2J98B

Human coronavirus 229e non structural protein 9 cys69ala mutant (nsp9)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
102
structure length
102
Chain Sequence
KPGKMKVKATKGEGDGGITSEGNALYNNEGGRAFMYAYVTTKPGMKYVKWEHDSGVVTVELEPPARFVIDTPTGPQIKYLYFVKNLNNLRRGAVLGYIGATV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords REPLICASE POLYPROTEIN 1AB
publication title Variable Oligomerization Modes in Coronavirus Non-Structural Protein 9.
pubmed doi rcsb
source organism Human coronavirus 229e
total genus 21
structure length 102
sequence length 102
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08710 nsp9 nsp9 replicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.250 Mainly Beta Beta Barrel Thrombin, subunit H Replicase NSP9 2j98B01
2J98B 1QZ8A 1UW7A 5HIYA 3EE7A 2J98A 5HIZA 5C94A 2J97A
chains in the Genus database with same CATH superfamily
3TU7H 2GZ9A 1P03A 1SHYA 3U9AH 4I8LA 3TJUA 1C2IA 1DWBH 5LGOA 3EA7A 1FY1A 3HGNA 1V2NT 3A86A 1EZSC 1RTFB 3E3TA 1N8OC 4K2YA 3BTFE 4YOJA 4ZHLU 2ZHWH 2AS9A 3GICB 1O39A 4RKJB 1MTNB 1P05A 2PSYA 1PPGE 4MTBA 2HNTF 3GCNA 1QTFA 3CP7A 3Q00A 1LO6A 1ZMLA 4BXSA 3FN8A 4A5TS 1K22H 1XX9A 1ELGA 4ZAEA 1CGIE 3GYLB 4GPGA 2BD9A 1IQGA 5EIYA 1G3DA 1QA7A 3NK8A 3ZV9A 1HAOH 1BMMH 1P9SA 2BD4A 1D6RA 1ELAA 1TNGA 1VJ9U 3QDZB 3RMNH 1PQAA 2J98A 1RTKA 1SLUB 1BITA 1GG6C 4Q63A 4BXWA 1THSH 5LPFA 3GCHB 2WSSD 1EPTA 3RC4A 3ZZ4A 4K3JA 3BTGE 3MU5A 3UTUH 2XBWA 1AB9B 3M3SA 1HAVB 1NRQH 2GT7A 4X1NU 3EA8A 1LTOA 2A5IA 2UUFB 2HNTE 1FY8E 3ZZ3A 1EASA 1JIRA 1GHVH 1HCGA 1GHBG 4JZFH 1GBFA 1HXEH 2W7SA 4OS5A 3BG4C 4A6LA 1TQ7B 1CBWB 1C5VA 2TGPZ 1SGIB 2KCYA 5F8XA 3ZZ9A 2WPHS 2ZU4A 2VU8E 4SGAE 5AF9H 1IQJA 1GI6A 2FI5E 2XNIA 3C27B 1P2OA 5GJ4B 5T6GA 1O3KA 1H9IE 1PYTC 5A8XA 2XTTB 1TBQH 2AHME 1WOFA 4JK6A 3RM0H 1O32A 4B2BA 1TBZH 2GMTB 3RXFA 4ZXYH 1SB1H 1CHOG 3RXAA 4CBOA 4ABBA 1DY9A 1SGNE 3PTBA 1V2VT 1QRZA 1EAWA 3SNEA 4H6TA 1SGFA 3UY9A 3Q76A 2ZU2A 1ZMJA 1PPBH 1P04A 3E90B 1NFXA 2NU2E 3GY6A 3GISB 2ESTE 2BX3A 1TA2A 3PMBB 3ATLA 4NA8A 1A0HB 2W7UA 2FS9A 1LVMA 1GJCB 3LT3A 3F1SB 4UDWH 3DHKH 2XNDD 3QN7A 1LHCH 2OXSA 1KY9A 3VGCB 2WUBA 3F9FA 3P8FA 2WPLS 3T25A 4NIXA 1AU8A 5EQQA 4Q7ZA 3BV9B 1CT2E 1ELEE 5EXNA 1RRKA 1UTLM 1XM1A 5E8EH 4ZMAH 2FYRA 1UTPA 2OUAA 2GCTB 3LGVA 4YO9A 4Q80A 3A7YA 1C1RA 1GGDC 1UW7A 7LPRA 2PTCE 3QZRA 5CHBA 3TGIE 5DO4H 1Q3XA 2ZKSA 1BCUH 2QF4A 2HNTC 3N7EA 2O8TA 1INCA 2VIVA 1GVKB 4JYVH 3WWFA 2ZHEH 1T32A 3DA9B 2DE9A 1O3HA 2XBXA 2ULLA 2AMDA 1A5GH 5C94A 2UUJB 3MOCA 4Q4LA 1NU7B 3E6PH 4NGAH 5GCHG 2FOEA 5DP5A 5DP4A 1S0QA 3QO6A 5EW1H 4YM9A 4P02A 2ZDAH 3KQEA 2JKHA 3A8CA 3WY8A 1HV7A 4HZHA 2CHAC 3PO1C 1QQ4A 4K1SA 4ZROA 1AE5A 5EOKA 2C8WB 3NWUA 1ANBA 2PTNA 3S9CA 4FU8A 1C5MD 3AVZA 1QBOA 1C5SA 1N8OB 2TBSA 3LOXA 2BLQA 1WTHD 4ISNA 3S9BA 3KIDU 4AFUA 4AB8A 3ZYDA 4K1TA 1FN6A 1C2FA 1GJ9B 1V2WT 1WQVH 2BDIA 2QC2A 3HKJB 2Z9IA 2FDAA 1QB6A 2RG3A 1OP8A 1UTOA 2XXLA 4U2WA 2C8XB 2O8UA 2L74A 1DITH 1MBMA 1YPHE 2PSXA 3A87A 4Y8ZA 2ZI2H 3MO6A 3GDSA 5HMAA 3RP2A 4FUIA 3ODDA 1SGQE 1O37A 1W0JD 5AFZH 1PPZA 1TA6A 2FOCA 3UOPA 2XCNA 1QY6A 1O3IA 1C9PA 3KN2A 1MKXH 1G30B 1KLTA 3KNXA 3SHCH 2Y6TA 1AIXH 3L33A 4MNWA 4AG1A 3ZZDA 1Z8GA 2BTCE 1C2HA 1C1VH 2P3FH 1E38B 3RXVA 1V2MT 2ZU3A 1YPEH 1NFUA 1VCQA 2H1UA 5F8TA 1TQ0B 2JDID 2J95A 2VVVA 2VNTA 1W13U 3TLOA 4SGBE 5EXMA 4I7YH 3PLKA 2GTBA 1L1NA 1PPFE 2NU1E 3RM2H 3BEFB 3MI4A 1B5GH 3PV4A 1P0SH 1SL3A 2STBE 4IGDA 2P16A 1W11U 3N7DA 1S0RA 4B76A 4ZCNA 1QRXA 2J97A 5C20A 1ELBA 2QAAA 4MNXA 4Y8YA 1W0YH 3SV7A 1A1RA 1OXGA 4UFDH 5BRRE 3UB0A 2A7CA 3VB6A 4E7NA 1W2KH 1KXDA 2PW8H 4AFQA 1CU1A 3MU8A 1HAZB 3ELAH 4ISOA 3STJA 2Y7ZA 2V3OH 3LJOA 3O8DA 2BYAX 3TJVA 5C17A 2BDBA 2FOHA 1YCPM 3GCTF 3GY2A 1O3BA 1OPHB 3UR9A 4DCDA 1E79D 4I32A 2CJIA 3N7OA 1BRUP 1S81A 1C1OA 1KXBA 1D3PB 1SOZA 1HIAB 3MWIU 2BQ6B 3LC5A 1GMDG 2PWXA 1NBME 1S6LA 2WYJA 1GJDB 4WWYA 3UWJH 1CA0B 1BBRH 2VINA 4UONA 1HAVA 1HAGE 2ZFRH 1YPHC 2C8YB 1Z1JA 3TJNA 4ZKSU 1TX6A 2VVUA 2OP9A 4Z1MD 2PUXB 3LKWA 2QXGA 3W95A 3QUMP 5AFYH 4X6PA 2FEQH 1QGFA 1G3BA 1O3EA 2GX4A 3SGAE 5T6DA 4X2XA 1K0HA 3SV6A 4FU7A 3OY6U 1WTGH 2CMYA 1VGCC 1YLCA 1KXAA 2LP6A 3SHAH 4ISHH 1XUKA 3T28A 2PLXA 3KGPA 2EI7A 3KHVA 2BDHA 3MH5A 1C9TA 1E1QD 2UWPA 2AIPA 2EI8A 1MD7A 5EJLA 2QXHA 3RXUA 1W12U 2EI6A 3BF6H 1JRTA 3MMGA 1H8DH 1FAXA 1YCPH 2O8LA 2ZGXH 3SYJA 4LOYH 3OTJE 1C5OH 1UVOA 3TITA 1AGJA 2FOFA 1C5TA 1GI2A 1WDIA 1QL8A 1O5CB 1VCPA 2C90B 2VWNA 2Q6GA 1C5XB 1TLDA 2WPKS 1K1LA 2BDAA 1MCTA 2A32A 4Y79A 5T3HA 2A0QB 3MH6A 4U01A 3U69H 8LPRA 1GWAA 3HGPA 5JPMH 2CF9H 1PPCE 1ESTA 3KL6A 2AERH 4MLFB 3K65B 2EC9H 2ZU1A 3DCLA 1B0EA 2ZTXA 3EDXB 3LGUA 1O2LA 1O34A 1WUNH 4FUBA 5LPEA 1GBAA 1NROH 2O8MA 1X7AC 1WU1A 1KXEA 4OS6A 4B6EA 4CBNA 3ZVBA 3SGQE 2YNBA 5EODA 4A1XA 3E1XB 3A7VA 5E2PA 2KAIB 1J14A 3A8AA 3FANA 3FZZA 6ESTA 1SGDE 2QA9E 1TPPA 1P3EA 2XC5A 1CHOF 4X6MA 3SJKA 2ZDNA 5DGJA 4ZKRU 1GBEA 1C2MA 4NWLA 1G2LA 1UO6A 4BTIB 2FOBA 1LPKB 2GJGA 2UWOA 2ZG0H 1GMCF 1N6XA 1O3FA 1GPZA 4Y11E 3RXEA 3ZVCA 4YOGA 4TPYA 1GMHF 4E06H 1ZGVA 4Y8XA 4CRGA 2AYWA 5EPNA 1AUTC 1OP2A 1TMUH 2FI4E 3D49H 3ATWA 1C5YB 1BTYA 3RXSA 1FAKH 1GI1A 5KECA 1QA0A 2WV9A 3VB3A 3GCOA 4NWKA 1ZTKA 2M5TA 1T8OA 1TPSA 3FVFB 1C5ZB 3A8DA 3ATIA 4XD7D 2Y81A 5C1YA 1RTLA 1VKYA 1GBJA 3H5CB 4FUJA 1EP6A 4B6FA 5DP3A 1GJ8B 4WMDA 3KYFA 4R0IA 1C1TA 1UCYH 1SLVB 3M35A 1LCYA 3K6ZA 4YTAA 3UNQA 1CSOE 3KEEA 3FO8D 1GBHA 3ESTA 2IN2A 4A1TA 1SGCA 1O31A 2HWLB 2Z9LA 4XBDA 1Z6EA 1QBVH 2NU4E 1IAUA 2ZGCA 4AYYB 3T29A 2ANMH 5GWZA 2ZFTA 4GHQA 1SFQB 1AZZA 5DN6D 4B1TA 1XKBC 1C1SA 1DE7H 1JWTA 4CR9A 1ORFA 1O36A 2G5NA 2IJOB 4B71A 3GY5A 1BMFD 4Y76A 2H2ZA 2PHBA 1YPMH 2BLOA 4DURA 2JH0D 3OFND 4LK4A 2PV9B 2VH0A 1S84A 2A4GA 2Z7FE 2V3HH 1A2CH 1K28D 2YMSB 4O3TA 5ESBA 4MVNA 2BY7X 1V2LT 3TPIZ 2GCHG 4RT1A 3SJOA 4MQAA 1AO5A 4I8HA 1ANCA 2J34A 1NY22 1NO9H 3AASA 4I8KA 3W1EA 2SGQE 3M37A 4DIIH 1CE5A 1F0TA 1PJPA 1P2NA 1GJ4H 1TGNA 4I33A 1EB1H 4YLUA 4BAHB 2TRMA 1J8AA 1KIGH 3SQHE 2QXIA 3SI4H 2A5KA 5GXPA 1BRAA 1PQ8A 4IBLH 1OYTH 1C1MA 1ELDE 1CHGA 5F53A 4INKA 4NA9H 5G4BA 2Z3CA 4NG9H 1TMTH 2XCFA 4XOJA 1Y3VA 1RGQA 3UWIA 2A4OA 1W7GH 2BB4A 2BVRH 2OINA 2SGFE 3RXIA 1OHHD 1UTKA 2F43B 3AW0A 1W7XH 4K8YA 4TWWA 3TGJE 2R3UA 4R8TB 1BMLA 2J94A 1Y5UT 2SGPE 1XUFA 5FX6A 2SGAA 3GYMA 2F9NA 1YLNA 2ZA5A 3M7UA 4KTCA 4X6NA 1THRH 3BEIB 2QYIA 1K1JA 3D62A 1ETSH 1FQ3A 2QGRA 4CHAB 1C1NA 1P11E 3RU4T 4UD9H 1O2GH 3AAUA 1S5SA 1NU9A 4Y6DA 2Y5FA 4X8TH 2A45B 5J4SA 4BAMB 1V2QT 3QZQA 1YPJH 5EU8A 1GL0E 2K8IA 3A84A 1F92A 2W6ID 1EATA 1Z6JH 1BZXE 1FN8A 2PKSB 4HG6A 4B73A 1ZSKA 2QF3A 4CH8B 1QCPA 1FIWA 1DSUA 4A92A 1UTNA 2OCVB 2VIQA 4VGCB 1F0UA 3U1JB 1WAYB 4X8VH 1O2VA 4TT3D 3CS7A 5K0HA 1OWDA 1ACBE 1QRWA 2BDCA 1K9OE 1FZZA 2D2DA 1A3BH 1GMDF 1AHTH 2FI3E 2ZQ2A 2QF0A 2VWOA 3LGYA 4WF8A 2PR3A 2A2QH 1HAPH 2B9LA 7GCHG 3B8JA 4AB9A 4Y7BA 3RXGA 1SMFE 1WYKA 1QIXB 4B75A 4KTSA 6CHAB 1K1OA 3A7XA 2FWWA 1ELTA 1U6QA 1TYNA 3DSOA 3PMHB 2VGCB 3TVJB 1D6WA 1SG8B 2H6MA 4WY3A 3HATH 1D9IA 1TABE 4NIVA 4Y7AA 1UK2A 3C1KA 2FESH 1BTWA 1UHBB 1T31A 3LIWA 4LZ1H 3EE7A 2ZCLP 3LH1A 1C1UH 4KGAA 2QE7D 1CT0E 1EZUC 2QCYA 2V0BA 3P8OA 4DJZB 2KAIA 1P09A 2BY5X 1CT4E 3NZIA 2BY8X 4MDSA 1UTQA 4XSKU 5E2OA 1Y8TA 1P2IA 2FX6A 3U28C 2ZDVH 4B2CA 1C2JA 1IQNA 2W26A 3A82A 1H1BA 2VH6A 4AZ2B 3SV9A 4ZKNU 4UFEH 2LPRA 3F3BA 2F3CE 2CV3A 2O9QA 1DANH 5EQSA 2J5UA 1OOKB 2K0QA 2FO9A 1AY6H 1TOMH 2ZZUH 3DSPA 3VB7A 5CHAB 2EA3A 4IW4E 3P92A 1GBCA 4XRNA 2PKAB 1EXFA 2ZP0H 3O8CA 2J9NA 2I6SA 1C5QA 1HAIH 2ODQA 5DP9A 2Z3DA 4GCHF 5LPRA 1W14U 1BQYA 1SGEE 4O9VA 4WXIA 2AEIH 1EOLA 3FP7E 2J4IA 1V2OT 4BNRA 2PGBB 2P3TB 1Z1IA 2AGEX 1GJ6A 4X8SH 3PWBA 1ANEA 2G81E 3RXCA 4ABHA 4JYTA 5J4QA 1O2WA 2W3IA 2ZCHP 2C3SA 3HK6B 1DS2E 4TPIZ 5CMXH 1TRNA 2SNVA 1GHZA 3TIUA 2ZPRA 4LZ4B 3VG8A 2YMSD 1VZQH 2VWMA 1OWIA 4ASUD 3ZVFA 3RXRA 1H8ED 1EOJA 1HB0B 1JOUB 2VJ1A 1OWHA 2Q6FA 8GCHF 4ZXXH 1EAIA 1TIOA 3ZZ8A 3W94A 3BG8A 2WPMS 1LPZB 1BB0B 1EFRD 1B7XB 4YT6H 1FUJA 1AFQB 1P02A 1T7CA 4QT8C 4K5ZA 1A3EH 4Y10E 1O2YA 2HGTH 3UNRA 2JH5D 4UFFH 1V2JT 1G2MA 1EAUA 3SU5A 1Z71A 2C8ZB 1ZRKA 1J16A 3MHWU 4AORA 1C2EA 2JETC 2P3UB 2ANKH 2P59A 1YGCH 1DPOA 1UK3A 3A8BA 1H8HD 5L6NH 1EB2A 3SO3A 2YOLA 1A61H 3RLYH 1ZJKA 3A85A 3RXHA 3BTEE 1JIMA 1O30A 2D1JA 3MU0A 1C2GA 3LJJA 5PTPA 2BHGA 1TGTA 2VVCA 1O2SA 1ARCA 1V2UT 4KP0A 1QFKH 1GHYH 2OQ5A 5C67A 3CS0A 5EXLA 1TNKA 2WZQA 1ZSJA 5T1VA 1BTZA 1MKXK 2FX4A 1E34B 3A7WA 3I29A 5HIZA 2G5VA 3K2UA 4CRFA 2ZIQH 2BD5A 1KXCA 3BN9A 3AW1A 1MTUA 1S82A 3GY7A 3T27A 2Y5HA 4AGKA 1M9UA 3QTVH 3D23A 1RIWC 3SU6A 6GCHF 1V2ST 2ZHFH 4Y0ZE 1W0ZU 3F0PA 2J92A 3EGKH 1ZHRA 3T26A 3VXEH 3V3MA 1K1NA 3LGIA 1EPTC 1NPMA 4AYVB 1ETTH 3HKIB 3P8NA 2BDYA 2THFB 3U8OH 5EW2H 1GG6B 2CF8H 2DE8A 1O3LA 2GVFA 1JBUH 4A7IB 3LU9B 2QF5A 1VITG 1HXFH 4THNH 3EAJA 3SU3A 1GJAB 2KCPA 1ZGIA 2I6QA 3SNDA 4K69A 3BIVH 2WPIS 5F6MA 1UK4A 3ZVAA 2RDLA 1G3CA 1VITH 1XXFA 1FJSA 4D9RA 5C2ZA 1LQDB 1P3CA 5HM2A 1F2SE 3EE0B 1GBBA 3KCGH 2KR7A 1PPEE 1ZRBA 3BG4B 1ETRH 3UREA 1RJXB 3PB1E 2PFEA 1EX3A 3Q3KA 1O2QA 4FUDA 4B2AA 2OTVA 1BTPA 3PYHA 1IQIA 1S85A 2F9BH 2FLBH 1HPGA 5C3NA 3Q3XA 1LHFH 2OK5A 2P8OC 2B8OH 3SUEA 1P9UA 4CREA 3UQVA 2XBYA 3FOAA 1MZDA 4X1RU 5C1UA 4INHA 5A8ZA 3E0NB 1JRSA 4ACAA 2G52A 3PV2A 2Y80A 1E1RD 1O3PB 1YPKH 1GBTA 3F9GA 2FXRA 3RXPA 3TJOA 3ZVDA 3G01A 4UE7H 3FZDA 2G8TA 1TNLA 4CR5A 1J15A 3SW2B 5A2MH 3RXQA 1BTXA 1GCTC 3JZ2B 3V13A 3MFJA 2D26C 2WYGA 1HAXB 3LC3A 5KGOA 4BAQB 1T4VH 4FUCA 3P17H 1TX7A 4U30A 3K6YA 1QL7A 1UHBA 3SU0A 1YF4A 3RMOH 5B6LA 1O2IA 2BXTH 3SUDA 4X2WA 1YP9A 1AN1E 2TGAA 4ABGA 2F83A 1GJ7B 4F55A 5C1XA 3UOUA 3TK9A 3SNBA 1SQRA 1YCPK 3SZEA 2ZGHA 5C0UA 2BZAA 1K2I1 2LNCA 2ODPA 1SSXA 4FXGH 1B0FA 5KEDA 1CA8B 2SFAA 3GY3A 1ZTJA 3OYPA 1GGDB 1NESE 4WH8A 3ODFA 5FHTA 4X1QU 1C4V2 1MU8B 1P06A 2B5TB 2PKAA 2Y5GA 4IS5A 3KQBA 4RI0A 5SGAE 3M3TA 3HPTB 1DX5M 1OX1A 1TAWA 4RN6A 1GCDA 2BD7A 3GOVB 1BA8B 1ZYOA 1Y59T 1LKBA 2CHAB 3PO1B 4WMFA 2B7DH 2HLDD 2A5AA 4DT7B 3O8BA 2TGTA 1J9CH 4H4FA 8KME2 4ACBA 5BPEA 1GHBF 4D76A 2F9VA 3ZVEA 2R0KA 5F8ZA 1TPOA 1O2MA 1SGYE 1G37A 1MCVA 1Y3YA 3DUXH 1UTJA 3P8GA 3T62A 1GBMA 1FXYA 1P8VC 3CNRA 5EGMA 3VPKA 1IQHA 1NRPH 1WSSH 3SNCA 2KCAA 2DUCA 3F9EA 4OGXA 3RUOA 3RU4D 4D8NA 1GDQA 3R3GB 3E16B 1MQ6A 1IQEA 4E7RG 4RKOB 1HJAC 4BTTB 3ZZ5A 2ZU5A 1ZJDA 2FPZA 2F9OA 5DP8A 1PFXC 3OAAD 3UFAA 1T8NA 1VR1H 3RMLH 1YC0A 3F0OA 2BY6X 1TALA 3P70B 1OWJA 3UQOA 3VXFH 3SUGA 2OQUA 3H09A 1GI9B 3SJ8A 1H8IH 1GJBB 1MKWK 2XWBI 2Q6DA 1SGTA 4GLYA 1SOTA 3SU1A 3QK1A 1A5HA 5A0BA 1O3CA 1GDNA 1HDTH 1QJ1B 3STIA 5JDUB 4NSVA 1MTNC 1F5KU 4DIHH 2ANYA 1O2ZA 1C5RA 1YBWA 2R3YA 1QQUA 2ALPA 2IPHA 4FETA 3M3VA 1EUFA 2GV7A 1FLEE 1DLKB 3QTOH 1DT2A 4JCNA 4XFQA 1YM0A 1FPCH 1EJMA 5H4IB 1QURH 1GBIA 1Q2WA 3MNBA 3LONA 3TH4H 2TIOA 2FYQA 2BLWA 4YZUA 3SZNA 1Y5BT 3GCHC 1SR5C 2YNAA 2Z9JA 2Z94A 4ABIA 1A0LA 3AK5A 1F5RA 2KM0A 4JMYA 1PYTD 5GCHF 2GDEH 4RT0A 1P57B 4JZEH 1C2LA 1ZLRA 1TB6H 1TFXA 1C5NH 1IQMA 2SNWA 1BMNH 2ZECA 4TY7A 3F9HA 2ANWA 1AZ8A 2BD2A 2STAE 1D3DB 4MNYA 2ZGBH 4BOHA 1KTTB 1KLJH 2OBOA 1HAHH 3MNCA 1DXWA 2A1DB 3A88A 3OU0A 1TOCB 1ANDA 3QGJA 4GVUA 1D4PB 1QJ6B 2F9UA 3FFGA 3URCA 1DICA 2WV4A 1FMGA 1A7SA 1TGSZ 2V7QD 2ZTZA 5DSFA 1NRSH 3F2FA 2R2WU 1J17T 3BTKE 3M61U 1HRTH 1VGCB 3PWCA 4F4OC 1QZ8A 1DSTA 2R9PA 2CK3D 3FP8E 2BVSH 4ZKOU 2ZNKH 3DSGA 2GMTC 1MU6B 3M36A 4I31A 1NM6A 1KDQB 2V35A 1BRBE 2BXUH 3URDA 3GDUA 5IDKA 1MTSA 3OX7U 3RXOA 2UWLA 2G55A 3KYGA 5JBTA 1O5AB 4FUFA 3T5FH 3ZZBA 1FX0B 4NSYA 5HM9A 1ID5H 1LHDH 2WV5A 3E91A 3U1IB 4PROA 3SV8A 3RMMH 1BDAA 2H5CA 2OC0A 1XUHA 1HBTH 4XDEA 1F5LA 1Z8RA 2CN0H 1ZHPA 1HIAA 2Z9KA 2C4FH 2ZWLH 3PV5A 1HUTH 1IHSH 2A2XH 3A81A 3Q77A 1MMJN 2UUKB 1DM4B 1LHGH 1XUJA 1C4U2 1BHXF 1RS0A 1JXPA 4MPXA 3MH4A 3V0XA 3VGCC 4JZIA 2R2MB 3B23B 2XBVA 4AFZA 3MH7A 2IPQX 1SQOA 4CRBA 1BTHH 1O2RA 3EA9A 3PRBA 1TNIA 3M7QA 2LELA 2VIWA 4IMZA 1S83A 1PQ7A 1GI4A 3PLPA 3ZZCA 3L6PA 3M5OA 1C5WB 2GCTC 1L4ZA 2AMPA 3GCTG 3M7TA 1YPLH 2W3KA 1TX8A 1XUGA 2JJ2D 4TSFD 1O0DH 2OC7A 3LGTA 3OSYA 5CE1A 3MTYA 3RXDA 5ETXA 1DDJA 1FONA 5CDFE 2Z3EA 1Z7KA 3K9XB 1AWFH 3RDZA 9ESTA 1FY5A 2ZDLA 2OLGA 4ABDA 3B9FH 5IK2D 4MPVA 1OYQA 2H9TH 3DT0H 2GP9B 3KQCA 1K1PA 4DVAU 1OSSA 3A7TA 2ZDKA 3ATMA 3EYDA 1GI3A 5F03A 1NRRH 2QY0B 2AGIX 1AE8H 5A0AE 4MG3A 1JMOH 1A0JA 4AN7A 1BTUA 1W8BH 1DFPA 4Y71A 2A31A 3TGKE 5L30H 1G32B 1TE0A 2ZFSA 4AFSA 3NKKA 2AGGX 1GI5A 1P2JA 1MAXA 3A80A 3I78A 5AHGH 1O2TA 3WWBA 2VIDA 3MO9A 2FLRH 3RXBA 3BTDE 2JIZD 4D7FA 1GL1A 4DGJA 1DOJA 5TCCA 1L1GA 1O5EH 1Y3XA 2P95A 4X1SU 1EJAA 1BBRE 4K8BA 1LKAA 1G9IE 1F0SA 1C1QA 2RCEA 2A7HA 4IN2A 3NRLA 2ZFPH 5B6OA 3F6UH 3JZ1B 4FUEA 5GIBA 3IITA 1MBQA 1DUAA 1O35A 1C1PA 5FCRA 1A4WH 1ESBA 1O3JA 4IC6A 1O3NA 1O2XA 4KTUA 1GHXH 2HALA 3TNSA 2FOAA 4HI3A 3RC6A 3MU1A 1SLXB 3P6ZB 3FAOA 4X6OA 1ZR0A 2J38A 4WH6A 2EEKA 4FUGA 5FCKA 1C4Y2 3LH3A 2ZCKP 1GHAG 1K1IA 1E35B 1BMAA 1ELVA 1MH0A 1QJ7B 1E37B 1O3DA 4YESB 4BANB 2OBQA 2XYAA 2ZO3H 1O33A 5I25A 3DFLA 2GT8A 2QIQA 2BLVA 3T2NA 5FPTA 1DUEA 1NT1A 3ENSB 4P00A 1C2KA 1CVWH 1HJ9A 2RA0A 1LPGB 4OS4A 2BQWB 2FTLE 1PQ5A 1YY3A 1AVGH 4YOIA 2F4LA 4OS2A 1GVLA 2ZHQH 7KMEH 2ZPSA 2KCOA 1AMHA 1VJAU 1RFNA 5EG4A 2SGDE 1COWD 2SGEE 1GMCG 1ABIH 4HGCA 1RXPA 2NU0E 1BT7A 5C5NA 1WV7H 2K1QA 5E0JA 2H9EH 3UUZA 1MTVA 1CA0C 3F68H 4DT4A 5C5OA 1GMHG 2XRCA 5L2YH 3GDVA 3S9AA 1ELCA 2G4UA 2G51A 9LPRA 2FM2A 1TNHA 4K1EA 1UVTH 3OE7D 1HNEE 1P12E 5JBAS 3NCLA 3EQ0H 3SJ9A 1FDPA 2WPJS 3QWCH 3KQDA 3PROA 1ZPCA 1NFYA 2FIRH 4YT7H 4ZHMU 3MO3A 1FY4A 2CXVA 1YLDA 3O8RA 2HVYB 1SGPE 2FMJA 3S7KB 3UR6A 2GKVE 1V2PT 2F9PA 3RXJA 4HFPB 4NIWA 4TYDA 5A09A 1IQLA 1GBKA 5A8YA 5K7RA 4Z6AH 5DJ7A 2QN5T 3KQ5A 1W3CA 1ZMNA 5FBEA 1KDQA 3ZIAD 4A1VA 3PTNA 1ESAA 1QNJA 4JYUH 4M9FA 4NIYA 1XVOA 3SU4A 3VEQB 5HXFA 5HGGA 1DXPA 4NZLA 1EAXA 5JBBS 4MPWA 4LXBH 1GDUA 1NBMD 3S0NA 2XC0A 4JK5A 1ELFA 3OY5U 1P01A 2D8WA 3MNXA 4X1PU 4ABEA 1CGHA 1THPB 2GZ8A 3U98H 3RC5A 2VIPA 1O5FH 1P2KA 2A4RA 4YXWD 2RA3A 3TK5A 5TJXA 1C5LH 1N1LA 1A46H 1AVWA 4E05H 1TRYA 2BVXH 1UCYE 5FPSA 5HYOA 4DY7B 2GGVB 1OWEA 2XW9A 4FVBA 2JH6D 4O3UA 1V6DA 4BTUB 3V7TA 1FPHH 4ZUHA 1TGCA 2JJ1D 3RLWH 4OGYA 1OWKA 2HPQH 3UPEA 1KYNA 1UTMA 5FX5A 1Z8IB 4O97A 3FKSD 3S7HB 4X8UH 2BOHB 1G36A 3SOSA 2ZGJA 1UVUH 1O5BB 2GCHF 3MYWA 1MTWA 1XVMA 2G00A 3M5LA 3Q3YA 3A7ZA 2J2UA 4Q7XA 3QLPH 5FL7D 2AH4X 1NTPA 2WHXA 2L6OA 1ZPZA 1PPHE 3GY4A 1WCZA 2IJD1 1ZPBA 1H4WA 1HAYB 1SC8U 2A7JA 4MPUA 1O2JA 4CRAA 1AWHB 2Z9GA 1OP0A 1EZQA 3BIUH 5GDSH 2FOMB 4FUHA 2F91A 3LGWA 1MQ5A 3ZZ7A 4B74A 4Q7YA 1BJVA 1P10A 2AMQA 4INLA 5JBCS 3SORA 3TH2H 3OEHD 2H9HA 4GUXA 1IHTH 1BBRK 2Y82A 4OM9A 1H9HE 4IN1A 3RXLA 1ARBA 1KTSB 2GD4B 4IC5A 1AFEH 1ZZZA 1C5PA 4ESTE 5FXLA 3SI3H 1SLWB 3LPRA 1C2DA 1OKXA 1C1WH 4FVDA 4WVPE 1L0ZA 1MUEB 2FZZA 1SI5H 1E0FD 3RXMA 1HLTH 3IG6B 1Y5AT 1DWDH 2FTMA 1S6FA 1BHXB 1F0RA 2A4QA 2PUQH 4AOQA 3MQKC 4OS1A 1T4UH 2FS8A 1O3GA 4CH2B 2BX4A 2VB0A 1DWCH 4I86A 3ITIA 7ESTE 3VFEA 1LQEA 1UMAH 5EQRA 4NZQA 1T8MA 3PRDA 1Y3WA 2ZEBA 5C0TA 2BD8A 4I8GA 3GY8A 1WQSA 3VB5A 4AC9A 2H5DA 1TONA 2RFKC 3PMJA 1EZXC 2ZPQA 4O03A 3U8TH 1NC6A 1HGTH 1KXFA 5JB8S 3SJIA 1AKSB 4NFFA 4ABJA 3BTTE 4U32A 2QV1A 3LDXH 1QR3E 2BOKA 2R0LA 4DW2U 3TH3H 3BSQA 3SQEE 5DP6A 1W0KD 7GCHF 2C93B 3NPSA 5EJ1A 5I46H 1SBWA 1ZTLA 5DG6A 4D7GA 3SN8A 1O5GH 2YMSC 2ZQ1A 1N6YA 4XBBA 2JETB 4K60A 4AX9H 4DOQA 1EKBB 1LMWB 2W5EA 2FOGA 3N99A 5DPAA 1Z8JB 2ZC9H 1SVPA 4CRDA 3SBKA 2NWNA 3ZV8A 1EQ9A 1SQTA 3A83A 5DP7A 1YPGH 1EP5A 1DVAH 1K1MA 2ODYB 3D65E 1YKTA 2HVXA 1SHHB 1O3OA 4M7GA 3TK6A 1HYLA 3ATKA 3QGNB 1P2QA 3OEED 5EPYA 1HJ8A 3ZZAA 4OS7A 1SQAA 1QHRB 3BTQE 1UVSH 4AGJA 4GSOA 1LDTT 1SGRE 2TGDA 3M5MA 1HFDA 2OC8A 2WUCA 1TWXB 1MAYA 2G4TA 3ZZ6A 1RIWB 1DY8A 1GI0A 1KLIH 2J98B 1V2KT 2BDGA 3BTME 1FIZA 1BRCE 1GHAF 3NUMA 1ZOMA 1CGJE 4GCHG 2RDEA 4Y0YE 1EPTB 1GVZA 1S6HA 1EJNA 5TCAA 4UEHH 4CHAC 2Y7XA 1FV9A 3F2HA 2XOKD 3ZVGA 3OTPA 4HTCH 2B0FA 5FAHA 1DLEA 1C5UA 4FOUC 1AVXA 1AD8H 1ZSLA 3DD2H 2ZFQH 1QBNA 4X0WU 4D9QA 4DG4A 1NZQH 1UVPA 4ABAA 5L2ZH 3E0PB 1UJ1A 1KSNA 2UUYA 5E0HA 3RXTA 4XE4A 2PKSC 3SUFA 3NXPA 2GV6A 1MABB 4JZDH 1NRNH 2XC4A 4ABFA 4H42U 6LPRA 2EY4C 1BOQA 2HOBA 2NU3E 3WW7A 1LVYA 1UCYK 1O38A 2ILNA 4VGCC 3U8RH 1V3XA 1XXDA 5FBIA 3H7TA 1D3TB 1SGFG 4FU9A 1FY3A 1GI8B 2FP7B 4CRCA 4ZH8A 1GHWH 1GJ5H 2V6NA 1QB1A 3MNSA 4ISLA 4NCYA 8GCHG 4XBCA 1BUIA 2BQ7B 1TBRH 1IOEA 3R0FA 2KZ4A 1O2NA 1O3MA 5JYIA 2BY9X 4WXVA 1CQQA 1TNJA 1ZHMA 4RSPA 1O2HA 1BJUA 2FODA 4MNVA 2ZDMA 5ABWA 5IYTA 2PP6A 2XWAA 1L4DA 1O2KA 4WMEA 2P8OB 2BD3A 2M2AA 4IMQA 1E36B 2Q1JA 2W6JD 4J1YA 1GI7B 6CHAC 2KX4A 2HLCA 1NFWA 3V12A 5AVDA 2VGCC 2P93A 1MZAA 3SV2H 4BAOB 2AFQB 1RD3B 4TY6A 3PLBA 2ZTYA 3PM3A 1TMBH 3UNSA 4KKDA 3BEUA 1AB9C 5GPIB 1MKWH 2P94A 1O2UA 1YWUA 2OD3B 4KELA 3KF2A 1GCTB 1TGBA 4BAKB 1D3QB 1H9LB 1GBLA 2QXJA 3HK3B 1SPJA 2KFWA 5EJZA 8ESTE 4H6SB 1MD8A 4TWYA 3FP6E 5HIYA 3SNAA 1NN6A 2ZHDA 3I77A 1ABJH 1CBWC 3RXKA 1L2EA 4Q2KA 5JB9S 1QL9A 3AAVA 3UIRA 5HKKD 2O8WA 1LVOA 2GDDA 2ASUB 4ISIH 2ZF0H 5DKMA 6GCHG 1TRMA 3P95A 1DWEH 4GAWA 1XKAC 2VBCA 3GS9A 5ESTE 1V2RT 2EQNA 5CHAC 4X2YA 3RU4E 2CGAA 5LH8A 1XUIA 4WJG2 1GBDA 1BIOA 1P2MA 1AQ7A 3BTWE 2AIQA 3QX5H 1O2PA 2BM2A 5A0CA 2WPDD 1CO7E 1G3EA 4UFGH 2HRVA 5E0GA 4I8JA 1F7ZA 2V3MA 3BTHE 3H7OA 4NA7A 1WBGB 1IQKA 3M5NA 1AUJA 1O2OA 3CENA 4J2YB 3SGBE 1WXRA 2TPIZ 1LHEH 1VCWA 2VWLA 2ZFFH 1VITF 1XMNB 4NFEA 1V2TT 1T8LA 2IOTA 3IWMA 1SFIA 1AI8H 3E8LA 4ZHAA 2PGQB 1O3AA 4Z0KA 2VIOA 1O5DH 3A89A 5FPYA 1OS8A 3S69A 3F2GA 1L1JA 2OC1A 4X2VA 3L3TA 3PMAB 2ALVA 4AG2A 4JZ1A 5DK1A 1SKYE 3ZYEA 2GZ7A 5GNDA 4F48B 1K21H 3UAIC 4YLQH 1KMHB 4GHTA 5T6FA 1FI8A 3TNTA 1NS3A 3DFJA 1A5IA 4F49A 3SU2A 1AKSA 1AFQC 1FNIA 1LVBA 2Z6BD 4ASHA 1YYY1 2BMGB 3MU4A 1Q31A 1HJAB 1IQFA 1Y3UA 2HPPH 1W10U 1TPAE 2WINI 2BZ6H 3VB4A 1QB9A
chains in the Genus database with same CATH topology
2J98B 1QZ8A 1UW7A 5HIYA 3EE7A 2J98A 5HIZA 5C94A 2J97A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J98 B;  1QZ8 A;  1UW7 A;  5HIY A;  3EE7 A;  2J98 A;  5HIZ A;  5C94 A;  2J97 A; 
#chains in the Genus database with same CATH topology
 3TU7 H;  2GZ9 A;  1P03 A;  1SHY A;  3U9A H;  4I8L A;  3TJU A;  1C2I A;  1DWB H;  5LGO A;  3EA7 A;  1FY1 A;  3HGN A;  1V2N T;  3A86 A;  1EZS C;  1RTF B;  3E3T A;  1N8O C;  4K2Y A;  3BTF E;  4YOJ A;  4ZHL U;  2ZHW H;  2AS9 A;  3GIC B;  1O39 A;  4RKJ B;  1MTN B;  1P05 A;  2PSY A;  1PPG E;  4MTB A;  2HNT F;  3GCN A;  1QTF A;  3CP7 A;  3Q00 A;  1LO6 A;  1ZML A;  4BXS A;  3FN8 A;  4A5T S;  1K22 H;  1XX9 A;  1ELG A;  4ZAE A;  1CGI E;  3GYL B;  4GPG A;  2BD9 A;  1IQG A;  5EIY A;  1G3D A;  1QA7 A;  3NK8 A;  3ZV9 A;  1HAO H;  1BMM H;  1P9S A;  2BD4 A;  1D6R A;  1ELA A;  1TNG A;  1VJ9 U;  3QDZ B;  3RMN H;  1PQA A;  2J98 A;  1RTK A;  1SLU B;  1BIT A;  1GG6 C;  4Q63 A;  4BXW A;  1THS H;  5LPF A;  3GCH B;  2WSS D;  1EPT A;  3RC4 A;  3ZZ4 A;  4K3J A;  3BTG E;  3MU5 A;  3UTU H;  2XBW A;  1AB9 B;  3M3S A;  1HAV B;  1NRQ H;  2GT7 A;  4X1N U;  3EA8 A;  1LTO A;  2A5I A;  2UUF B;  2HNT E;  1FY8 E;  3ZZ3 A;  1EAS A;  1JIR A;  1GHV H;  1HCG A;  1GHB G;  4JZF H;  1GBF A;  1HXE H;  2W7S A;  4OS5 A;  3BG4 C;  4A6L A;  1TQ7 B;  1CBW B;  1C5V A;  2TGP Z;  1SGI B;  2KCY A;  5F8X A;  3ZZ9 A;  2WPH S;  2ZU4 A;  2VU8 E;  4SGA E;  5AF9 H;  1IQJ A;  1GI6 A;  2FI5 E;  2XNI A;  3C27 B;  1P2O A;  5GJ4 B;  5T6G A;  1O3K A;  1H9I E;  1PYT C;  5A8X A;  2XTT B;  1TBQ H;  2AHM E;  1WOF A;  4JK6 A;  3RM0 H;  1O32 A;  4B2B A;  1TBZ H;  2GMT B;  3RXF A;  4ZXY H;  1SB1 H;  1CHO G;  3RXA A;  4CBO A;  4ABB A;  1DY9 A;  1SGN E;  3PTB A;  1V2V T;  1QRZ A;  1EAW A;  3SNE A;  4H6T A;  1SGF A;  3UY9 A;  3Q76 A;  2ZU2 A;  1ZMJ A;  1PPB H;  1P04 A;  3E90 B;  1NFX A;  2NU2 E;  3GY6 A;  3GIS B;  2EST E;  2BX3 A;  1TA2 A;  3PMB B;  3ATL A;  4NA8 A;  1A0H B;  2W7U A;  2FS9 A;  1LVM A;  1GJC B;  3LT3 A;  3F1S B;  4UDW H;  3DHK H;  2XND D;  3QN7 A;  1LHC H;  2OXS A;  1KY9 A;  3VGC B;  2WUB A;  3F9F A;  3P8F A;  2WPL S;  3T25 A;  4NIX A;  1AU8 A;  5EQQ A;  4Q7Z A;  3BV9 B;  1CT2 E;  1ELE E;  5EXN A;  1RRK A;  1UTL M;  1XM1 A;  5E8E H;  4ZMA H;  2FYR A;  1UTP A;  2OUA A;  2GCT B;  3LGV A;  4YO9 A;  4Q80 A;  3A7Y A;  1C1R A;  1GGD C;  1UW7 A;  7LPR A;  2PTC E;  3QZR A;  5CHB A;  3TGI E;  5DO4 H;  1Q3X A;  2ZKS A;  1BCU H;  2QF4 A;  2HNT C;  3N7E A;  2O8T A;  1INC A;  2VIV A;  1GVK B;  4JYV H;  3WWF A;  2ZHE H;  1T32 A;  3DA9 B;  2DE9 A;  1O3H A;  2XBX A;  2ULL A;  2AMD A;  1A5G H;  5C94 A;  2UUJ B;  3MOC A;  4Q4L A;  1NU7 B;  3E6P H;  4NGA H;  5GCH G;  2FOE A;  5DP5 A;  5DP4 A;  1S0Q A;  3QO6 A;  5EW1 H;  4YM9 A;  4P02 A;  2ZDA H;  3KQE A;  2JKH A;  3A8C A;  3WY8 A;  1HV7 A;  4HZH A;  2CHA C;  3PO1 C;  1QQ4 A;  4K1S A;  4ZRO A;  1AE5 A;  5EOK A;  2C8W B;  3NWU A;  1ANB A;  2PTN A;  3S9C A;  4FU8 A;  1C5M D;  3AVZ A;  1QBO A;  1C5S A;  1N8O B;  2TBS A;  3LOX A;  2BLQ A;  1WTH D;  4ISN A;  3S9B A;  3KID U;  4AFU A;  4AB8 A;  3ZYD A;  4K1T A;  1FN6 A;  1C2F A;  1GJ9 B;  1V2W T;  1WQV H;  2BDI A;  2QC2 A;  3HKJ B;  2Z9I A;  2FDA A;  1QB6 A;  2RG3 A;  1OP8 A;  1UTO A;  2XXL A;  4U2W A;  2C8X B;  2O8U A;  2L74 A;  1DIT H;  1MBM A;  1YPH E;  2PSX A;  3A87 A;  4Y8Z A;  2ZI2 H;  3MO6 A;  3GDS A;  5HMA A;  3RP2 A;  4FUI A;  3ODD A;  1SGQ E;  1O37 A;  1W0J D;  5AFZ H;  1PPZ A;  1TA6 A;  2FOC A;  3UOP A;  2XCN A;  1QY6 A;  1O3I A;  1C9P A;  3KN2 A;  1MKX H;  1G30 B;  1KLT A;  3KNX A;  3SHC H;  2Y6T A;  1AIX H;  3L33 A;  4MNW A;  4AG1 A;  3ZZD A;  1Z8G A;  2BTC E;  1C2H A;  1C1V H;  2P3F H;  1E38 B;  3RXV A;  1V2M T;  2ZU3 A;  1YPE H;  1NFU A;  1VCQ A;  2H1U A;  5F8T A;  1TQ0 B;  2JDI D;  2J95 A;  2VVV A;  2VNT A;  1W13 U;  3TLO A;  4SGB E;  5EXM A;  4I7Y H;  3PLK A;  2GTB A;  1L1N A;  1PPF E;  2NU1 E;  3RM2 H;  3BEF B;  3MI4 A;  1B5G H;  3PV4 A;  1P0S H;  1SL3 A;  2STB E;  4IGD A;  2P16 A;  1W11 U;  3N7D A;  1S0R A;  4B76 A;  4ZCN A;  1QRX A;  2J97 A;  5C20 A;  1ELB A;  2QAA A;  4MNX A;  4Y8Y A;  1W0Y H;  3SV7 A;  1A1R A;  1OXG A;  4UFD H;  5BRR E;  3UB0 A;  2A7C A;  3VB6 A;  4E7N A;  1W2K H;  1KXD A;  2PW8 H;  4AFQ A;  1CU1 A;  3MU8 A;  1HAZ B;  3ELA H;  4ISO A;  3STJ A;  2Y7Z A;  2V3O H;  3LJO A;  3O8D A;  2BYA X;  3TJV A;  5C17 A;  2BDB A;  2FOH A;  1YCP M;  3GCT F;  3GY2 A;  1O3B A;  1OPH B;  3UR9 A;  4DCD A;  1E79 D;  4I32 A;  2CJI A;  3N7O A;  1BRU P;  1S81 A;  1C1O A;  1KXB A;  1D3P B;  1SOZ A;  1HIA B;  3MWI U;  2BQ6 B;  3LC5 A;  1GMD G;  2PWX A;  1NBM E;  1S6L A;  2WYJ A;  1GJD B;  4WWY A;  3UWJ H;  1CA0 B;  1BBR H;  2VIN A;  4UON A;  1HAV A;  1HAG E;  2ZFR H;  1YPH C;  2C8Y B;  1Z1J A;  3TJN A;  4ZKS U;  1TX6 A;  2VVU A;  2OP9 A;  4Z1M D;  2PUX B;  3LKW A;  2QXG A;  3W95 A;  3QUM P;  5AFY H;  4X6P A;  2FEQ H;  1QGF A;  1G3B A;  1O3E A;  2GX4 A;  3SGA E;  5T6D A;  4X2X A;  1K0H A;  3SV6 A;  4FU7 A;  3OY6 U;  1WTG H;  2CMY A;  1VGC C;  1YLC A;  1KXA A;  2LP6 A;  3SHA H;  4ISH H;  1XUK A;  3T28 A;  2PLX A;  3KGP A;  2EI7 A;  3KHV A;  2BDH A;  3MH5 A;  1C9T A;  1E1Q D;  2UWP A;  2AIP A;  2EI8 A;  1MD7 A;  5EJL A;  2QXH A;  3RXU A;  1W12 U;  2EI6 A;  3BF6 H;  1JRT A;  3MMG A;  1H8D H;  1FAX A;  1YCP H;  2O8L A;  2ZGX H;  3SYJ A;  4LOY H;  3OTJ E;  1C5O H;  1UVO A;  3TIT A;  1AGJ A;  2FOF A;  1C5T A;  1GI2 A;  1WDI A;  1QL8 A;  1O5C B;  1VCP A;  2C90 B;  2VWN A;  2Q6G A;  1C5X B;  1TLD A;  2WPK S;  1K1L A;  2BDA A;  1MCT A;  2A32 A;  4Y79 A;  5T3H A;  2A0Q B;  3MH6 A;  4U01 A;  3U69 H;  8LPR A;  1GWA A;  3HGP A;  5JPM H;  2CF9 H;  1PPC E;  1EST A;  3KL6 A;  2AER H;  4MLF B;  3K65 B;  2EC9 H;  2ZU1 A;  3DCL A;  1B0E A;  2ZTX A;  3EDX B;  3LGU A;  1O2L A;  1O34 A;  1WUN H;  4FUB A;  5LPE A;  1GBA A;  1NRO H;  2O8M A;  1X7A C;  1WU1 A;  1KXE A;  4OS6 A;  4B6E A;  4CBN A;  3ZVB A;  3SGQ E;  2YNB A;  5EOD A;  4A1X A;  3E1X B;  3A7V A;  5E2P A;  2KAI B;  1J14 A;  3A8A A;  3FAN A;  3FZZ A;  6EST A;  1SGD E;  2QA9 E;  1TPP A;  1P3E A;  2XC5 A;  1CHO F;  4X6M A;  3SJK A;  2ZDN A;  5DGJ A;  4ZKR U;  1GBE A;  1C2M A;  4NWL A;  1G2L A;  1UO6 A;  4BTI B;  2FOB A;  1LPK B;  2GJG A;  2UWO A;  2ZG0 H;  1GMC F;  1N6X A;  1O3F A;  1GPZ A;  4Y11 E;  3RXE A;  3ZVC A;  4YOG A;  4TPY A;  1GMH F;  4E06 H;  1ZGV A;  4Y8X A;  4CRG A;  2AYW A;  5EPN A;  1AUT C;  1OP2 A;  1TMU H;  2FI4 E;  3D49 H;  3ATW A;  1C5Y B;  1BTY A;  3RXS A;  1FAK H;  1GI1 A;  5KEC A;  1QA0 A;  2WV9 A;  3VB3 A;  3GCO A;  4NWK A;  1ZTK A;  2M5T A;  1T8O A;  1TPS A;  3FVF B;  1C5Z B;  3A8D A;  3ATI A;  4XD7 D;  2Y81 A;  5C1Y A;  1RTL A;  1VKY A;  1GBJ A;  3H5C B;  4FUJ A;  1EP6 A;  4B6F A;  5DP3 A;  1GJ8 B;  4WMD A;  3KYF A;  4R0I A;  1C1T A;  1UCY H;  1SLV B;  3M35 A;  1LCY A;  3K6Z A;  4YTA A;  3UNQ A;  1CSO E;  3KEE A;  3FO8 D;  1GBH A;  3EST A;  2IN2 A;  4A1T A;  1SGC A;  1O31 A;  2HWL B;  2Z9L A;  4XBD A;  1Z6E A;  1QBV H;  2NU4 E;  1IAU A;  2ZGC A;  4AYY B;  3T29 A;  2ANM H;  5GWZ A;  2ZFT A;  4GHQ A;  1SFQ B;  1AZZ A;  5DN6 D;  4B1T A;  1XKB C;  1C1S A;  1DE7 H;  1JWT A;  4CR9 A;  1ORF A;  1O36 A;  2G5N A;  2IJO B;  4B71 A;  3GY5 A;  1BMF D;  4Y76 A;  2H2Z A;  2PHB A;  1YPM H;  2BLO A;  4DUR A;  2JH0 D;  3OFN D;  4LK4 A;  2PV9 B;  2VH0 A;  1S84 A;  2A4G A;  2Z7F E;  2V3H H;  1A2C H;  1K28 D;  2YMS B;  4O3T A;  5ESB A;  4MVN A;  2BY7 X;  1V2L T;  3TPI Z;  2GCH G;  4RT1 A;  3SJO A;  4MQA A;  1AO5 A;  4I8H A;  1ANC A;  2J34 A;  1NY2 2;  1NO9 H;  3AAS A;  4I8K A;  3W1E A;  2SGQ E;  3M37 A;  4DII H;  1CE5 A;  1F0T A;  1PJP A;  1P2N A;  1GJ4 H;  1TGN A;  4I33 A;  1EB1 H;  4YLU A;  4BAH B;  2TRM A;  1J8A A;  1KIG H;  3SQH E;  2QXI A;  3SI4 H;  2A5K A;  5GXP A;  1BRA A;  1PQ8 A;  4IBL H;  1OYT H;  1C1M A;  1ELD E;  1CHG A;  5F53 A;  4INK A;  4NA9 H;  5G4B A;  2Z3C A;  4NG9 H;  1TMT H;  2XCF A;  4XOJ A;  1Y3V A;  1RGQ A;  3UWI A;  2A4O A;  1W7G H;  2BB4 A;  2BVR H;  2OIN A;  2SGF E;  3RXI A;  1OHH D;  1UTK A;  2F43 B;  3AW0 A;  1W7X H;  4K8Y A;  4TWW A;  3TGJ E;  2R3U A;  4R8T B;  1BML A;  2J94 A;  1Y5U T;  2SGP E;  1XUF A;  5FX6 A;  2SGA A;  3GYM A;  2F9N A;  1YLN A;  2ZA5 A;  3M7U A;  4KTC A;  4X6N A;  1THR H;  3BEI B;  2QYI A;  1K1J A;  3D62 A;  1ETS H;  1FQ3 A;  2QGR A;  4CHA B;  1C1N A;  1P11 E;  3RU4 T;  4UD9 H;  1O2G H;  3AAU A;  1S5S A;  1NU9 A;  4Y6D A;  2Y5F A;  4X8T H;  2A45 B;  5J4S A;  4BAM B;  1V2Q T;  3QZQ A;  1YPJ H;  5EU8 A;  1GL0 E;  2K8I A;  3A84 A;  1F92 A;  2W6I D;  1EAT A;  1Z6J H;  1BZX E;  1FN8 A;  2PKS B;  4HG6 A;  4B73 A;  1ZSK A;  2QF3 A;  4CH8 B;  1QCP A;  1FIW A;  1DSU A;  4A92 A;  1UTN A;  2OCV B;  2VIQ A;  4VGC B;  1F0U A;  3U1J B;  1WAY B;  4X8V H;  1O2V A;  4TT3 D;  3CS7 A;  5K0H A;  1OWD A;  1ACB E;  1QRW A;  2BDC A;  1K9O E;  1FZZ A;  2D2D A;  1A3B H;  1GMD F;  1AHT H;  2FI3 E;  2ZQ2 A;  2QF0 A;  2VWO A;  3LGY A;  4WF8 A;  2PR3 A;  2A2Q H;  1HAP H;  2B9L A;  7GCH G;  3B8J A;  4AB9 A;  4Y7B A;  3RXG A;  1SMF E;  1WYK A;  1QIX B;  4B75 A;  4KTS A;  6CHA B;  1K1O A;  3A7X A;  2FWW A;  1ELT A;  1U6Q A;  1TYN A;  3DSO A;  3PMH B;  2VGC B;  3TVJ B;  1D6W A;  1SG8 B;  2H6M A;  4WY3 A;  3HAT H;  1D9I A;  1TAB E;  4NIV A;  4Y7A A;  1UK2 A;  3C1K A;  2FES H;  1BTW A;  1UHB B;  1T31 A;  3LIW A;  4LZ1 H;  3EE7 A;  2ZCL P;  3LH1 A;  1C1U H;  4KGA A;  2QE7 D;  1CT0 E;  1EZU C;  2QCY A;  2V0B A;  3P8O A;  4DJZ B;  2KAI A;  1P09 A;  2BY5 X;  1CT4 E;  3NZI A;  2BY8 X;  4MDS A;  1UTQ A;  4XSK U;  5E2O A;  1Y8T A;  1P2I A;  2FX6 A;  3U28 C;  2ZDV H;  4B2C A;  1C2J A;  1IQN A;  2W26 A;  3A82 A;  1H1B A;  2VH6 A;  4AZ2 B;  3SV9 A;  4ZKN U;  4UFE H;  2LPR A;  3F3B A;  2F3C E;  2CV3 A;  2O9Q A;  1DAN H;  5EQS A;  2J5U A;  1OOK B;  2K0Q A;  2FO9 A;  1AY6 H;  1TOM H;  2ZZU H;  3DSP A;  3VB7 A;  5CHA B;  2EA3 A;  4IW4 E;  3P92 A;  1GBC A;  4XRN A;  2PKA B;  1EXF A;  2ZP0 H;  3O8C A;  2J9N A;  2I6S A;  1C5Q A;  1HAI H;  2ODQ A;  5DP9 A;  2Z3D A;  4GCH F;  5LPR A;  1W14 U;  1BQY A;  1SGE E;  4O9V A;  4WXI A;  2AEI H;  1EOL A;  3FP7 E;  2J4I A;  1V2O T;  4BNR A;  2PGB B;  2P3T B;  1Z1I A;  2AGE X;  1GJ6 A;  4X8S H;  3PWB A;  1ANE A;  2G81 E;  3RXC A;  4ABH A;  4JYT A;  5J4Q A;  1O2W A;  2W3I A;  2ZCH P;  2C3S A;  3HK6 B;  1DS2 E;  4TPI Z;  5CMX H;  1TRN A;  2SNV A;  1GHZ A;  3TIU A;  2ZPR A;  4LZ4 B;  3VG8 A;  2YMS D;  1VZQ H;  2VWM A;  1OWI A;  4ASU D;  3ZVF A;  3RXR A;  1H8E D;  1EOJ A;  1HB0 B;  1JOU B;  2VJ1 A;  1OWH A;  2Q6F A;  8GCH F;  4ZXX H;  1EAI A;  1TIO A;  3ZZ8 A;  3W94 A;  3BG8 A;  2WPM S;  1LPZ B;  1BB0 B;  1EFR D;  1B7X B;  4YT6 H;  1FUJ A;  1AFQ B;  1P02 A;  1T7C A;  4QT8 C;  4K5Z A;  1A3E H;  4Y10 E;  1O2Y A;  2HGT H;  3UNR A;  2JH5 D;  4UFF H;  1V2J T;  1G2M A;  1EAU A;  3SU5 A;  1Z71 A;  2C8Z B;  1ZRK A;  1J16 A;  3MHW U;  4AOR A;  1C2E A;  2JET C;  2P3U B;  2ANK H;  2P59 A;  1YGC H;  1DPO A;  1UK3 A;  3A8B A;  1H8H D;  5L6N H;  1EB2 A;  3SO3 A;  2YOL A;  1A61 H;  3RLY H;  1ZJK A;  3A85 A;  3RXH A;  3BTE E;  1JIM A;  1O30 A;  2D1J A;  3MU0 A;  1C2G A;  3LJJ A;  5PTP A;  2BHG A;  1TGT A;  2VVC A;  1O2S A;  1ARC A;  1V2U T;  4KP0 A;  1QFK H;  1GHY H;  2OQ5 A;  5C67 A;  3CS0 A;  5EXL A;  1TNK A;  2WZQ A;  1ZSJ A;  5T1V A;  1BTZ A;  1MKX K;  2FX4 A;  1E34 B;  3A7W A;  3I29 A;  5HIZ A;  2G5V A;  3K2U A;  4CRF A;  2ZIQ H;  2BD5 A;  1KXC A;  3BN9 A;  3AW1 A;  1MTU A;  1S82 A;  3GY7 A;  3T27 A;  2Y5H A;  4AGK A;  1M9U A;  3QTV H;  3D23 A;  1RIW C;  3SU6 A;  6GCH F;  1V2S T;  2ZHF H;  4Y0Z E;  1W0Z U;  3F0P A;  2J92 A;  3EGK H;  1ZHR A;  3T26 A;  3VXE H;  3V3M A;  1K1N A;  3LGI A;  1EPT C;  1NPM A;  4AYV B;  1ETT H;  3HKI B;  3P8N A;  2BDY A;  2THF B;  3U8O H;  5EW2 H;  1GG6 B;  2CF8 H;  2DE8 A;  1O3L A;  2GVF A;  1JBU H;  4A7I B;  3LU9 B;  2QF5 A;  1VIT G;  1HXF H;  4THN H;  3EAJ A;  3SU3 A;  1GJA B;  2KCP A;  1ZGI A;  2I6Q A;  3SND A;  4K69 A;  3BIV H;  2WPI S;  5F6M A;  1UK4 A;  3ZVA A;  2RDL A;  1G3C A;  1VIT H;  1XXF A;  1FJS A;  4D9R A;  5C2Z A;  1LQD B;  1P3C A;  5HM2 A;  1F2S E;  3EE0 B;  1GBB A;  3KCG H;  2KR7 A;  1PPE E;  1ZRB A;  3BG4 B;  1ETR H;  3URE A;  1RJX B;  3PB1 E;  2PFE A;  1EX3 A;  3Q3K A;  1O2Q A;  4FUD A;  4B2A A;  2OTV A;  1BTP A;  3PYH A;  1IQI A;  1S85 A;  2F9B H;  2FLB H;  1HPG A;  5C3N A;  3Q3X A;  1LHF H;  2OK5 A;  2P8O C;  2B8O H;  3SUE A;  1P9U A;  4CRE A;  3UQV A;  2XBY A;  3FOA A;  1MZD A;  4X1R U;  5C1U A;  4INH A;  5A8Z A;  3E0N B;  1JRS A;  4ACA A;  2G52 A;  3PV2 A;  2Y80 A;  1E1R D;  1O3P B;  1YPK H;  1GBT A;  3F9G A;  2FXR A;  3RXP A;  3TJO A;  3ZVD A;  3G01 A;  4UE7 H;  3FZD A;  2G8T A;  1TNL A;  4CR5 A;  1J15 A;  3SW2 B;  5A2M H;  3RXQ A;  1BTX A;  1GCT C;  3JZ2 B;  3V13 A;  3MFJ A;  2D26 C;  2WYG A;  1HAX B;  3LC3 A;  5KGO A;  4BAQ B;  1T4V H;  4FUC A;  3P17 H;  1TX7 A;  4U30 A;  3K6Y A;  1QL7 A;  1UHB A;  3SU0 A;  1YF4 A;  3RMO H;  5B6L A;  1O2I A;  2BXT H;  3SUD A;  4X2W A;  1YP9 A;  1AN1 E;  2TGA A;  4ABG A;  2F83 A;  1GJ7 B;  4F55 A;  5C1X A;  3UOU A;  3TK9 A;  3SNB A;  1SQR A;  1YCP K;  3SZE A;  2ZGH A;  5C0U A;  2BZA A;  1K2I 1;  2LNC A;  2ODP A;  1SSX A;  4FXG H;  1B0F A;  5KED A;  1CA8 B;  2SFA A;  3GY3 A;  1ZTJ A;  3OYP A;  1GGD B;  1NES E;  4WH8 A;  3ODF A;  5FHT A;  4X1Q U;  1C4V 2;  1MU8 B;  1P06 A;  2B5T B;  2PKA A;  2Y5G A;  4IS5 A;  3KQB A;  4RI0 A;  5SGA E;  3M3T A;  3HPT B;  1DX5 M;  1OX1 A;  1TAW A;  4RN6 A;  1GCD A;  2BD7 A;  3GOV B;  1BA8 B;  1ZYO A;  1Y59 T;  1LKB A;  2CHA B;  3PO1 B;  4WMF A;  2B7D H;  2HLD D;  2A5A A;  4DT7 B;  3O8B A;  2TGT A;  1J9C H;  4H4F A;  8KME 2;  4ACB A;  5BPE A;  1GHB F;  4D76 A;  2F9V A;  3ZVE A;  2R0K A;  5F8Z A;  1TPO A;  1O2M A;  1SGY E;  1G37 A;  1MCV A;  1Y3Y A;  3DUX H;  1UTJ A;  3P8G A;  3T62 A;  1GBM A;  1FXY A;  1P8V C;  3CNR A;  5EGM A;  3VPK A;  1IQH A;  1NRP H;  1WSS H;  3SNC A;  2KCA A;  2DUC A;  3F9E A;  4OGX A;  3RUO A;  3RU4 D;  4D8N A;  1GDQ A;  3R3G B;  3E16 B;  1MQ6 A;  1IQE A;  4E7R G;  4RKO B;  1HJA C;  4BTT B;  3ZZ5 A;  2ZU5 A;  1ZJD A;  2FPZ A;  2F9O A;  5DP8 A;  1PFX C;  3OAA D;  3UFA A;  1T8N A;  1VR1 H;  3RML H;  1YC0 A;  3F0O A;  2BY6 X;  1TAL A;  3P70 B;  1OWJ A;  3UQO A;  3VXF H;  3SUG A;  2OQU A;  3H09 A;  1GI9 B;  3SJ8 A;  1H8I H;  1GJB B;  1MKW K;  2XWB I;  2Q6D A;  1SGT A;  4GLY A;  1SOT A;  3SU1 A;  3QK1 A;  1A5H A;  5A0B A;  1O3C A;  1GDN A;  1HDT H;  1QJ1 B;  3STI A;  5JDU B;  4NSV A;  1MTN C;  1F5K U;  4DIH H;  2ANY A;  1O2Z A;  1C5R A;  1YBW A;  2R3Y A;  1QQU A;  2ALP A;  2IPH A;  4FET A;  3M3V A;  1EUF A;  2GV7 A;  1FLE E;  1DLK B;  3QTO H;  1DT2 A;  4JCN A;  4XFQ A;  1YM0 A;  1FPC H;  1EJM A;  5H4I B;  1QUR H;  1GBI A;  1Q2W A;  3MNB A;  3LON A;  3TH4 H;  2TIO A;  2FYQ A;  2BLW A;  4YZU A;  3SZN A;  1Y5B T;  3GCH C;  1SR5 C;  2YNA A;  2Z9J A;  2Z94 A;  4ABI A;  1A0L A;  3AK5 A;  1F5R A;  2KM0 A;  4JMY A;  1PYT D;  5GCH F;  2GDE H;  4RT0 A;  1P57 B;  4JZE H;  1C2L A;  1ZLR A;  1TB6 H;  1TFX A;  1C5N H;  1IQM A;  2SNW A;  1BMN H;  2ZEC A;  4TY7 A;  3F9H A;  2ANW A;  1AZ8 A;  2BD2 A;  2STA E;  1D3D B;  4MNY A;  2ZGB H;  4BOH A;  1KTT B;  1KLJ H;  2OBO A;  1HAH H;  3MNC A;  1DXW A;  2A1D B;  3A88 A;  3OU0 A;  1TOC B;  1AND A;  3QGJ A;  4GVU A;  1D4P B;  1QJ6 B;  2F9U A;  3FFG A;  3URC A;  1DIC A;  2WV4 A;  1FMG A;  1A7S A;  1TGS Z;  2V7Q D;  2ZTZ A;  5DSF A;  1NRS H;  3F2F A;  2R2W U;  1J17 T;  3BTK E;  3M61 U;  1HRT H;  1VGC B;  3PWC A;  4F4O C;  1QZ8 A;  1DST A;  2R9P A;  2CK3 D;  3FP8 E;  2BVS H;  4ZKO U;  2ZNK H;  3DSG A;  2GMT C;  1MU6 B;  3M36 A;  4I31 A;  1NM6 A;  1KDQ B;  2V35 A;  1BRB E;  2BXU H;  3URD A;  3GDU A;  5IDK A;  1MTS A;  3OX7 U;  3RXO A;  2UWL A;  2G55 A;  3KYG A;  5JBT A;  1O5A B;  4FUF A;  3T5F H;  3ZZB A;  1FX0 B;  4NSY A;  5HM9 A;  1ID5 H;  1LHD H;  2WV5 A;  3E91 A;  3U1I B;  4PRO A;  3SV8 A;  3RMM H;  1BDA A;  2H5C A;  2OC0 A;  1XUH A;  1HBT H;  4XDE A;  1F5L A;  1Z8R A;  2CN0 H;  1ZHP A;  1HIA A;  2Z9K A;  2C4F H;  2ZWL H;  3PV5 A;  1HUT H;  1IHS H;  2A2X H;  3A81 A;  3Q77 A;  1MMJ N;  2UUK B;  1DM4 B;  1LHG H;  1XUJ A;  1C4U 2;  1BHX F;  1RS0 A;  1JXP A;  4MPX A;  3MH4 A;  3V0X A;  3VGC C;  4JZI A;  2R2M B;  3B23 B;  2XBV A;  4AFZ A;  3MH7 A;  2IPQ X;  1SQO A;  4CRB A;  1BTH H;  1O2R A;  3EA9 A;  3PRB A;  1TNI A;  3M7Q A;  2LEL A;  2VIW A;  4IMZ A;  1S83 A;  1PQ7 A;  1GI4 A;  3PLP A;  3ZZC A;  3L6P A;  3M5O A;  1C5W B;  2GCT C;  1L4Z A;  2AMP A;  3GCT G;  3M7T A;  1YPL H;  2W3K A;  1TX8 A;  1XUG A;  2JJ2 D;  4TSF D;  1O0D H;  2OC7 A;  3LGT A;  3OSY A;  5CE1 A;  3MTY A;  3RXD A;  5ETX A;  1DDJ A;  1FON A;  5CDF E;  2Z3E A;  1Z7K A;  3K9X B;  1AWF H;  3RDZ A;  9EST A;  1FY5 A;  2ZDL A;  2OLG A;  4ABD A;  3B9F H;  5IK2 D;  4MPV A;  1OYQ A;  2H9T H;  3DT0 H;  2GP9 B;  3KQC A;  1K1P A;  4DVA U;  1OSS A;  3A7T A;  2ZDK A;  3ATM A;  3EYD A;  1GI3 A;  5F03 A;  1NRR H;  2QY0 B;  2AGI X;  1AE8 H;  5A0A E;  4MG3 A;  1JMO H;  1A0J A;  4AN7 A;  1BTU A;  1W8B H;  1DFP A;  4Y71 A;  2A31 A;  3TGK E;  5L30 H;  1G32 B;  1TE0 A;  2ZFS A;  4AFS A;  3NKK A;  2AGG X;  1GI5 A;  1P2J A;  1MAX A;  3A80 A;  3I78 A;  5AHG H;  1O2T A;  3WWB A;  2VID A;  3MO9 A;  2FLR H;  3RXB A;  3BTD E;  2JIZ D;  4D7F A;  1GL1 A;  4DGJ A;  1DOJ A;  5TCC A;  1L1G A;  1O5E H;  1Y3X A;  2P95 A;  4X1S U;  1EJA A;  1BBR E;  4K8B A;  1LKA A;  1G9I E;  1F0S A;  1C1Q A;  2RCE A;  2A7H A;  4IN2 A;  3NRL A;  2ZFP H;  5B6O A;  3F6U H;  3JZ1 B;  4FUE A;  5GIB A;  3IIT A;  1MBQ A;  1DUA A;  1O35 A;  1C1P A;  5FCR A;  1A4W H;  1ESB A;  1O3J A;  4IC6 A;  1O3N A;  1O2X A;  4KTU A;  1GHX H;  2HAL A;  3TNS A;  2FOA A;  4HI3 A;  3RC6 A;  3MU1 A;  1SLX B;  3P6Z B;  3FAO A;  4X6O A;  1ZR0 A;  2J38 A;  4WH6 A;  2EEK A;  4FUG A;  5FCK A;  1C4Y 2;  3LH3 A;  2ZCK P;  1GHA G;  1K1I A;  1E35 B;  1BMA A;  1ELV A;  1MH0 A;  1QJ7 B;  1E37 B;  1O3D A;  4YES B;  4BAN B;  2OBQ A;  2XYA A;  2ZO3 H;  1O33 A;  5I25 A;  3DFL A;  2GT8 A;  2QIQ A;  2BLV A;  3T2N A;  5FPT A;  1DUE A;  1NT1 A;  3ENS B;  4P00 A;  1C2K A;  1CVW H;  1HJ9 A;  2RA0 A;  1LPG B;  4OS4 A;  2BQW B;  2FTL E;  1PQ5 A;  1YY3 A;  1AVG H;  4YOI A;  2F4L A;  4OS2 A;  1GVL A;  2ZHQ H;  7KME H;  2ZPS A;  2KCO A;  1AMH A;  1VJA U;  1RFN A;  5EG4 A;  2SGD E;  1COW D;  2SGE E;  1GMC G;  1ABI H;  4HGC A;  1RXP A;  2NU0 E;  1BT7 A;  5C5N A;  1WV7 H;  2K1Q A;  5E0J A;  2H9E H;  3UUZ A;  1MTV A;  1CA0 C;  3F68 H;  4DT4 A;  5C5O A;  1GMH G;  2XRC A;  5L2Y H;  3GDV A;  3S9A A;  1ELC A;  2G4U A;  2G51 A;  9LPR A;  2FM2 A;  1TNH A;  4K1E A;  1UVT H;  3OE7 D;  1HNE E;  1P12 E;  5JBA S;  3NCL A;  3EQ0 H;  3SJ9 A;  1FDP A;  2WPJ S;  3QWC H;  3KQD A;  3PRO A;  1ZPC A;  1NFY A;  2FIR H;  4YT7 H;  4ZHM U;  3MO3 A;  1FY4 A;  2CXV A;  1YLD A;  3O8R A;  2HVY B;  1SGP E;  2FMJ A;  3S7K B;  3UR6 A;  2GKV E;  1V2P T;  2F9P A;  3RXJ A;  4HFP B;  4NIW A;  4TYD A;  5A09 A;  1IQL A;  1GBK A;  5A8Y A;  5K7R A;  4Z6A H;  5DJ7 A;  2QN5 T;  3KQ5 A;  1W3C A;  1ZMN A;  5FBE A;  1KDQ A;  3ZIA D;  4A1V A;  3PTN A;  1ESA A;  1QNJ A;  4JYU H;  4M9F A;  4NIY A;  1XVO A;  3SU4 A;  3VEQ B;  5HXF A;  5HGG A;  1DXP A;  4NZL A;  1EAX A;  5JBB S;  4MPW A;  4LXB H;  1GDU A;  1NBM D;  3S0N A;  2XC0 A;  4JK5 A;  1ELF A;  3OY5 U;  1P01 A;  2D8W A;  3MNX A;  4X1P U;  4ABE A;  1CGH A;  1THP B;  2GZ8 A;  3U98 H;  3RC5 A;  2VIP A;  1O5F H;  1P2K A;  2A4R A;  4YXW D;  2RA3 A;  3TK5 A;  5TJX A;  1C5L H;  1N1L A;  1A46 H;  1AVW A;  4E05 H;  1TRY A;  2BVX H;  1UCY E;  5FPS A;  5HYO A;  4DY7 B;  2GGV B;  1OWE A;  2XW9 A;  4FVB A;  2JH6 D;  4O3U A;  1V6D A;  4BTU B;  3V7T A;  1FPH H;  4ZUH A;  1TGC A;  2JJ1 D;  3RLW H;  4OGY A;  1OWK A;  2HPQ H;  3UPE A;  1KYN A;  1UTM A;  5FX5 A;  1Z8I B;  4O97 A;  3FKS D;  3S7H B;  4X8U H;  2BOH B;  1G36 A;  3SOS A;  2ZGJ A;  1UVU H;  1O5B B;  2GCH F;  3MYW A;  1MTW A;  1XVM A;  2G00 A;  3M5L A;  3Q3Y A;  3A7Z A;  2J2U A;  4Q7X A;  3QLP H;  5FL7 D;  2AH4 X;  1NTP A;  2WHX A;  2L6O A;  1ZPZ A;  1PPH E;  3GY4 A;  1WCZ A;  2IJD 1;  1ZPB A;  1H4W A;  1HAY B;  1SC8 U;  2A7J A;  4MPU A;  1O2J A;  4CRA A;  1AWH B;  2Z9G A;  1OP0 A;  1EZQ A;  3BIU H;  5GDS H;  2FOM B;  4FUH A;  2F91 A;  3LGW A;  1MQ5 A;  3ZZ7 A;  4B74 A;  4Q7Y A;  1BJV A;  1P10 A;  2AMQ A;  4INL A;  5JBC S;  3SOR A;  3TH2 H;  3OEH D;  2H9H A;  4GUX A;  1IHT H;  1BBR K;  2Y82 A;  4OM9 A;  1H9H E;  4IN1 A;  3RXL A;  1ARB A;  1KTS B;  2GD4 B;  4IC5 A;  1AFE H;  1ZZZ A;  1C5P A;  4EST E;  5FXL A;  3SI3 H;  1SLW B;  3LPR A;  1C2D A;  1OKX A;  1C1W H;  4FVD A;  4WVP E;  1L0Z A;  1MUE B;  2FZZ A;  1SI5 H;  1E0F D;  3RXM A;  1HLT H;  3IG6 B;  1Y5A T;  1DWD H;  2FTM A;  1S6F A;  1BHX B;  1F0R A;  2A4Q A;  2PUQ H;  4AOQ A;  3MQK C;  4OS1 A;  1T4U H;  2FS8 A;  1O3G A;  4CH2 B;  2BX4 A;  2VB0 A;  1DWC H;  4I86 A;  3ITI A;  7EST E;  3VFE A;  1LQE A;  1UMA H;  5EQR A;  4NZQ A;  1T8M A;  3PRD A;  1Y3W A;  2ZEB A;  5C0T A;  2BD8 A;  4I8G A;  3GY8 A;  1WQS A;  3VB5 A;  4AC9 A;  2H5D A;  1TON A;  2RFK C;  3PMJ A;  1EZX C;  2ZPQ A;  4O03 A;  3U8T H;  1NC6 A;  1HGT H;  1KXF A;  5JB8 S;  3SJI A;  1AKS B;  4NFF A;  4ABJ A;  3BTT E;  4U32 A;  2QV1 A;  3LDX H;  1QR3 E;  2BOK A;  2R0L A;  4DW2 U;  3TH3 H;  3BSQ A;  3SQE E;  5DP6 A;  1W0K D;  7GCH F;  2C93 B;  3NPS A;  5EJ1 A;  5I46 H;  1SBW A;  1ZTL A;  5DG6 A;  4D7G A;  3SN8 A;  1O5G H;  2YMS C;  2ZQ1 A;  1N6Y A;  4XBB A;  2JET B;  4K60 A;  4AX9 H;  4DOQ A;  1EKB B;  1LMW B;  2W5E A;  2FOG A;  3N99 A;  5DPA A;  1Z8J B;  2ZC9 H;  1SVP A;  4CRD A;  3SBK A;  2NWN A;  3ZV8 A;  1EQ9 A;  1SQT A;  3A83 A;  5DP7 A;  1YPG H;  1EP5 A;  1DVA H;  1K1M A;  2ODY B;  3D65 E;  1YKT A;  2HVX A;  1SHH B;  1O3O A;  4M7G A;  3TK6 A;  1HYL A;  3ATK A;  3QGN B;  1P2Q A;  3OEE D;  5EPY A;  1HJ8 A;  3ZZA A;  4OS7 A;  1SQA A;  1QHR B;  3BTQ E;  1UVS H;  4AGJ A;  4GSO A;  1LDT T;  1SGR E;  2TGD A;  3M5M A;  1HFD A;  2OC8 A;  2WUC A;  1TWX B;  1MAY A;  2G4T A;  3ZZ6 A;  1RIW B;  1DY8 A;  1GI0 A;  1KLI H;  2J98 B;  1V2K T;  2BDG A;  3BTM E;  1FIZ A;  1BRC E;  1GHA F;  3NUM A;  1ZOM A;  1CGJ E;  4GCH G;  2RDE A;  4Y0Y E;  1EPT B;  1GVZ A;  1S6H A;  1EJN A;  5TCA A;  4UEH H;  4CHA C;  2Y7X A;  1FV9 A;  3F2H A;  2XOK D;  3ZVG A;  3OTP A;  4HTC H;  2B0F A;  5FAH A;  1DLE A;  1C5U A;  4FOU C;  1AVX A;  1AD8 H;  1ZSL A;  3DD2 H;  2ZFQ H;  1QBN A;  4X0W U;  4D9Q A;  4DG4 A;  1NZQ H;  1UVP A;  4ABA A;  5L2Z H;  3E0P B;  1UJ1 A;  1KSN A;  2UUY A;  5E0H A;  3RXT A;  4XE4 A;  2PKS C;  3SUF A;  3NXP A;  2GV6 A;  1MAB B;  4JZD H;  1NRN H;  2XC4 A;  4ABF A;  4H42 U;  6LPR A;  2EY4 C;  1BOQ A;  2HOB A;  2NU3 E;  3WW7 A;  1LVY A;  1UCY K;  1O38 A;  2ILN A;  4VGC C;  3U8R H;  1V3X A;  1XXD A;  5FBI A;  3H7T A;  1D3T B;  1SGF G;  4FU9 A;  1FY3 A;  1GI8 B;  2FP7 B;  4CRC A;  4ZH8 A;  1GHW H;  1GJ5 H;  2V6N A;  1QB1 A;  3MNS A;  4ISL A;  4NCY A;  8GCH G;  4XBC A;  1BUI A;  2BQ7 B;  1TBR H;  1IOE A;  3R0F A;  2KZ4 A;  1O2N A;  1O3M A;  5JYI A;  2BY9 X;  4WXV A;  1CQQ A;  1TNJ A;  1ZHM A;  4RSP A;  1O2H A;  1BJU A;  2FOD A;  4MNV A;  2ZDM A;  5ABW A;  5IYT A;  2PP6 A;  2XWA A;  1L4D A;  1O2K A;  4WME A;  2P8O B;  2BD3 A;  2M2A A;  4IMQ A;  1E36 B;  2Q1J A;  2W6J D;  4J1Y A;  1GI7 B;  6CHA C;  2KX4 A;  2HLC A;  1NFW A;  3V12 A;  5AVD A;  2VGC C;  2P93 A;  1MZA A;  3SV2 H;  4BAO B;  2AFQ B;  1RD3 B;  4TY6 A;  3PLB A;  2ZTY A;  3PM3 A;  1TMB H;  3UNS A;  4KKD A;  3BEU A;  1AB9 C;  5GPI B;  1MKW H;  2P94 A;  1O2U A;  1YWU A;  2OD3 B;  4KEL A;  3KF2 A;  1GCT B;  1TGB A;  4BAK B;  1D3Q B;  1H9L B;  1GBL A;  2QXJ A;  3HK3 B;  1SPJ A;  2KFW A;  5EJZ A;  8EST E;  4H6S B;  1MD8 A;  4TWY A;  3FP6 E;  5HIY A;  3SNA A;  1NN6 A;  2ZHD A;  3I77 A;  1ABJ H;  1CBW C;  3RXK A;  1L2E A;  4Q2K A;  5JB9 S;  1QL9 A;  3AAV A;  3UIR A;  5HKK D;  2O8W A;  1LVO A;  2GDD A;  2ASU B;  4ISI H;  2ZF0 H;  5DKM A;  6GCH G;  1TRM A;  3P95 A;  1DWE H;  4GAW A;  1XKA C;  2VBC A;  3GS9 A;  5EST E;  1V2R T;  2EQN A;  5CHA C;  4X2Y A;  3RU4 E;  2CGA A;  5LH8 A;  1XUI A;  4WJG 2;  1GBD A;  1BIO A;  1P2M A;  1AQ7 A;  3BTW E;  2AIQ A;  3QX5 H;  1O2P A;  2BM2 A;  5A0C A;  2WPD D;  1CO7 E;  1G3E A;  4UFG H;  2HRV A;  5E0G A;  4I8J A;  1F7Z A;  2V3M A;  3BTH E;  3H7O A;  4NA7 A;  1WBG B;  1IQK A;  3M5N A;  1AUJ A;  1O2O A;  3CEN A;  4J2Y B;  3SGB E;  1WXR A;  2TPI Z;  1LHE H;  1VCW A;  2VWL A;  2ZFF H;  1VIT F;  1XMN B;  4NFE A;  1V2T T;  1T8L A;  2IOT A;  3IWM A;  1SFI A;  1AI8 H;  3E8L A;  4ZHA A;  2PGQ B;  1O3A A;  4Z0K A;  2VIO A;  1O5D H;  3A89 A;  5FPY A;  1OS8 A;  3S69 A;  3F2G A;  1L1J A;  2OC1 A;  4X2V A;  3L3T A;  3PMA B;  2ALV A;  4AG2 A;  4JZ1 A;  5DK1 A;  1SKY E;  3ZYE A;  2GZ7 A;  5GND A;  4F48 B;  1K21 H;  3UAI C;  4YLQ H;  1KMH B;  4GHT A;  5T6F A;  1FI8 A;  3TNT A;  1NS3 A;  3DFJ A;  1A5I A;  4F49 A;  3SU2 A;  1AKS A;  1AFQ C;  1FNI A;  1LVB A;  2Z6B D;  4ASH A;  1YYY 1;  2BMG B;  3MU4 A;  1Q31 A;  1HJA B;  1IQF A;  1Y3U A;  2HPP H;  1W10 U;  1TPA E;  2WIN I;  2BZ6 H;  3VB4 A;  1QB9 A; 
#chains in the Genus database with same CATH homology
 2J98 B;  1QZ8 A;  1UW7 A;  5HIY A;  3EE7 A;  2J98 A;  5HIZ A;  5C94 A;  2J97 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...