 2G52A 3O8RA 2Y6TA 3T2NA 4AN7A 4LZ1H 2FYQA 1HUTH 1A4WH 4CRDA 3MI4A 4DY7B 1EJMA 3QZQA 4Y8XA 2GZ9A 5FXLA 4IMQA 3TK5A 2BZAA 2SNVA 3ZZ3A 5T3HA 4AYYB 3UOPA 4A92A 4O3UA 1CT0E 1OWEA 1GMCF 1C1QA 1TX8A 2C3SA 2FOGA 2O8WA 1GJ6A 1O2NA 5IYTA 6CHAC 4NFEA 1AIXH 1GBAA 2VGCC 2QF3A 1SGDE 2KCYA 1GJDB 1MCVA 1EJAA 1XUJA 3ZZ6A 3ZZ9A 3N7EA 2B5TB 4K8YA 1HIAA 3SQEE 1THRH 5JBTA 1AFEH 3HPTB 3KEEA 2BDBA 3UNSA 3S0NA 1NRQH 4I86A 1GVLA 3RXKA 1RTKA 1KYNA 2P3FH 2G51A 4X1RU 4FVDA 1L4DA 2ANWA 2GDDA 4RSPA 3SUFA 1AI8H 3LH1A 2WPLS 4NSYA 2VWMA 2ZDLA 5HIZA 5A0BA 1NFUA 3RXJA 5EPYA 1HYLA 3KYFA 1ZSLA 4E7NA 3P8OA 4X2YA 3RLYH 2J97A 3M61U 5B6OA 1ELTA 3L3TA 3T28A 3ZZ7A 3CP7A 4IMZA 3RXEA 2JDID 8ESTE 1FI8A 4XBCA 3EAJA 4UFGH 1TGNA 2HNTC 1O2UA 3BTEE 2CN0H 1SGFG 2UUKB 4TSFD 1B7XB 1FZZA 4ZH8A 3QK1A 3QLPH 5FCKA 3SNEA 1HAHH 2OINA 1DWCH 1QJ6B 3FP6E 1O2MA 1MKWK 1TMTH 3A86A 2AGIX 1K0HA 1UK2A 2FX4A 4Z6AH 1HCGA 4D9QA 2J98B 2Y82A 5GJ4B 1O2VA 2ZHDA 1ZJKA 1EJNA 1O37A 3TPIZ 2AH4X 2V3MA 5DG6A 1GI5A 1EB2A 1FN6A 1AU8A 3NK8A 5L2YH 2J34A 4ZCNA 3W95A 5KGOA 4YZUA 3SNDA 4GAWA 3LU9B 3LT3A 2THFB 3KNXA 3P70B 1BOQA 1TNGA 1O5EH 1C5WB 3GDUA 4CRCA 2Y7XA 1EAIA 1DPOA 3F2HA 1TOCB 1FIWA 3TK9A 1QCPA 1P12E 3T5FH 1NBMD 5DKMA 4JZEH 1MU6B 3RXAA 2P16A 3MNSA 5DP4A 4TPYA 1PPGE 1VKYA 5EW2H 1SKYE 1H9LB 1DSUA 3KQDA 1O3KA 1BMMH 1CA0C 1GMDF 3SV9A 3FAOA 1ZPZA 3TJOA 1CQQA 2R2WU 3SV8A 3MH5A 2BD7A 1P09A 1O2ZA 2EA3A 1UK4A 3M5LA 3A84A 4NWKA 2Y80A 1FIZA 5JB9S 2H9HA 5DP8A 5C3NA 1OWDA 3HATH 4X6MA 2AFQB 3FFGA 3QWCH 5G4BA 4YLQH 2ZTZA 1GHXH 2QXHA 1KXFA 4H6TA 3UR9A 1P11E 3BTQE 2FLRH 2V7QD 1ZZZA 1EKBB 3V12A 1C5SA 1GBHA 1HAZB 1GHWH 2XBWA 1ID5H 1GJ4H 2XNIA 1V2JT 2BQ6B 1AQ7A 2C8WB 1QIXB 3GDSA 1N1LA 1O39A 5EJZA 1AZZA 1NT1A 4K2YA 1PPEE 4MNXA 1HB0B 2VIOA 2ZFQH 5DP6A 1C1NA 1GBIA 2FYRA 4MVNA 2CGAA 1PQ5A 4FUBA 1UCYE 4FVBA 1O35A 2GZ7A 2OC1A 3KQEA 1SLXB 3Q3XA 2C8XB 2K8IA 3I78A 2LELA 3OTPA 1AVXA 2OUAA 2Y5FA 5KECA 2TGTA 3RXBA 2QV1A 5A2MH 1CHGA 2NU4E 4R0IA 1INCA 5EGMA 1GJBB 2BHGA 1DXPA 4MPVA 1SFQB 2V3HH 4XOJA 4IS5A 4MNWA 1V3XA 1EZQA 1XM1A 2HLCA 1AMHA 1QA7A 1C5XB 3VEQB 5IK2D 1UTPA 1SLUB 2XRCA 1J14A 3ZVAA 1MAXA 1VGCB 1HRTH 3BIVH 1ZMNA 2A31A 1J15A 4OGXA 1P06A 5KEDA 4ABIA 1NROH 1K1NA 1MQ6A 3ZV8A 2Z3DA 2AS9A 3QO6A 2R9PA 1WOFA 5TJXA 1QR3E 1GCDA 2OBQA 5T6GA 4F48B 2G81E 3MYWA 3TU7H 3QTOH 1EZSC 2GV6A 3TK6A 1QB6A 1E36B 1NPMA 3KIDU 4ISIH 3UUZA 4NA8A 3GS9A 1P10A 2BD8A 3BN9A 4D7GA 1CA0B 2AIPA 3P92A 5EXLA 1NZQH 1G3EA 1XUHA 1ZTJA 3GCHC 1SLVB 1OP8A 6LPRA 4BTUB 3V0XA 3GICB 4I31A 1RGQA 2OXSA 4UE7H 3SGAE 3SORA 3DSOA 1C2MA 1DICA 3GY5A 4ZKSU 3RXIA 5GPIB 1L1NA 4KELA 2SGEE 2FOAA 4BAKB 1SC8U 2Z9IA 1EPTC 2JETC 4AOQA 2F4LA 1AGJA 1YLNA 1A3EH 1MMJN 1J16A 2LPRA 3RMLH 4BTTB 1P9SA 1SQRA 1IHSH 1ZPBA 3BV9B 5EQSA 4JK6A 3RXQA 4BXSA 1OHHD 4TWWA 1LHGH 2UUYA 3QTVH 1C1SA 4OS4A 1DSTA 2CK3D 3RXRA 4DW2U 3NRLA 5C2ZA 4RI0A 1ZGIA 1FY1A 1SHYA 3TNSA 2QXIA 3HKIB 4WXIA 4CRFA 1H8HD 1O34A 2A32A 1P0SH 1CGIE 2VIPA 1RFNA 1DX5M 4I8JA 3Q77A 1P02A 3UR6A 1ARCA 2FZZA 1C5NH 3E8LA 2PKAA 1YGCH 4ZXYH 1GI8B 1E79D 1XXFA 3UREA 1Z8GA 4Z1MD 3BTKE 1UMAH 3RLWH 4X6OA 2IN2A 1IQMA 3JZ2B 4I8LA 2Q6GA 2WV9A 4I7YH 4GCHG 1NY22 1GBLA 2ZPSA 1FPHH 3PLPA 2H2ZA 2WPKS 2ZHQH 2YNBA 4GSOA 3OEHD 3UIRA 2QGRA 2TIOA 1JRTA 1GHAG 4OS6A 1C5OH 1Y3VA 1C2KA 4I33A 1W0JD 2BDCA 2A0QB 4DCDA 1P3EA 4YESB 1ESBA 3DSGA 4Y76A 2IPHA 3TH4H 1F0TA 3PMJA 1V2LT 2FIRH 2KFWA 1E1QD 1CA8B 2BXUH 3SU2A 1OWJA 2TPIZ 3T25A 1GBBA 1SR5C 1XX9A 2FM2A 3HKJB 3MQKC 2HPQH 4PROA 3ZVCA 1JBUH 2KCOA 2CV3A 5T6FA 5A09A 1C2IA 1DUEA 1L1JA 2HGTH 2OC0A 2FOEA 2RDEA 4IC5A 2DE9A 4X1PU 4UFFH 2EI7A 1PPZA 1GHZA 1TRMA 2Y5GA 1C1MA 2ZEBA 3F1SB 1HAGE 4Q80A 4ABHA 1YC0A 1ETRH 3GCHB 4TY7A 3LIWA 1KTTB 1VJ9U 5E0JA 2VWNA 2A7JA 3ZZBA 2QA9E 1ZHMA 2PTNA 1FLEE 1KXCA 4KTUA 2OQUA 8KME2 5GCHF 3KF2A 1OSSA 2ZGBH 2KZ4A 4O03A 1WUNH 1CT4E 1G3CA 2WPIS 4YT7H 1KDQA 5F8XA 1C4V2 1TX6A 3M35A 2BQWB 5T1VA 4ABBA 2BX3A 2P8OC 1F0RA 1GL0E 3SJ9A 2QF4A 1O2LA 1VCPA 3TH3H 1ZSKA 1O2XA 2G5VA 5FBEA 2GP9B 1TBZH 3Q76A 5J4QA 1FX0B 3PTNA 1TPPA 4NFFA 3F68H 1DWEH 1N8OB 1A61H 1Q3XA 1QZ8A 4YTAA 1UTMA 2Z9KA 1C4U2 2FWWA 4K1SA 3T26A 1YCPK 1HAIH 3A7XA 5GNDA 3SI4H 1TNLA 1UK3A 2NU1E 4RN6A 4WH6A 2XTTB 4INLA 1TMUH 1EZUC 2ZF0H 3ZVBA 2ODYB 1CVWH 3BTDE 2R3YA 1YPKH 4Y10E 1AO5A 1O2JA 5EG4A 1YPJH 2VINA 3A7YA 1TE0A 4B1TA 3PV4A 8GCHF 5JBAS 2O8LA 1HJ8A 1O5BB 5ESBA 4CH8B 1ARBA 1GI7B 3TH2H 2ZHWH 4O3TA 1S0QA 4I8KA 4MNYA 1EUFA 2VJ1A 4YOIA 4NZLA 2LP6A 3QN7A 3DFJA 1FQ3A 2K1QA 5F53A 4XSKU 1YCPM 2AYWA 3A82A 3VGCB 2ZC9H 1P2OA 1TPAE 5T6DA 4B2BA 1FV9A 2BD3A 3RU4D 5HM2A 1AHTH 3PRDA 3AW1A 4ISNA 2D26C 1BHXB 2A5AA 2IJD1 5B6LA 4FU9A 1O2HA 1LVOA 2SNWA 3TVJB 3OYPA 3SV2H 2PKSC 2OK5A 4NWLA 5AFYH 5A0AE 4DURA 4YT6H 5C1YA 3GYMA 2ZGXH 4X6PA 1ELDE 1A0JA 3RXDA 2XOKD 1YP9A 1LHFH 3SOSA 1TGSZ 4F49A 3KQCA 3MNXA 3URCA 3UQOA 3SHAH 1TONA 3EE0B 1BTPA 1CBWC 2GD4B 4Y79A 1H8ED 4ISHH 1QQ4A 3UY9A 2Y81A 4ASUD 2F83A 1O3NA 3VB6A 3SZNA 4CR9A 1SGRE 4RKOB 2D8WA 1V2NT 3MU0A 5JYIA 3ZYDA 3PMBB 3UPEA 2H9TH 3ZVGA 1C2GA 1BA8B 3MFJA 1UTQA 1EAXA 3RMNH 4A1VA 2P8OB 1YPHE 4X2VA 3KHVA 3SQHE 3RC4A 1J8AA 3LGVA 3E16B 1MABB 3S9AA 3SNAA 3UQVA 1DY8A 2WINI 2A1DB 4FUJA 1T31A 3OE7D 1QTFA 2ZU3A 3IITA 2ZA5A 1V6DA 1XUGA 1GJAB 5AVDA 3A7TA 3A7ZA 2RA3A 1TA2A 2BY5X 1O3GA 4FUCA 3VB4A 1ELAA 4AG2A 4XBBA 3OSYA 4FUFA 1LHCH 1AE8H 2Z6BD 3CENA 1DANH 1V2OT 1ZSJA 1EZXC 3PWBA 1F0SA 1O31A 1OXGA 5L2ZH 2A4QA 3BF6H 1QGFA 2BY6X 1RIWC 2CF9H 2A2XH 2GZ8A 3CNRA 3SU0A 5LPEA 1NTPA 1GHYH 4B73A 3S7HB 2BLQA 1D9IA 4Y0YE 3NXPA 3BEUA 1GI2A 2GMTB 3GCTF 2VIWA 1KLJH 3S9CA 1KMHB 1PQAA 2JJ2D 3WY8A 3R0FA 1VITH 1LVBA 1JIMA 1GGDC 4Y11E 2ANKH 4JYVH 2AGEX 4TT3D 1QBOA 1PYTC 1W2KH 2G00A 1YPEH 1BMLA 1ZJDA 2CF8H 2ANYA 3F9HA 5DP3A 4K5ZA 4UFDH 2H6MA 2AGGX 4Z0KA 1GBDA 1K1OA 2XCNA 4J1YA 4B6FA 1BUIA 1LTOA 1W7GH 3GY8A 9LPRA 4ESTE 3ESTA 1C9TA 1T8OA 2FI3E 3PRBA 1D3TB 1AVWA 4WXVA 4B76A 1FN8A 3H09A 1O2SA 3GY6A 1Z8JB 3MU1A 4ZROA 5K7RA 1Q31A 1WDIA 3M3TA 1B5GH 1SB1H 1CBWB 1QA0A 3BTTE 1GL1A 5LPRA 1NRNH 1Z8IB 1WQSA 3M7QA 2QXGA 3NWUA 5SGAE 4ASHA 3LGYA 2SGQE 2XXLA 3SYJA 5EJLA 2FXRA 1P04A 1OKXA 1S6LA 3UAIC 1MTVA 1AVGH 2V6NA 1IQFA 2YMSD 1W10U 4NA9H 4J2YB 3URDA 1A0LA 1O5CB 4ZXXH 3D65E 1RTLA 2VU8E 3M7TA 9ESTA 4DVAU 3SUDA 3A89A 3D62A 4BANB 1P2NA 1GDQA 1DY9A 1P05A 2VH6A 4Y7AA 1RTFB 1EOJA 1VITF 1GWAA 4Q7YA 4XRNA 3O8CA 1ELCA 2WHXA 3AVZA 1EATA 4B2CA 1IHTH 2PW8H 2FX6A 1V2WT 4ZMAH 2BOHB 1YWUA 1W11U 2GCHF 2BY7X 2KAIB 3MU8A 4K3JA 2Z9LA 1YYY1 1KY9A 1XVOA 3RM2H 2J95A 1QRWA 2PUXB 4FUHA 4K69A 2Y7ZA 3SN8A 3ZZAA 1G2LA 2ASUB 3E0NB 2SGPE 1MTWA 3BEFB 3EA8A 1RIWB 1W12U 3STIA 4YLUA 4U01A 1GDUA 1MKXK 4F4OC 3A7WA 3NCLA 1CGJE 1YPMH 4NIVA 2SGAA 1SGQE 3V3MA 1EAUA 3RXCA 1D3PB 3UTUH 2TBSA 1GGDB 1S0RA 1Z8RA 3ITIA 1QQUA 5EU8A 2HVXA 2SGFE 4WMEA 5AHGH 1O2GH 2IPQX 3LOXA 3N99A 2WZQA 4X1QU 3LJJA 4IN1A 1FXYA 3QDZB 2XW9A 3ZZ5A 1C5QA 1BTUA 3KYGA 1XVMA 3S69A 3MO3A 3VFEA 2PWXA 2ZPRA 5PTPA 5J4SA 2W7SA 6CHAB 2TGPZ 1ZTKA 2VGCB 4Y8YA 1ANDA 2VIQA 1BJUA 3GY7A 1XKAC 1GJ9B 5L6NH 1ELBA 2W26A 1P2KA 5AFZH 3V7TA 3VG8A 2RDLA 2BXTH 1Y3XA 1F92A 3VXFH 1MBQA 1J17T 2NU2E 1O5FH 5HKKD 5JBCS 1D3DB 3FP8E 4AX9H 1KXBA 2HWLB 2PR3A 1ZRKA 1E37B 3RXTA 2ZECA 4INHA 2WV4A 1FY5A 2CMYA 2ZG0H 1O36A 2J92A 1O5AB 1O3DA 2ZO3H 2JIZD 4JZ1A 4KGAA 1THPB 1K1JA 2H9EH 4Y71A 2F9UA 2QAAA 3Q3YA 2K0QA 4GLYA 3U8OH 3BTME 2KCAA 4IC6A 5C17A 1O3AA 3F2FA 1K28D 1G3DA 3P8NA 4VGCC 2W7UA 4JYTA 3ATMA 1V2RT 2ALPA 1SGTA 5CDFE 1L1GA 1C5UA 5GXPA 2A5KA 5BPEA 1EP6A 3PO1C 3OY6U 4A5TS 3QGJA 4MPXA 1WAYB 3MO9A 4MPWA 4ABGA 4ACBA 2BYAX 4B74A 3TITA 3E3TA 4D8NA 2A5IA 5CHAC 2H1UA 4CBOA 4XE4A 3SU6A 4AZ2B 2PTCE 1UJ1A 1TFXA 5E2PA 3GY3A 3UWJH 2I6QA 4WY3A 1C5RA 2R3UA 3ODFA 2BD9A 2M2AA 1WTHD 2ZQ1A 2V35A 4RKJB 5HIYA 1C2JA 1LVYA 1W0YH 3NUMA 1DT2A 4ACAA 4CBNA 3RM0H 1S81A 1W13U 3LC3A 1ZPCA 1QB1A 3RXMA 1BZXE 4NZQA 1S6HA 1P2IA 1QL9A 5EXMA 1F5LA 4DOQA 2HVYB 4NA7A 7GCHG 5I25A 4CRAA 4BNRA 2AEIH 1TBQH 2F9OA 3FZZA 2ZFPH 4ZHLU 3RU4E 1DXWA 1Y3WA 1BIOA 4UDWH 3UOUA 1BRAA 2A7CA 5HXFA 5F03A 3Q3KA 3C27B 2BTCE 5DJ7A 1BCUH 2UUJB 2FPZA 2FOHA 1A0HB 4FUGA 3SJIA 4BTIB 1UCYH 3TGJE 3MHWU 1G37A 2JH5D 4OM9A 1C1WH 4THNH 3ZZCA 3SU3A 3LDXH 4BXWA 1O3PB 3FZDA 1EPTA 2EY4C 1GJ5H 2ZDMA 3ATLA 1AZ8A 1GDNA 2FS8A 7LPRA 1CHOG 1OP2A 5L30H 1WTGH 2HNTF 2BLWA 3M5MA 5E0HA 2QN5T 1ZHRA 4B6EA 4U2WA 1KLTA 3F0OA 1O3MA 4MDSA 4XD7D 3O8BA 1DFPA 1SGIB 1O3JA 3FP7E 1BTXA 1W14U 1MZAA 2F3CE 1LKBA 4HI3A 3ELAH 4MNVA 5FL7D 2ILNA 4WJG2 2VVUA 2BDGA 3FO8D 4K8BA 3VB7A 1FNIA 2KX4A 4AGJA 1SOTA 1Y8TA 1WBGB 3LGUA 4ZKNU 1AB9C 3A85A 3S9BA 3KN2A 3OTJE 3MOCA 1SG8B 3PO1B 5ESTE 2BD2A 2J4IA 1DVAH 1TQ7B 4O9VA 4GPGA 2BQ7B 1LHDH 1A3BH 2UUFB 5EJ1A 1MCTA 5CHAB 5A8XA 3MWIU 3RXGA 2ULLA 2O8UA 5GDSH 3OAAD 1VZQH 1FUJA 2O9QA 1MTNC 1V2UT 2ANMH 3Q00A 2J2UA 1TIOA 1JMOH 5EPNA 4XBDA 1OWIA 2GKVE 2Q1JA 1AD8H 3OX7U 1DUAA 1XUFA 2OQ5A 1O30A 4IGDA 2QC2A 2ZI2H 3WWFA 2B7DH 5TCCA 2BVSH 4X1NU 7ESTE 1T32A 4KTCA 3GOVB 1ABIH 1GBMA 3SW2B 3BG8A 2XBYA 5FX5A 3AW0A 3KL6A 1ELGA 3RXSA 2FLBH 4Q63A 1XUIA 1T8MA 1QL8A 3SGBE 3A87A 3STJA 3QUMP 2Z7FE 1IQEA 1L0ZA 1HV7A 1NRPH 1TWXB 2B8OH 4CHAC 1P3CA 3PV5A 5E0GA 3O8DA 2PV9B 2VIVA 1ANEA 1HFDA 1QY6A 1CSOE 3T29A 4CREA 1LCYA 3DA9B 1GI6A 1OYTH 5FBIA 4O97A 2ZDNA 2P94A 2H5DA 1C5TA 5E2OA 1ABJH 2FTMA 5HM9A 1NFXA 3F9EA 1VCWA 1S6FA 2HPPH 1C2LA 4YXWD 2STAE 4FU8A 4MPUA 1NRSH 3A8CA 3RXLA 2FTLE 3K2UA 3MNCA 1GBJA 2G4TA 3GDVA 1ELFA 1O3EA 2OLGA 3C1KA 2Z3CA 1Z1IA 1EPTB 2JETB 4OS5A 1O0DH 5GIBA 4DIIH 4YOJA 1FY8E 1A1RA 1MU8B 1GHBF 2OCVB 4H4FA 2A4OA 4OS2A 3DSPA 1MD8A 6GCHF 1WSSH 3D23A 4Q7XA 3GCNA 3MO6A 4JMYA 4AG1A 4JK5A 1GBEA 1KIGH 1HAYB 3SHCH 1UVOA 4Q2KA 1NFYA 1H8IH 3EYDA 4FUEA 3FOAA 1ANCA 1COWD 1MTNB 1D4PB 1ZHPA 1THSH 3OFND 1O2KA 3LGTA 1JRSA 1IQNA 1TB6H 3SZEA 5C20A 2W5EA 4GCHF 3BTFE 2BDHA 2XBVA 1SQTA 2AMDA 2KR7A 2OC7A 3RMOH 1K21H 3BG4C 1GHAF 2F9PA 1T7CA 1YPHC 2ZU5A 1BTYA 3VB5A 1GPZA 2FODA 1SQOA 1EX3A 3ZZ4A 1LPGB 4NIXA 1ZTLA 3RDZA 2A4GA 2B0FA 4WMFA 2F9NA 2WYJA 2P93A 1TRNA 3TNTA 1O38A 4P02A 3U9AH 4LK4A 4B2AA 1SGYE 3V13A 4MLFB 1TNHA 4H42U 3DT0H 1QL7A 1C1PA 1H9IE 4M9FA 1OP0A 2D2DA 1CE5A 4Q4LA 5F6MA 3SGQE 2P95A 5CHBA 5JBBS 1IQHA 1K22H 4CR5A 2F9VA 1B0EA 2HRVA 5DO4H 3CS7A 3UB0A 1KXDA 2ZU2A 1F7ZA 3RP2A 2JJ1D 4INKA 3UFAA 1YKTA 1G9IE 1GMHF 2ZDAH 5DN6D 1GMCG 1C1OA 3I77A 4Y0ZE 1EP5A 2ZHFH 4U32A 5JB8S 1UHBA 1ESAA 3MU5A 1DLEA 1OWHA 3M37A 1LMWB 3ZVFA 3TGIE 3LC5A 4KTSA 2JH6D 1NRRH 1SL3A 3RXPA 2W6JD 3U1IB 3GY4A 5HMAA 4X8UH 2ZGHA 3NPSA 1MBMA 1MZDA 3RXFA 5F8TA 2OD3B 3BIUH 4ZHMU 1N6XA 1K1PA 1V2VT 1OWKA 3PB1E 4ISOA 3KCGH 1G36A 2KAIA 4Y6DA 2FP7B 1NO9H 1MQ5A 1S82A 1LVMA 3LGWA 1LQDB 4X2WA 1IQJA 1BITA 1HJAC 3F9GA 5C67A 1H9HE 1JWTA 4X8VH 3A88A 5JDUB 3P8FA 1ESTA 2CXVA 1BDAA 1AWHB 1Z71A 3PLBA 4GHTA 1V2TT 4FUDA 1BBRH 1RXPA 2VH0A 1M9UA 4TWYA 4HFPB 5ABWA 1C5VA 1YLDA 5CMXH 1BHXF 3MTYA 2EI6A 1W7XH 3B9FH 3QZRA 2FOFA 1ZGVA 4D76A 3FANA 1NU7B 1CT2E 1C9PA 1SGNE 4IBLH 1RD3B 3UWIA 3PTBA 1QHRB 1UW7A 2W3KA 3BG4B 1S85A 3OEED 1BRUP 3AK5A 1OX1A 1ZOMA 1G30B 1HAVA 1NS3A 1TPSA 2VIDA 1GI1A 4TPIZ 1LDTT 4U30A 2FI4E 2QXJA 5DSFA 4ZKOU 4DG4A 3OU0A 2W6ID 4NIWA 3SI3H 1TNIA 4JZFH 3LPRA 4NCYA 2ZGJA 1G32B 2ZFFH 2PGQB 4AGKA 2ZCHP 4NG9H 1UTLM 1SGEE 1K2I1 3E91A 3A8AA 2PKSB 2QY0B 4DIHH 4ABFA 3EGKH 4ABEA 4WVPE 4UEHH 2P3TB 5LGOA 2RA0A 1UCYK 2Z3EA 1V2KT 1HJ9A 1GI0A 1H8DH 1NM6A 4JCNA 5EQRA 1LKAA 1E1RD 3LONA 3MU4A 1Y3YA 2QIQA 3PM3A 2WPHS 4XDEA 3ZVEA 4DT4A 1ZYOA 2ZFRH 1AFQC 1O2PA 3UNQA 5DP5A 2ZTYA 1BT7A 1C5YB 1RS0A 1O2QA 1A5IA 5C5OA 1XXDA 2ODPA 2ZP0H 2HALA 1PQ7A 2EEKA 4WH8A 3AAUA 4A1XA 3SUGA 1GMDG 1JOUB 3H5CB 4X0WU 1C5ZB 4BAMB 1SLWB 2FESH 1JXPA 3SNBA 3F3BA 2I6SA 3A8BA 2BLOA 5DK1A 1UHBB 2GT7A 1PQ8A 1HJAB 1DM4B 1DS2E 1O3IA 1A7SA 1MTSA 3PROA 1D6RA 1D3QB 1ETTH 1T4UH 1QRXA 2GJGA 1O3OA 2ZWLH 5A0CA 1MH0A 3A80A 1DDJA 2Z9GA 2ZNKH 3NKKA 3W94A 3DHKH 4JZIA 2AHME 3WWBA 7KMEH 3HGPA 1PPHE 2GGVB 2PP6A 3P17H 4H6SB 3PV2A 2PSYA 3U8TH 3M7UA 1C5MD 5A8ZA 1C1VH 1Y5AT 1YCPH 2SFAA 1AKSB 2PLXA 5C5NA 1HDTH 1N6YA 2GVFA 3M5NA 3SNCA 1YPLH 6ESTA 3DFLA 4WWYA 2BOKA 4R8TB 2YNAA 3WW7A 5DP9A 4E06H 2EQNA 3FKSD 1YLCA 1A5HA 3MH6A 1QB9A 2Q6FA 2O8MA 3QX5H 4ZHAA 1W0ZU 1A5GH 5FX6A 2LNCA 4ABDA 1PPFE 2C93B 1UO6A 1O3LA 2WV5A 1HAPH 1VGCC 1S84A 1LPZB 1D6WA 1HAVB 1SVPA 4OS1A 3U1JB 3GCOA 1T8NA 1O2OA 1S5SA 2GDEH 1QURH 3ZZ8A 1VJAU 1WQVH 1MAYA 3BEIB 1TRYA 2QYIA 2AERH 1AFQB 2ZTXA 3MNBA 1MD7A 4UONA 1FMGA 1KXEA 3DD2H 1GJ7B 2Z9JA 4MG3A 3RMMH 2L6OA 1DOJA 3BSQA 1TQ0B 2HNTE 4JZDH 1QBVH 2BDYA 3MMGA 4UFEH 1GG6C 2G8TA 1DLKB 3JZ1B 3L6PA 4OGYA 3RUOA 1V2ST 1C2EA 1Z6JH 2QF5A 4GUXA 4UD9H 1SMFE 2BD5A 1MUEB 1DE7H 1O3HA 3QGNB 2Z94A 3MH7A 2A45B 2WSSD 4Q7ZA 2WUCA 3KGPA 3RXUA 5FAHA 5C0UA 4DT7B 3A83A 1LPKB 5LPFA 2ODQA 3M3VA 1C1TA 1IQGA 1C2FA 2ZDVH 3LKWA 5FHTA 1BMNH 1ZLRA 2VVCA 1HIAB 2XCFA 1KSNA 2FO9A 2C4FH 2FEQH 3A81A 4X2XA 4NGAH 5ETXA 5C1UA 4DJZB 1WYKA 3HK3B 2EI8A 2DE8A 4AFZA 1TALA 1O3CA 4HZHA 2IOTA 3K6YA 3KQBA 5FPTA 1GVZA 4ISLA 1TYNA 1SFIA 2JH0D 1F0UA 5I46H 2R0LA 2WPMS 4CH2B 1IQIA 5DPAA 5C0TA 1GJ8B 3SV7A 4SGBE 3F0PA 2J94A 1FY3A 4FXGH 2UWPA 2A4RA 1FDPA 2J5UA 2ZFSA 2FDAA 4AFUA 3LGIA 1FAXA 2BDIA 2VBCA 1VCQA 5HGGA 4ZAEA 2F43B 2O8TA 1Y5UT 3IWMA 1BB0B 4I8GA 1YY3A 3VB3A 1EASA 1GVKB 2HOBA 1FAKH 3ATWA 1IOEA 2A7HA 3ATKA 1C2HA 4YM9A 3R3GB 2BMGB 2KCPA 5DP7A 1PFXC 3SJ8A 2VWLA 1DITH 1SPJA 1GBFA 4BAHB 2ZKSA 3B8JA 2G4UA 4CRBA 1H1BA 5HYOA 4GHQA 3PYHA 2FOBA 3D49H 1QJ7B 1KTSB 3BTGE 1F5KU 1C1RA 5TCAA 4K60A 1FJSA 5IDKA 2FOMB 2STBE 4TY6A 2OP9A 1U6QA 1ELVA 2H5CA 2FS9A 1LO6A 3F2GA 4M7GA 2VVVA 1GBTA 2JKHA 1C1UH 2PGBB 1BJVA 1GG6B 1HLTH 1V2MT 4AORA 1YM0A 3MH4A 2XC5A 1O2IA 3RXVA 3SJKA 1K1MA 1AN1E 4ABAA 4RT1A 3W1EA 4VGCB 2P59A 1EXFA 1TPOA 2BY8X 2ZPQA 5CE1A 1Z7KA 2VB0A 3P95A 1BRBE 1V2PT 2YOLA 5GCHG 2WYGA 1NC6A 1K9OE 1LQEA 1X7AC 4B71A 2OC8A 2ZDKA 4AB8A 1A2CH 1RRKA 2D1JA 2XYAA 1P2MA 1BBRK 2VWOA 1TGBA 1WV7H 1UVTH 4IW4E 1PPBH 5C94A
chains in the Genus database with same CATH topology
3E6PH 3RU4T 1GHBG 1E35B 2PHBA 2Y5HA 4K1EA 1GBCA 2BM2A 3SJOA 2NU0E 2F9BH 6GCHG 3K9XB 5EXNA 1W3CA 8LPRA 1PYTD 4D9RA 1NESE 1EAWA 1N8OC 1XMNB 4I32A 1UTJA 4FUIA 5GWZA 3P6ZB 2ZU1A 1Y5BT 3SU1A 3M36A 2PFEA 3U69H 2R0KA 3U98H 2QCYA 2XWAA 1PJPA 2PUQH 5F8ZA 3SUEA 2OBOA 2GTBA 2RCEA 3RC5A 1Q2WA 3GY2A 1O33A 1CGHA 7GCHF 1WCZA 1MKWH 1UTNA 1FONA 4X8TH 2TGAA 1TBRH 1MTUA 1FPCH 3LJOA 2BVRH 1BRCE 4JYUH 3T27A 2R2MB 2A2QH 2WUBA 8GCHG 1SGPE 4MTBA 5JPMH 4BOHA 1SOZA 1MKXH 1SHHB 1TAWA 3EA9A 1T4VH 1UVUH 4ZKRU 2BD4A 4YO9A 4NSVA 1OYQA 3SO3A 1NU9A 1CO7E 2FMJA 1ACBE 1CU1A 1SI5H 5BRRE 2V3OH 5C1XA 3VGCC 1G3BA 1HGTH 1O3BA 3HK6B 1IAUA 1HAXB 1BQYA 1K1LA 1ZMJA 1TX7A 5EOKA 5E8EH 3P8GA 4E05H 1QBNA 2F91A 1CHOF 1KLIH 1F2SE 4GVUA 1HBTH 1XKBC 4TYDA 1L4ZA 1YF4A 3EQ0H 1AWFH 3BTWE 3HGNA 1J9CH 1H4WA 3PWCA 3EA7A 3PMAB 1PPCE 2NWNA 2PSXA 4AFQA 1E38B 1DWDH 5AF9H 3PMHB 1C4Y2 1O5GH 1ORFA 1TGCA 2GCTC 1NN6A 2CHAC 3SV6A 4QT8C 1GMHG 1TABE 2GV7A 2J9NA 1ZMLA 2UWLA 1AB9B 1UTOA 3U8RH 2P3UB 3RC6A 2ALVA 2ZIQH 3T62A 1GI9B 2NU3E 2M5TA 1O2WA 3E1XB 1O2YA 1QFKH 2ZCKP 3ATIA 4NIYA 1SSXA 3IG6B 1C2DA 1O2RA 2SGDE 1OS8A 2IJOB 5DGJA 2C90B 2ZGCA 5K0HA 2AIQA 1BMAA 2RG3A 4WF8A 2BX4A 1A46H 4FU7A 4YOGA 4AB9A 1OPHB 1GBKA 1OOKB 3ODDA 3RXHA 1YBWA 4I8HA 4BAOB 1GCTC 2C8YB 1EQ9A 3B23B 3M3SA 1G2MA 4CRGA 2ZHEH 1QNJA 2ZZUH 3M5OA 1TNKA 1HAOH 4E7RG 2TGDA 4DGJA 4AFSA 1GI3A 3NZIA 3TJVA 1AE5A 1UVSH 1RJXB 1TOMH 3TJNA 1IQKA 4D7FA 2ZFTA 1XUKA 2BZ6H 4X8SH 1KXAA 4HGCA 1FY4A 1GHVH 1C5LH 1P2QA 2ZCLP 4X6NA 3H7OA 1UVPA 3ENSB 5EODA 3ZYEA 2CJIA 1TGTA 1P8VC 4ZUHA 1HXEH 3H7TA 1S83A 1ELEE 1JIRA 1TNJA 1HPGA 1W8BH 2PKAB 3DUXH 4MQAA 1P03A 4CHAB 2GX4A 4KKDA 3LH3A 2J38A 2GMTC 1E34B 1K1IA 2ESTE 4XFQA 3GCTG 2TRMA 1WU1A 2BDAA 4Y8ZA 3ZVDA 3A8DA 2QF0A 2BLVA 3EDXB 1T8LA 1GJCB 3N7OA 1B0FA 5FPSA 1Z6EA 3S7KB 1F5RA 4B75A 3AASA 5H4IB 1P01A 5LH8A 3AAVA 1UTKA 2BB4A 4ABJA 4WMDA 5A8YA 3VXEH 1BBRE 2UWOA 2OTVA 3PLKA 2BVXH 3F9FA 2XWBI 1QJ1B 2C8ZB 3E0PB 1V2QT 1IQLA 3I29A 1AY6H 2GCTB 2G55A 3K6ZA 2GT8A 2CHAB 1P57B 3BTHE 3TJUA 3OY5U 4A6LA 2WPJS 2G5NA 2BY9X 4HTCH 3E90B 1P2JA 3ZV9A 1NFWA 3FVFB 1ZR0A 1DWBH 2XC0A 2ZU4A 5EW1H 1SQAA 1QRZA 2FI5E 3VPKA 2XBXA 1SBWA 3L33A 1AKSA 2FOCA 1AUTC 1EOLA 3GYLB 4KP0A 4LXBH 5FPYA 1BTHH 1TLDA 4AYVB 2B9LA 1O2TA 2VNTA 1SGCA 1C5PA 3TGKE 4BAQB 1ZRBA 1ANBA 2EC9H 3A7VA 1GCTB 1O5DH 3ZZDA 3SU5A 1VITG 3SU4A 3F6UH 1GI4A 1KDQB 1BTZA 1TMBH 3TIUA 4A7IB 3GISB 4IN2A 1L2EA 3G01A 5EQQA 1E0FD 1VR1H 1Y3UA 3TLOA 4OS7A 4LZ4B 1AUJA 1HNEE 1TA6A 2GCHG 1SGFA 4LOYH 2AMQA 5FCRA 1O3FA 4A1TA 3CS0A 2V0BA 1O32A 3SBKA 1Z1JA 1YPGH 2ZQ2A 4X1SU 1EB1H 1ETSH 4SGAE 3K65B 2DUCA 1HXFH 1Y59T 1LHEH 2Q6DA 1P9UA 4Y7BA 1BTWA 2W3IA 3UNRA 2XC4A 3RXOA 4K1TA 2AMPA 2G52A 3O8RA 2Y6TA 3T2NA 4AN7A 4LZ1H 2FYQA 1HUTH 1A4WH 4CRDA 3MI4A 4DY7B 1EJMA 3QZQA 4Y8XA 2GZ9A 5FXLA 4IMQA 3TK5A 2BZAA 2SNVA 3ZZ3A 5T3HA 4AYYB 3UOPA 4A92A 4O3UA 1CT0E 1OWEA 1GMCF 1C1QA 1TX8A 2C3SA 2FOGA 2O8WA 1GJ6A 1O2NA 5IYTA 6CHAC 4NFEA 1AIXH 1GBAA 2VGCC 2QF3A 1SGDE 1GJDB 1MCVA 1EJAA 1XUJA 3ZZ6A 3ZZ9A 2B5TB 4K8YA 1HIAA 3SQEE 1THRH 5JBTA 1AFEH 3HPTB 3KEEA 2BDBA 3UNSA 3S0NA 1NRQH 1GVLA 3RXKA 1RTKA 1KYNA 2P3FH 2G51A 4X1RU 4FVDA 1L4DA 2ANWA 2GDDA 4RSPA 3SUFA 1AI8H 3LH1A 2WPLS 4NSYA 2VWMA 2ZDLA 5A0BA 1NFUA 3RXJA 5EPYA 1HYLA 1ZSLA 4E7NA 3P8OA 4X2YA 3RLYH 3M61U 5B6OA 1ELTA 3L3TA 3T28A 3ZZ7A 3CP7A 4IMZA 3RXEA 8ESTE 1FI8A 4XBCA 3EAJA 4UFGH 1TGNA 2HNTC 1O2UA 3BTEE 2CN0H 1SGFG 2UUKB 1B7XB 1FZZA 4ZH8A 3QK1A 3QLPH 5FCKA 3SNEA 1HAHH 2OINA 1DWCH 1QJ6B 3FP6E 1O2MA 1MKWK 1TMTH 3A86A 2AGIX 1UK2A 2FX4A 4Z6AH 1HCGA 4D9QA 2Y82A 5GJ4B 1O2VA 2ZHDA 1ZJKA 1EJNA 1O37A 3TPIZ 2AH4X 5DG6A 1GI5A 1EB2A 1FN6A 1AU8A 3NK8A 5L2YH 2J34A 3W95A 4YZUA 3SNDA 4GAWA 3LU9B 3LT3A 2THFB 3KNXA 3P70B 1BOQA 1TNGA 1O5EH 1C5WB 3GDUA 4CRCA 2Y7XA 1EAIA 1DPOA 1TOCB 1FIWA 3TK9A 1QCPA 1P12E 3T5FH 5DKMA 4JZEH 1MU6B 3RXAA 2P16A 3MNSA 5DP4A 4TPYA 1PPGE 5EW2H 1H9LB 1DSUA 3KQDA 1O3KA 1BMMH 1CA0C 1GMDF 3SV9A 3FAOA 1ZPZA 3TJOA 1CQQA 2R2WU 3SV8A 3MH5A 2BD7A 1P09A 1O2ZA 2EA3A 1UK4A 3M5LA 3A84A 4NWKA 2Y80A 1FIZA 5JB9S 2H9HA 5DP8A 5C3NA 1OWDA 3HATH 4X6MA 2AFQB 3FFGA 3QWCH 5G4BA 4YLQH 2ZTZA 1GHXH 2QXHA 1KXFA 4H6TA 3UR9A 1P11E 3BTQE 2FLRH 1ZZZA 1EKBB 3V12A 1C5SA 1GBHA 1HAZB 1GHWH 2XBWA 1ID5H 1GJ4H 2XNIA 1V2JT 2BQ6B 1AQ7A 2C8WB 1QIXB 3GDSA 1N1LA 1O39A 1AZZA 1NT1A 4K2YA 1PPEE 4MNXA 1HB0B 2VIOA 2ZFQH 5DP6A 1C1NA 1GBIA 2FYRA 4MVNA 2CGAA 1PQ5A 4FUBA 1UCYE 4FVBA 1O35A 2GZ7A 2OC1A 3KQEA 1SLXB 3Q3XA 2C8XB 3I78A 1AVXA 2OUAA 2Y5FA 2TGTA 3RXBA 2QV1A 5A2MH 1CHGA 2NU4E 4R0IA 1INCA 5EGMA 1GJBB 2BHGA 1DXPA 4MPVA 1SFQB 2V3HH 4XOJA 4IS5A 4MNWA 1V3XA 1EZQA 1XM1A 2HLCA 1AMHA 1QA7A 1C5XB 3VEQB 1UTPA 1SLUB 2XRCA 1J14A 3ZVAA 1MAXA 1VGCB 1HRTH 3BIVH 1ZMNA 2A31A 1J15A 4OGXA 1P06A 4ABIA 1NROH 1K1NA 1MQ6A 3ZV8A 2Z3DA 2AS9A 3QO6A 2R9PA 1WOFA 5TJXA 1QR3E 1GCDA 2OBQA 5T6GA 2G81E 3MYWA 3TU7H 3QTOH 1EZSC 2GV6A 3TK6A 1QB6A 1E36B 1NPMA 3KIDU 4ISIH 3UUZA 4NA8A 1P10A 2BD8A 3BN9A 4D7GA 1CA0B 2AIPA 3P92A 5EXLA 1NZQH 1G3EA 1XUHA 1ZTJA 3GCHC 1SLVB 1OP8A 6LPRA 4BTUB 3V0XA 3GICB 4I31A 1RGQA 2OXSA 4UE7H 3SGAE 3SORA 1C2MA 1DICA 3GY5A 4ZKSU 3RXIA 5GPIB 1L1NA 4KELA 2SGEE 2FOAA 4BAKB 1SC8U 2Z9IA 1EPTC 2JETC 4AOQA 1AGJA 1A3EH 1MMJN 1J16A 2LPRA 3RMLH 4BTTB 1P9SA 1IHSH 1ZPBA 3BV9B 5EQSA 4JK6A 3RXQA 4BXSA 4TWWA 1LHGH 2UUYA 3QTVH 1C1SA 4OS4A 1DSTA 3RXRA 4DW2U 5C2ZA 1ZGIA 1FY1A 1SHYA 3TNSA 2QXIA 3HKIB 4WXIA 4CRFA 1O34A 2A32A 1P0SH 1CGIE 2VIPA 1RFNA 1DX5M 4I8JA 3Q77A 1P02A 3UR6A 1ARCA 2FZZA 1C5NH 3E8LA 2PKAA 1YGCH 4ZXYH 1GI8B 1XXFA 3UREA 1Z8GA 3BTKE 1UMAH 3RLWH 4X6OA 2IN2A 1IQMA 3JZ2B 4I8LA 2Q6GA 4I7YH 4GCHG 1NY22 1GBLA 2ZPSA 1FPHH 3PLPA 2H2ZA 2WPKS 2ZHQH 2YNBA 4GSOA 3UIRA 2QGRA 2TIOA 1JRTA 1GHAG 4OS6A 1C5OH 1Y3VA 1C2KA 4I33A 2BDCA 2A0QB 4DCDA 1P3EA 4YESB 1ESBA 4Y76A 2IPHA 3TH4H 1F0TA 3PMJA 1V2LT 2FIRH 1CA8B 2BXUH 3SU2A 1OWJA 2TPIZ 3T25A 1GBBA 1SR5C 1XX9A 2FM2A 3HKJB 2HPQH 4PROA 3ZVCA 1JBUH 5T6FA 2CV3A 5A09A 1C2IA 1DUEA 1L1JA 2HGTH 2OC0A 2FOEA 4IC5A 4X1PU 2DE9A 4UFFH 2EI7A 1PPZA 1GHZA 1TRMA 2Y5GA 1C1MA 2ZEBA 3F1SB 1HAGE 4Q80A 4ABHA 1YC0A 1ETRH 3GCHB 4TY7A 3LIWA 1KTTB 1VJ9U 5E0JA 2VWNA 2A7JA 3ZZBA 2QA9E 1ZHMA 2PTNA 1FLEE 1KXCA 4KTUA 2OQUA 8KME2 5GCHF 3KF2A 1OSSA 2ZGBH 4O03A 1WUNH 1CT4E 1G3CA 2WPIS 4YT7H 1KDQA 5F8XA 1C4V2 1TX6A 3M35A 2BQWB 4ABBA 2BX3A 2P8OC 1F0RA 1GL0E 3SJ9A 1O2LA 1VCPA 3TH3H 1ZSKA 1O2XA 2G5VA 5FBEA 2GP9B 1TBZH 3Q76A 5J4QA 3PTNA 1TPPA 4NFFA 3F68H 1DWEH 1N8OB 1A61H 1Q3XA 4YTAA 1UTMA 2Z9KA 1C4U2 2FWWA 4K1SA 3T26A 1YCPK 1HAIH 3A7XA 3SI4H 1TNLA 1UK3A 2NU1E 4RN6A 4WH6A 2XTTB 4INLA 1TMUH 1EZUC 2ZF0H 3ZVBA 2ODYB 1CVWH 3BTDE 2R3YA 1YPKH 4Y10E 1AO5A 1O2JA 5EG4A 1YPJH 2VINA 3A7YA 1TE0A 4B1TA 3PV4A 8GCHF 5JBAS 2O8LA 1HJ8A 1O5BB 5ESBA 4CH8B 1ARBA 1GI7B 3TH2H 2ZHWH 4O3TA 1S0QA 4I8KA 4MNYA 1EUFA 2VJ1A 4YOIA 4NZLA 3QN7A 3DFJA 1FQ3A 2K1QA 4XSKU 1YCPM 2AYWA 3A82A 3VGCB 2ZC9H 1P2OA 1TPAE 5T6DA 4B2BA 1FV9A 2BD3A 3RU4D 5HM2A 1AHTH 3AW1A 4ISNA 2D26C 1BHXB 2A5AA 4FU9A 1O2HA 1LVOA 2SNWA 3TVJB 3OYPA 3SV2H 2PKSC 4NWLA 5AFYH 5A0AE 4DURA 4YT6H 5C1YA 3GYMA 2ZGXH 4X6PA 1ELDE 1A0JA 3RXDA 1YP9A 1LHFH 3SOSA 1TGSZ 4F49A 3KQCA 3MNXA 3URCA 3UQOA 3SHAH 1TONA 3EE0B 1BTPA 1CBWC 2GD4B 4Y79A 4ISHH 1QQ4A 3UY9A 2Y81A 2F83A 1O3NA 3VB6A 3SZNA 4CR9A 1SGRE 4RKOB 2D8WA 1V2NT 3MU0A 5JYIA 3ZYDA 3PMBB 3UPEA 2H9TH 3ZVGA 1C2GA 1BA8B 3MFJA 1UTQA 1EAXA 3RMNH 4A1VA 2P8OB 1YPHE 4X2VA 3KHVA 3SQHE 3RC4A 1J8AA 3LGVA 3E16B 3S9AA 3SNAA 3UQVA 1DY8A 2WINI 2A1DB 4FUJA 1T31A 1QTFA 2ZU3A 3IITA 2ZA5A 1V6DA 1XUGA 1GJAB 5AVDA 3A7TA 3A7ZA 2RA3A 1TA2A 2BY5X 1O3GA 4FUCA 3VB4A 1ELAA 4AG2A 4XBBA 3OSYA 4FUFA 1LHCH 1AE8H 2Z6BD 3CENA 1DANH 1V2OT 1ZSJA 1EZXC 3PWBA 1F0SA 1O31A 1OXGA 5L2ZH 2A4QA 3BF6H 1QGFA 2BY6X 1RIWC 2CF9H 2A2XH 2GZ8A 3SU0A 5LPEA 1NTPA 1GHYH 4B73A 3S7HB 2BLQA 1D9IA 4Y0YE 3NXPA 3BEUA 1GI2A 2GMTB 3GCTF 2VIWA 1KLJH 3S9CA 1PQAA 3WY8A 3R0FA 1VITH 1LVBA 1JIMA 1GGDC 4Y11E 2ANKH 4JYVH 2AGEX 1QBOA 1PYTC 1W2KH 2G00A 1YPEH 1BMLA