2J98B

Human coronavirus 229e non structural protein 9 cys69ala mutant (nsp9)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
102
structure length
102
Chain Sequence
KPGKMKVKATKGEGDGGITSEGNALYNNEGGRAFMYAYVTTKPGMKYVKWEHDSGVVTVELEPPARFVIDTPTGPQIKYLYFVKNLNNLRRGAVLGYIGATV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Variable Oligomerization Modes in Coronavirus Non-Structural Protein 9.
pubmed doi rcsb
source organism Human coronavirus 229e
molecule tags Rna binding protein
molecule keywords REPLICASE POLYPROTEIN 1AB
total genus 21
structure length 102
sequence length 102
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08710 nsp9 nsp9 replicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.250 Mainly Beta Beta Barrel Thrombin, subunit H Replicase NSP9 2j98B01
2J98B 5C94A 3EE7A 1UW7A 2J97A 5HIZA 5HIYA 2J98A 1QZ8A
chains in the Genus database with same CATH superfamily
3T29A 2ZHQH 2ZGCA 1HAXB 1P3CA 3RXTA 3P8GA 2HNTE 5EQRA 3LC5A 2FX4A 1GBDA 2ASUB 1TGSZ 4K1EA 1MCVA 1SBWA 1MAXA 1YPHE 3RXIA 1LHEH 3CP7A 2BDCA 1Z6EA 1UHBA 4ABEA 1LKAA 1J15A 3U8TH 1OSSA 4Y11E 2G81E 3UNRA 5E0JA 4YXWD 2BDHA 2BM2A 2BYAX 4GHQA 1O36A 1TNHA 3OAAD 1S6LA 4Q7ZA 3RXDA 5JBAS 2P8OC 5EODA 3T27A 1TNLA 3OEHD 2A1DB 2C4FH 1YPMH 1CHGA 1GJ5H 4K8BA 4NIXA 2HLCA 1FIZA 1WDIA 2O8TA 1EASA 3WWFA 2ALVA 1Q31A 6CHAC 1CA0C 2P3FH 1WTHD 4SGAE 5EJ1A 1OHHD 2ZNKH 1UMAH 4Y7BA 2QF0A 2HVYB 1LHCH 2D8WA 1OS8A 3F9FA 1HNEE 2ZHFH 1Y8TA 1FMGA 2PTCE 3ZVCA 2BY8X 6ESTA 1A7SA 2OQ5A 1ZHRA 1UVUH 5EIYA 3UAIC 4H6TA 1C5TA 1GGDC 2A4GA 2BOKA 2Z3DA 2EI7A 1Z6JH 4X8TH 1MTUA 1MKWK 3T25A 4RN6A 4OS6A 1C1QA 1TNJA 1P04A 2BDIA 4ASHA 2W7SA 3FN8A 1LVBA 2ZDVH 1T31A 2ALPA 5DP4A 4KTUA 1C5WB 1NBMD 2ZC9H 4CH2B 2UUFB 3UY9A 3GS9A 1K1MA 1WV7H 2XBVA 2GT8A 5AVDA 1O3JA 1F2SE 3RXUA 1TB6H 2ZO3H 3TJNA 1DICA 2F91A 1SQAA 2F43B 1AN1E 1UJ1A 1W14U 1ABJH 2CV3A 1NN6A 1B0FA 1L0ZA 1O38A 1HCGA 2QF5A 1AKSB 4FU7A 1MKWH 2RA3A 4JZFH 4KP0A 3SU4A 1YPEH 1N6XA 5EPNA 2A5KA 3ZYEA 1V2ST 1NTPA 4I8JA 3T5FH 3U1IB 1AU8A 1OWIA 2Y82A 2XWAA 3S9AA 1QJ7B 1DXWA 2CN0H 1C2FA 3BTGE 1DFPA 5I46H 3MO9A 2NWNA 1K1OA 2K1QA 4ABGA 1OWKA 5J4QA 3FANA 1DY9A 1HIAA 3KGPA 3SU2A 3LKWA 2VIVA 5T6GA 2PV9B 2P93A 2HWLB 2XBXA 5FBIA 1AE5A 3M5LA 1FI8A 2BD5A 4WXIA 5DK1A 5JPMH 3RU4T 2V0BA 1EJAA 2A4QA 3F9GA 1EUFA 1FNIA 3NRLA 1EAUA 2ZFFH 2Z6BD 1TYNA 4BXSA 3M7QA 2A31A 2AERH 2XYAA 1D3DB 3A7ZA 2XXLA 3LT3A 2A5IA 1TE0A 2AIQA 1GDQA 1O2PA 1W12U 5C94A 3E91A 4XFQA 1O2ZA 2BD8A 1RS0A 2UWOA 3TK9A 3URDA 1LDTT 1C5RA 3E8LA 1MQ5A 5BPEA 2XC0A 3PROA 1E35B 1FPCH 3M3TA 2ZGXH 1KXAA 1GHWH 1NESE 2OC0A 3GYMA 1KLTA 1QNJA 4GVUA 2J92A 3SV8A 3DFLA 4M9FA 1MMJN 1DPOA 2K0QA 3ELAH 2XOKD 3RC6A 2FI3E 1SLVB 4U2WA 1AUTC 1P03A 4UFFH 1IQHA 1EOLA 2QXGA 1EOJA 1NFYA 2KCPA 1EB2A 2Z94A 3BG4C 1G3EA 3RXGA 3A84A 3SJIA 3ZZAA 1MZAA 2J5UA 1RRKA 1AD8H 1O3LA 2JKHA 1N6YA 2C8XB 4OS4A 3QLPH 3M5NA 3UREA 2ZPRA 1SQRA 1QJ1B 4UFGH 5C2ZA 2V3OH 1UVOA 1GDNA 1NROH 3KQ5A 3E1XB 3ZV9A 3SBKA 4B2BA 1YLNA 1O33A 3MU8A 1MQ6A 5C17A 3ESTA 3ZVFA 3ZZ5A 2A4RA 1AKSA 2Z3CA 2ZEBA 1KSNA 4OGXA 3S69A 2NU3E 2PGBB 3SGBE 1YCPM 3FO8D 5DSFA 4ESTE 1T4VH 1G37A 1BBRE 1BB0B 1OWJA 2YMSC 2O9QA 3A85A 1Y3XA 1HUTH 1MD7A 3VGCC 1BJUA 3AK5A 3HK6B 1EPTC 1IAUA 1IQMA 5JBTA 4CHAC 2LPRA 1UHBB 1K1LA 2ODYB 2SFAA 1QB6A 4CRGA 1WUNH 3GY4A 2C93B 3F68H 4RKOB 1JRSA 1MU6B 2Z9JA 1RD3B 2BLWA 2BQ7B 3HATH 2ZHWH 4IW4E 3LGTA 3GDVA 4ISNA 4ZKOU 1ACBE 1LVMA 4XDEA 2OC1A 1GBEA 2AMDA 1J14A 3MH6A 1GI0A 3GICB 1ELEE 5FPYA 1O2VA 3Q00A 1PYTD 1GJ9B 2ZFSA 3SQHE 3GOVB 4ABIA 2V35A 1O5AB 1O3AA 3SGAE 3HGPA 5GJ4B 3D62A 3GCTG 1DUEA 2GGVB 1JMOH 4AB9A 1ZYOA 1GBFA 1CGHA 3P95A 3DFJA 3MHWU 1P05A 1CBWB 3PLBA 4Y71A 5ABWA 4CHAB 1V2UT 2W6ID 1IQIA 3A7YA 3EA7A 1HAVA 2STBE 1BCUH 3NUMA 1V2RT 1QHRB 1NFXA 5FL7D 1GBKA 1GI7B 1DSUA 4Y76A 3MNSA 5E2OA 1EAIA 1T4UH 1H9HE 4X6OA 1DX5M 1V2QT 1BITA 1NM6A 3A86A 3OYPA 3Q3XA 5DO4H 2ZECA 5H4IB 1V2OT 4XBDA 2KR7A 3QGJA 1C4V2 1TA2A 1TABE 3GCOA 1ZJKA 4MLFB 1ETTH 1FIWA 1GI3A 1PYTC 1QA0A 1OXGA 1A0HB 2J2UA 1SLXB 1O5GH 1MKXH 1XVOA 3DHKH 2QGRA 1Z8JB 2OTVA 4BAKB 4GSOA 1HAZB 1EXFA 1BMLA 5FPTA 5AF9H 1E36B 4OGYA 2J98B 4IN2A 3RLWH 1W3CA 2AGGX 1ZHPA 3C27B 4JK5A 4X8UH 4XE4A 1J16A 1VCPA 3QGNB 4M7GA 3STIA 1O3MA 3SI4H 4KTCA 1TA6A 4DY7B 2W5EA 1XKBC 2BLOA 4BTTB 3S7KB 2P3UB 3P92A 2ZWLH 1GCTC 4IMZA 3M37A 2AFQB 2FZZA 5GIBA 1K21H 1P01A 3GCTF 2FOMB 3P8NA 1ZRKA 3RXRA 2GCHG 3A8AA 4JYVH 8GCHF 1LPZB 1LVYA 4LZ1H 1IQLA 4TY7A 3PRDA 2F9NA 5GPIB 4OS7A 4FVDA 1COWD 1ZPCA 5DP8A 3AAVA 2JETC 2FS8A 1TMTH 4YM9A 1O3OA 2IJD1 1GG6C 3DUXH 4Y79A 1S5SA 2BDYA 4X2YA 1A0LA 1F5RA 2ZI2H 1J17T 3M36A 5CHAC 1SGQE 1DM4B 1NRRH 3A83A 1A3EH 1ARBA 1IQNA 2VINA 3U8RH 2PSXA 2WSSD 5F6MA 5HKKD 1C2DA 1ZTLA 3RU4D 2WPMS 4QT8C 3ZZ9A 2KCOA 1X7AC 3U69H 1IQKA 2OC8A 4ZXXH 3SJ8A 3RXQA 2QYIA 2YMSD 3PRBA 2UUYA 1S6FA 1SOZA 1O37A 1HAPH 2TGPZ 1TOMH 1HB0B 1ZMLA 5DP7A 5CDFE 2ZTXA 1C4U2 3LJJA 4JZIA 5IYTA 2LELA 2F9PA 1XXDA 1HBTH 1PQ8A 4PROA 2VVVA 1NRSH 3OEED 3BTTE 4O9VA 1ZTJA 4RKJB 1CT4E 4YT6H 2JETB 2GT7A 1C5MD 1DDJA 2BVRH 1TRYA 2BY7X 2GCHF 3P8OA 2XW9A 3TJOA 1ZMJA 3K9XB 2Y7ZA 3N7OA 3KNXA 1Y5AT 1W11U 2BDGA 3RMMH 1GBAA 4X1SU 4NZLA 3SHAH 1P2KA 2AYWA 3UTUH 1TRMA 1K1NA 1O2GH 4YLQH 1DWDH 5JBBS 2WUBA 3SV6A 1YPJH 1SQOA 2H6MA 3B23B 3BIVH 1GI6A 3KQEA 4DOQA 3M5MA 2QAAA 4OS5A 3RXLA 3UNQA 1EAWA 4I32A 3RMOH 1OWHA 1BIOA 1LVOA 3F9EA 1PQAA 5F8XA 2BD4A 4ABJA 1YF4A 5C0UA 2Y81A 4AORA 1BTHH 3LONA 2BLVA 5DG6A 2OLGA 4HZHA 3A87A 4BAMB 2J38A 1TX7A 1DUAA 1LCYA 1O2UA 1SGYE 2R0KA 3BN9A 1C1NA 1GMHG 2VJ1A 4Y7AA 3PWBA 3M3VA 4F4OC 4K5ZA 2GKVE 1XM1A 1GMHF 3VFEA 1UTPA 5K7RA 2C8WB 3G01A 2WYGA 1CT2E 1EKBB 2NU1E 2RCEA 3RM2H 1TPPA 1YKTA 2P95A 2VIWA 4Q2KA 2OQUA 4K3JA 1RXPA 3RXHA 2KCYA 4D9RA 4Z1MD 1SGFA 4B2CA 2A32A 2Y7XA 4HGCA 2ODQA 4BAOB 4O03A 1UVPA 2ANKH 3GY8A 5ESTE 3VG8A 1MH0A 5EXMA 2FOBA 1O3EA 4B6FA 4I31A 2Y5HA 2G8TA 2GDEH 1FONA 1ZZZA 4A6LA 1FLEE 3TU7H 2AH4X 2BB4A 3B9FH 1BRUP 1WYKA 3EYDA 1BMFD 5DP9A 3U8OH 3TK6A 1ZPZA 3MYWA 3C1KA 1KIGH 2FTLE 2ZDKA 2ZDAH 1HYLA 1O2QA 1SI5H 1SSXA 1C1WH 3SV9A 1GBCA 4B6EA 1O2RA 1F0SA 2W3KA 3NCLA 4E06H 2EA3A 4CRAA 4WJG2 1QRZA 3EE7A 1HAYB 3ZZ4A 5CE1A 2EY4C 1MUEB 1KDQA 3OY6U 5F8TA 4XBCA 2VIPA 2ZF0H 1T32A 3Q76A 4CRCA 2WUCA 1RGQA 1PFXC 4R0IA 3EA9A 2PR3A 2GX4A 1H8ED 4ABFA 1CQQA 2G4TA 3ZZBA 3ZZ8A 2HALA 1NPMA 1QBVH 7ESTE 2JH5D 1Y3UA 3MO3A 5E0GA 4GPGA 3MH7A 2STAE 4K1TA 2VH6A 3PV5A 4ACAA 1C2JA 2WYJA 1HJAB 1JXPA 3ATIA 1MTSA 2BDBA 2DUCA 4RT0A 1F7ZA 2RG3A 2BQ6B 1Z1IA 1PPGE 1DVAH 4B76A 3NXPA 1Z7KA 2O8MA 1G3BA 2WV9A 2QV1A 1XUGA 1JIRA 3D23A 3RXBA 4ZROA 2J95A 1J8AA 1INCA 1ESAA 3BTHE 1QBOA 4X6MA 3ATWA 5TCAA 2ULLA 3KQCA 1O3HA 4ISLA 5EJLA 2XC4A 1AVGH 1THRH 2QF3A 2KCAA 1TONA 3SV2H 1OP8A 5A8XA 1KY9A 1E37B 4CR5A 1JOUB 1U6QA 1GVZA 1SGCA 3PMAB 1ZRBA 4NFEA 4X2VA 1OOKB 1TGCA 2ZIQH 5C0TA 1V2WT 1ANDA 1C1SA 1O2TA 3F9HA 2Y5GA 1UTNA 2PHBA 1JBUH 3E3TA 4MVNA 3GY2A 4XD7D 2ZCHP 4NA8A 1YCPK 1C1OA 3ZZ6A 1T8OA 1NRNH 3AW1A 1OYTH 1O3PB 2GCTC 3TGIE 1P3EA 1IQGA 4DVAU 4YZUA 3RU4E 1SLUB 5C1YA 2VWOA 5KEDA 3U28C 1CU1A 3QWCH 4ZH8A 1GBJA 1P2JA 1OKXA 3DSPA 5HMAA 2ANWA 4Z6AH 4NIVA 2Z9GA 3DSOA 1BRAA 3DA9B 2ZGHA 5A09A 1O3DA 1AB9C 2KX4A 2ZKSA 4IC6A 4WVPE 3A8BA 1GMDG 1GL0E 1BZXE 2KAIB 3MNCA 4OM9A 3VB7A 1AZZA 1NU7B 2EEKA 3ZIAD 2HPQH 3RMNH 1F92A 3MU5A 4UDWH 1YP9A 1QL9A 3SJ9A 1NC6A 1T8LA 1H9LB 4JZEH 3S9CA 1MTNB 2KM0A 3SUFA 1C2IA 2A2QH 1ABIH 1XVMA 2I6SA 1C5VA 4D8NA 4GCHF 1XUJA 2R0LA 4F49A 5L30H 3T26A 4A1XA 1QB1A 3UQVA 1K28D 5T3HA 1S0RA 2AS9A 2HPPH 3ATKA 2UUJB 3M5OA 2DE9A 1SHYA 1FY1A 4FUFA 4E7NA 1PPEE 2PTNA 1BTYA 3K2UA 1ELDE 4GLYA 5EXLA 5DJ7A 1LHDH 4A92A 3KF2A 3SN8A 1FY4A 2IOTA 1DOJA 3P8FA 5A0CA 1AHTH 4UFDH 2EI6A 1F0RA 5HM2A 2O8LA 4E05H 2ZFPH 1MTNC 4YOIA 2GZ7A 3QZQA 2BZ6H 1YC0A 2AMQA 3GDUA 5T6DA 5C20A 4LK4A 2QCYA 3TLOA 4AGKA 1UO6A 1M9UA 4MQAA 1QJ6B 1WAYB 1IQJA 3KYGA 4IGDA 5C1UA 1WQSA 5A8ZA 1AVXA 2HVXA 3M3SA 3BG4B 1C5QA 2C8ZB 3SNDA 2R9PA 2XC5A 1Y5BT 3FP6E 2Z7FE 1A2CH 1UK3A 5L6NH 1XUHA 2UUKB 2FLBH 1FQ3A 1QRWA 1AI8H 4J1YA 1MBMA 4WWYA 5TJXA 3TH3H 1A4WH 1V2TT 2ZHEH 4ZUHA 2ZQ1A 1DLKB 3RLYH 3TJUA 3O8BA 1P0SH 3SUDA 5C3NA 1P12E 2GD4B 1B5GH 1ELTA 5FCRA 1C2LA 1H8HD 2JDID 3VB6A 1FV9A 5CHBA 1W7XH 4MNYA 3V0XA 4NGAH 2PKAB 1BTXA 1AO5A 1UTMA 3KHVA 1DSTA 1W10U 1P06A 2V7QD 5IDKA 1IQEA 2SNVA 3BTFE 3BTKE 2A7HA 7LPRA 3K6ZA 1C9TA 1MABB 1O2LA 3FFGA 4YT7H 1C5UA 2GZ9A 1BRBE 6LPRA 3CENA 3VGCB 1V2VT 2GDDA 3F2GA 4X1QU 1O3IA 2KZ4A 4BAQB 5LPEA 1LPGB 2IPHA 5JDUB 1UTKA 3OY5U 8LPRA 2RA0A 3A7VA 4FUGA 2BQWB 1RTKA 1VJAU 2A4OA 2F9BH 2Q1JA 1P8VC 1O31A 2SNWA 2ZPSA 2P8OB 1HJ9A 2ZCLP 2FEQH 1BRCE 3V3MA 2XBWA 3HKIB 2O8WA 1TNGA 3PMHB 3FP8E 4I8KA 1TNKA 1YPLH 3WW7A 5HXFA 3NK8A 1V2PT 5HIYA 1VITF 1NS3A 4FU9A 1V2NT 3WY8A 3SZNA 1BT7A 1UCYH 3KL6A 2VGCC 2ZU1A 4UE7H 1E79D 1SFQB 2IPQX 1KTSB 1MKXK 1UTOA 1HAGE 2ZG0H 1O2MA 2PFEA 1C2GA 3TNSA 3W1EA 1O35A 2CHAC 2I6QA 4D9QA 3ZVEA 3ZVGA 1GI1A 3NKKA 4UONA 4JZDH 1ELBA 1YWUA 3HKJB 2AGIX 1AUJA 5DP3A 1QY6A 4IMQA 1Y3VA 1O3BA 3F2HA 3ATLA 1DXPA 1UCYK 1GI4A 1H8DH 1KXDA 3SO3A 3MH5A 2WINI 1GI9B 2BLQA 2W6JD 2V3HH 1RTFB 9LPRA 5JYIA 2FESH 3LH3A 4ZKNU 1A3BH 5HGGA 1L4ZA 3ZV8A 1LKBA 1ZTKA 2BD2A 4ACBA 1W0YH 1W13U 2QC2A 1SVPA 2G5NA 3OX7U 1C9PA 1L1NA 1Q2WA 4HTCH 1PPZA 1G3CA 2L6OA 3SNCA 1FJSA 2CXVA 2ZHDA 1HXEH 1OX1A 5LPRA 3MU4A 4FETA 2QF4A 4A1VA 2FMJA 1ETSH 1P02A 2ZTZA 1FN8A 3VEQB 2CF9H 4KELA 2ZU2A 2G5VA 1GHBG 1PPCE 1RTLA 3V12A 1P57B 1W8BH 4FUIA 1D4PB 2C3SA 1E0FD 3R0FA 3SQEE 3TITA 1Z71A 4E7RG 3RUOA 4CRBA 1ANBA 1TLDA 1YLDA 4CBNA 1MTVA 2WPKS 4HI3A 2BD3A 5B6OA 2F9OA 1P2QA 2OINA 2R3YA 2H1UA 1GJDB 3HK3B 3A88A 1C5ZB 1S0QA 2FX6A 2NU4E 3RDZA 6CHAB 1TX8A 2ZGJA 3GY6A 3SGQE 2W7UA 3SJOA 5EPYA 3S9BA 1ARCA 3MWIU 2CJIA 3RXMA 2PGQB 2CGAA 4BTIB 1VKYA 2VIDA 1SHHB 3RC4A 1GMCF 1J9CH 1EZUC 1OPHB 3BTWE 4KTSA 1ANCA 5JB8S 3LGWA 1K22H 2FOCA 4FUBA 1SB1H 1F0TA 4NSVA 1NRQH 2LP6A 4YOJA 1ZHMA 2SGQE 5I25A 1AMHA 1N8OB 3N7EA 3RXPA 4RI0A 1PPBH 3O8DA 2FM2A 1O2JA 4I8HA 4K69A 1JRTA 1EPTA 3SHCH 1ESBA 1YBWA 2EI8A 2UWLA 3TJVA 3KEEA 5FX5A 1IOEA 1FY3A 4Q63A 4B74A 4ZHLU 1O5DH 1ELAA 1KYNA 3SU6A 2YNAA 1SGDE 1AWFH 2A0QB 2GJGA 2VVCA 2ZU4A 1O2NA 4IS5A 1O2HA 2AHME 2D2DA 3GCHC 1ESTA 1EP6A 1VJ9U 1CA0B 2FOAA 5F53A 1GHYH 2OCVB 2XRCA 4INHA 3GY3A 1AGJA 2HOBA 2IN2A 1BOQA 1JIMA 3QX5H 2JJ1D 5FBEA 4NSYA 2JH0D 5TCCA 1G3DA 4UD9H 4LOYH 3IITA 1V2MT 1F0UA 3KIDU 1V2JT 2HNTC 2ESTE 1GHXH 3I29A 4TPYA 1P9SA 2FI4E 1YLCA 2XBYA 1GJ4H 2SGFE 4UEHH 2JIZD 1GJAB 1L2EA 2KAIA 2B0FA 4BOHA 7KMEH 1P2MA 1H8IH 1LTOA 1C5SA 3RXAA 4WXVA 2NU0E 5CMXH 2TRMA 1SOTA 3LGUA 3VPKA 2W26A 2GMTB 4AYYB 5C1XA 1GHAG 1KLJH 3SI3H 2ZZUH 1VGCB 1V2KT 1MCTA 2BXUH 1TNIA 1PPHE 1FAXA 3E0NB 2GV7A 3I78A 3F0OA 3H09A 1O32A 3F6UH 1ZGVA 4FUDA 1UK2A 4FUJA 3MNBA 1GL1A 2BY6X 3MOCA 1RFNA 1SGEE 3LOXA 3U1JB 3BIUH 1UCYE 1FZZA 3F2FA 3QK1A 1G36A 2K8IA 3ODFA 2OBOA 1F5LA 2VB0A 3FZZA 1ZOMA 5EJZA 2PKSC 2D1JA 2FODA 3QTOH 1V6DA 2WPLS 2JJ2D 3PMBB 3OTPA 3VB4A 3BEIB 1C2KA 1EX3A 4J2YB 1HV7A 1BBRK 4CBOA 3TH4H 1OP2A 2W3IA 2ZDMA 1PPFE 3A89A 1G32B 4NA9H 4GCHG 1UVTH 4B73A 1C5OH 1BHXB 3KQBA 3B8JA 4XBBA 3PLPA 7GCHF 1YY3A 2HNTF 3V7TA 2IJOB 4THNH 1HAHH 1L1GA 1CT0E 1TALA 3ZVDA 2PWXA 4GAWA 4DIHH 1KXEA 1LQDB 4Y0YE 1C1RA 1ZSLA 4DCDA 2WHXA 3ZZDA 4BAHB 2G00A 2PKSB 1S85A 4X8SH 4FXGH 1P9UA 1EPTB 2AIPA 4FVBA 4HG6A 1NT1A 1GHAF 2TGTA 1K1IA 1THPB 4TY6A 3M61U 1P10A 1NFWA 3E16B 3L3TA 4X2WA 5GDSH 5EXNA 1P2NA 4XSKU 1IQFA 3EE0B 1GMCG 1WXRA 4JK6A 2BX3A 5K0HA 2G4UA 3IWMA 2BMGB 3OE7D 2BOHB 4FU8A 4ABHA 4DIIH 3RC5A 4I8LA 3SJKA 1GG6B 2F9VA 1C1TA 1O3CA 1TIOA 1OP0A 3QUMP 5CHAB 1FDPA 4LZ4B 1DANH 1SGFG 2Q6FA 2LNCA 4B71A 4X1NU 2G55A 2FOEA 1DWEH 3A7TA 4ISIH 2EC9H 1CBWC 1P2IA 4X6NA 1NO9H 1C2HA 2YNBA 3UUZA 3DD2H 5C5NA 2Y80A 2XNIA 2BVXH 1EJNA 4ABBA 3RXSA 4INLA 1O39A 9ESTA 1KXCA 1SLWB 4ASUD 1G2LA 1O0DH 4I33A 3LC3A 4TWYA 4AFZA 4MNVA 2YMSB 2H9HA 1TOCB 1CGIE 4BXWA 2H5CA 1F5KU 1ETRH 2QN5T 5HM9A 3PB1E 1OWEA 2ZFQH 2CK3D 1AFQC 1ANEA 1O2KA 2A7CA 2Y6TA 4NIYA 1MTWA 4H4FA 1ELVA 1GVLA 1THSH 1YCPH 1D3PB 2C90B 3BTQE 3LH1A 2Z9KA 2A7JA 1C1VH 1KXBA 3PYHA 3M7TA 2ZFTA 3W94A 3RXOA 4DG4A 4SGBE 3SOSA 1UTQA 4CREA 1BMAA 1T8MA 1LHGH 1GJCB 5E8EH 1ELCA 4TWWA 2J34A 3LGIA 3SUGA 1TRNA 3R3GB 5AFYH 1LQEA 1E34B 3TK5A 3ZYDA 2M2AA 3UNSA 3TNTA 2P3TB 3KN2A 1KMHB 2GP9B 4JYUH 2ZPQA 4XOJA 1TAWA 5GNDA 1SKYE 3RM0H 1W0KD 1HXFH 4TSFD 2AGEX 5SGAE 1C2EA 1NFUA 3KQDA 1UTJA 3CNRA 1O30A 2ZTYA 5PTPA 1TGTA 2ZP0H 3MNXA 1C4Y2 2R2MB 1K1JA 1XX9A 2FXRA 3TPIZ 4D7GA 3ODDA 3UR6A 1V2LT 3QN7A 1QFKH 1SPJA 2PW8H 3GY7A 5HIZA 4K1SA 1FPHH 1PJPA 1HRTH 2V3MA 3WWBA 2PLXA 5FPSA 4Y0ZE 1SGIB 1TGNA 4YLUA 1BHXF 1GI2A 1TBRH 1XXFA 5G4BA 2BXTH 4YTAA 2FWWA 4DGJA 1Z8GA 4WMDA 2PSYA 4Q80A 1SMFE 3LIWA 2YOLA 4WMEA 3D65E 3UFAA 3SU5A 5KECA 3GCNA 1PQ5A 3QZRA 3PO1B 1NY22 3S0NA 4F55A 4Q7XA 2WPHS 4MPWA 2XWBI 1C5YB 1TX6A 1SGRE 1GVKB 1SFIA 1G2MA 2XCNA 1ELFA 2H5DA 2NU2E 1NU9A 1YYY1 2WPDD 4TPIZ 1HJ8A 1O3FA 3FKSD 1VITG 1ZMNA 3DSGA 4XRNA 1YM0A 1TPAE 3BTDE 4ZCNA 2V6NA 1GDUA 2QA9E 1O5BB 4CRDA 5HYOA 2TBSA 4KGAA 3MI4A 4R8TB 1LHFH 2Q6DA 4A1TA 1QQUA 3AASA 2F3CE 2J4IA 4ISOA 3SNAA 3T28A 5C5OA 4RSPA 1GHBF 1MD8A 5AFZH 4AX9H 1QA7A 3JZ2B 1EZSC 4Y8YA 5KGOA 3VB5A 2FI5E 2THFB 5EGMA 1QL8A 1GBBA 2UWPA 2J94A 2FTMA 5EG4A 1XMNB 2G52A 3LGYA 4TYDA 2PKAA 3MH4A 5GCHG 3Q3YA 1FX0B 1A1RA 1GJBB 4LXBH 4U01A 3RP2A 1QIXB 2R2WU 3SU0A 4ABAA 4ZHMU 1BTPA 1SR5C 3SZEA 1GBIA 5DGJA 5FHTA 1E1QD 1N8OC 1W2KH 3QO6A 1C2MA 1S82A 1TBZH 3OSYA 1DT2A 5EOKA 3NPSA 5A2MH 1A5IA 2F83A 4MPXA 3QDZB 1DY8A 6GCHF 1T7CA 3W95A 2P94A 1EATA 4KKDA 3CS7A 3PM3A 1FN6A 5EU8A 1ID5H 1GWAA 1HDTH 1S83A 3TH2H 1H1BA 3ENSB 4O3UA 1T8NA 1UTLM 2TPIZ 2OK5A 3ZVBA 5GXPA 2OP9A 3AVZA 5FCKA 1AWHB 4U30A 4AGJA 2QY0B 1D3TB 1O2XA 3UWIA 1TBQH 2F9UA 1EFRD 1QURH 3PV2A 3GISB 4AFSA 3MMGA 2FOGA 4OS2A 2VGCB 5EQSA 1OWDA 5LH8A 1N1LA 1XKAC 3RXFA 1KTTB 3ZZCA 3AAUA 1GHVH 3NZIA 2DE8A 3ATMA 4X8VH 1G9IE 5E2PA 1DE7H 3N99A 4NA7A 1ZSJA 1HJAC 2BD7A 4MDSA 1MBQA 2Z9IA 2CHAB 3A8DA 1W7GH 2C8YB 4YO9A 3K65B 3SNEA 3A7WA 3U98H 2ANYA 2FYRA 5L2YH 1GBTA 3SNBA 2Z9LA 1QRXA 4AFQA 1GBLA 3TIUA 5AHGH 1JWTA 4YOGA 4O97A 1AY6H 1AIXH 1HLTH 1BTUA 1C1PA 1RIWB 3BG8A 2OD3B 3PMJA 1EZQA 3SU3A 1EQ9A 2CF8H 3FVFB 4NG9H 3PLKA 1GJ7B 1HAVB 2VIOA 1TQ7B 4B75A 1PQ7A 3BEUA 4AC9A 1DLEA 1L1JA 1HAOH 5BRRE 2VWNA 4K60A 3SU1A 4NWLA 1QBNA 4IN1A 3ZVAA 1O3GA 2XNDD 2FDAA 3PV4A 1K0HA 3VXEH 4FUCA 1SC8U 4Q4LA 3UQOA 1K1PA 1EZXC 1DITH 1ZLRA 4B1TA 1QZ8A 5T1VA 1Y3WA 2PUXB 1ZSKA 2ZU3A 3RXJA 1CHOF 3EA8A 3MO6A 3SW2B 3T62A 3TGKE 1D6WA 2FIRH 1GBHA 2BTCE 3GCHB 4ZHAA 3HGNA 2ZCKP 1GHZA 4NWKA 3P6ZB 1O5EH 1Z8RA 1QQ4A 4DT4A 2BHGA 1ZJDA 4BANB 1EB1H 1O2WA 1RIWC 3BTME 4K8YA 4P02A 4DT7B 2FS9A 4AOQA 4GUXA 4ABDA 2Z3EA 1O3NA 3PWCA 2OXSA 2HGTH 3MU0A 4I8GA 1GCDA 3RXKA 2VH0A 3A82A 3TVJB 2TGAA 1W0JD 1SG8B 1HAIH 1O2YA 3URCA 5A8YA 2ANMH 1GGDB 3E6PH 1QB9A 3IG6B 1SGPE 1HGTH 1HFDA 1WQVH 4AZ2B 4Y8XA 2VVUA 1S81A 3OTJE 1TFXA 3A81A 1EJMA 2BVSH 4JYTA 2OBQA 2GTBA 2B9LA 1CSOE 1A46H 2A5AA 4K2YA 5DP5A 5B6LA 2BZAA 3I77A 2G51A 1BMMH 1WCZA 2XCFA 1IHSH 1TWXB 1CHOG 4H42U 3H7TA 2A45B 4X0WU 2ZA5A 4MNXA 4I86A 5DN6D 2M5TA 3OU0A 1BUIA 2VU8E 5ETXA 4X6PA 2WPIS 3DT0H 1TPSA 1C1MA 1NRPH 3SYJA 2ZU5A 1EP5A 2FP7B 1VCQA 4AG2A 4CH8B 2XTTB 2H9EH 2GCTB 2FOFA 1A61H 4INKA 7GCHG 5L2ZH 4WY3A 1ORFA 3GYLB 3LGVA 4OS1A 4YESB 1D9IA 1LMWB 5C67A 4DW2U 2ZQ2A 2SGDE 2BX4A 3UOPA 3D49H 3FP7E 1CGJE 2BY9X 2GMTC 4ZKSU 3MU1A 1SGTA 2A2XH 3UOUA 3N7DA 1Z8IB 2ODPA 1O2OA 3VXFH 1O34A 2D26C 4ZKRU 1K2I1 1AB9B 2ZDLA 3F1SB 1Z1JA 4FOUC 3V13A 4NFFA 1W0ZU 2ZDNA 4NZQA 1P2OA 3LDXH 3MTYA 5DPAA 3ITIA 3U9AH 1IHTH 1O5FH 1E1RD 3EQ0H 2GZ8A 4B2AA 1Q3XA 1TMUH 4Z0KA 4AB8A 1KDQB 1OYQA 8KME2 2H2ZA 2ZFRH 6GCHG 1S84A 2TGDA 1H4WA 4CR9A 1HIAB 3FOAA 2SGEE 1BTZA 2WZQA 3Q77A 5T6FA 1A0JA 3M7UA 3O8RA 2FOHA 4AYVB 1BA8B 2GV6A 4X1RU 2FO9A 1L4DA 4GHTA 3RMLH 3M35A 3OFND 1YPHC 1SL3A 1O2IA 4JMYA 1E38B 1QTFA 1CE5A 3F3BA 4WMFA 3S7HB 4FUHA 4CRFA 1A5HA 3EAJA 2RDLA 4MG3A 3ZZ7A 3SUEA 2P59A 4ZXYH 1FY5A 3K6YA 5A0AE 3A8CA 4WH6A 3BTEE 4H6SB 1QCPA 2RDEA 1CO7E 1FAKH 1HPGA 2B7DH 1FUJA 1TGBA 2OC7A 2PP6A 2WPJS 4HFPB 3NWUA 1H9IE 5IK2D 5GCHF 4Y10E 1VGCC 1ZPBA 5F8ZA 1NBME 1O3KA 2HRVA 5A0BA 2GVFA 4DURA 1YPGH 4AN7A 3L33A 1D3QB 5E0HA 3LJOA 2AMPA 1BMNH 1WTGH 4DJZB 1TQ0B 2FPZA 1K9OE 2B5TB 1XUFA 3UWJH 5LPFA 1GBMA 4D7FA 4A5TS 1LPKB 1BJVA 2BDAA 2SGPE 4O3TA 1UW7A 2TIOA 1Y3YA 3Q3KA 1MZDA 4TT3D 4NIWA 5DP6A 2PUQH 1KLIH 1V3XA 1GCTB 1BQYA 1SQTA 2WV4A 1CVWH 1G30B 3SORA 1TMBH 1AE8H 1A5GH 1AFQB 3VB3A 4MNWA 1WU1A 5ESBA 1C1UH 2P16A 1DWCH 4IBLH 2WV5A 2H9TH 1BDAA 2HLDD 1ZR0A 1WBGB 4NCYA 1GI5A 1VR1H 5GWZA 1C5XB 5FX6A 3H5CB 3QTVH 2ZGBH 4Y6DA 2J97A 2VBCA 1QGFA 3AW0A 5FAHA 3EGKH 3H7OA 4BNRA 3PTNA 4X2XA 1UVSH 3BV9B 1C5NH 2VWMA 8GCHG 3L6PA 1DS2E 1FY8E 2AEIH 1FXYA 4A7IB 1B7XB 1VITH 3KYFA 2QXJA 3SV7A 3EDXB 1GJ8B 1BBRH 3F0PA 3A7XA 2L74A 3STJA 4IC5A 3UR9A 1WSSH 4U32A 1BTWA 1RJXB 3KCGH 1CA8B 3E90B 1YGCH 1LO6A 2Q6GA 2F4LA 2QE7D 3CS0A 4FUEA 1Y5UT 2EQNA 4RT1A 1GJ6A 3P17H 2VNTA 3FAOA 4MPUA 3TGJE 3PTBA 5F03A 1GMDF 2KFWA 1MU8B 1DWBH 2SGAA 4X1PU 1EAXA 5JB9S 5EW2H 3UPEA 3LU9B 1KXFA 2BD9A 1UK4A 3LPRA 4JCNA 1P11E 2B8OH 3UIRA 3GDSA 3RXVA 1B0EA 2ILNA 2FYQA 1NZQH 4BTUB 5J4SA 5EQQA 4I7YH 3O8CA 1GI8B 1ELGA 2BY5X 4JZ1A 1SGNE 4VGCB 3RXEA 5JBCS 3RXCA 3UB0A 2QIQA 3BEFB 2JH6D 2VIQA 5DKMA 3P70B 1MAYA 1VCWA 1VZQH 1TPOA 1XUKA 1WOFA 5LGOA 1AQ7A 1D6RA 1AVWA 3T2NA 3FZDA 2O8UA 3MFJA 4ZMAH 2R3UA 4AFUA 4ISHH 3A80A 3HPTB 4MPVA 3BSQA 1O2SA 3BF6H 2Y5FA 5FXLA 1ZGIA 1AFEH 3ZZ3A 1P09A 8ESTE 1XUIA 2OUAA 4WH8A 3PO1C 2CMYA 1C5PA 3GY5A 1QL7A 4MTBA 2RFKC 5EW1H 1QR3E 2QXHA 2VWLA 4F48B 4D76A 1C5LH 2J9NA 3E0PB 3JZ1B 4Q7YA 4VGCC 3MQKC 1AZ8A 4Y8ZA 2FLRH 1S6HA 4UFEH 4AG1A 1YPKH 2QXIA 4P00A 4WF8A 2J98A 4ZAEA 1GPZA 1O5CB 3DCLA 1Y59T
chains in the Genus database with same CATH topology
2J98B 5C94A 3EE7A 1UW7A 2J97A 5HIZA 5HIYA 2J98A 1QZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J98 B;  5C94 A;  3EE7 A;  1UW7 A;  2J97 A;  5HIZ A;  5HIY A;  2J98 A;  1QZ8 A; 
#chains in the Genus database with same CATH topology
 3T29 A;  2ZHQ H;  2ZGC A;  1HAX B;  1P3C A;  3RXT A;  3P8G A;  2HNT E;  5EQR A;  3LC5 A;  2FX4 A;  1GBD A;  2ASU B;  1TGS Z;  4K1E A;  1MCV A;  1SBW A;  1MAX A;  1YPH E;  3RXI A;  1LHE H;  3CP7 A;  2BDC A;  1Z6E A;  1UHB A;  4ABE A;  1LKA A;  1J15 A;  3U8T H;  1OSS A;  4Y11 E;  2G81 E;  3UNR A;  5E0J A;  4YXW D;  2BDH A;  2BM2 A;  2BYA X;  4GHQ A;  1O36 A;  1TNH A;  3OAA D;  1S6L A;  4Q7Z A;  3RXD A;  5JBA S;  2P8O C;  5EOD A;  3T27 A;  1TNL A;  3OEH D;  2A1D B;  2C4F H;  1YPM H;  1CHG A;  1GJ5 H;  4K8B A;  4NIX A;  2HLC A;  1FIZ A;  1WDI A;  2O8T A;  1EAS A;  3WWF A;  2ALV A;  1Q31 A;  6CHA C;  1CA0 C;  2P3F H;  1WTH D;  4SGA E;  5EJ1 A;  1OHH D;  2ZNK H;  1UMA H;  4Y7B A;  2QF0 A;  2HVY B;  1LHC H;  2D8W A;  1OS8 A;  3F9F A;  1HNE E;  2ZHF H;  1Y8T A;  1FMG A;  2PTC E;  3ZVC A;  2BY8 X;  6EST A;  1A7S A;  2OQ5 A;  1ZHR A;  1UVU H;  5EIY A;  3UAI C;  4H6T A;  1C5T A;  1GGD C;  2A4G A;  2BOK A;  2Z3D A;  2EI7 A;  1Z6J H;  4X8T H;  1MTU A;  1MKW K;  3T25 A;  4RN6 A;  4OS6 A;  1C1Q A;  1TNJ A;  1P04 A;  2BDI A;  4ASH A;  2W7S A;  3FN8 A;  1LVB A;  2ZDV H;  1T31 A;  2ALP A;  5DP4 A;  4KTU A;  1C5W B;  1NBM D;  2ZC9 H;  4CH2 B;  2UUF B;  3UY9 A;  3GS9 A;  1K1M A;  1WV7 H;  2XBV A;  2GT8 A;  5AVD A;  1O3J A;  1F2S E;  3RXU A;  1TB6 H;  2ZO3 H;  3TJN A;  1DIC A;  2F91 A;  1SQA A;  2F43 B;  1AN1 E;  1UJ1 A;  1W14 U;  1ABJ H;  2CV3 A;  1NN6 A;  1B0F A;  1L0Z A;  1O38 A;  1HCG A;  2QF5 A;  1AKS B;  4FU7 A;  1MKW H;  2RA3 A;  4JZF H;  4KP0 A;  3SU4 A;  1YPE H;  1N6X A;  5EPN A;  2A5K A;  3ZYE A;  1V2S T;  1NTP A;  4I8J A;  3T5F H;  3U1I B;  1AU8 A;  1OWI A;  2Y82 A;  2XWA A;  3S9A A;  1QJ7 B;  1DXW A;  2CN0 H;  1C2F A;  3BTG E;  1DFP A;  5I46 H;  3MO9 A;  2NWN A;  1K1O A;  2K1Q A;  4ABG A;  1OWK A;  5J4Q A;  3FAN A;  1DY9 A;  1HIA A;  3KGP A;  3SU2 A;  3LKW A;  2VIV A;  5T6G A;  2PV9 B;  2P93 A;  2HWL B;  2XBX A;  5FBI A;  1AE5 A;  3M5L A;  1FI8 A;  2BD5 A;  4WXI A;  5DK1 A;  5JPM H;  3RU4 T;  2V0B A;  1EJA A;  2A4Q A;  3F9G A;  1EUF A;  1FNI A;  3NRL A;  1EAU A;  2ZFF H;  2Z6B D;  1TYN A;  4BXS A;  3M7Q A;  2A31 A;  2AER H;  2XYA A;  1D3D B;  3A7Z A;  2XXL A;  3LT3 A;  2A5I A;  1TE0 A;  2AIQ A;  1GDQ A;  1O2P A;  1W12 U;  5C94 A;  3E91 A;  4XFQ A;  1O2Z A;  2BD8 A;  1RS0 A;  2UWO A;  3TK9 A;  3URD A;  1LDT T;  1C5R A;  3E8L A;  1MQ5 A;  5BPE A;  2XC0 A;  3PRO A;  1E35 B;  1FPC H;  3M3T A;  2ZGX H;  1KXA A;  1GHW H;  1NES E;  2OC0 A;  3GYM A;  1KLT A;  1QNJ A;  4GVU A;  2J92 A;  3SV8 A;  3DFL A;  4M9F A;  1MMJ N;  1DPO A;  2K0Q A;  3ELA H;  2XOK D;  3RC6 A;  2FI3 E;  1SLV B;  4U2W A;  1AUT C;  1P03 A;  4UFF H;  1IQH A;  1EOL A;  2QXG A;  1EOJ A;  1NFY A;  2KCP A;  1EB2 A;  2Z94 A;  3BG4 C;  1G3E A;  3RXG A;  3A84 A;  3SJI A;  3ZZA A;  1MZA A;  2J5U A;  1RRK A;  1AD8 H;  1O3L A;  2JKH A;  1N6Y A;  2C8X B;  4OS4 A;  3QLP H;  3M5N A;  3URE A;  2ZPR A;  1SQR A;  1QJ1 B;  4UFG H;  5C2Z A;  2V3O H;  1UVO A;  1GDN A;  1NRO H;  3KQ5 A;  3E1X B;  3ZV9 A;  3SBK A;  4B2B A;  1YLN A;  1O33 A;  3MU8 A;  1MQ6 A;  5C17 A;  3EST A;  3ZVF A;  3ZZ5 A;  2A4R A;  1AKS A;  2Z3C A;  2ZEB A;  1KSN A;  4OGX A;  3S69 A;  2NU3 E;  2PGB B;  3SGB E;  1YCP M;  3FO8 D;  5DSF A;  4EST E;  1T4V H;  1G37 A;  1BBR E;  1BB0 B;  1OWJ A;  2YMS C;  2O9Q A;  3A85 A;  1Y3X A;  1HUT H;  1MD7 A;  3VGC C;  1BJU A;  3AK5 A;  3HK6 B;  1EPT C;  1IAU A;  1IQM A;  5JBT A;  4CHA C;  2LPR A;  1UHB B;  1K1L A;  2ODY B;  2SFA A;  1QB6 A;  4CRG A;  1WUN H;  3GY4 A;  2C93 B;  3F68 H;  4RKO B;  1JRS A;  1MU6 B;  2Z9J A;  1RD3 B;  2BLW A;  2BQ7 B;  3HAT H;  2ZHW H;  4IW4 E;  3LGT A;  3GDV A;  4ISN A;  4ZKO U;  1ACB E;  1LVM A;  4XDE A;  2OC1 A;  1GBE A;  2AMD A;  1J14 A;  3MH6 A;  1GI0 A;  3GIC B;  1ELE E;  5FPY A;  1O2V A;  3Q00 A;  1PYT D;  1GJ9 B;  2ZFS A;  3SQH E;  3GOV B;  4ABI A;  2V35 A;  1O5A B;  1O3A A;  3SGA E;  3HGP A;  5GJ4 B;  3D62 A;  3GCT G;  1DUE A;  2GGV B;  1JMO H;  4AB9 A;  1ZYO A;  1GBF A;  1CGH A;  3P95 A;  3DFJ A;  3MHW U;  1P05 A;  1CBW B;  3PLB A;  4Y71 A;  5ABW A;  4CHA B;  1V2U T;  2W6I D;  1IQI A;  3A7Y A;  3EA7 A;  1HAV A;  2STB E;  1BCU H;  3NUM A;  1V2R T;  1QHR B;  1NFX A;  5FL7 D;  1GBK A;  1GI7 B;  1DSU A;  4Y76 A;  3MNS A;  5E2O A;  1EAI A;  1T4U H;  1H9H E;  4X6O A;  1DX5 M;  1V2Q T;  1BIT A;  1NM6 A;  3A86 A;  3OYP A;  3Q3X A;  5DO4 H;  2ZEC A;  5H4I B;  1V2O T;  4XBD A;  2KR7 A;  3QGJ A;  1C4V 2;  1TA2 A;  1TAB E;  3GCO A;  1ZJK A;  4MLF B;  1ETT H;  1FIW A;  1GI3 A;  1PYT C;  1QA0 A;  1OXG A;  1A0H B;  2J2U A;  1SLX B;  1O5G H;  1MKX H;  1XVO A;  3DHK H;  2QGR A;  1Z8J B;  2OTV A;  4BAK B;  4GSO A;  1HAZ B;  1EXF A;  1BML A;  5FPT A;  5AF9 H;  1E36 B;  4OGY A;  2J98 B;  4IN2 A;  3RLW H;  1W3C A;  2AGG X;  1ZHP A;  3C27 B;  4JK5 A;  4X8U H;  4XE4 A;  1J16 A;  1VCP A;  3QGN B;  4M7G A;  3STI A;  1O3M A;  3SI4 H;  4KTC A;  1TA6 A;  4DY7 B;  2W5E A;  1XKB C;  2BLO A;  4BTT B;  3S7K B;  2P3U B;  3P92 A;  2ZWL H;  1GCT C;  4IMZ A;  3M37 A;  2AFQ B;  2FZZ A;  5GIB A;  1K21 H;  1P01 A;  3GCT F;  2FOM B;  3P8N A;  1ZRK A;  3RXR A;  2GCH G;  3A8A A;  4JYV H;  8GCH F;  1LPZ B;  1LVY A;  4LZ1 H;  1IQL A;  4TY7 A;  3PRD A;  2F9N A;  5GPI B;  4OS7 A;  4FVD A;  1COW D;  1ZPC A;  5DP8 A;  3AAV A;  2JET C;  2FS8 A;  1TMT H;  4YM9 A;  1O3O A;  2IJD 1;  1GG6 C;  3DUX H;  4Y79 A;  1S5S A;  2BDY A;  4X2Y A;  1A0L A;  1F5R A;  2ZI2 H;  1J17 T;  3M36 A;  5CHA C;  1SGQ E;  1DM4 B;  1NRR H;  3A83 A;  1A3E H;  1ARB A;  1IQN A;  2VIN A;  3U8R H;  2PSX A;  2WSS D;  5F6M A;  5HKK D;  1C2D A;  1ZTL A;  3RU4 D;  2WPM S;  4QT8 C;  3ZZ9 A;  2KCO A;  1X7A C;  3U69 H;  1IQK A;  2OC8 A;  4ZXX H;  3SJ8 A;  3RXQ A;  2QYI A;  2YMS D;  3PRB A;  2UUY A;  1S6F A;  1SOZ A;  1O37 A;  1HAP H;  2TGP Z;  1TOM H;  1HB0 B;  1ZML A;  5DP7 A;  5CDF E;  2ZTX A;  1C4U 2;  3LJJ A;  4JZI A;  5IYT A;  2LEL A;  2F9P A;  1XXD A;  1HBT H;  1PQ8 A;  4PRO A;  2VVV A;  1NRS H;  3OEE D;  3BTT E;  4O9V A;  1ZTJ A;  4RKJ B;  1CT4 E;  4YT6 H;  2JET B;  2GT7 A;  1C5M D;  1DDJ A;  2BVR H;  1TRY A;  2BY7 X;  2GCH F;  3P8O A;  2XW9 A;  3TJO A;  1ZMJ A;  3K9X B;  2Y7Z A;  3N7O A;  3KNX A;  1Y5A T;  1W11 U;  2BDG A;  3RMM H;  1GBA A;  4X1S U;  4NZL A;  3SHA H;  1P2K A;  2AYW A;  3UTU H;  1TRM A;  1K1N A;  1O2G H;  4YLQ H;  1DWD H;  5JBB S;  2WUB A;  3SV6 A;  1YPJ H;  1SQO A;  2H6M A;  3B23 B;  3BIV H;  1GI6 A;  3KQE A;  4DOQ A;  3M5M A;  2QAA A;  4OS5 A;  3RXL A;  3UNQ A;  1EAW A;  4I32 A;  3RMO H;  1OWH A;  1BIO A;  1LVO A;  3F9E A;  1PQA A;  5F8X A;  2BD4 A;  4ABJ A;  1YF4 A;  5C0U A;  2Y81 A;  4AOR A;  1BTH H;  3LON A;  2BLV A;  5DG6 A;  2OLG A;  4HZH A;  3A87 A;  4BAM B;  2J38 A;  1TX7 A;  1DUA A;  1LCY A;  1O2U A;  1SGY E;  2R0K A;  3BN9 A;  1C1N A;  1GMH G;  2VJ1 A;  4Y7A A;  3PWB A;  3M3V A;  4F4O C;  4K5Z A;  2GKV E;  1XM1 A;  1GMH F;  3VFE A;  1UTP A;  5K7R A;  2C8W B;  3G01 A;  2WYG A;  1CT2 E;  1EKB B;  2NU1 E;  2RCE A;  3RM2 H;  1TPP A;  1YKT A;  2P95 A;  2VIW A;  4Q2K A;  2OQU A;  4K3J A;  1RXP A;  3RXH A;  2KCY A;  4D9R A;  4Z1M D;  1SGF A;  4B2C A;  2A32 A;  2Y7X A;  4HGC A;  2ODQ A;  4BAO B;  4O03 A;  1UVP A;  2ANK H;  3GY8 A;  5EST E;  3VG8 A;  1MH0 A;  5EXM A;  2FOB A;  1O3E A;  4B6F A;  4I31 A;  2Y5H A;  2G8T A;  2GDE H;  1FON A;  1ZZZ A;  4A6L A;  1FLE E;  3TU7 H;  2AH4 X;  2BB4 A;  3B9F H;  1BRU P;  1WYK A;  3EYD A;  1BMF D;  5DP9 A;  3U8O H;  3TK6 A;  1ZPZ A;  3MYW A;  3C1K A;  1KIG H;  2FTL E;  2ZDK A;  2ZDA H;  1HYL A;  1O2Q A;  1SI5 H;  1SSX A;  1C1W H;  3SV9 A;  1GBC A;  4B6E A;  1O2R A;  1F0S A;  2W3K A;  3NCL A;  4E06 H;  2EA3 A;  4CRA A;  4WJG 2;  1QRZ A;  3EE7 A;  1HAY B;  3ZZ4 A;  5CE1 A;  2EY4 C;  1MUE B;  1KDQ A;  3OY6 U;  5F8T A;  4XBC A;  2VIP A;  2ZF0 H;  1T32 A;  3Q76 A;  4CRC A;  2WUC A;  1RGQ A;  1PFX C;  4R0I A;  3EA9 A;  2PR3 A;  2GX4 A;  1H8E D;  4ABF A;  1CQQ A;  2G4T A;  3ZZB A;  3ZZ8 A;  2HAL A;  1NPM A;  1QBV H;  7EST E;  2JH5 D;  1Y3U A;  3MO3 A;  5E0G A;  4GPG A;  3MH7 A;  2STA E;  4K1T A;  2VH6 A;  3PV5 A;  4ACA A;  1C2J A;  2WYJ A;  1HJA B;  1JXP A;  3ATI A;  1MTS A;  2BDB A;  2DUC A;  4RT0 A;  1F7Z A;  2RG3 A;  2BQ6 B;  1Z1I A;  1PPG E;  1DVA H;  4B76 A;  3NXP A;  1Z7K A;  2O8M A;  1G3B A;  2WV9 A;  2QV1 A;  1XUG A;  1JIR A;  3D23 A;  3RXB A;  4ZRO A;  2J95 A;  1J8A A;  1INC A;  1ESA A;  3BTH E;  1QBO A;  4X6M A;  3ATW A;  5TCA A;  2ULL A;  3KQC A;  1O3H A;  4ISL A;  5EJL A;  2XC4 A;  1AVG H;  1THR H;  2QF3 A;  2KCA A;  1TON A;  3SV2 H;  1OP8 A;  5A8X A;  1KY9 A;  1E37 B;  4CR5 A;  1JOU B;  1U6Q A;  1GVZ A;  1SGC A;  3PMA B;  1ZRB A;  4NFE A;  4X2V A;  1OOK B;  1TGC A;  2ZIQ H;  5C0T A;  1V2W T;  1AND A;  1C1S A;  1O2T A;  3F9H A;  2Y5G A;  1UTN A;  2PHB A;  1JBU H;  3E3T A;  4MVN A;  3GY2 A;  4XD7 D;  2ZCH P;  4NA8 A;  1YCP K;  1C1O A;  3ZZ6 A;  1T8O A;  1NRN H;  3AW1 A;  1OYT H;  1O3P B;  2GCT C;  3TGI E;  1P3E A;  1IQG A;  4DVA U;  4YZU A;  3RU4 E;  1SLU B;  5C1Y A;  2VWO A;  5KED A;  3U28 C;  1CU1 A;  3QWC H;  4ZH8 A;  1GBJ A;  1P2J A;  1OKX A;  3DSP A;  5HMA A;  2ANW A;  4Z6A H;  4NIV A;  2Z9G A;  3DSO A;  1BRA A;  3DA9 B;  2ZGH A;  5A09 A;  1O3D A;  1AB9 C;  2KX4 A;  2ZKS A;  4IC6 A;  4WVP E;  3A8B A;  1GMD G;  1GL0 E;  1BZX E;  2KAI B;  3MNC A;  4OM9 A;  3VB7 A;  1AZZ A;  1NU7 B;  2EEK A;  3ZIA D;  2HPQ H;  3RMN H;  1F92 A;  3MU5 A;  4UDW H;  1YP9 A;  1QL9 A;  3SJ9 A;  1NC6 A;  1T8L A;  1H9L B;  4JZE H;  3S9C A;  1MTN B;  2KM0 A;  3SUF A;  1C2I A;  2A2Q H;  1ABI H;  1XVM A;  2I6S A;  1C5V A;  4D8N A;  4GCH F;  1XUJ A;  2R0L A;  4F49 A;  5L30 H;  3T26 A;  4A1X A;  1QB1 A;  3UQV A;  1K28 D;  5T3H A;  1S0R A;  2AS9 A;  2HPP H;  3ATK A;  2UUJ B;  3M5O A;  2DE9 A;  1SHY A;  1FY1 A;  4FUF A;  4E7N A;  1PPE E;  2PTN A;  1BTY A;  3K2U A;  1ELD E;  4GLY A;  5EXL A;  5DJ7 A;  1LHD H;  4A92 A;  3KF2 A;  3SN8 A;  1FY4 A;  2IOT A;  1DOJ A;  3P8F A;  5A0C A;  1AHT H;  4UFD H;  2EI6 A;  1F0R A;  5HM2 A;  2O8L A;  4E05 H;  2ZFP H;  1MTN C;  4YOI A;  2GZ7 A;  3QZQ A;  2BZ6 H;  1YC0 A;  2AMQ A;  3GDU A;  5T6D A;  5C20 A;  4LK4 A;  2QCY A;  3TLO A;  4AGK A;  1UO6 A;  1M9U A;  4MQA A;  1QJ6 B;  1WAY B;  1IQJ A;  3KYG A;  4IGD A;  5C1U A;  1WQS A;  5A8Z A;  1AVX A;  2HVX A;  3M3S A;  3BG4 B;  1C5Q A;  2C8Z B;  3SND A;  2R9P A;  2XC5 A;  1Y5B T;  3FP6 E;  2Z7F E;  1A2C H;  1UK3 A;  5L6N H;  1XUH A;  2UUK B;  2FLB H;  1FQ3 A;  1QRW A;  1AI8 H;  4J1Y A;  1MBM A;  4WWY A;  5TJX A;  3TH3 H;  1A4W H;  1V2T T;  2ZHE H;  4ZUH A;  2ZQ1 A;  1DLK B;  3RLY H;  3TJU A;  3O8B A;  1P0S H;  3SUD A;  5C3N A;  1P12 E;  2GD4 B;  1B5G H;  1ELT A;  5FCR A;  1C2L A;  1H8H D;  2JDI D;  3VB6 A;  1FV9 A;  5CHB A;  1W7X H;  4MNY A;  3V0X A;  4NGA H;  2PKA B;  1BTX A;  1AO5 A;  1UTM A;  3KHV A;  1DST A;  1W10 U;  1P06 A;  2V7Q D;  5IDK A;  1IQE A;  2SNV A;  3BTF E;  3BTK E;  2A7H A;  7LPR A;  3K6Z A;  1C9T A;  1MAB B;  1O2L A;  3FFG A;  4YT7 H;  1C5U A;  2GZ9 A;  1BRB E;  6LPR A;  3CEN A;  3VGC B;  1V2V T;  2GDD A;  3F2G A;  4X1Q U;  1O3I A;  2KZ4 A;  4BAQ B;  5LPE A;  1LPG B;  2IPH A;  5JDU B;  1UTK A;  3OY5 U;  8LPR A;  2RA0 A;  3A7V A;  4FUG A;  2BQW B;  1RTK A;  1VJA U;  2A4O A;  2F9B H;  2Q1J A;  1P8V C;  1O31 A;  2SNW A;  2ZPS A;  2P8O B;  1HJ9 A;  2ZCL P;  2FEQ H;  1BRC E;  3V3M A;  2XBW A;  3HKI B;  2O8W A;  1TNG A;  3PMH B;  3FP8 E;  4I8K A;  1TNK A;  1YPL H;  3WW7 A;  5HXF A;  3NK8 A;  1V2P T;  5HIY A;  1VIT F;  1NS3 A;  4FU9 A;  1V2N T;  3WY8 A;  3SZN A;  1BT7 A;  1UCY H;  3KL6 A;  2VGC C;  2ZU1 A;  4UE7 H;  1E79 D;  1SFQ B;  2IPQ X;  1KTS B;  1MKX K;  1UTO A;  1HAG E;  2ZG0 H;  1O2M A;  2PFE A;  1C2G A;  3TNS A;  3W1E A;  1O35 A;  2CHA C;  2I6Q A;  4D9Q A;  3ZVE A;  3ZVG A;  1GI1 A;  3NKK A;  4UON A;  4JZD H;  1ELB A;  1YWU A;  3HKJ B;  2AGI X;  1AUJ A;  5DP3 A;  1QY6 A;  4IMQ A;  1Y3V A;  1O3B A;  3F2H A;  3ATL A;  1DXP A;  1UCY K;  1GI4 A;  1H8D H;  1KXD A;  3SO3 A;  3MH5 A;  2WIN I;  1GI9 B;  2BLQ A;  2W6J D;  2V3H H;  1RTF B;  9LPR A;  5JYI A;  2FES H;  3LH3 A;  4ZKN U;  1A3B H;  5HGG A;  1L4Z A;  3ZV8 A;  1LKB A;  1ZTK A;  2BD2 A;  4ACB A;  1W0Y H;  1W13 U;  2QC2 A;  1SVP A;  2G5N A;  3OX7 U;  1C9P A;  1L1N A;  1Q2W A;  4HTC H;  1PPZ A;  1G3C A;  2L6O A;  3SNC A;  1FJS A;  2CXV A;  2ZHD A;  1HXE H;  1OX1 A;  5LPR A;  3MU4 A;  4FET A;  2QF4 A;  4A1V A;  2FMJ A;  1ETS H;  1P02 A;  2ZTZ A;  1FN8 A;  3VEQ B;  2CF9 H;  4KEL A;  2ZU2 A;  2G5V A;  1GHB G;  1PPC E;  1RTL A;  3V12 A;  1P57 B;  1W8B H;  4FUI A;  1D4P B;  2C3S A;  1E0F D;  3R0F A;  3SQE E;  3TIT A;  1Z71 A;  4E7R G;  3RUO A;  4CRB A;  1ANB A;  1TLD A;  1YLD A;  4CBN A;  1MTV A;  2WPK S;  4HI3 A;  2BD3 A;  5B6O A;  2F9O A;  1P2Q A;  2OIN A;  2R3Y A;  2H1U A;  1GJD B;  3HK3 B;  3A88 A;  1C5Z B;  1S0Q A;  2FX6 A;  2NU4 E;  3RDZ A;  6CHA B;  1TX8 A;  2ZGJ A;  3GY6 A;  3SGQ E;  2W7U A;  3SJO A;  5EPY A;  3S9B A;  1ARC A;  3MWI U;  2CJI A;  3RXM A;  2PGQ B;  2CGA A;  4BTI B;  1VKY A;  2VID A;  1SHH B;  3RC4 A;  1GMC F;  1J9C H;  1EZU C;  1OPH B;  3BTW E;  4KTS A;  1ANC A;  5JB8 S;  3LGW A;  1K22 H;  2FOC A;  4FUB A;  1SB1 H;  1F0T A;  4NSV A;  1NRQ H;  2LP6 A;  4YOJ A;  1ZHM A;  2SGQ E;  5I25 A;  1AMH A;  1N8O B;  3N7E A;  3RXP A;  4RI0 A;  1PPB H;  3O8D A;  2FM2 A;  1O2J A;  4I8H A;  4K69 A;  1JRT A;  1EPT A;  3SHC H;  1ESB A;  1YBW A;  2EI8 A;  2UWL A;  3TJV A;  3KEE A;  5FX5 A;  1IOE A;  1FY3 A;  4Q63 A;  4B74 A;  4ZHL U;  1O5D H;  1ELA A;  1KYN A;  3SU6 A;  2YNA A;  1SGD E;  1AWF H;  2A0Q B;  2GJG A;  2VVC A;  2ZU4 A;  1O2N A;  4IS5 A;  1O2H A;  2AHM E;  2D2D A;  3GCH C;  1EST A;  1EP6 A;  1VJ9 U;  1CA0 B;  2FOA A;  5F53 A;  1GHY H;  2OCV B;  2XRC A;  4INH A;  3GY3 A;  1AGJ A;  2HOB A;  2IN2 A;  1BOQ A;  1JIM A;  3QX5 H;  2JJ1 D;  5FBE A;  4NSY A;  2JH0 D;  5TCC A;  1G3D A;  4UD9 H;  4LOY H;  3IIT A;  1V2M T;  1F0U A;  3KID U;  1V2J T;  2HNT C;  2EST E;  1GHX H;  3I29 A;  4TPY A;  1P9S A;  2FI4 E;  1YLC A;  2XBY A;  1GJ4 H;  2SGF E;  4UEH H;  2JIZ D;  1GJA B;  1L2E A;  2KAI A;  2B0F A;  4BOH A;  7KME H;  1P2M A;  1H8I H;  1LTO A;  1C5S A;  3RXA A;  4WXV A;  2NU0 E;  5CMX H;  2TRM A;  1SOT A;  3LGU A;  3VPK A;  2W26 A;  2GMT B;  4AYY B;  5C1X A;  1GHA G;  1KLJ H;  3SI3 H;  2ZZU H;  1VGC B;  1V2K T;  1MCT A;  2BXU H;  1TNI A;  1PPH E;  1FAX A;  3E0N B;  2GV7 A;  3I78 A;  3F0O A;  3H09 A;  1O32 A;  3F6U H;  1ZGV A;  4FUD A;  1UK2 A;  4FUJ A;  3MNB A;  1GL1 A;  2BY6 X;  3MOC A;  1RFN A;  1SGE E;  3LOX A;  3U1J B;  3BIU H;  1UCY E;  1FZZ A;  3F2F A;  3QK1 A;  1G36 A;  2K8I A;  3ODF A;  2OBO A;  1F5L A;  2VB0 A;  3FZZ A;  1ZOM A;  5EJZ A;  2PKS C;  2D1J A;  2FOD A;  3QTO H;  1V6D A;  2WPL S;  2JJ2 D;  3PMB B;  3OTP A;  3VB4 A;  3BEI B;  1C2K A;  1EX3 A;  4J2Y B;  1HV7 A;  1BBR K;  4CBO A;  3TH4 H;  1OP2 A;  2W3I A;  2ZDM A;  1PPF E;  3A89 A;  1G32 B;  4NA9 H;  4GCH G;  1UVT H;  4B73 A;  1C5O H;  1BHX B;  3KQB A;  3B8J A;  4XBB A;  3PLP A;  7GCH F;  1YY3 A;  2HNT F;  3V7T A;  2IJO B;  4THN H;  1HAH H;  1L1G A;  1CT0 E;  1TAL A;  3ZVD A;  2PWX A;  4GAW A;  4DIH H;  1KXE A;  1LQD B;  4Y0Y E;  1C1R A;  1ZSL A;  4DCD A;  2WHX A;  3ZZD A;  4BAH B;  2G00 A;  2PKS B;  1S85 A;  4X8S H;  4FXG H;  1P9U A;  1EPT B;  2AIP A;  4FVB A;  4HG6 A;  1NT1 A;  1GHA F;  2TGT A;  1K1I A;  1THP B;  4TY6 A;  3M61 U;  1P10 A;  1NFW A;  3E16 B;  3L3T A;  4X2W A;  5GDS H;  5EXN A;  1P2N A;  4XSK U;  1IQF A;  3EE0 B;  1GMC G;  1WXR A;  4JK6 A;  2BX3 A;  5K0H A;  2G4U A;  3IWM A;  2BMG B;  3OE7 D;  2BOH B;  4FU8 A;  4ABH A;  4DII H;  3RC5 A;  4I8L A;  3SJK A;  1GG6 B;  2F9V A;  1C1T A;  1O3C A;  1TIO A;  1OP0 A;  3QUM P;  5CHA B;  1FDP A;  4LZ4 B;  1DAN H;  1SGF G;  2Q6F A;  2LNC A;  4B71 A;  4X1N U;  2G55 A;  2FOE A;  1DWE H;  3A7T A;  4ISI H;  2EC9 H;  1CBW C;  1P2I A;  4X6N A;  1NO9 H;  1C2H A;  2YNB A;  3UUZ A;  3DD2 H;  5C5N A;  2Y80 A;  2XNI A;  2BVX H;  1EJN A;  4ABB A;  3RXS A;  4INL A;  1O39 A;  9EST A;  1KXC A;  1SLW B;  4ASU D;  1G2L A;  1O0D H;  4I33 A;  3LC3 A;  4TWY A;  4AFZ A;  4MNV A;  2YMS B;  2H9H A;  1TOC B;  1CGI E;  4BXW A;  2H5C A;  1F5K U;  1ETR H;  2QN5 T;  5HM9 A;  3PB1 E;  1OWE A;  2ZFQ H;  2CK3 D;  1AFQ C;  1ANE A;  1O2K A;  2A7C A;  2Y6T A;  4NIY A;  1MTW A;  4H4F A;  1ELV A;  1GVL A;  1THS H;  1YCP H;  1D3P B;  2C90 B;  3BTQ E;  3LH1 A;  2Z9K A;  2A7J A;  1C1V H;  1KXB A;  3PYH A;  3M7T A;  2ZFT A;  3W94 A;  3RXO A;  4DG4 A;  4SGB E;  3SOS A;  1UTQ A;  4CRE A;  1BMA A;  1T8M A;  1LHG H;  1GJC B;  5E8E H;  1ELC A;  4TWW A;  2J34 A;  3LGI A;  3SUG A;  1TRN A;  3R3G B;  5AFY H;  1LQE A;  1E34 B;  3TK5 A;  3ZYD A;  2M2A A;  3UNS A;  3TNT A;  2P3T B;  3KN2 A;  1KMH B;  2GP9 B;  4JYU H;  2ZPQ A;  4XOJ A;  1TAW A;  5GND A;  1SKY E;  3RM0 H;  1W0K D;  1HXF H;  4TSF D;  2AGE X;  5SGA E;  1C2E A;  1NFU A;  3KQD A;  1UTJ A;  3CNR A;  1O30 A;  2ZTY A;  5PTP A;  1TGT A;  2ZP0 H;  3MNX A;  1C4Y 2;  2R2M B;  1K1J A;  1XX9 A;  2FXR A;  3TPI Z;  4D7G A;  3ODD A;  3UR6 A;  1V2L T;  3QN7 A;  1QFK H;  1SPJ A;  2PW8 H;  3GY7 A;  5HIZ A;  4K1S A;  1FPH H;  1PJP A;  1HRT H;  2V3M A;  3WWB A;  2PLX A;  5FPS A;  4Y0Z E;  1SGI B;  1TGN A;  4YLU A;  1BHX F;  1GI2 A;  1TBR H;  1XXF A;  5G4B A;  2BXT H;  4YTA A;  2FWW A;  4DGJ A;  1Z8G A;  4WMD A;  2PSY A;  4Q80 A;  1SMF E;  3LIW A;  2YOL A;  4WME A;  3D65 E;  3UFA A;  3SU5 A;  5KEC A;  3GCN A;  1PQ5 A;  3QZR A;  3PO1 B;  1NY2 2;  3S0N A;  4F55 A;  4Q7X A;  2WPH S;  4MPW A;  2XWB I;  1C5Y B;  1TX6 A;  1SGR E;  1GVK B;  1SFI A;  1G2M A;  2XCN A;  1ELF A;  2H5D A;  2NU2 E;  1NU9 A;  1YYY 1;  2WPD D;  4TPI Z;  1HJ8 A;  1O3F A;  3FKS D;  1VIT G;  1ZMN A;  3DSG A;  4XRN A;  1YM0 A;  1TPA E;  3BTD E;  4ZCN A;  2V6N A;  1GDU A;  2QA9 E;  1O5B B;  4CRD A;  5HYO A;  2TBS A;  4KGA A;  3MI4 A;  4R8T B;  1LHF H;  2Q6D A;  4A1T A;  1QQU A;  3AAS A;  2F3C E;  2J4I A;  4ISO A;  3SNA A;  3T28 A;  5C5O A;  4RSP A;  1GHB F;  1MD8 A;  5AFZ H;  4AX9 H;  1QA7 A;  3JZ2 B;  1EZS C;  4Y8Y A;  5KGO A;  3VB5 A;  2FI5 E;  2THF B;  5EGM A;  1QL8 A;  1GBB A;  2UWP A;  2J94 A;  2FTM A;  5EG4 A;  1XMN B;  2G52 A;  3LGY A;  4TYD A;  2PKA A;  3MH4 A;  5GCH G;  3Q3Y A;  1FX0 B;  1A1R A;  1GJB B;  4LXB H;  4U01 A;  3RP2 A;  1QIX B;  2R2W U;  3SU0 A;  4ABA A;  4ZHM U;  1BTP A;  1SR5 C;  3SZE A;  1GBI A;  5DGJ A;  5FHT A;  1E1Q D;  1N8O C;  1W2K H;  3QO6 A;  1C2M A;  1S82 A;  1TBZ H;  3OSY A;  1DT2 A;  5EOK A;  3NPS A;  5A2M H;  1A5I A;  2F83 A;  4MPX A;  3QDZ B;  1DY8 A;  6GCH F;  1T7C A;  3W95 A;  2P94 A;  1EAT A;  4KKD A;  3CS7 A;  3PM3 A;  1FN6 A;  5EU8 A;  1ID5 H;  1GWA A;  1HDT H;  1S83 A;  3TH2 H;  1H1B A;  3ENS B;  4O3U A;  1T8N A;  1UTL M;  2TPI Z;  2OK5 A;  3ZVB A;  5GXP A;  2OP9 A;  3AVZ A;  5FCK A;  1AWH B;  4U30 A;  4AGJ A;  2QY0 B;  1D3T B;  1O2X A;  3UWI A;  1TBQ H;  2F9U A;  1EFR D;  1QUR H;  3PV2 A;  3GIS B;  4AFS A;  3MMG A;  2FOG A;  4OS2 A;  2VGC B;  5EQS A;  1OWD A;  5LH8 A;  1N1L A;  1XKA C;  3RXF A;  1KTT B;  3ZZC A;  3AAU A;  1GHV H;  3NZI A;  2DE8 A;  3ATM A;  4X8V H;  1G9I E;  5E2P A;  1DE7 H;  3N99 A;  4NA7 A;  1ZSJ A;  1HJA C;  2BD7 A;  4MDS A;  1MBQ A;  2Z9I A;  2CHA B;  3A8D A;  1W7G H;  2C8Y B;  4YO9 A;  3K65 B;  3SNE A;  3A7W A;  3U98 H;  2ANY A;  2FYR A;  5L2Y H;  1GBT A;  3SNB A;  2Z9L A;  1QRX A;  4AFQ A;  1GBL A;  3TIU A;  5AHG H;  1JWT A;  4YOG A;  4O97 A;  1AY6 H;  1AIX H;  1HLT H;  1BTU A;  1C1P A;  1RIW B;  3BG8 A;  2OD3 B;  3PMJ A;  1EZQ A;  3SU3 A;  1EQ9 A;  2CF8 H;  3FVF B;  4NG9 H;  3PLK A;  1GJ7 B;  1HAV B;  2VIO A;  1TQ7 B;  4B75 A;  1PQ7 A;  3BEU A;  4AC9 A;  1DLE A;  1L1J A;  1HAO H;  5BRR E;  2VWN A;  4K60 A;  3SU1 A;  4NWL A;  1QBN A;  4IN1 A;  3ZVA A;  1O3G A;  2XND D;  2FDA A;  3PV4 A;  1K0H A;  3VXE H;  4FUC A;  1SC8 U;  4Q4L A;  3UQO A;  1K1P A;  1EZX C;  1DIT H;  1ZLR A;  4B1T A;  1QZ8 A;  5T1V A;  1Y3W A;  2PUX B;  1ZSK A;  2ZU3 A;  3RXJ A;  1CHO F;  3EA8 A;  3MO6 A;  3SW2 B;  3T62 A;  3TGK E;  1D6W A;  2FIR H;  1GBH A;  2BTC E;  3GCH B;  4ZHA A;  3HGN A;  2ZCK P;  1GHZ A;  4NWK A;  3P6Z B;  1O5E H;  1Z8R A;  1QQ4 A;  4DT4 A;  2BHG A;  1ZJD A;  4BAN B;  1EB1 H;  1O2W A;  1RIW C;  3BTM E;  4K8Y A;  4P02 A;  4DT7 B;  2FS9 A;  4AOQ A;  4GUX A;  4ABD A;  2Z3E A;  1O3N A;  3PWC A;  2OXS A;  2HGT H;  3MU0 A;  4I8G A;  1GCD A;  3RXK A;  2VH0 A;  3A82 A;  3TVJ B;  2TGA A;  1W0J D;  1SG8 B;  1HAI H;  1O2Y A;  3URC A;  5A8Y A;  2ANM H;  1GGD B;  3E6P H;  1QB9 A;  3IG6 B;  1SGP E;  1HGT H;  1HFD A;  1WQV H;  4AZ2 B;  4Y8X A;  2VVU A;  1S81 A;  3OTJ E;  1TFX A;  3A81 A;  1EJM A;  2BVS H;  4JYT A;  2OBQ A;  2GTB A;  2B9L A;  1CSO E;  1A46 H;  2A5A A;  4K2Y A;  5DP5 A;  5B6L A;  2BZA A;  3I77 A;  2G51 A;  1BMM H;  1WCZ A;  2XCF A;  1IHS H;  1TWX B;  1CHO G;  4H42 U;  3H7T A;  2A45 B;  4X0W U;  2ZA5 A;  4MNX A;  4I86 A;  5DN6 D;  2M5T A;  3OU0 A;  1BUI A;  2VU8 E;  5ETX A;  4X6P A;  2WPI S;  3DT0 H;  1TPS A;  1C1M A;  1NRP H;  3SYJ A;  2ZU5 A;  1EP5 A;  2FP7 B;  1VCQ A;  4AG2 A;  4CH8 B;  2XTT B;  2H9E H;  2GCT B;  2FOF A;  1A61 H;  4INK A;  7GCH G;  5L2Z H;  4WY3 A;  1ORF A;  3GYL B;  3LGV A;  4OS1 A;  4YES B;  1D9I A;  1LMW B;  5C67 A;  4DW2 U;  2ZQ2 A;  2SGD E;  2BX4 A;  3UOP A;  3D49 H;  3FP7 E;  1CGJ E;  2BY9 X;  2GMT C;  4ZKS U;  3MU1 A;  1SGT A;  2A2X H;  3UOU A;  3N7D A;  1Z8I B;  2ODP A;  1O2O A;  3VXF H;  1O34 A;  2D26 C;  4ZKR U;  1K2I 1;  1AB9 B;  2ZDL A;  3F1S B;  1Z1J A;  4FOU C;  3V13 A;  4NFF A;  1W0Z U;  2ZDN A;  4NZQ A;  1P2O A;  3LDX H;  3MTY A;  5DPA A;  3ITI A;  3U9A H;  1IHT H;  1O5F H;  1E1R D;  3EQ0 H;  2GZ8 A;  4B2A A;  1Q3X A;  1TMU H;  4Z0K A;  4AB8 A;  1KDQ B;  1OYQ A;  8KME 2;  2H2Z A;  2ZFR H;  6GCH G;  1S84 A;  2TGD A;  1H4W A;  4CR9 A;  1HIA B;  3FOA A;  2SGE E;  1BTZ A;  2WZQ A;  3Q77 A;  5T6F A;  1A0J A;  3M7U A;  3O8R A;  2FOH A;  4AYV B;  1BA8 B;  2GV6 A;  4X1R U;  2FO9 A;  1L4D A;  4GHT A;  3RML H;  3M35 A;  3OFN D;  1YPH C;  1SL3 A;  1O2I A;  4JMY A;  1E38 B;  1QTF A;  1CE5 A;  3F3B A;  4WMF A;  3S7H B;  4FUH A;  4CRF A;  1A5H A;  3EAJ A;  2RDL A;  4MG3 A;  3ZZ7 A;  3SUE A;  2P59 A;  4ZXY H;  1FY5 A;  3K6Y A;  5A0A E;  3A8C A;  4WH6 A;  3BTE E;  4H6S B;  1QCP A;  2RDE A;  1CO7 E;  1FAK H;  1HPG A;  2B7D H;  1FUJ A;  1TGB A;  2OC7 A;  2PP6 A;  2WPJ S;  4HFP B;  3NWU A;  1H9I E;  5IK2 D;  5GCH F;  4Y10 E;  1VGC C;  1ZPB A;  5F8Z A;  1NBM E;  1O3K A;  2HRV A;  5A0B A;  2GVF A;  4DUR A;  1YPG H;  4AN7 A;  3L33 A;  1D3Q B;  5E0H A;  3LJO A;  2AMP A;  1BMN H;  1WTG H;  4DJZ B;  1TQ0 B;  2FPZ A;  1K9O E;  2B5T B;  1XUF A;  3UWJ H;  5LPF A;  1GBM A;  4D7F A;  4A5T S;  1LPK B;  1BJV A;  2BDA A;  2SGP E;  4O3T A;  1UW7 A;  2TIO A;  1Y3Y A;  3Q3K A;  1MZD A;  4TT3 D;  4NIW A;  5DP6 A;  2PUQ H;  1KLI H;  1V3X A;  1GCT B;  1BQY A;  1SQT A;  2WV4 A;  1CVW H;  1G30 B;  3SOR A;  1TMB H;  1AE8 H;  1A5G H;  1AFQ B;  3VB3 A;  4MNW A;  1WU1 A;  5ESB A;  1C1U H;  2P16 A;  1DWC H;  4IBL H;  2WV5 A;  2H9T H;  1BDA A;  2HLD D;  1ZR0 A;  1WBG B;  4NCY A;  1GI5 A;  1VR1 H;  5GWZ A;  1C5X B;  5FX6 A;  3H5C B;  3QTV H;  2ZGB H;  4Y6D A;  2J97 A;  2VBC A;  1QGF A;  3AW0 A;  5FAH A;  3EGK H;  3H7O A;  4BNR A;  3PTN A;  4X2X A;  1UVS H;  3BV9 B;  1C5N H;  2VWM A;  8GCH G;  3L6P A;  1DS2 E;  1FY8 E;  2AEI H;  1FXY A;  4A7I B;  1B7X B;  1VIT H;  3KYF A;  2QXJ A;  3SV7 A;  3EDX B;  1GJ8 B;  1BBR H;  3F0P A;  3A7X A;  2L74 A;  3STJ A;  4IC5 A;  3UR9 A;  1WSS H;  4U32 A;  1BTW A;  1RJX B;  3KCG H;  1CA8 B;  3E90 B;  1YGC H;  1LO6 A;  2Q6G A;  2F4L A;  2QE7 D;  3CS0 A;  4FUE A;  1Y5U T;  2EQN A;  4RT1 A;  1GJ6 A;  3P17 H;  2VNT A;  3FAO A;  4MPU A;  3TGJ E;  3PTB A;  5F03 A;  1GMD F;  2KFW A;  1MU8 B;  1DWB H;  2SGA A;  4X1P U;  1EAX A;  5JB9 S;  5EW2 H;  3UPE A;  3LU9 B;  1KXF A;  2BD9 A;  1UK4 A;  3LPR A;  4JCN A;  1P11 E;  2B8O H;  3UIR A;  3GDS A;  3RXV A;  1B0E A;  2ILN A;  2FYQ A;  1NZQ H;  4BTU B;  5J4S A;  5EQQ A;  4I7Y H;  3O8C A;  1GI8 B;  1ELG A;  2BY5 X;  4JZ1 A;  1SGN E;  4VGC B;  3RXE A;  5JBC S;  3RXC A;  3UB0 A;  2QIQ A;  3BEF B;  2JH6 D;  2VIQ A;  5DKM A;  3P70 B;  1MAY A;  1VCW A;  1VZQ H;  1TPO A;  1XUK A;  1WOF A;  5LGO A;  1AQ7 A;  1D6R A;  1AVW A;  3T2N A;  3FZD A;  2O8U A;  3MFJ A;  4ZMA H;  2R3U A;  4AFU A;  4ISH H;  3A80 A;  3HPT B;  4MPV A;  3BSQ A;  1O2S A;  3BF6 H;  2Y5F A;  5FXL A;  1ZGI A;  1AFE H;  3ZZ3 A;  1P09 A;  8EST E;  1XUI A;  2OUA A;  4WH8 A;  3PO1 C;  2CMY A;  1C5P A;  3GY5 A;  1QL7 A;  4MTB A;  2RFK C;  5EW1 H;  1QR3 E;  2QXH A;  2VWL A;  4F48 B;  4D76 A;  1C5L H;  2J9N A;  3E0P B;  3JZ1 B;  4Q7Y A;  4VGC C;  3MQK C;  1AZ8 A;  4Y8Z A;  2FLR H;  1S6H A;  4UFE H;  4AG1 A;  1YPK H;  2QXI A;  4P00 A;  4WF8 A;  2J98 A;  4ZAE A;  1GPZ A;  1O5C B;  3DCL A;  1Y59 T; 
#chains in the Genus database with same CATH homology
 2J98 B;  5C94 A;  3EE7 A;  1UW7 A;  2J97 A;  5HIZ A;  5HIY A;  2J98 A;  1QZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...