1DY8A

Inhibition of the hepatitis c virus ns3/4a protease. the crystal structures of two protease-inhibitor complexes (inhibitor ii)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
175
structure length
175
Chain Sequence
APITAYSQQTRGLLGCIITSLTGRDKNQVDGEVQVLSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWPAPPGARSMTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHVVGIFRAAVCTRGVAKAVDFIPVESM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PROTEASE/HELICASE NS3 (P70)
publication title Inhibition of the Hepatitis C Virus Ns3/4A Protease the Crystal Structures of Two Protease-Inhibitor Complexes
pubmed doi rcsb
source organism Hepatitis c virus (isolate taiwan)
total genus 39
structure length 175
sequence length 175
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2000-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1dy8A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 1dy8A01
1ZPBA 3LGVA 1C2MA 3SQEE 3KN2A 4X0WU 5EPNA 2FX6A 5A0AE 4MLFB 3RMOH 3VXEH 1KXFA 1GBFA 1C2HA 2ZTYA 2ULLA 4AB9A 2OC8A 3MO9A 3GDSA 3BF6H 1TONA 2AGEX 1LVMA 2C4FH 1SGPE 1AVWA 3FANA 5F8TA 1GJ6A 1D3QB 5FXLA 1DICA 2BY8X 1TQ7B 1P2JA 1O3PB 2C90B 1CSOE 2A4RA 2PV9B 2O8WA 3BEUA 3ELAH 2VIDA 3M3SA 3LONA 3AAVA 1RXPA 3DFJA 4BAQB 1X7AC 4NIXA 1N8OC 1O2OA 2VIOA 4J1YA 1VZQH 2ZPRA 3M5MA 5L2ZH 1V3XA 4Y7BA 1DSTA 1AHTH 5L6NH 1P02A 2ESTE 1LO6A 2BD3A 1FPHH 2BQ7B 1SGEE 1P0SH 1DVAH 2F9VA 3T26A 3RXOA 2UWPA 3RXHA 2OD3B 1SR5C 1ESAA 7GCHF 3E90B 1KXEA 3M35A 5L30H 3Q77A 2QAAA 4CRAA 1MAXA 1QA7A 1QRXA 4AG2A 1YM0A 3ATIA 4FVBA 5EXLA 1L4ZA 1O36A 3RXGA 2C8ZB 1UJ1A 2D8WA 3ZVCA 1Y59T 1EASA 3UQOA 4IS5A 1OSSA 1RTKA 1LHCH 5EXMA 3Q76A 2FZZA 1HFDA 1P57B 1EZSC 1SPJA 3RXJA 2GCHG 1Y3WA 3HKIB 3TJVA 3MH7A 1GHZA 1KXDA 5T6GA 2EC9H 3TVJB 1ANCA 1C9PA 1GBKA 3BEIB 4Y6DA 4IGDA 1WXRA 1QB9A 1ANDA 2BX4A 1EOJA 3UTUH 4I8HA 1OYTH 1SOZA 1O5DH 2ZDLA 5C5NA 3K65B 1MU8B 3MU8A 3UUZA 4BXWA 2Y5HA 1S5SA 5DPAA 1LMWB 4YTAA 2A7JA 1TB6H 1V2QT 5A2MH 3URCA 1SGRE 4FU7A 4FUGA 5FCKA 4NA9H 1C4Y2 4OS1A 4I7YH 1FXYA 4RKOB 3I78A 1J16A 1DS2E 4E7RG 1CU1A 1EJAA 2WPHS 2F9OA 1NFUA 2WPIS 3RXCA 1INCA 2YNBA 1QA0A 2PKAB 2ZU5A 1C4U2 2XC4A 3IWMA 4OS7A 4KKDA 5ESBA 3R3GB 3TJUA 1TLDA 2VIPA 1AI8H 1NU7B 4M9FA 1C5PA 1GI3A 1GI0A 2ZFPH 7LPRA 2FIRH 2FO9A 3PM3A 3T27A 1W8BH 2V3OH 5F03A 5C5OA 1FY1A 4Y8YA 3QTVH 4I8KA 1QL8A 1BTUA 3F9GA 2ZFTA 5I46H 2OUAA 1O37A 3CS0A 2XTTB 3RMNH 5F8XA 1EJNA 2PWXA 1S81A 1KIGH 5LPRA 2NU4E 3M7UA 2QYIA 1MQ5A 1SQTA 2Y5GA 3A8AA 4YESB 3LGYA 4ISLA 4A1TA 1K9OE 2OBOA 1W12U 1HDTH 4I8JA 4RN6A 2R2WU 1PPGE 1TA2A 1A5IA 3BIUH 2R2MB 2P59A 1IQNA 1GWAA 1GHAG 4ZH8A 1E35B 1OP2A 4UONA 4DIHH 1K2I1 1LVYA 3CP7A 3EYDA 4Y11E 1BITA 1PPEE 3FP6E 3M36A 3QGJA 1UCYH 3UIRA 2GDDA 3A88A 4X2VA 1O32A 1SI5H 4ISNA 2C8YB 1ZTKA 4H6TA 1T7CA 1QTFA 1G37A 1HAGE 2H5DA 3RXVA 3TH3H 1YPHE 3MFJA 2PUQH 5ABWA 2FYRA 1C4V2 2VH6A 1A3BH 1CBWB 1JXPA 1F0RA 3BTWE 3T5FH 1F0SA 2A2XH 4YT7H 1FNIA 1YPLH 3QDZB 5C1UA 3QZRA 3GY2A 4Y8ZA 1D6WA 1J8AA 2BD5A 1MBQA 2ZHWH 2QXHA 2VIVA 1MAYA 3FFGA 1F92A 1C5NH 1HAXB 2Z9LA 1ZMJA 3DFLA 3P6ZB 3NK8A 3QTOH 1NESE 2JH5D 2IPHA 3Q00A 1LPKB 3MI4A 1H8IH 1PYTD 3ZZ3A 4WY3A 2ZKSA 2J9NA 1FPCH 1SLWB 2PUXB 1GBCA 2PGBB 2FLRH 1SGTA 4ABEA 1YF4A 1CHOF 3NXPA 3GISB 3ZZAA 5JBTA 4H6SB 3LH3A 1GMDG 1ELFA 1SGIB 2P94A 2GDEH 1MZDA 3BTDE 2KAIA 2BD4A 4VGCB 3EA9A 3P8GA 3PMBB 2F4LA 1TX6A 1F5KU 2D1JA 2VWOA 2OC1A 1HRTH 1GL1A 1VJ9U 4K1TA 4MDSA 3ZZ7A 1GHBG 3F1SB 3U8TH 1FN6A 1Q2WA 1UTJA 2O9QA 2QF0A 2ZQ2A 3KF2A 1NRSH 4ABAA 3VPKA 3T28A 1ETSH 3LGUA 1GBHA 1NT1A 1Z71A 2W7UA 2BDIA 3ZZ4A 1GHWH 1YPKH 3V7TA 1O35A 4HFPB 3RXUA 4NIVA 1ZTLA 2AMQA 5AHGH 1O2HA 2ZG0H 2WPMS 4K60A 3RXBA 2PKAA 1THSH 4NWKA 1GMHG 1EKBB 4IBLH 9LPRA 1M9UA 1OOKB 2WUBA 1ZHPA 1F5LA 3SNCA 3S0NA 7KMEH 1MTNB 1DOJA 1IQEA 1E36B 2HVXA 4MTBA 2FLBH 3SI4H 2BDGA 2QY0B 3S9AA 3GYLB 2EA3A 2ZDKA 3RXSA 5PTPA 1U6QA 1FDPA 3UREA 1V2OT 3TK9A 3UQVA 2Y5FA 4DOQA 3OY6U 1GI8B 4XDEA 2WV9A 3E3TA 1WQVH 3GCTG 3TIUA 5HGGA 2ZCKP 3SU2A 1GVZA 1NRQH 3ESTA 3HPTB 4WMDA 2CV3A 2J92A 3E1XB 2ZFRH 1L1NA 1ELCA 1UO6A 2ZF0H 1LHEH 1OP0A 3SV6A 4WXVA 1GJ7B 4X1SU 3TH2H 3SJOA 4TYDA 1AVXA 1S83A 4AB8A 5HM9A 3ODDA 1YCPM 1YLDA 2VIQA 1AO5A 2ZGCA 1O2GH 1C5XB 5DK1A 4ISHH 3UNSA 2QN5T 3U98H 1NROH 4DJZB 2VIWA 4O3UA 3SNDA 1C1SA 2ZFSA 1O2YA 2GCTB 1UMAH 2NU2E 3MH6A 3SBKA 4GHQA 4OS5A 3FAOA 1S82A 4TPIZ 5GPIB 1DFPA 2BZ6H 4LZ4B 3KIDU 3LT3A 1Y5AT 2HPQH 4KP0A 2SNVA 8KME2 1TWXB 5GXPA 1EOLA 5TCAA 4BANB 3A83A 1O5CB 2EI8A 2TBSA 1E0FD 7GCHG 2GP9B 5FPTA 3GYMA 5C2ZA 1ZGIA 2P93A 2BDHA 2ALVA 1DM4B 2BOKA 1TOMH 1NY22 1FMGA 1HAPH 4O9VA 3ZZ9A 4R0IA 1KXAA 4E7NA 5EU8A 3B23B 4B6EA 5E0JA 3SV9A 1IAUA 1RS0A 4VGCC 2AFQB 1O34A 2ZDVH 2VWLA 2ZNKH 1ABIH 1O2ZA 3LH1A 2QXIA 2AIQA 8ESTE 3T2NA 4AN7A 1A61H 1DWEH 4H42U 1A4WH 1HNEE 1KLTA 3ZV9A 2OXSA 2XWAA 4SGBE 1TPOA 2WHXA 3LIWA 1P2QA 1C2EA 3UOUA 3ENSB 3SU6A 3SNBA 3TGKE 3RP2A 1IQMA 1O5BB 1ELAA 5JBBS 1TNGA 3I29A 1HXEH 1CT2E 4BTUB 2VVUA 1DWCH 3F6UH 2CF8H 3RLYH 2XBVA 2H9TH 5HYOA 1C5TA 1DWBH 3STJA 3ATMA 1MD8A 4DCDA 4AFQA 1Z1JA 4DY7B 1MTNC 1VR1H 4Y0ZE 1UHBB 2P3FH 4XE4A 2Z9KA 4JZFH 3QLPH 3KHVA 2ZHFH 1C1UH 1C2IA 1GMCF 1NFYA 4KTSA 1UTNA 1EAUA 2SGQE 4ABIA 2VH0A 1FY4A 2FOEA 1HAZB 3SZEA 1ORFA 2O8MA 4U32A 1TRYA 2ZECA 2BM2A 2HPPH 4ZKNU 4I8GA 1ZMNA 3SQHE 5LH8A 2ALPA 1QQ4A 1P12E 2STBE 1SGCA 4M7GA 1EP5A 3GY4A 2XWBI 1ZPCA 2ZP0H 4Q7XA 2WPKS 9ESTA 1SGDE 1GHYH 1RIWB 2XCNA 3CS7A 1GGDB 3SYJA 2P8OB 3PROA 2XNIA 2CHAB 3UR6A 2BDAA 2OBQA 2G55A 4UFFH 1LHDH 4ZKSU 2GTBA 3SGAE 4ZXXH 1YC0A 1QQUA 1QBOA 2P3TB 1RD3B 1BDAA 2H2ZA 2ZGHA 4NCYA 3FZZA 1G9IE 1O39A 4B2BA 2OQUA 5FPSA 3ZZDA 3MTYA 2GCTC 1O3EA 3AVZA 1IHTH 4MPWA 4AYYB 1H4WA 2J38A 1C5RA 1Z8IB 4DIIH 1ZLRA 1GCTB 2IN2A 2ZFQH 3UNRA 4ASHA 4XFQA 1GI4A 1AMHA 4YO9A 1GI6A 3UWIA 1C1QA 3M5NA 2ZHEH 1KSNA 1EPTB 3MMGA 3SI3H 3MH5A 1GBEA 2ZZUH 4TY7A 2AMPA 1YPMH 2BY7X 1AWFH 5TCCA 3URDA 4ZKOU 1DITH 1ZHMA 3BG8A 4UFGH 1K1PA 1ANBA 1V2VT 2NU0E 1SVPA 3TJNA 2GKVE 2UUFB 3V0XA 4JYTA 4I32A 4A1VA 3HK3B 4NG9H 5EGMA 4K1EA 1SHYA 1EP6A 3MNCA 2TGDA 3F68H 1UCYK 4INLA 4TWWA 3P70B 1S0RA 1TRNA 1Z8GA 1ZMLA 3NWUA 1XUJA 1CA0B 1P8VC 1K1OA 3SW2B 5C3NA 3VB5A 1MMJN 1YCPH 1ELTA 2FX4A 3TPIZ 1CHOG 8LPRA 4BNRA 1C1TA 1UTQA 2XRCA 1K22H 4J2YB 2FTMA 4JK5A 1O3AA 3I77A 3BTTE 2PW8H 4NSYA 1HIAB 2BVSH 2YNAA 4BAOB 2STAE 1JWTA 1TGSZ 2ANMH 2R9PA 1ETTH 1FUJA 3L6PA 4JZDH 4K3JA 4UE7H 5FBIA 1W13U 1BZXE 6GCHF 1ELBA 3SU4A 3RXEA 1O3DA 1UK3A 2IOTA 1QL7A 2QV1A 1GJ8B 3QUMP 1UTKA 1C9TA 4NZLA 3MOCA 3SUGA 4IC5A 1BRCE 1SQAA 1DUEA 1TPAE 2WZQA 2Q1JA 1YPJH 3JZ2B 3ITIA 1UHBA 2Z3EA 1JOUB 3M5OA 2ASUB 1NPMA 1HGTH 1DLKB 1F5RA 1G2LA 1JRTA 3M61U 2JKHA 4GPGA 1CO7E 3B9FH 2ZPQA 3L3TA 2SGEE 3SU3A 2ZU3A 2UWOA 4DT7B 1A5HA 2BD7A 3P8OA 3SU5A 4NGAH 1IHSH 1G36A 1ANEA 1AZZA 3E0PB 3E8LA 3QN7A 3SGBE 1VCWA 1PFXC 3BTEE 4E06H 5B6OA 3GY5A 2LPRA 4WF8A 4YOGA 3TNTA 1AB9B 1XXDA 2FEQH 4GVUA 1RIWC 4X2XA 4TWYA 1O3LA 2GZ9A 1F0UA 5IYTA 1EZQA 1GGDC 1SHHB 1EAWA 3O8RA 2P8OC 1BOQA 4XBCA 2CHAC 2GZ7A 1NFXA 2H5CA 3O8BA 1TGTA 1V2WT 1D3DB 2GV6A 1O5FH 4ABDA 4AGJA 5E0GA 1YGCH 3E6PH 4INHA 1GJAB 2VBCA 4ABHA 2BD2A 2GT8A 3C1KA 4LOYH 4WJG2 2QC2A 1O2RA 1UTLM 1TPPA 1UVUH 5DP4A 2A2QH 1JIMA 3SU1A 1DPOA 5JB8S 1T8OA 1QGFA 1EPTC 5GJ4B 2OINA 1RGQA 1TGBA 4WWYA 3LDXH 4ABFA 1C5OH 2FOMB 4Y79A 1FQ3A 3D23A 1GI5A 3LGTA 1EPTA 4GUXA 1EAIA 1CT0E 3SUDA 1MZAA 4O97A 2Q6GA 3PV4A 4H4FA 1QJ7B 3SJKA 1G30B 4RI0A 4FUDA 1XVOA 2QF3A 2DUCA 2HOBA 3OTJE 1P05A 1P10A 1LVOA 1IQLA 1C2DA 1OYQA 1P2IA 2XXLA 3MNSA 1IQJA 4GLYA 4FUHA 5FBEA 4CR9A 1YPGH 1HB0B 1O3IA 1UK2A 3VB6A 1D3PB 5BPEA 1CA0C 2WYGA 1TNHA 1AE5A 2G4UA 2PFEA 4B6FA 3QO6A 3KQBA 5CMXH 1VJAU 1HUTH 4GSOA 5EQRA 3RC6A 2EI7A 1BB0B 2VWNA 1RRKA 2PTCE 4ZHAA 2QGRA 2VGCB 1BMAA 1QNJA 2FESH 1BUIA 2G5VA 3KGPA 3ZZ5A 2V6NA 1TQ0B 4X8VH 2A5KA 4BAKB 4B1TA 2A5AA 1HIAA 1OWIA 3GY8A 2G81E 1FY8E 4X6PA 1FV9A 3T25A 3V3MA 1PPFE 1UK4A 4ABJA 5T6FA 1YLCA 1TFXA 2B0FA 1TMTH 2BZAA 1BBRH 1WTGH 5A8YA 4K1SA 1PQAA 1FN8A 3TU7H 2AMDA 2ZA5A 5EQQA 4A92A 1Y3VA 1AD8H 4X1RU 3LOXA 4KTCA 2O8TA 1LPGB 1VGCB 4UFEH 1GBAA 2W3KA 1GI2A 3RXDA 2F91A 3MO3A 3H09A 1WQSA 1V6DA 1RJXB 1GJCB 4TPYA 1AB9C 1UTOA 2FPZA 4FXGH 2BDCA 2CMYA 2RDLA 5GNDA 2BLOA 1IQGA 3RC5A 1GMCG 1NZQH 3P8FA 4IW4E 5JBCS 2ZIQH 3S69A 2H9HA 2VWMA 1EZUC 1WUNH 4Y10E 3RXLA 3S7HB 3LC3A 2FODA 2OP9A 1DDJA 1BHXB 3DT0H 1LKAA 3ZYEA 3ATLA 2F3CE 1K1NA 1AE8H 3RXKA 5HMAA 4KTUA 4X1PU 1O3OA 4JZIA 1MTSA 3ZVFA 5JPMH 3A7ZA 4ZHMU 1W7GH 4AX9H 2UUJB 1YPHC 2HWLB 1ELDE 1G32B 3PLBA 3TNSA 2ZGJA 4BAMB 1BRBE 4MG3A 5E2PA 2FXRA 2J34A 1BJVA 1YP9A 3ODFA 1OXGA 4A6LA 1T4UH 3SHAH 1Z6JH 2Y81A 4HTCH 4MNYA 1TE0A 1TAWA 4I31A 1JIRA 3HKJB 2FI4E 1KTTB 1QHRB 1XX9A 1C1PA 1TNIA 2A32A 1BTWA 4X6NA 3TGIE 1HAYB 1H9IE 2BXUH 1F7ZA 1GL0E 2UUKB 1NU9A 5DP9A 1BTXA 3OU0A 3E91A 2RA3A 1MCTA 3RXTA 1Z6EA 2VNTA 1LCYA 3A7WA 1C1WH 4MNVA 1ZSKA 4ZAEA 4AGKA 3H7TA 2GV7A 5CE1A 1ZRBA 1QBVH 3V13A 3OTPA 2BLWA 3NCLA 1EJMA 3NUMA 1V2MT 2ZHDA 3LGIA 2D2DA 2M5TA 1AY6H 4AFSA 1TRMA 1CT4E 1TBQH 2QCYA 3Q3XA 4D9QA 3EDXB 5EOKA 3C27B 5G4BA 2Y82A 2AIPA 2CN0H 1PPHE 1GJ4H 4FU9A 1C5ZB 3RU4T 2VGCC 1IQHA 1AGJA 5K7RA 2BOHB 1O2NA 3ZZCA 1QY6A 1GI9B 1T31A 3M37A 2C93B 4XBBA 1CGJE 1C5UA 2A1DB 5JYIA 1K1MA 1O2QA 1CHGA 5DP6A 1V2LT 5C1YA 1O2IA 2ZTXA 4PROA 1XUGA 1CBWC 3AW1A 3D65E 3Q3YA 3NPSA 1A0HB 1MD7A 1MKXH 3VB4A 1SFIA 3EA8A 1PQ5A 2HGTH 3V12A 2DE9A 4LXBH 5HXFA 2RCEA 3A82A 2BD8A 3GY7A 1S85A 1O38A 1P06A 1J17T 6GCHG 5DP5A 2A4QA 1H8DH 1C5WB 1VGCC 1G2MA 2WPJS 4CH2B 1C1VH 4AZ2B 1UVTH 1DT2A 1EATA 2HNTE 1CVWH 6CHAB 3M7QA 1TOCB 1HCGA 2O8LA 1MTWA 4WVPE 3ZVAA 5DG6A 2GMTB 3TITA 3TJOA 1THPB 3LC5A 4JMYA 4FUIA 4CHAB 1FI8A 1DSUA 1L4DA 4IN2A 4K8BA 1BMNH 2G5NA 4Z6AH 3BN9A 1TX7A 1WYKA 1YCPK 3GCHB 4UDWH 4X8TH 5SGAE 2QA9E 1V2RT 1L2EA 5C67A 3NZIA 1A0JA 1C2KA 2BTCE 4FVDA 4X1NU 1RTFB 1C5VA 5C1XA 1K1JA 5I25A 4LZ1H 4JCNA 2TPIZ 5HM2A 1E37B 1TNJA 2PSXA 1Z8RA 1ZJDA 3VXFH 1Y5BT 1GBTA 2F9PA 4KGAA 2AGIX 1MKWH 5DGJA 2BY9X 2OK5A 3PTNA 1EQ9A 4JZ1A 2B9LA 1OWHA 3SV8A 2NU1E 2FS8A 3ZVBA 1ETRH 1AN1E 1GVLA 1TGCA 2FOHA 1O3NA 4B74A 1C2GA 1HXFH 2V35A 2VINA 1YBWA 1FIWA 2ZWLH 3WY8A 1NN6A 4K8YA 1SB1H 5FAHA 1DY9A 2F9NA 5AF9H 1ZZZA 3A87A 3PWCA 1W10U 3SJ9A 3U1JB 1OWEA 2ANYA 1SOTA 2ZCLP 4I33A 1OS8A 1TALA 3RUOA 4YLQH 1KXCA 2WV5A 3NKKA 1A2CH 3PMHB 1N1LA 1QB1A 4NIWA 1OPHB 1VITF 2K1QA 2BLVA 1NRRH 3M3TA 1Z7KA 2A7CA 1UCYE 2XYAA 5FX6A 3HGNA 2A31A 1UTPA 2XW9A 4CRDA 2BD9A 2IJD1 3PLPA 1VITH 1LHFH 1SGYE 3BTFE 3PMAB 1OWDA 1O3CA 3PYHA 1BMLA 4ABGA 2DE8A 3PV2A 3K6YA 4CRGA 2XBWA 1TBRH 1LKBA 3U8RH 1S6FA 2TGPZ 3M3VA 2W3IA 1GBLA 2J94A 1K1LA 1KXBA 5CHAB 4F4OC 3CENA 3MNBA 5A0BA 4B75A 2XCFA 4CREA 5JB9S 2JETB 3KQEA 1ZSLA 4ABBA 2C3SA 1C5YB 2ZGBH 4WH6A 1DY8A 5TJXA 1V2TT 1Y8TA 2SGAA 2Z94A 1MBMA 3A7VA 1SSXA 2QXJA 2UWLA 1PQ8A 1O5AB 4YOJA 1HLTH 1W2KH 1Z8JB 1O2VA 3A7YA 1E38B 5DJ7A 3BTHE 3P8NA 3ATWA 1QB6A 4DGJA 1KLJH 1QR3E 3RU4D 3PWBA 3BTKE 4WXIA 3A80A 4KELA 3QGNB 4NA7A 4AORA 5J4QA 1QFKH 2GT7A 1N6YA 1AFEH 4AYVB 1GBJA 2ZC9H 1MH0A 3RU4E 3TK6A 3RC4A 2FWWA 6CHAC 2AERH 1S6HA 1AWHB 1T8LA 1NTPA 1TNLA 1V2PT 2TIOA 5F8ZA 3RM0H 5EQSA 4CHAC 1ELEE 1BTZA 1C1MA 1OX1A 2BDYA 5GDSH 3SV7A 1O2XA 2NU3E 4CRCA 1TX8A 5E8EH 1H1BA 3GCHC 3U1IB 1XUKA 1V2UT 1A3EH 1ZOMA 1TYNA 2PHBA 1SLVB 2W26A 1QCPA 3IITA 5GCHF 3BEFB 1GBMA 4U01A 1GJ9B 4MPUA 3A7TA 3HK6B 1CE5A 1B0FA 4OS2A 2ZDNA 2Q6DA 1MU6B 2A7HA 3BTME 3RXAA 2TGTA 1QIXB 2BQ6B 1GCDA 1LDTT 2W7SA 1RTLA 4MPVA 1SGQE 3GY6A 6ESTA 5DO4H 1O0DH 1A46H 2BYAX 2Z7FE 3LU9B 1C5QA 4QT8C 3E0NB 1QRWA 1GG6B 1GDQA 1HJ8A 1XKAC 1C5LH 1AFQB 2Z9GA 2R3YA 4B76A 1BBRK 2A0QB 4U30A 2G52A 1SLXB 3AASA 4UFDH 1YKTA 3RXFA 2VJ1A 2BQWB 1O31A 1ELGA 4X2WA 4D7FA 1B0EA 1HAIH 2AH4X 3FZDA 3DD2H 2ZTZA 3MU0A 1BHXF 1FAXA 3N7OA 5FHTA 1O3HA 1W7XH 2PTNA 3RXRA 1GJBB 1MQ6A 1UVPA 2Y80A 2BX3A 1AU8A 1O5EH 1KY9A 4D76A 1WSSH 3A8DA 4A5TS 4CRFA 1XUHA 1AUTC 2BY5X 3STIA 1FAKH 4K5ZA 3LGWA 1XXFA 2BVXH 3LJJA 4Q2KA 5LGOA 1DX5M 2SGPE 1FLEE 2YOLA 1O33A 3GDVA 3KQDA 1XM1A 1AZ8A 1N6XA 5CHAC 2RA0A 3GDUA 2JETC 4IN1A 4O03A 1ZR0A 1MUEB 5ESTE 1C2JA 1IOEA 3LJOA 2FOAA 1LQDB 5T6DA 1V2KT 5EW2H 4Q80A 3RMMH 1GDNA 3M5LA 2GX4A 2HNTF 4GCHF 1L1JA 1BRAA 1BCUH 3BV9B 4K2YA 1SMFE 3GOVB 2TGAA 4Z0KA 2G00A 1ZHRA 5B6LA 1LQEA 5J4SA 2ZPSA 1P3EA 4THNH 1BT7A 1GCTC 1W0YH 2KAIB 1O3JA 2Z6BD 1T8NA 1XUFA 2GD4B 4NFEA 3TK5A 2NWNA 3FVFB 1WV7H 2Y7ZA 3S9BA 1P03A 2WINI 2J95A 1HAOH 1DXWA 2TRMA 2SGFE 1O2PA 3KEEA 3GCNA 3ZVGA 1NM6A 1ABJH 2FOFA 1KYNA 1AKSB 1G3BA 2ZQ1A 2FI3E 1NRPH 3QWCH 1GI7B 2Z3DA 5K0HA 1C2LA 3MYWA 1KDQB 1GDUA 4X6MA 1BTHH 4AFUA 3BTQE 3D49H 3EGKH 1TMBH 5AVDA 1GPZA 1UTMA 5EG4A 1S0QA 5L2YH 2F83A 2GVFA 3PV5A 3K9XB 2JH6D 1J14A 2VB0A 2QIQA 6LPRA 2ZDAH 2VVVA 4B2CA 1P9SA 1JRSA 1ARBA 3P17H 2ZI2H 2J4IA 1O2LA 2FM2A 4UD9H 1F2SE 3HATH 3SV2H 3QZQA 4XOJA 3SO3A 1ID5H 3U8OH 1XKBC 4OGXA 5EXNA 2B5TB 1GG6C 3VB7A 1W3CA 2BDBA 5A8ZA 1WOFA 1MKXK 1V2NT 1AFQC 1EZXC 1QURH 2R3UA 4IC6A 2I6SA 3FP8E 2ODPA 3R0FA 1IQIA 1D6RA 1FJSA 1QJ1B 2OTVA 7ESTE 1UVSH 4XSKU 3PO1B 2OC0A 4CRBA 3TH4H 4DG4A 2OQ5A 8GCHF 1LPZB 4NIYA 4DVAU 4GAWA 2FP7B 2PKSB 1P2KA 1BMMH 1E34B 4X2YA 2B8OH 1WCZA 4Q7ZA 3ZZ8A 3S7KB 1EXFA 4BAHB 1PQ7A 4Y71A 1A7SA 1W0ZU 1C5MD 3B8JA 1WTHD 3PLKA 2FS9A 3BSQA 1QJ6B 1RFNA 3ZV8A 1P2NA 5F6MA 2FMJA 1OWKA 3UPEA 3ZZBA 4HGCA 1TNKA 1GBIA 2C8XB 1ZPZA 1FIZA 1T32A 3MU1A 2PR3A 1A0LA 4TY6A 3DUXH 1O2JA 5H4IB 2VVCA 5JBAS 4FU8A 3SJ8A 1ZRKA 3A8BA 1JMOH 1HJAB 1VITG 1AQ7A 1HPGA 4D9RA 1HAVB 2V3HH 1Q31A 1FY5A 3SUFA 4AG1A 1QRZA 1HV7A 1MCVA 1YYY1 4ISOA 1P9UA 2P95A 1T4VH 3JZ1B 1MKWK 4HI3A 3KQCA 4ZROA 2CJIA 1XVMA 3KNXA 1D4PB 3MU5A 2F9BH 1V2JT 1PJPA 1EAXA 4YM9A 3LKWA 1MTVA 1TA6A 1SGFG 4F49A 3RXPA 3W94A 1XUIA 1ACBE 1SC8U 2P3UB 3F9EA 3T62A 4CR5A 3PMJA 3AW0A 4JK6A 3TLOA 1C1OA 3OY5U 4MNWA 5IDKA 3MWIU 3DHKH 3UNQA 1SGFA 5EW1H 3MO6A 3OYPA 3SHCH 3LPRA 2W5EA 5AFYH 1SL3A 3AAUA 1P01A 3AK5A 1P2MA 1DLEA 3RM2H 4Y7AA 1O2UA 2VU8E 1BIOA 2C8WB 3UY9A 3PTBA 1AKSA 2ZU2A 4ZUHA 1C1NA 4SGAE 4MVNA 1ZJKA 1QL9A 1KDQA 1PPBH 1OP8A 1A5GH 3RXIA 3SORA 3BG4B 1AUJA 1GVKB 4JYVH 4BTTB 1UVOA 1O2KA 1L1GA 5LPEA 1T8MA 4FUFA 3GY3A 1PYTC 2ZCHP 1EB1H 1O5GH 1NRNH 2D26C 2XBXA 2ZHQH 3ZZ6A 4JYUH 1GI1A 4CBNA 2ZO3H 1SFQB 1GBBA 5AFZH 2PLXA 4UEHH 4MQAA 1ZSJA 1AIXH 1ZTJA 2GGVB 2XC0A 2GCHF 4YT6H 4YLUA 5DP3A 1NS3A 4FUBA 2H6MA 2R0LA 4B2AA 2AGGX 1BA8B 4CH8B 3TGJE 1D9IA 1L0ZA 3PB1E 1P3CA 1Y3UA 3MH4A 5GCHG 1MTUA 5E0HA 2FI5E 1DANH 1JBUH 2QXGA 4OS4A 4B71A 2FOGA 4ZKRU 3A7XA 2SFAA 3PO1C 4IMQA 3RDZA 5FCRA 1LVBA 2ANWA 3E16B 5T1VA 1B7XB 2PKSC 1EUFA 2A45B 4FUEA 1J9CH 1K28D 4I8LA 1O2SA 2EEKA 2ILNA 1O3GA 2PGQB 5A09A 5ETXA 5DP8A 3D62A 3OSYA 2OC7A 3SNEA 3A8CA 1FONA 3SN8A 1XMNB 2G51A 1NO9H 5E2OA 3G01A 2EI6A 1SLUB 1Z1IA 3L33A 5BRRE 2F9UA 1TMUH 2G4TA 1GBDA 5C20A 1O3MA 4E05H 1BRUP 4FUJA 4CBOA 3RXMA 3ZYDA 1CGIE 3A85A 1HJAC 2UUYA 4DW2U 1NFWA 4U2WA 3OX7U 1CA8B 2ANKH 3MU4A 5GIBA 3UWJH 1C1RA 1S84A 1THRH 2SNWA 3GICB 4IMZA 4ZXYH 3VFEA 1YPEH 2WYJA 3A81A 1BJUA 1DWDH 2ODQA 2R0KA 3ZVDA 5JDUB 1IQKA 4D7GA 4YOIA 1FZZA 3P92A 1BQYA 1HAVA 1ELVA 1O30A 1ZYOA 4GHTA 2PSYA 1GJ5H 1KLIH 2OCVB 5FX5A 1C5SA 1GHAF 3RLWH 3MHWU 1Q3XA 3F9FA 3U69H 3QK1A 2O8UA 3EA7A 2ZFFH 1PPZA 3H5CB 4Q7YA 4ESTE 3ATKA 5A0CA 4NZQA 3VEQB 1K1IA 1BTYA 1P2OA 3VGCB 1H9HE 2P16A 4MPXA 2Y7XA 2BHGA 1EB2A 4RSPA 2FOCA 4GCHG 4X6OA 1ARCA 4ZHLU 1HAHH 2BMGB 1G3DA 1LTOA 4R8TB 1V2ST 2WPLS 2B7DH 2HNTC 2ZU4A 4K69A 5EODA 1P09A 4NFFA 1QBNA 1VCQA 3UR9A 2Y6TA 1GHVH 3DA9B 4WH8A 3RMLH 4JZEH 2ODYB 3FP7E 1D3TB 1PPCE 3BG4C 4HZHA 3T29A 1SQOA 2ZGXH 1W11U 5GWZA 3GCOA 1N8OB 1WAYB 3A89A 4A7IB 2H1UA 2BB4A 5LPFA 3K2UA 2J2UA 3BIVH 2GZ8A 1SG8B 2CGAA 2Q6FA 3SNAA 1C2FA 2HALA 1HJ9A 4YZUA 4INKA 2XC5A 4AOQA 1AVGH 3W95A 3EAJA 1LHGH 1SBWA 3M7TA 1SGNE 1Y5UT 2BXTH 2Z9JA 3O8DA 5A8XA 3A84A 1IQFA 3K6ZA 1BTPA 4X8SH 4O3TA 2OLGA 1TPSA 3KCGH 2FOBA 4A1XA 1DXPA 1G3EA 2SGDE 1NC6A 5DP7A 2FDAA 2FYQA 1GHXH 1P04A 1WU1A 2G8TA 3IG6B 4NSVA 3QX5H 4BXSA 1Y3YA 4LK4A 4Y0YE 4AFZA 1GMDF 1H9LB 3SZNA 5DKMA 2CF9H 1OWJA 1CGHA 1WBGB 3H7OA 3BTGE 1BBRE 1ESBA 2A4GA 3S9CA 5EPYA 1GHBF 2AYWA 4NA8A 2ZEBA 4ISIH 2A4OA 1TABE 4WMEA 4BOHA 2FTLE 3UOPA 3SU0A 4OM9A 1P11E 2HLCA 1O2TA 1VCPA 4DURA 1FY3A 1GJDB 4XBDA 4B73A 5T3HA 2AEIH 3UFAA 1DUAA 1F0TA 2BY6X 2HRVA 2THFB 1EX3A 4Y8XA 3SOSA 3VB3A 2V0BA 1ESTA 4WMFA 4MNXA 2BVRH 1GMHF 4Y76A 4X1QU 1G3CA 3SUEA 1B5GH 1O3BA 2AS9A 4BTIB 1TGNA 2Z3CA 3A86A 8GCHG 2ZDMA 2GMTC 3MNXA 3EE0B 4NWLA 2ZU1A 2WV4A 2RG3A 2IJOB 1O2WA 1ZGVA 3F9HA 3U9AH 3O8CA 2LNCA 1O3KA 2A5IA 1J15A 1A1RA 1DE7H 1HYLA 1W14U 4FUCA 4D8NA 2Z9IA 4RKJB 1O3FA 1Y3XA 1OKXA 1O2MA 1TIOA 3SJIA 3GCTF 2CXVA 3EQ0H 3ZVEA 1CQQA 4OS6A 4ZMAH 2JH0D 3SGQE 2I6QA 2BLQA 3KL6A 3HGPA 1HBTH 1K21H 1KTSB 5FPYA 3P95A 4OGYA 2XBYA 2WUCA 3RXQA 3VGCC 3Q3KA 2H9EH 4X8UH 1TBZH
chains in the Genus database with same CATH superfamily
1ZPBA 3LGVA 1C2MA 3SQEE 3KN2A 4X0WU 5EPNA 2FX6A 1SKYE 5A0AE 4MLFB 3RMOH 3VXEH 1KXFA 1GBFA 1C2HA 2ZTYA 2ULLA 4AB9A 2OC8A 3MO9A 3GDSA 3BF6H 1TONA 2AGEX 1LVMA 2C4FH 1SGPE 1AVWA 3FANA 5F8TA 1GJ6A 1D3QB 4RT1A 5FXLA 1DICA 2BY8X 1TQ7B 1P2JA 1O3PB 2C90B 1CSOE 2A4RA 2PV9B 2O8WA 3BEUA 3ELAH 2VIDA 3M3SA 3LONA 3AAVA 1RXPA 3DFJA 4BAQB 1X7AC 4NIXA 1N8OC 1O2OA 2WSSD 2VIOA 4J1YA 1VZQH 2ZPRA 3M5MA 4TSFD 5L2ZH 1V3XA 4Y7BA 1DSTA 1AHTH 5L6NH 1P02A 2ESTE 1LO6A 2BD3A 1FPHH 2BQ7B 1SGEE 1P0SH 1DVAH 2F9VA 3T26A 5DN6D 3RXOA 2UWPA 3RXHA 2OD3B 1SR5C 1ESAA 4I86A 7GCHF 1YLNA 3E90B 1KXEA 3M35A 5L30H 3Q77A 2QAAA 4CRAA 1MAXA 1QA7A 1QRXA 4AG2A 1YM0A 5C0TA 3ATIA 4FVBA 5EXLA 1L4ZA 1O36A 3RXGA 2C8ZB 1UJ1A 2D8WA 3ZVCA 1Y59T 1EASA 3UQOA 4IS5A 1OSSA 1RTKA 1LHCH 5EXMA 3Q76A 2FZZA 1HFDA 1P57B 1EZSC 1SPJA 3RXJA 2GCHG 1Y3WA 3HKIB 3OEHD 3TJVA 3MH7A 1GHZA 1KXDA 5T6GA 2EC9H 3TVJB 1ANCA 1C9PA 1GBKA 3BEIB 4Y6DA 4IGDA 1WXRA 1QB9A 1ANDA 2BX4A 1EOJA 3UTUH 4I8HA 1OYTH 1SOZA 1O5DH 1E1QD 2ZDLA 5C5NA 3K65B 1MU8B 3MU8A 2LELA 3UUZA 4BXWA 2Y5HA 1S5SA 5DPAA 5FL7D 1LMWB 4YTAA 2A7JA 1TB6H 1V2QT 3ZIAD 5A2MH 3URCA 1SGRE 4FU7A 4FUGA 5FCKA 3VG8A 4NA9H 1C4Y2 4OS1A 4I7YH 1FXYA 4RKOB 3I78A 2QF4A 1J16A 1DS2E 4E7RG 1CU1A 1EJAA 2WPHS 2F9OA 1NFUA 2WPIS 3RXCA 1INCA 2YNBA 1QA0A 2PKAB 2ZU5A 1C4U2 2XC4A 3IWMA 4OS7A 4KKDA 5ESBA 3R3GB 3TJUA 1TLDA 2VIPA 1AI8H 1NU7B 4M9FA 1C5PA 1GI3A 1GI0A 2ZFPH 7LPRA 2FIRH 2FO9A 3PM3A 3T27A 1W8BH 2V3OH 5F03A 5C5OA 1FY1A 4Y8YA 3QTVH 4I8KA 1QL8A 1BTUA 3F9GA 2ZFTA 5I46H 2OUAA 1O37A 3CS0A 2XTTB 3RMNH 5F8XA 1EJNA 2PWXA 1S81A 1KIGH 5LPRA 2NU4E 3M7UA 1YY3A 2QYIA 1MQ5A 1SQTA 2Y5GA 3A8AA 4YESB 3LGYA 4ISLA 4A1TA 1K9OE 2OBOA 1W12U 1HDTH 4I8JA 4RN6A 2R2WU 1PPGE 1TA2A 1A5IA 3BIUH 2R2MB 2P59A 1IQNA 1GWAA 1GHAG 4ZH8A 1E35B 1OP2A 4UONA 4DIHH 1K2I1 1LVYA 4ASUD 3CP7A 3EYDA 4Y11E 1BITA 1PPEE 3FP6E 3M36A 3QGJA 1UCYH 4Z1MD 3UIRA 2GDDA 3A88A 4X2VA 1O32A 1SI5H 3KYGA 4ISNA 2C8YB 1ZTKA 4H6TA 1T7CA 1QTFA 1G37A 1HAGE 2H5DA 3RXVA 2KCAA 3TH3H 1YPHE 3MFJA 2PUQH 5ABWA 2FYRA 1C4V2 2VH6A 1A3BH 1CBWB 1JXPA 1F0RA 3BTWE 3T5FH 1F0SA 2A2XH 4YT7H 1FNIA 1YPLH 3QDZB 5C1UA 5CHBA 3QZRA 3GY2A 3N7DA 2K8IA 4Y8ZA 1D6WA 1J8AA 2BD5A 1MBQA 2ZHWH 2QXHA 2VIVA 1MAYA 3FFGA 1F92A 1C5NH 1HAXB 2Z9LA 1ZMJA 3DFLA 3P6ZB 3NK8A 3QTOH 1NESE 2JH5D 2IPHA 3Q00A 1LPKB 3MI4A 1H8IH 1PYTD 3ZZ3A 4WY3A 2ZKSA 2J9NA 1FPCH 1SLWB 2PUXB 1GBCA 2PGBB 2FLRH 1SGTA 4ABEA 1YF4A 1CHOF 3NXPA 3GISB 3ZZAA 5JBTA 4H6SB 3LH3A 1GMDG 1ELFA 1SGIB 2P94A 2GDEH 1MZDA 3BTDE 2KAIA 2BD4A 4VGCB 2F4LA 3EA9A 3P8GA 3PMBB 1TX6A 1F5KU 2D1JA 2VWOA 2OC1A 1HRTH 1GL1A 1VJ9U 4K1TA 4MDSA 3ZZ7A 1GHBG 3F1SB 3U8TH 1FN6A 1Q2WA 1UTJA 2O9QA 2QF0A 2ZQ2A 3KF2A 1NRSH 4ABAA 3VPKA 3T28A 1ETSH 3LGUA 1GBHA 1NT1A 1Z71A 3F3BA 2W7UA 2BDIA 3ZZ4A 1GHWH 2L6OA 1YPKH 3V7TA 1O35A 4HFPB 3RXUA 4NIVA 1ZTLA 2AMQA 5AHGH 1O2HA 2ZG0H 2WPMS 4K60A 3RXBA 2PKAA 1THSH 2KCYA 4NWKA 1GMHG 1EKBB 4IBLH 9LPRA 1M9UA 1OOKB 4ZCNA 2WUBA 1ZHPA 1F5LA 3SNCA 3S0NA 7KMEH 1MTNB 1DOJA 1IQEA 1E36B 2HVXA 4MTBA 3F0PA 2FLBH 3SI4H 2BDGA 2QY0B 3S9AA 3GYLB 2EA3A 2ZDKA 3RXSA 5PTPA 1U6QA 1FDPA 3UREA 1V2OT 3TK9A 3UQVA 2Y5FA 4DOQA 1H8ED 3OY6U 1GI8B 2WV9A 4XDEA 2XNDD 1WQVH 3E3TA 3GCTG 2CK3D 3TIUA 5HGGA 2ZCKP 3SU2A 1GVZA 1NRQH 3ESTA 3HPTB 4WMDA 2CV3A 2J92A 3E1XB 2ZFRH 1L1NA 1ELCA 1UO6A 2ZF0H 1LHEH 1OP0A 3SV6A 4WXVA 1GJ7B 4X1SU 3TH2H 3SJOA 4TYDA 2KX4A 1AVXA 1S83A 4AB8A 5HM9A 3ODDA 1YCPM 1YLDA 2VIQA 2JIZD 1AO5A 2ZGCA 3F0OA 1O2GH 1C5XB 5DK1A 4ISHH 3UNSA 2QN5T 3U98H 1NROH 4DJZB 2VIWA 4O3UA 3SNDA 1C1SA 2ZFSA 1O2YA 2GCTB 1UMAH 2NU2E 3MH6A 3SBKA 4GHQA 4OS5A 3FAOA 1S82A 4TPIZ 5GPIB 1DFPA 2BZ6H 4LZ4B 3KIDU 3LT3A 1Y5AT 2HPQH 4KP0A 2SNVA 8KME2 1TWXB 5GXPA 1EOLA 5TCAA 4F55A 4BANB 2J98A 3A83A 1O5CB 2EI8A 2TBSA 1E0FD 7GCHG 2GP9B 5FPTA 2XOKD 3GYMA 5C2ZA 1ZGIA 2P93A 2BDHA 1QZ8A 2ALVA 1DM4B 2BOKA 1TOMH 1NY22 1FMGA 1HAPH 4O9VA 3ZZ9A 4R0IA 1KXAA 4E7NA 5EU8A 3B23B 4B6EA 5E0JA 3SV9A 1IAUA 1RS0A 4VGCC 2AFQB 1O34A 4AC9A 2ZDVH 2VWLA 2ZNKH 1ABIH 1O2ZA 3LH1A 3KQ5A 2QXIA 2AIQA 8ESTE 3T2NA 4AN7A 1A61H 1DWEH 4H42U 1A4WH 1H8HD 1HNEE 1KLTA 3ZV9A 2OXSA 2XWAA 4SGBE 2QF5A 1TPOA 2WHXA 3LIWA 1P2QA 1C2EA 3UOUA 3ENSB 3SU6A 3SNBA 3TGKE 3RP2A 1IQMA 1O5BB 1ELAA 5JBBS 1TNGA 3I29A 1HXEH 1CT2E 4BTUB 2VVUA 1DWCH 3F6UH 1E1RD 2CF8H 3RLYH 2XBVA 2H9TH 5HYOA 1C5TA 1DWBH 3STJA 4DT4A 3ATMA 1MD8A 4DCDA 4AFQA 1Z1JA 4DY7B 1MTNC 1VR1H 4Y0ZE 1UHBB 2P3FH 4XE4A 5KEDA 2Z9KA 4JZFH 3QLPH 3KHVA 2ZHFH 1C1UH 1C2IA 1GMCF 1NFYA 4KTSA 1UTNA 1EAUA 2SGQE 4ABIA 2VH0A 1FY4A 2KFWA 2FOEA 4FETA 1HAZB 3SZEA 1ORFA 2O8MA 3CNRA 4U32A 1TRYA 2ZECA 2BM2A 2HPPH 4ZKNU 4I8GA 1ZMNA 3SQHE 5LH8A 2ALPA 1QQ4A 1P12E 2STBE 1SGCA 4M7GA 1EP5A 3GY4A 2XWBI 1ZPCA 2ZP0H 4Q7XA 2WPKS 9ESTA 1SGDE 1GHYH 1RIWB 2XCNA 3CS7A 1GGDB 3SYJA 2P8OB 3PROA 2XNIA 2CHAB 3UR6A 2BDAA 2OBQA 2G55A 4UFFH 1LHDH 4ZKSU 2GTBA 3SGAE 4ZXXH 1YC0A 1QQUA 1QBOA 2P3TB 1RD3B 1BDAA 2H2ZA 2ZGHA 4NCYA 3FZZA 1G9IE 1O39A 4B2BA 2OQUA 5FPSA 3ZZDA 3MTYA 2GCTC 1O3EA 3AVZA 1IHTH 3FO8D 4MPWA 4AYYB 1H4WA 2J38A 1C5RA 1Z8IB 4DIIH 1KMHB 1ZLRA 1GCTB 2IN2A 2ZFQH 3UNRA 4ASHA 4XFQA 1GI4A 1AMHA 4YO9A 1GI6A 4Q63A 3UWIA 1C1QA 3M5NA 2ZHEH 1KSNA 1EPTB 3MMGA 3SI3H 3MH5A 1GBEA 2ZZUH 4TY7A 2AMPA 1YPMH 2BY7X 1AWFH 5TCCA 3URDA 4ZKOU 1DITH 1ZHMA 3BG8A 4UFGH 1K1PA 1ANBA 1V2VT 2NU0E 1SVPA 3TJNA 2GKVE 2UUFB 3V0XA 4JYTA 4I32A 4A1VA 3HK3B 4NG9H 5EGMA 4K1EA 1SHYA 5CDFE 1EP6A 3MNCA 2TGDA 3F68H 1UCYK 3F2GA 4INLA 4TWWA 3P70B 1S0RA 1TRNA 1Z8GA 1ZMLA 3FKSD 3NWUA 1XUJA 1CA0B 1P8VC 1K1OA 3SW2B 5C3NA 1SQRA 3VB5A 1MMJN 1YCPH 1ELTA 2FX4A 3TPIZ 1CHOG 8LPRA 4BNRA 1C1TA 1UTQA 2XRCA 1K22H 4J2YB 2FTMA 4JK5A 1O3AA 3I77A 3BTTE 2PW8H 4NSYA 1HIAB 2BVSH 2YNAA 4BAOB 2STAE 1JWTA 1TGSZ 2ANMH 2R9PA 1ETTH 1FUJA 3L6PA 4JZDH 4K3JA 4UE7H 5FBIA 1W13U 1BZXE 6GCHF 1ELBA 3SU4A 3RXEA 1O3DA 1UK3A 2IOTA 1QL7A 2QV1A 1GJ8B 3QUMP 1UTKA 1C9TA 4NZLA 3MOCA 3SUGA 4IC5A 1BRCE 1SQAA 1DUEA 1TPAE 2WZQA 2Q1JA 1YPJH 3JZ2B 3ITIA 1UHBA 2Z3EA 1JOUB 3M5OA 2ASUB 1NPMA 4P02A 1HGTH 1DLKB 1F5RA 1G2LA 1JRTA 3M61U 2JKHA 4GPGA 1CO7E 3B9FH 2ZPQA 3L3TA 3PRBA 2SGEE 3SU3A 2ZU3A 2UWOA 4DT7B 1A5HA 2BD7A 3P8OA 3SU5A 4NGAH 1IHSH 1G36A 1ANEA 1AZZA 3E0PB 3E8LA 3QN7A 3SGBE 1VCWA 1PFXC 3BTEE 4E06H 5B6OA 3GY5A 2LPRA 4WF8A 4YOGA 3TNTA 1AB9B 1XXDA 2FEQH 4GVUA 1RIWC 4X2XA 4TWYA 1O3LA 2GZ9A 1F0UA 5IYTA 1EZQA 1GGDC 1SHHB 1EAWA 3O8RA 2P8OC 1BOQA 4XBCA 2CHAC 2GZ7A 1NFXA 2H5CA 3O8BA 1TGTA 1V2WT 1D3DB 2GV6A 1O5FH 4ABDA 4AGJA 5E0GA 1YGCH 3E6PH 2VBCA 1GJAB 4INHA 4ABHA 2BD2A 2RFKC 2GT8A 5HIZA 3C1KA 4LOYH 4WJG2 2QC2A 1O2RA 1UTLM 1TPPA 1UVUH 5DP4A 2A2QH 2W6JD 1JIMA 3SU1A 1DPOA 5JB8S 1T8OA 1QGFA 1EPTC 5GJ4B 2OINA 1RGQA 1TGBA 4WWYA 3LDXH 4ABFA 1C5OH 2FOMB 4Y79A 1FQ3A 3D23A 1GI5A 3LGTA 1EPTA 1WDIA 4GUXA 1EAIA 1CT0E 3SUDA 1MZAA 4O97A 2Q6GA 3PV4A 4H4FA 1QJ7B 3SJKA 1G30B 4RI0A 4FUDA 1XVOA 2QF3A 2DUCA 2HOBA 3OTJE 1P05A 1P10A 1LVOA 1IQLA 1C2DA 1OYQA 1P2IA 2XXLA 3MNSA 1IQJA 4GLYA 4FUHA 4HG6A 5FBEA 4CR9A 1YPGH 1VKYA 1HB0B 1O3IA 1UK2A 3VB6A 1D3PB 5BPEA 1CA0C 2WYGA 1TNHA 1AE5A 2G4UA 2PFEA 4B6FA 3QO6A 3KQBA 2IPQX 5CMXH 1VJAU 1HUTH 4GSOA 5EQRA 3RC6A 2EI7A 1BB0B 2VWNA 1RRKA 2PTCE 4ZHAA 2QGRA 2VGCB 1BMAA 1QNJA 2FESH 1BUIA 2G5VA 3KGPA 3ZZ5A 2V6NA 1TQ0B 4X8VH 2A5KA 4BAKB 4B1TA 2A5AA 1HIAA 1OWIA 3DCLA 3GY8A 2G81E 1FY8E 4X6PA 1FV9A 3T25A 1K0HA 3V3MA 1PPFE 2YMSB 1UK4A 4ABJA 5T6FA 1YLCA 2QE7D 1TFXA 2B0FA 2HLDD 1TMTH 2BZAA 1BBRH 1WTGH 5A8YA 4K1SA 2J5UA 1PQAA 1FN8A 3TU7H 2AMDA 2ZA5A 5EQQA 4A92A 1Y3VA 1AD8H 4X1RU 3LOXA 4KTCA 2O8TA 1LPGB 1VGCB 4UFEH 2V7QD 1GBAA 2W3KA 1GI2A 3RXDA 2F91A 3MO3A 3H09A 1WQSA 1V6DA 1RJXB 1GJCB 4TPYA 1AB9C 1UTOA 2FPZA 4FXGH 2BDCA 2CMYA 1MABB 2RDLA 2BLOA 1IQGA 5GNDA 3RC5A 1GMCG 1NZQH 3P8FA 4IW4E 5JBCS 2ZIQH 3S69A 2H9HA 2VWMA 1EZUC 1WUNH 4Y10E 3RXLA 3S7HB 3LC3A 2FODA 2OP9A 1DDJA 1BHXB 3DT0H 1LKAA 3ZYEA 3ATLA 2F3CE 1K1NA 1AE8H 3RXKA 2KCPA 5HMAA 4KTUA 4X1PU 1O3OA 4JZIA 1MTSA 3ZVFA 5JPMH 3A7ZA 4ZHMU 1W7GH 4AX9H 2UUJB 1YPHC 2HWLB 1ELDE 1G32B 3PLBA 3TNSA 2ZGJA 4BAMB 1BRBE 4MG3A 5KECA 5E2PA 2FXRA 2J34A 1BJVA 1YP9A 3ODFA 1OXGA 4A6LA 1T4UH 3SHAH 1Z6JH 2Y81A 4HTCH 4MNYA 1TE0A 1TAWA 4I31A 1JIRA 3HKJB 2FI4E 1KTTB 1QHRB 1XX9A 1C1PA 1TNIA 5EJLA 2A32A 1BTWA 4X6NA 3TGIE 1HAYB 1H9IE 2KM0A 2BXUH 1F7ZA 1GL0E 2UUKB 2V3MA 1NU9A 5DP9A 1BTXA 3OU0A 3E91A 2RA3A 1MCTA 3RXTA 1Z6EA 2J97A 1COWD 2VNTA 1LCYA 3A7WA 1C1WH 4MNVA 1ZSKA 4ZAEA 4AGKA 3H7TA 2GV7A 5CE1A 1ZRBA 1QBVH 5F53A 3V13A 3OTPA 5HKKD 2BLWA 3NCLA 1EJMA 3F2FA 3NUMA 1V2MT 2ZHDA 3LGIA 2D2DA 5C0UA 2M5TA 1AY6H 4AFSA 1TRMA 1CT4E 1TBQH 2QCYA 3Q3XA 4D9QA 3EDXB 1S6LA 5EOKA 3C27B 5G4BA 2Y82A 2AIPA 2CN0H 1PPHE 1GJ4H 4FU9A 1C5ZB 3RU4T 4F48B 2VGCC 1IQHA 5EJZA 1AGJA 5K7RA 2BOHB 1O2NA 3ZZCA 1QY6A 1GI9B 3FOAA 1T31A 3M37A 2C93B 4XBBA 1CGJE 1C5UA 5KGOA 2A1DB 5JYIA 1K1MA 1O2QA 1CHGA 5DP6A 1V2LT 2JJ1D 5C1YA 1O2IA 2ZTXA 4PROA 1XUGA 2YMSC 1CBWC 3AW1A 3D65E 3Q3YA 3NPSA 1A0HB 1MD7A 1MKXH 3VB4A 1SFIA 3EA8A 1PQ5A 1FX0B 2HGTH 3V12A 5IK2D 2DE9A 4LXBH 5HXFA 2RCEA 3A82A 2BD8A 3GY7A 1S85A 1O38A 1P06A 1J17T 6GCHG 5DP5A 2A4QA 1H8DH 1C5WB 1VGCC 1G2MA 2WPJS 4CH2B 1C1VH 4AZ2B 1UVTH 1DT2A 1EATA 2HNTE 1CVWH 6CHAB 3M7QA 1TOCB 4FOUC 1HCGA 2O8LA 1MTWA 4WVPE 3ZVAA 5DG6A 2GMTB 3TITA 3TJOA 1THPB 3LC5A 4JMYA 4FUIA 4CHAB 1FI8A 1DSUA 1L4DA 4IN2A 5C94A 4K8BA 1BMNH 2G5NA 4Z6AH 3BN9A 1TX7A 1WYKA 1YCPK 3GCHB 4UDWH 4X8TH 5SGAE 2QA9E 1V2RT 1L2EA 5C67A 3NZIA 1A0JA 1C2KA 2BTCE 4FVDA 4X1NU 1RTFB 1C5VA 5C1XA 1K1JA 5I25A 5EIYA 4LZ1H 4JCNA 2TPIZ 5HM2A 1E37B 1TNJA 2PSXA 1Z8RA 1ZJDA 3VXFH 1Y5BT 1GBTA 2F9PA 4KGAA 2AGIX 1MKWH 3DSPA 5DGJA 2BY9X 2OK5A 3DSGA 3PTNA 1EQ9A 4JZ1A 2B9LA 1OWHA 3SV8A 2NU1E 2FS8A 3ZVBA 1ETRH 1AN1E 1GVLA 1TGCA 2FOHA 1O3NA 4B74A 1C2GA 1HXFH 2V35A 2VINA 1YBWA 1FIWA 2ZWLH 3WY8A 1NN6A 4K8YA 1SB1H 5FAHA 1DY9A 2F9NA 5AF9H 1ZZZA 3A87A 3PWCA 1W10U 3SJ9A 3U1JB 1OWEA 3PRDA 2ANYA 1SOTA 2ZCLP 4I33A 1OS8A 1TALA 3RUOA 4YLQH 1KXCA 2WV5A 3NKKA 1A2CH 3PMHB 1N1LA 1QB1A 4NIWA 1OPHB 1VITF 2K1QA 2BLVA 1NRRH 3M3TA 1Z7KA 2A7CA 1UCYE 2XYAA 5FX6A 3HGNA 2A31A 1UTPA 2XW9A 4CRDA 2BD9A 2IJD1 3PLPA 1VITH 1LHFH 1SGYE 3BTFE 3PMAB 1OWDA 1O3CA 3PYHA 1BMLA 4ABGA 2DE8A 3PV2A 3K6YA 4CRGA 2M2AA 2XBWA 1TBRH 1LKBA 3U8RH 1S6FA 2TGPZ 3M3VA 2W3IA 1GBLA 2J94A 1K1LA 1KXBA 5CHAB 4F4OC 3CENA 3MNBA 5A0BA 4B75A 2XCFA 4CREA 3N7EA 5JB9S 2JETB 3KQEA 1ZSLA 4ABBA 2C3SA 1C5YB 2ZGBH 4WH6A 1DY8A 5TJXA 1V2TT 1Y8TA 2SGAA 2Z94A 1MBMA 3A7VA 1SSXA 2QXJA 2UWLA 1PQ8A 1O5AB 2GJGA 4YOJA 1HLTH 1W2KH 1Z8JB 1O2VA 3A7YA 1E38B 5DJ7A 3BTHE 3P8NA 3ATWA 1QB6A 4DGJA 1KLJH 2W6ID 1QR3E 3RU4D 3PWBA 3BTKE 4WXIA 3A80A 4KELA 3QGNB 4NA7A 4AORA 5J4QA 1QFKH 2GT7A 1N6YA 1AFEH 4AYVB 1GBJA 4XD7D 2EQNA 2ZC9H 1MH0A 3RU4E 3TK6A 3RC4A 2FWWA 6CHAC 2AERH 1S6HA 1AWHB 1T8LA 1NTPA 1TNLA 1V2PT 2TIOA 5F8ZA 3RM0H 5EQSA 4CHAC 1ELEE 1BTZA 1C1MA 1OX1A 2BDYA 5GDSH 3SV7A 1O2XA 2NU3E 4CRCA 1TX8A 5E8EH 1H1BA 3GCHC 3U1IB 1XUKA 1V2UT 1A3EH 1ZOMA 1TYNA 2PHBA 1SLVB 2W26A 1QCPA 3IITA 5GCHF 3BEFB 1GBMA 4U01A 1GJ9B 4MPUA 3OE7D 3A7TA 3HK6B 1CE5A 1B0FA 4OS2A 2ZDNA 2Q6DA 1MU6B 2A7HA 3BTME 3RXAA 2TGTA 1QIXB 2BQ6B 1GCDA 1LDTT 2W7SA 1RTLA 4MPVA 1SGQE 3GY6A 6ESTA 5DO4H 1O0DH 1A46H 2BYAX 2Z7FE 3LU9B 1C5QA 4QT8C 3E0NB 1QRWA 1GG6B 1GDQA 1HJ8A 1XKAC 1C5LH 1AFQB 2Z9GA 2R3YA 4B76A 1BBRK 2A0QB 4U30A 2G52A 1SLXB 5EJ1A 3AASA 4UFDH 1YKTA 3RXFA 2VJ1A 2BQWB 1O31A 1ELGA 4X2WA 4D7FA 1B0EA 1HAIH 2AH4X 3FZDA 3DD2H 2ZTZA 3MU0A 1BHXF 1FAXA 3N7OA 3WWFA 5FHTA 1O3HA 1W7XH 2PTNA 3RXRA 1GJBB 1MQ6A 1UVPA 2Y80A 2BX3A 1AU8A 1O5EH 1KY9A 4D76A 1WSSH 3KYFA 3A8DA 4A5TS 4CRFA 1XUHA 1AUTC 2BY5X 3STIA 1FAKH 4K5ZA 3LGWA 1XXFA 2BVXH 3LJJA 4Q2KA 5LGOA 1DX5M 2SGPE 1FLEE 2YOLA 1O33A 3GDVA 3NRLA 3KQDA 1XM1A 1AZ8A 1N6XA 5CHAC 2RA0A 2WPDD 3GDUA 2JETC 4ACAA 4IN1A 4O03A 1ZR0A 1MUEB 5ESTE 1C2JA 1IOEA 3LJOA 2FOAA 1LQDB 5T6DA 1V2KT 3DSOA 5EW2H 4P00A 4Q80A 3RMMH 1GDNA 3M5LA 2GX4A 2HNTF 4GCHF 1L1JA 1BRAA 1BCUH 3BV9B 4K2YA 1SMFE 3GOVB 2TGAA 4Z0KA 2G00A 1ZHRA 5B6LA 1LQEA 5J4SA 2ZPSA 1P3EA 4THNH 1BT7A 1GCTC 1W0YH 2KAIB 1O3JA 2Z6BD 1T8NA 1XUFA 2GD4B 4NFEA 3TK5A 2NWNA 3FVFB 2KZ4A 1WV7H 2Y7ZA 3S9BA 1P03A 2WINI 2J95A 1HAOH 1DXWA 2TRMA 2SGFE 1O2PA 3KEEA 3GCNA 3ZVGA 1NM6A 1ABJH 2FOFA 1KYNA 1AKSB 1G3BA 2ZQ1A 2FI3E 1NRPH 3QWCH 1GI7B 2Z3DA 5K0HA 1C2LA 3MYWA 1KDQB 1GDUA 4X6MA 1BTHH 4AFUA 3BTQE 3D49H 3EGKH 1TMBH 5AVDA 1GPZA 2F43B 1UTMA 5EG4A 1S0QA 5L2YH 2F83A 2GVFA 3PV5A 3K9XB 2JH6D 1J14A 2JJ2D 2VB0A 2QIQA 6LPRA 2ZDAH 2VVVA 4B2CA 1P9SA 1JRSA 1ARBA 3P17H 3U28C 2ZI2H 2J4IA 1O2LA 2FM2A 4UD9H 1F2SE 3HATH 3SV2H 3QZQA 4XOJA 3SO3A 1ID5H 3U8OH 1XKBC 4OGXA 5EXNA 2B5TB 1GG6C 3VB7A 1W3CA 2BDBA 5A8ZA 1WOFA 1MKXK 1V2NT 1AFQC 1W0KD 1EZXC 1QURH 2R3UA 4IC6A 3GS9A 2I6SA 3FP8E 2ODPA 3W1EA 3R0FA 2AHME 1IQIA 1D6RA 1FJSA 1QJ1B 2OTVA 7ESTE 1UVSH 4XSKU 3PO1B 2OC0A 4CRBA 3TH4H 4DG4A 2OQ5A 8GCHF 1LPZB 4NIYA 4DVAU 4GAWA 2FP7B 2PKSB 1P2KA 1BMMH 1E34B 4X2YA 2B8OH 1WCZA 4Q7ZA 3ZZ8A 3S7KB 1EXFA 1NBMD 4BAHB 1PQ7A 4Y71A 1A7SA 1W0ZU 1C5MD 3B8JA 1WTHD 3PLKA 2FS9A 3BSQA 1QJ6B 1RFNA 3ZV8A 1P2NA 5F6MA 2FMJA 1OWKA 3UPEA 3ZZBA 4HGCA 1TNKA 1GBIA 2C8XB 1ZPZA 1FIZA 1T32A 1NBME 3MU1A 2PR3A 1A0LA 4TY6A 3DUXH 1O2JA 5H4IB 2VVCA 4Q4LA 5JBAS 2RDEA 1E79D 4FU8A 3SJ8A 1ZRKA 3A8BA 1JMOH 1HJAB 1EFRD 1VITG 1AQ7A 1HPGA 3N99A 4D9RA 1HAVB 2J98B 2V3HH 1Q31A 1FY5A 3SUFA 4AG1A 1QRZA 1HV7A 4ACBA 1MCVA 1YYY1 4ISOA 1P9UA 2P95A 1T4VH 3JZ1B 1MKWK 4HI3A 3KQCA 4ZROA 2LP6A 2CJIA 1XVMA 3KNXA 1D4PB 3MU5A 2F9BH 1V2JT 1PJPA 1EAXA 4YM9A 3LKWA 1MTVA 1TA6A 1SGFG 4F49A 3RXPA 3W94A 1XUIA 1ACBE 1SC8U 2P3UB 3F9EA 3T62A 4CR5A 3PMJA 3AW0A 4JK6A 3TLOA 1C1OA 3OY5U 4MNWA 5IDKA 3MWIU 3DHKH 3UNQA 1SGFA 5EW1H 3MO6A 3OYPA 3SHCH 3LPRA 2W5EA 5AFYH 1SL3A 3AAUA 2L74A 1P01A 3AK5A 1P2MA 1DLEA 3RM2H 4Y7AA 1O2UA 2VU8E 1BIOA 2C8WB 3UY9A 1BMFD 3PTBA 1AKSA 2YMSD 2ZU2A 4ZUHA 1C1NA 4SGAE 4MVNA 1ZJKA 1QL9A 1KDQA 1PPBH 1OP8A 1A5GH 3RXIA 3SORA 3BG4B 1AUJA 1GVKB 1OHHD 4JYVH 4BTTB 1UVOA 1O2KA 1L1GA 5LPEA 1T8MA 4FUFA 3GY3A 1PYTC 2ZCHP 1EB1H 1O5GH 1NRNH 2D26C 2XBXA 2ZHQH 3ZZ6A 4JYUH 1GI1A 4CBNA 2ZO3H 1SFQB 1GBBA 5AFZH 2PLXA 4UEHH 4MQAA 1ZSJA 1AIXH 1ZTJA 2GGVB 2XC0A 2GCHF 4YT6H 4YLUA 5DP3A 1NS3A 1YWUA 4FUBA 2H6MA 2JDID 2R0LA 4B2AA 2AGGX 1BA8B 4CH8B 3TGJE 1D9IA 1L0ZA 3PB1E 1P3CA 1Y3UA 3MH4A 5GCHG 2HVYB 1MTUA 5E0HA 2FI5E 1DANH 1JBUH 2QXGA 4OS4A 4B71A 2FOGA 4ZKRU 3A7XA 2SFAA 3PO1C 4IMQA 3RDZA 5FCRA 1LVBA 2ANWA 3E16B 5T1VA 1B7XB 2PKSC 1EUFA 2A45B 4FUEA 1J9CH 1K28D 4I8LA 2KR7A 1O2SA 2EEKA 2ILNA 1O3GA 2PGQB 5A09A 3F2HA 5ETXA 5DP8A 3D62A 3OSYA 2OC7A 3SNEA 3A8CA 1FONA 3SN8A 1XMNB 2G51A 1NO9H 5E2OA 3G01A 2EI6A 1SLUB 1Z1IA 5DSFA 3L33A 5BRRE 2F9UA 1TMUH 2G4TA 1GBDA 2K0QA 5C20A 1O3MA 5C17A 4E05H 1BRUP 4FUJA 4CBOA 4RT0A 3RXMA 3ZYDA 1CGIE 3A85A 1HJAC 2UUYA 4DW2U 1NFWA 4U2WA 3OX7U 1CA8B 2ANKH 3MU4A 5GIBA 3UWJH 1C1RA 3MQKC 1S84A 1THRH 2SNWA 3GICB 4IMZA 4ZXYH 3VFEA 1YPEH 2WYJA 3A81A 3OEED 1BJUA 1DWDH 2ODQA 2R0KA 3ZVDA 5JDUB 1IQKA 4D7GA 4YOIA 1FZZA 3P92A 1BQYA 1HAVA 1ELVA 1O30A 1ZYOA 4GHTA 2PSYA 1GJ5H 1KLIH 2PP6A 2OCVB 5FX5A 1C5SA 1GHAF 3RLWH 3MHWU 1Q3XA 3F9FA 3U69H 3QK1A 2O8UA 3EA7A 2ZFFH 1PPZA 3H5CB 4Q7YA 4ESTE 3ATKA 5A0CA 3UB0A 4NZQA 3VEQB 1K1IA 1BTYA 1P2OA 3VGCB 1H9HE 2P16A 1UW7A 4MPXA 2Y7XA 2BHGA 1EB2A 4RSPA 2FOCA 4GCHG 4X6OA 5HIYA 1ARCA 4ZHLU 1HAHH 2BMGB 1G3DA 1LTOA 4R8TB 1V2ST 2WPLS 2B7DH 2HNTC 2ZU4A 4K69A 5EODA 1P09A 4NFFA 1QBNA 1VCQA 3UR9A 2Y6TA 1GHVH 3DA9B 4WH8A 3RMLH 4JZEH 2ODYB 3FP7E 1D3TB 1PPCE 3BG4C 4HZHA 4XRNA 3T29A 1SQOA 3FN8A 2ZGXH 1W11U 5GWZA 3GCOA 1N8OB 1WAYB 3A89A 4A7IB 2H1UA 2BB4A 3WW7A 5LPFA 3K2UA 2J2UA 1W0JD 2GZ8A 3BIVH 1SG8B 2CGAA 2Q6FA 3SNAA 1C2FA 2HALA 1HJ9A 4YZUA 4INKA 2XC5A 4AOQA 1AVGH 3W95A 3EAJA 1LHGH 1SBWA 3M7TA 1SGNE 1Y5UT 2BXTH 2Z9JA 3O8DA 5A8XA 3A84A 1IQFA 3EE7A 1BTPA 3K6ZA 4O3TA 4X8SH 4TT3D 2OLGA 1TPSA 3KCGH 2FOBA 4A1XA 1DXPA 1G3EA 2SGDE 3UAIC 1NC6A 5DP7A 2FDAA 2FYQA 1GHXH 1P04A 1WU1A 2G8TA 3IG6B 4NSVA 3QX5H 4BXSA 1Y3YA 4LK4A 4Y0YE 4AFZA 1GMDF 1H9LB 3SZNA 5DKMA 2CF9H 1OWJA 1CGHA 1WBGB 3H7OA 3BTGE 1BBRE 1ESBA 2A4GA 3S9CA 5EPYA 1GHBF 2AYWA 4NA8A 3WWBA 2ZEBA 4ISIH 2A4OA 1TABE 4WMEA 4BOHA 2FTLE 3UOPA 4OM9A 3SU0A 1P11E 2HLCA 1O2TA 1VCPA 4DURA 1FY3A 1GJDB 4XBDA 4B73A 5T3HA 2AEIH 3UFAA 1DUAA 1F0TA 2BY6X 2HRVA 2THFB 1EX3A 3OFND 4Y8XA 3SOSA 3VB3A 2V0BA 1ESTA 4WMFA 4MNXA 2BVRH 1GMHF 4Y76A 4X1QU 1G3CA 3SUEA 1B5GH 1O3BA 2AS9A 4BTIB 1TGNA 2Z3CA 3A86A 8GCHG 2ZDMA 2GMTC 3MNXA 3EE0B 4NWLA 2ZU1A 2WV4A 2RG3A 2IJOB 1O2WA 1ZGVA 3F9HA 3OAAD 3U9AH 3O8CA 2LNCA 1O3KA 2EY4C 2A5IA 1J15A 1A1RA 1DE7H 1HYLA 1W14U 4FUCA 4D8NA 2Z9IA 4RKJB 1O3FA 1Y3XA 1OKXA 1O2MA 4YXWD 1TIOA 3SJIA 3GCTF 2CXVA 3EQ0H 3ZVEA 1CQQA 4OS6A 4ZMAH 2JH0D 3SGQE 2I6QA 2BLQA 3KL6A 2KCOA 3HGPA 1HBTH 1K21H 1KTSB 5FPYA 3P95A 4OGYA 2XBYA 2WUCA 3RXQA 3VGCC 3Q3KA 2H9EH 4X8UH 1TBZH
chains in the Genus database with same CATH topology
1ZPBA 3LGVA 1C2MA 3SQEE 3KN2A 4X0WU 5EPNA 2FX6A 5A0AE 1SKYE 4MLFB 3RMOH 3VXEH 1KXFA 1GBFA 1C2HA 2ZTYA 2ULLA 4AB9A 2OC8A 3MO9A 3GDSA 3BF6H 1TONA 2AGEX 1LVMA 2C4FH 1SGPE 1AVWA 3FANA 5F8TA 1GJ6A 1D3QB 5FXLA 1DICA 2BY8X 1TQ7B 1P2JA 1O3PB 2C90B 1CSOE 2A4RA 2PV9B 2O8WA 3BEUA 3ELAH 2VIDA 3M3SA 3LONA 3AAVA 1RXPA 3DFJA 4BAQB 1X7AC 4NIXA 1N8OC 1O2OA 2WSSD 2VIOA 4J1YA 1VZQH 2ZPRA 3M5MA 4TSFD 5L2ZH 1V3XA 4Y7BA 1DSTA 1AHTH 5L6NH 1P02A 2ESTE 1LO6A 2BD3A 1FPHH 2BQ7B 1SGEE 1P0SH 1DVAH 2F9VA 3T26A 5DN6D 3RXOA 2UWPA 3RXHA 2OD3B 1SR5C 1ESAA 7GCHF 3E90B 1KXEA 3M35A 5L30H 3Q77A 2QAAA 4CRAA 1MAXA 1QA7A 1QRXA 4AG2A 1YM0A 5C0TA 3ATIA 4FVBA 5EXLA 1L4ZA 1O36A 3RXGA 2C8ZB 1UJ1A 2D8WA 3ZVCA 1Y59T 1EASA 3UQOA 4IS5A 1OSSA 1RTKA 1LHCH 5EXMA 3Q76A 2FZZA 1HFDA 1P57B 1EZSC 1SPJA 3RXJA 2GCHG 1Y3WA 3HKIB 3OEHD 3TJVA 3MH7A 1GHZA 1KXDA 5T6GA 2EC9H 3TVJB 1ANCA 1C9PA 1GBKA 3BEIB 4Y6DA 4IGDA 1WXRA 1QB9A 1ANDA 2BX4A 1EOJA 3UTUH 4I8HA 1OYTH 1SOZA 1O5DH 2ZDLA 5C5NA 1E1QD 3K65B 1MU8B 3MU8A 2LELA 3UUZA 4BXWA 2Y5HA 1S5SA 5DPAA 5FL7D 1LMWB 4YTAA 2A7JA 1TB6H 1V2QT 3ZIAD 5A2MH 3URCA 1SGRE 4FU7A 4FUGA 5FCKA 3VG8A 4NA9H 1C4Y2 4OS1A 4I7YH 1FXYA 4RKOB 3I78A 2QF4A 1J16A 1DS2E 4E7RG 1CU1A 1EJAA 2WPHS 2F9OA 1NFUA 2WPIS 3RXCA 1INCA 2YNBA 1QA0A 2PKAB 2ZU5A 1C4U2 2XC4A 3IWMA 4OS7A 4KKDA 5ESBA 3R3GB 3TJUA 1TLDA 2VIPA 1AI8H 1NU7B 4M9FA 1C5PA 1GI3A 1GI0A 2ZFPH 7LPRA 2FIRH 2FO9A 3PM3A 3T27A 1W8BH 2V3OH 5F03A 5C5OA 1FY1A 4Y8YA 3QTVH 4I8KA 1QL8A 1BTUA 3F9GA 2ZFTA 5I46H 2OUAA 1O37A 3CS0A 2XTTB 3RMNH 5F8XA 1EJNA 2PWXA 1S81A 1KIGH 5LPRA 2NU4E 3M7UA 2QYIA 1MQ5A 1SQTA 2Y5GA 3A8AA 4YESB 3LGYA 4ISLA 4A1TA 1K9OE 2OBOA 1W12U 1HDTH 4I8JA 4RN6A 2R2WU 1PPGE 1TA2A 1A5IA 3BIUH 2R2MB 2P59A 1IQNA 1GWAA 1GHAG 4ZH8A 1E35B 1OP2A 4UONA 4DIHH 1K2I1 1LVYA 4ASUD 3CP7A 3EYDA 4Y11E 1BITA 1PPEE 3FP6E 3M36A 3QGJA 1UCYH 4Z1MD 3UIRA 2GDDA 3A88A 4X2VA 1O32A 1SI5H 4ISNA 2C8YB 1ZTKA 4H6TA 1T7CA 1QTFA 1G37A 1HAGE 2H5DA 3RXVA 2KCAA 3TH3H 1YPHE 3MFJA 2PUQH 5ABWA 2FYRA 1C4V2 2VH6A 1A3BH 1CBWB 1JXPA 1F0RA 3BTWE 3T5FH 1F0SA 2A2XH 4YT7H 1FNIA 1YPLH 3QDZB 5C1UA 5CHBA 3QZRA 3GY2A 3N7DA 2K8IA 4Y8ZA 1D6WA 1J8AA 2BD5A 1MBQA 2ZHWH 2QXHA 2VIVA 1MAYA 3FFGA 1F92A 1C5NH 1HAXB 2Z9LA 1ZMJA 3DFLA 3P6ZB 3NK8A 3QTOH 1NESE 2JH5D 2IPHA 3Q00A 1LPKB 3MI4A 1H8IH 1PYTD 3ZZ3A 4WY3A 2ZKSA 2J9NA 1FPCH 1SLWB 2PUXB 1GBCA 2PGBB 2FLRH 1SGTA 4ABEA 1YF4A 1CHOF 3NXPA 3GISB 3ZZAA 5JBTA 4H6SB 3LH3A 1GMDG 1ELFA 1SGIB 2P94A 2GDEH 1MZDA 3BTDE 2KAIA 2BD4A 4VGCB 3EA9A 3P8GA 3PMBB 2F4LA 1TX6A 1F5KU 2D1JA 2VWOA 2OC1A 1HRTH 1GL1A 1VJ9U 4K1TA 4MDSA 3ZZ7A 1GHBG 3F1SB 3U8TH 1FN6A 1Q2WA 1UTJA 2O9QA 2QF0A 2ZQ2A 3KF2A 1NRSH 4ABAA 3VPKA 3T28A 1ETSH 3LGUA 1GBHA 1NT1A 1Z71A 3F3BA 2W7UA 2BDIA 3ZZ4A 1GHWH 2L6OA 1YPKH 3V7TA 1O35A 4HFPB 3RXUA 4NIVA 1ZTLA 2AMQA 5AHGH 1O2HA 2ZG0H 2WPMS 4K60A 3RXBA 2PKAA 1THSH 4NWKA 2KCYA 1GMHG 1EKBB 4IBLH 9LPRA 1M9UA 1OOKB 4ZCNA 2WUBA 1ZHPA 1F5LA 3SNCA 3S0NA 7KMEH 1MTNB 1DOJA 1IQEA 1E36B 2HVXA 4MTBA 3F0PA 2FLBH 3SI4H 2BDGA 2QY0B 3S9AA 3GYLB 2EA3A 2ZDKA 3RXSA 5PTPA 1U6QA 1FDPA 3UREA 1V2OT 3TK9A 3UQVA 2Y5FA 4DOQA 1H8ED 3OY6U 1GI8B 4XDEA 2WV9A 3E3TA 1WQVH 2XNDD 3GCTG 2CK3D 3TIUA 5HGGA 2ZCKP 3SU2A 1GVZA 1NRQH 3ESTA 3HPTB 4WMDA 2CV3A 2J92A 3E1XB 2ZFRH 1L1NA 1ELCA 1UO6A 2ZF0H 1LHEH 1OP0A 3SV6A 4WXVA 1GJ7B 4X1SU 3TH2H 3SJOA 4TYDA 1AVXA 1S83A 4AB8A 5HM9A 3ODDA 1YCPM 1YLDA 2VIQA 2JIZD 1AO5A 2ZGCA 3F0OA 1O2GH 1C5XB 5DK1A 4ISHH 3UNSA 2QN5T 3U98H 1NROH 4DJZB 2VIWA 4O3UA 3SNDA 1C1SA 2ZFSA 1O2YA 2GCTB 1UMAH 2NU2E 3MH6A 3SBKA 4GHQA 4OS5A 3FAOA 1S82A 4TPIZ 5GPIB 1DFPA 2BZ6H 4LZ4B 3KIDU 3LT3A 1Y5AT 2HPQH 4KP0A 2SNVA 8KME2 1TWXB 5GXPA 1EOLA 5TCAA 4F55A 4BANB 3A83A 1O5CB 2EI8A 2TBSA 1E0FD 7GCHG 2GP9B 5FPTA 2XOKD 3GYMA 5C2ZA 1ZGIA 2P93A 2BDHA 2ALVA 1DM4B 2BOKA 1TOMH 1NY22 1FMGA 1HAPH 4O9VA 3ZZ9A 4R0IA 1KXAA 4E7NA 5EU8A 3B23B 4B6EA 5E0JA 3SV9A 1IAUA 1RS0A 4VGCC 2AFQB 1O34A 2ZDVH 2VWLA 2ZNKH 1ABIH 1O2ZA 3LH1A 2QXIA 2AIQA 8ESTE 3T2NA 4AN7A 1A61H 1DWEH 4H42U 1A4WH 1HNEE 1H8HD 1KLTA 3ZV9A 2OXSA 2XWAA 4SGBE 2QF5A 1TPOA 2WHXA 3LIWA 1P2QA 1C2EA 3UOUA 3ENSB 3SU6A 3SNBA 3TGKE 3RP2A 1IQMA 1O5BB 1ELAA 5JBBS 1TNGA 3I29A 1HXEH 1CT2E 4BTUB 2VVUA 1DWCH 3F6UH 1E1RD 2CF8H 3RLYH 2XBVA 2H9TH 5HYOA 1C5TA 1DWBH 3STJA 4DT4A 3ATMA 1MD8A 4DCDA 4AFQA 1Z1JA 4DY7B 1MTNC 1VR1H 4Y0ZE 1UHBB 2P3FH 4XE4A 2Z9KA 4JZFH 3QLPH 3KHVA 2ZHFH 1C1UH 1C2IA 1GMCF 1NFYA 4KTSA 1UTNA 1EAUA 2SGQE 4ABIA 2VH0A 1FY4A 2KFWA 2FOEA 4FETA 1HAZB 3SZEA 1ORFA 2O8MA 4U32A 1TRYA 2ZECA 2BM2A 2HPPH 4ZKNU 4I8GA 1ZMNA 3SQHE 5LH8A 2ALPA 1QQ4A 1P12E 2STBE 1SGCA 4M7GA 1EP5A 3GY4A 2XWBI 1ZPCA 2ZP0H 4Q7XA 2WPKS 9ESTA 1SGDE 1GHYH 1RIWB 2XCNA 3CS7A 1GGDB 3SYJA 2P8OB 3PROA 2XNIA 2CHAB 3UR6A 2BDAA 2OBQA 2G55A 4UFFH 1LHDH 4ZKSU 2GTBA 3SGAE 4ZXXH 1YC0A 1QQUA 1QBOA 2P3TB 1RD3B 1BDAA 2H2ZA 2ZGHA 4NCYA 3FZZA 1G9IE 1O39A 4B2BA 2OQUA 5FPSA 3ZZDA 3MTYA 2GCTC 1O3EA 3AVZA 1IHTH 4MPWA 4AYYB 3FO8D 1H4WA 2J38A 1C5RA 1Z8IB 4DIIH 1KMHB 1ZLRA 1GCTB 2IN2A 2ZFQH 3UNRA 4ASHA 4XFQA 1GI4A 1AMHA 4YO9A 1GI6A 3UWIA 4Q63A 1C1QA 3M5NA 2ZHEH 1KSNA 1EPTB 3MMGA 3SI3H 3MH5A 1GBEA 2ZZUH 4TY7A 2AMPA 1YPMH 2BY7X 1AWFH 5TCCA 3URDA 4ZKOU 1DITH 1ZHMA 3BG8A 4UFGH 1K1PA 1ANBA 1V2VT 2NU0E 1SVPA 3TJNA 2GKVE 2UUFB 3V0XA 4JYTA 4I32A 4A1VA 3HK3B 4NG9H 5EGMA 4K1EA 1SHYA 5CDFE 1EP6A 3MNCA 2TGDA 3F68H 1UCYK 4INLA 3F2GA 4TWWA 3P70B 1S0RA 1TRNA 1Z8GA 1ZMLA 3NWUA 3FKSD 1XUJA 1CA0B 1P8VC 1K1OA 3SW2B 5C3NA 3VB5A 1MMJN 1YCPH 1ELTA 2FX4A 3TPIZ 1CHOG 8LPRA 4BNRA 1C1TA 1UTQA 2XRCA 1K22H 4J2YB 2FTMA 4JK5A 1O3AA 3I77A 3BTTE 2PW8H 4NSYA 1HIAB 2BVSH 2YNAA 4BAOB 2STAE 1JWTA 1TGSZ 2ANMH 2R9PA 1ETTH 1FUJA 3L6PA 4JZDH 4K3JA 4UE7H 5FBIA 1W13U 1BZXE 6GCHF 1ELBA 3SU4A 3RXEA 1O3DA 1UK3A 2IOTA 1QL7A 2QV1A 1GJ8B 3QUMP 1UTKA 1C9TA 4NZLA 3MOCA 3SUGA 4IC5A 1BRCE 1SQAA 1DUEA 1TPAE 2WZQA 2Q1JA 1YPJH 3JZ2B 3ITIA 1UHBA 2Z3EA 1JOUB 3M5OA 2ASUB 1NPMA 1HGTH 1DLKB 1F5RA 1G2LA 1JRTA 3M61U 2JKHA 4GPGA 1CO7E 3B9FH 2ZPQA 3L3TA 3PRBA 2SGEE 3SU3A 2ZU3A 2UWOA 4DT7B 1A5HA 2BD7A 3P8OA 3SU5A 4NGAH 1IHSH 1G36A 1ANEA 1AZZA 3E0PB 3E8LA 3QN7A 3SGBE 1VCWA 1PFXC 3BTEE 4E06H 5B6OA 3GY5A 2LPRA 4WF8A 4YOGA 3TNTA 1AB9B 1XXDA 2FEQH 4GVUA 1RIWC 4X2XA 4TWYA 1O3LA 2GZ9A 1F0UA 5IYTA 1EZQA 1GGDC 1SHHB 1EAWA 3O8RA 2P8OC 1BOQA 4XBCA 2CHAC 2GZ7A 1NFXA 2H5CA 3O8BA 1TGTA 1V2WT 1D3DB 2GV6A 1O5FH 4ABDA 4AGJA 5E0GA 1YGCH 3E6PH 4INHA 1GJAB 2VBCA 4ABHA 2BD2A 2GT8A 3C1KA 4LOYH 4WJG2 2QC2A 1O2RA 1UTLM 1TPPA 1UVUH 5DP4A 2A2QH 2W6JD 1JIMA 3SU1A 1DPOA 5JB8S 1T8OA 1QGFA 1EPTC 5GJ4B 2OINA 1RGQA 1TGBA 4WWYA 3LDXH 4ABFA 1C5OH 2FOMB 4Y79A 1FQ3A 3D23A 1GI5A 3LGTA 1EPTA 4GUXA 1EAIA 1CT0E 3SUDA 1MZAA 4O97A 2Q6GA 3PV4A 4H4FA 1QJ7B 3SJKA 1G30B 4RI0A 4FUDA 1XVOA 2QF3A 2DUCA 2HOBA 3OTJE 1P05A 1P10A 1LVOA 1IQLA 1C2DA 1OYQA 1P2IA 2XXLA 3MNSA 1IQJA 4GLYA 4FUHA 5FBEA 4CR9A 1YPGH 1HB0B 1O3IA 1UK2A 3VB6A 1D3PB 5BPEA 1CA0C 2WYGA 1TNHA 1AE5A 2G4UA 2PFEA 4B6FA 3QO6A 3KQBA 5CMXH 1VJAU 1HUTH 4GSOA 5EQRA 3RC6A 2EI7A 1BB0B 2VWNA 1RRKA 2PTCE 4ZHAA 2QGRA 2VGCB 1BMAA 1QNJA 2FESH 1BUIA 2G5VA 3KGPA 3ZZ5A 2V6NA 1TQ0B 4X8VH 2A5KA 4BAKB 4B1TA 2A5AA 1HIAA 1OWIA 3GY8A 3DCLA 2G81E 1FY8E 4X6PA 1FV9A 3T25A 3V3MA 1PPFE 2YMSB 1UK4A 4ABJA 5T6FA 1YLCA 2QE7D 1TFXA 2B0FA 2HLDD 1TMTH 2BZAA 1BBRH 1WTGH 5A8YA 4K1SA 2J5UA 1PQAA 1FN8A 3TU7H 2AMDA 2ZA5A 5EQQA 4A92A 1Y3VA 1AD8H 4X1RU 3LOXA 4KTCA 2O8TA 1LPGB 1VGCB 4UFEH 2V7QD 1GBAA 2W3KA 1GI2A 3RXDA 2F91A 3MO3A 3H09A 1WQSA 1V6DA 1RJXB 1GJCB 4TPYA 1AB9C 1UTOA 2FPZA 4FXGH 2BDCA 2CMYA 2RDLA 1MABB 2BLOA 1IQGA 3RC5A 5GNDA 1GMCG 1NZQH 3P8FA 4IW4E 5JBCS 2ZIQH 3S69A 2H9HA 2VWMA 1EZUC 1WUNH 4Y10E 3RXLA 3S7HB 3LC3A 2FODA 2OP9A 1DDJA 1BHXB 3DT0H 1LKAA 3ZYEA 3ATLA 2F3CE 1K1NA 1AE8H 3RXKA 2KCPA 5HMAA 4KTUA 4X1PU 1O3OA 4JZIA 1MTSA 3ZVFA 5JPMH