1O5CB

Dissecting and designing inhibitor selectivity determinants at the s1 site using an artificial ala190 protease (ala190 upa)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEASTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDACQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting, hydrolase
molecule keywords Urokinase-type plasminogen activator
publication title Dissecting and designing inhibitor selectivity determinants at the S1 site using an artificial Ala190 protease (Ala190 uPA)
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2003-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o5cB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o5cB01
1QR3E 1XUHA 4LXBH 1BTYA 3GYMA 1GJ9B 1O2HA 1D3TB 1O2VA 2FEQH 1P8VC 2RDLA 2C4FH 1D3QB 2BHGA 3P92A 3W94A 2OINA 4NWKA 3RMMH 5GCHG 1A5HA 2BY8X 3KEEA 1TIOA 3O8DA 3LC5A 1UHBB 1PPGE 1P2QA 1KXBA 2ASUB 3F9GA 1JRSA 1ZTLA 3U8RH 4D8NA 2BDHA 3VFEA 1SSXA 2ZDLA 6CHAB 1O5GH 2UUJB 2Q6DA 1TABE 1P57B 2PFEA 5I46H 3K6YA 2R9PA 1TONA 1YCPM 2OUAA 4JYUH 1VZQH 4TWWA 1RXPA 1GJAB 4MNWA 2NU2E 1VITG 1TGNA 3T29A 2YNBA 1O5DH 1YPGH 1XKAC 1GWAA 3PWBA 1GI0A 1K1NA 1BRBE 2VIDA 4INHA 1DPOA 1SGIB 2LPRA 5EXLA 4MPVA 1WQSA 2UWLA 3TU7H 2ALVA 4K69A 4Q7YA 3ZVBA 1AB9B 4I31A 2PTNA 1O5CB 2Z3EA 3SHCH 1OWJA 1GJCB 1EZQA 1T8LA 1TX6A 1C5MD 2QN5T 2HGTH 4R0IA 3FP7E 5FX6A 1O2PA 1V2PT 1U6QA 3A88A 2XNIA 4BTTB 1WUNH 3P6ZB 1AI8H 2VWNA 4LK4A 1A3EH 1FMGA 2PW8H 5DKMA 2A2QH 1GBCA 1L4ZA 1C9TA 8LPRA 2ZI2H 1UVPA 1YBWA 3ZV9A 3UQVA 1AZZA 3RC5A 1Z8JB 2ZU3A 3LOXA 1TAWA 1O33A 1AUJA 3UIRA 3SV9A 4YT7H 1Y3VA 1HAPH 3VEQB 5JB8S 3PO1C 1GMHG 1XXDA 5DP6A 1P09A 2ZTYA 3SW2B 1C1NA 1IQLA 3RU4D 3W95A 1UCYE 3U1IB 2J95A 1AGJA 3HKIB 1MTNC 1UVOA 4K60A 1SGFG 1BRAA 1CHOG 4B73A 3ZYEA 3ATMA 1Y5BT 2FDAA 1EB1H 1OXGA 1V2JT 1F7ZA 4MNYA 3RMOH 5C3NA 1L1JA 1JXPA 1NRRH 2STAE 1B5GH 3LPRA 5FPSA 1A5IA 2GVFA 4MTBA 1LQDB 3SI3H 1CT0E 2XWAA 3LU9B 4CBNA 1SL3A 4A6LA 2ZNKH 3ESTA 2HNTC 1KDQB 1O2ZA 3HATH 1TNGA 2ZPRA 2Z3DA 1BHXB 2FI3E 1ZSJA 4INKA 1YCPH 2WINI 1DOJA 1T4UH 1MU6B 2NU4E 4X2VA 1O35A 1BTUA 1O5FH 2ZDNA 3SN8A 3TGJE 2WPMS 3A7XA 4AN7A 1SOZA 1V2WT 1TNIA 2FODA 1YPJH 3A8AA 2ZECA 1WSSH 3MYWA 2VVVA 3KL6A 5TCAA 1QBOA 5FHTA 2BZ6H 1O3EA 1V2OT 3V13A 1YPEH 4K2YA 3ZVAA 2XXLA 1MKXK 2H2ZA 5A09A 1O32A 2BDCA 4JCNA 1Y59T 4THNH 2R3YA 5C1UA 2FESH 2BDYA 3P8OA 3RU4T 5LGOA 5E2OA 3SUFA 2UUFB 2F9NA 1MU8B 2AGEX 5CHAC 1GBTA 1GJ7B 2OCVB 2DE9A 2VWLA 2W7UA 5HYOA 2C3SA 1K22H 2A4GA 1SGRE 3MU4A 3TLOA 1RIWC 1BTPA 1N8OC 2F3CE 2RCEA 1XKBC 1AE5A 1AUTC 4J1YA 3P70B 1TQ7B 1A3BH 4DIHH 3UNSA 5AF9H 2V35A 1Q2WA 3BTFE 3LH3A 4DT7B 4WWYA 3D65E 4MVNA 2JKHA 4GSOA 1P06A 3AW1A 1JIRA 1GJ4H 2BD2A 1ETTH 5A0BA 2W3IA 4XDEA 3CP7A 1Y3WA 2FTLE 3RXIA 4ABJA 1SMFE 1O3FA 1TGTA 5J4SA 1MCVA 1ZRBA 1MD8A 1CE5A 3STJA 5L2ZH 1B0EA 2FTMA 3IWMA 3ATLA 4YLQH 3PM3A 4IMQA 4O9VA 1NU9A 4CRCA 4Y0YE 5PTPA 5T6GA 3UTUH 2WYGA 3GCHB 3PMAB 4UEHH 8GCHG 1BTXA 3CS0A 3BTWE 3PMHB 4LOYH 2UWOA 3SU6A 1GJDB 2ANWA 2LNCA 1GI9B 1MKWK 1KXCA 1XUKA 4KELA 1GL1A 3KQBA 1C5RA 1BUIA 2B0FA 1VCWA 1YPLH 4HFPB 1HBTH 3EDXB 2VIVA 1FXYA 3H7OA 2PLXA 1IQNA 1F2SE 1SLVB 1QQ4A 1LTOA 4MPWA 5L2YH 1L4DA 4DCDA 4OS5A 1FV9A 5FAHA 4TWYA 2G52A 1TMBH 1CA8B 2JH5D 1NS3A 3B23B 4AB8A 1F5KU 3A86A 1SPJA 5JDUB 1EX3A 3QZQA 4I8LA 3RXPA 3BEUA 4A5TS 3KNXA 1TGBA 1GCDA 3A83A 1GBDA 2RA0A 2A32A 1XMNB 2FS8A 1T7CA 4AGKA 1GJBB 1A0HB 1GGDB 5F8TA 3A7VA 2Y5GA 2P95A 4D9QA 1HAZB 2QV1A 2FX6A 2GT7A 4KGAA 1GBIA 2CGAA 1GMCF 1CQQA 4UONA 1EJAA 4OS1A 2ZZUH 1MZDA 4CH2B 2A7CA 2EEKA 3GISB 4XE4A 4ZKRU 5EPNA 1XX9A 1AKSA 1GHWH 1INCA 4CR5A 4JZIA 1X7AC 3AVZA 1HDTH 4O3UA 2KAIA 1HIAA 4CRFA 3GY3A 2O8LA 3RXAA 1Z6EA 1UTMA 5IYTA 1YLDA 5FPYA 4A7IB 4D7FA 1GVZA 1V2QT 1FJSA 1KTSB 1O2IA 2B9LA 5ETXA 1FAKH 1BZXE 1F0RA 4INLA 4WH6A 1SGQE 4X6PA 1EAUA 2TBSA 3BTEE 4Y6DA 1MMJN 1CA0B 3EGKH 3M7QA 3MO9A 1NRQH 4FUJA 5AFZH 1ZPBA 2FX4A 2BDBA 4DOQA 2GMTB 1ARCA 3GCTG 1G30B 2YNAA 3FP8E 1TA2A 1HJ8A 3A84A 1AD8H 4YZUA 1P2MA 1GMDG 1LVMA 1NRSH 2FOEA 5F8ZA 5JBBS 4H6TA 1N6XA 1DSTA 2ZHQH 3MU5A 4I7YH 3M3VA 4ABIA 2VGCC 2AYWA 1YPHE 1B0FA 1QL7A 4BTUB 4JYVH 3GCOA 4X8SH 1FQ3A 2NU0E 3RMLH 2F83A 2FOGA 1FPCH 4DVAU 6GCHG 1YYY1 1GHAF 3EYDA 2V0BA 2PGBB 4AZ2B 3V7TA 2FI4E 4X8VH 1QJ6B 3RXFA 4UFEH 4BAHB 3RP2A 4GAWA 2UUYA 3RXQA 2XBVA 1C5NH 2HVXA 4J2YB 2BMGB 1C5ZB 1Z8RA 4XBDA 1Y3XA 5EQQA 1P03A 4IW4E 5ESTE 1SQOA 2ILNA 1HAXB 4B2CA 1S0QA 3RXEA 3KQEA 1ZGVA 5C1YA 3E6PH 3SJIA 1TWXB 1O2QA 1BCUH 4JZ1A 5IDKA 2B8OH 1TYNA 3OTJE 2CXVA 1DY9A 3QGJA 5JBAS 3SU1A 1C2HA 3T28A 1ZPCA 3TPIZ 4MPUA 1K1OA 1ELVA 3K2UA 2VJ1A 1W8BH 3GY6A 1P9UA 1YF4A 1W2KH 2H5CA 4NCYA 1MAXA 1YCPK 1DSUA 1ZTKA 3GICB 3FP6E 1TRYA 1G2MA 1IAUA 1Y8TA 3RXHA 1EJNA 1OWEA 1KTTB 1QBNA 3L33A 1SGEE 1IQMA 2J9NA 4HTCH 5GCHF 2GKVE 3E16B 1HJAC 3MU0A 3R3GB 3ATWA 2Z6BD 1W12U 5DK1A 3LGUA 2C8YB 2A45B 4FUEA 3T27A 3LT3A 2ZGXH 4K1TA 2XC4A 3RXCA 1GBMA 3SQHE 3PMBB 1QJ1B 4GHQA 4K5ZA 1GG6C 4BTIB 3ZZ3A 3HKJB 1GJ6A 1PFXC 1VITF 1K1MA 4TPYA 1FONA 5A8YA 1OWKA 1IHSH 1RTFB 1OWHA 4YOJA 4I33A 2Z94A 1HNEE 3LGIA 3H5CB 4GPGA 2Z9LA 1LVYA 2JETB 2SNWA 5JB9S 2GCTB 4ZAEA 1PPHE 1O3IA 1TRNA 1BIOA 3QLPH 1XUGA 1O5AB 3FZDA 1BTZA 3I77A 4NFEA 2AS9A 2WV4A 5K7RA 1AY6H 3VXEH 2P8OC 4D76A 1FPHH 3KQDA 3OU0A 9ESTA 1BA8B 1TMUH 1UCYH 2R3UA 4WXVA 2Y7ZA 4YTAA 3SO3A 3ZZAA 4UFGH 4NIWA 1C1WH 3T26A 5LH8A 4NA8A 4BAQB 3NUMA 5DJ7A 1C1VH 1O2LA 2GZ9A 4YOIA 3U98H 4CHAC 3M3SA 1YPMH 3P8NA 5DP5A 1QFKH 2XCNA 1TGCA 1E0FD 2QF0A 8KME2 3LH1A 5FBEA 3RXBA 1TX8A 3NWUA 3SJOA 1GVLA 1NU7B 2IJOB 1GCTB 2Z9JA 1W0ZU 1LPZB 5C1XA 3SNAA 1O3MA 4CRDA 1BQYA 4UFDH 2BYAX 3UFAA 1AE8H 2FOCA 1CHOF 1LPKB 3VB4A 4X1NU 3ZZ5A 2G4UA 3S0NA 1SFQB 1AZ8A 2W3KA 3FANA 1CBWB 2PKSC 5DGJA 1IQKA 1HXEH 1C4V2 5ABWA 4AFQA 5AVDA 2HNTE 3UR6A 1P0SH 2I6QA 4HI3A 4SGBE 1NT1A 7LPRA 1S0RA 2ODPA 1QL9A 5EODA 1C9PA 2A1DB 3LC3A 4MNVA 2ZO3H 1EPTA 1DDJA 1NFWA 1PJPA 1A4WH 1EOLA 4WJG2 2BVSH 2IOTA 1O31A 1UTNA 4AG2A 3DA9B 1DWDH 1WV7H 2GCHG 2O8UA 2FP7B 5J4QA 5LPEA 1K21H 1UTPA 2H9TH 3Q3KA 1O38A 1G37A 4FUFA 4AYVB 2FLRH 1H9IE 1FZZA 1EASA 4ABDA 1FN6A 1BBRE 3HGNA 1HFDA 3IITA 3TIUA 2Q6FA 2ZFSA 1WBGB 2Y82A 1W13U 1MAYA 1ZJKA 3DT0H 3E0PB 1C5PA 1VCQA 3MNCA 4WMDA 4B2AA 1SGNE 2BB4A 1O3PB 1O2RA 2BDIA 1ABIH 1ELBA 4X2XA 4YM9A 2BQ6B 1GHZA 3BV9B 3TH3H 1HAOH 3RXVA 3ZVGA 3LGTA 1WU1A 1D3DB 1P10A 2BY6X 1WAYB 1W7XH 1A0LA 1J16A 1DLEA 1SGCA 1K28D 5E2PA 2BQ7B 4X2WA 2H6MA 2OD3B 1JRTA 1OX1A 1C2MA 1O3DA 4D9RA 1GDNA 2P94A 3NK8A 1FY3A 3ZZ8A 4ZMAH 2BD7A 3S9AA 3G01A 2P16A 3UR9A 3U8TH 2GDEH 1QHRB 2IPHA 4WMEA 4TY6A 1T32A 4ZKNU 3SU3A 3F1SB 1SI5H 3ATIA 1UHBA 2BD4A 1EAIA 1W0YH 3VB7A 4FUHA 1T8OA 4DW2U 4H4FA 2TPIZ 1C2KA 2P3TB 4BNRA 3MU1A 1YPKH 1UK2A 3JZ2B 1NFUA 3F9EA 2GGVB 5ESBA 1O2YA 2Z3CA 4Q7XA 5CMXH 5JPMH 1VGCC 2ANYA 1NFYA 5L6NH 1ZRKA 2SGQE 1HAVB 3BF6H 4WF8A 8GCHF 5HXFA 1DM4B 1ESTA 4NIYA 3C1KA 3UPEA 2XRCA 3T5FH 1M9UA 4WXIA 3I78A 1GBJA 3QTOH 4F4OC 5A0AE 4Y7AA 4Z0KA 3LIWA 3TNSA 1CT4E 3SUDA 2G00A 4CRAA 2OC8A 4ABFA 1BMMH 2BD8A 4AFSA 2SGEE 1FDPA 2ZG0H 1XUIA 2ZEBA 2WPIS 3BG8A 3BIVH 2SGPE 1SFIA 1KLJH 3RMNH 3MH4A 1ZGIA 3L6PA 4DGJA 5HGGA 1ELFA 9LPRA 3PMJA 3T62A 2W26A 1AHTH 4K3JA 3PLKA 1YC0A 1TPSA 3RC4A 1MTVA 5FXLA 3BEFB 4ISNA 3RXDA 1ELEE 2SGFE 4OGXA 4FUBA 1LO6A 1O36A 1ETSH 1C4U2 4E7RG 4YO9A 1GBKA 5EW2H 1NESE 1O2SA 2ZFPH 1P05A 4Y8XA 4FUCA 3BG4C 3V0XA 1GHBG 4A1VA 1SC8U 2UUKB 5LPRA 2HOBA 1ANBA 3MU8A 4JZEH 1D4PB 1ZTJA 4IS5A 3SUEA 1FLEE 5FBIA 7ESTE 2Z9GA 4NIVA 1HPGA 4B75A 4MLFB 2ZTXA 4Y10E 4XFQA 3GYLB 7GCHG 3F9FA 1LHEH 5DP8A 1J15A 1GBFA 2ZQ1A 1IQEA 4DJZB 2GV7A 4NA9H 2EA3A 1IQFA 4VGCB 2F9OA 2NU3E 4XSKU 2OC7A 2FZZA 5G4BA 2Z9IA 3BEIB 2AEIH 1P2IA 3EA7A 1FY8E 3SNEA 4WY3A 4SGAE 1GI5A 5EU8A 1GI8B 3QDZB 1PPFE 4Q7ZA 1ARBA 4GCHG 2Z9KA 1C4Y2 2V3HH 3GY4A 2OXSA 1AU8A 5F03A 5GJ4B 3OY6U 2BTCE 3PYHA 3SJKA 1TA6A 3SORA 2WPLS 1YP9A 2Y7XA 1KDQA 4UFFH 2F9UA 1C2FA 1Q3XA 4CRBA 3GCTF 2AMPA 2ZFQH 1V2MT 1K9OE 1S5SA 2A5IA 3A7ZA 1GJ8B 1H9LB 2ULLA 1FNIA 1NRPH 5E0GA 1AVWA 4QT8C 3A80A 5EXMA 4BXSA 2HALA 2WPKS 3TK5A 1UCYK 3STIA 1QGFA 4XBCA 2ZC9H 3L3TA 2V6NA 1ZMNA 1HXFH 4NWLA 5HMAA 3RXTA 1DITH 2VWMA 1O5BB 4IGDA 3S9CA 3LGYA 4FUGA 2ZP0H 2EC9H 1O3KA 3MMGA 6GCHF 1C2LA 3ATKA 4AOQA 4ZKSU 1O34A 4B71A 3O8RA 2ZU4A 2QXJA 1C1SA 2CF8H 1GI7B 2F9BH 2OC1A 4MDSA 1K1IA 1HIAB 1O3BA 4RKOB 1AFQC 3A8CA 2BY5X 3ZYDA 1TPPA 3FFGA 1TNLA 4I8HA 1C5VA 2C93B 3U69H 4MPXA 1CO7E 1GI4A 4IBLH 2CHAC 5JYIA 4CR9A 3ZZ9A 1P01A 3LDXH 3HGPA 2PHBA 3M7UA 4BOHA 1E35B 1HAGE 1LKAA 3MNSA 3D62A 3GY7A 3A87A 1DLKB 2P3UB 1BOQA 3IG6B 4O97A 1EPTC 2J34A 1BITA 2NU1E 3QTVH 3E0NB 1G36A 1ANCA 3SNBA 2QC2A 1QTFA 1ZZZA 2J2UA 2TGAA 3BTTE 1FAXA 2OC0A 1DUEA 4GVUA 4A92A 1O3OA 3TGKE 1OP2A 1SG8B 1RGQA 1PPZA 1O2UA 1CT2E 4I32A 1WQVH 1RJXB 4KP0A 1O0DH 3BTDE 1LQEA 1HYLA 1L2EA 1LCYA 2QA9E 3BSQA 3PO1B 3BTGE 2BZAA 3A82A 3F9HA 4DURA 1IQGA 4AG1A 4X1QU 2R2MB 1P3CA 1HAHH 2F9PA 1C5WB 2I6SA 2ZFRH 2PV9B 1MTNB 3VGCC 3KHVA 1QNJA 1LHCH 1DUAA 1QB6A 1A61H 3A8DA 2FOHA 3M35A 1K1LA 1EUFA 1T8MA 2HWLB 4I8GA 2A4OA 4NSYA 3B8JA 1DWEH 1S83A 2XBWA 1HGTH 1C1TA 1EP6A 4RKJB 1UK3A 1HV7A 3E91A 2BDGA 2DE8A 3A7TA 2BVXH 1BHXF 2BXTH 2HPQH 2BDAA 1GI3A 1KYNA 3URDA 4X0WU 1LHFH 1CHGA 3DFJA 3M7TA 1C2IA 2G51A 1QCPA 1HLTH 1L1NA 4TY7A 1DWCH 1CGHA 1ZHRA 2BOHB 1O37A 2PKAB 2AGIX 1C1UH 3Q00A 1FY1A 2BM2A 2OTVA 4JZDH 1O3AA 1H9HE 4X8TH 1W7GH 3QUMP 3ZVDA 2BD5A 1ACBE 4UDWH 1L1GA 3U9AH 5EG4A 1UO6A 1UTKA 1TBQH 2GT8A 3M37A 1EB2A 1B7XB 7KMEH 6CHAC 4Y8YA 1JIMA 2B5TB 1KY9A 5TJXA 3ZZBA 1MQ5A 3K6ZA 1EAXA 1Z1IA 1XUFA 1MTWA 4UD9H 1CU1A 1BJVA 4U30A 1V2RT 1V6DA 1SLUB 1G3EA 2VVUA 1O2TA 4IN1A 1TBRH 1FY4A 1NO9H 5CHAB 3NCLA 4AORA 1SGFA 1Z6JH 1VR1H 1SB1H 2RA3A 4JYTA 3AW0A 3SZNA 2Y5FA 3VB3A 3PWCA 4I8JA 5GDSH 2WV5A 5C20A 5DPAA 4UE7H 1AB9C 5A8XA 1RIWB 1N8OB 4JZFH 2OP9A 1RTLA 5FCKA 2EI8A 1BBRH 5A0CA 1RD3B 2WPJS 2QXGA 4ASHA 2THFB 1C1QA 4NIXA 1T4VH 1O3JA 2P3FH 3SGAE 3ZVFA 5GWZA 2BD3A 3EA9A 3UUZA 2BLVA 1GDQA 2VNTA 4YT6H 2GCHF 4PROA 3VPKA 2ZIQH 1ZMJA 2PWXA 1BTHH 3UOPA 3C27B 2CJIA 2PTCE 1KIGH 1NZQH 2C90B 3TH4H 4DIIH 2Q1JA 2CF9H 3PV4A 1EZUC 3FZZA 1OP0A 3SGQE 5EOKA 3PTBA 1TX7A 2ZDMA 2ZHFH 1KXDA 2IN2A 5DO4H 1ELTA 4K8YA 1UVSH 3SV7A 4AX9H 1F92A 3UQOA 4JK6A 1D6WA 1WOFA 1P04A 4Q2KA 1W11U 1AO5A 1C5OH 1THSH 1P3EA 1ANEA 1C2DA 1Z8IB 5DP4A 2G8TA 4ABAA 1JWTA 1S85A 3GOVB 1CVWH 4O3TA 4A1TA 1SQTA 3ZZ6A 1ZR0A 1AMHA 3QZRA 1QIXB 1O2WA 1NN6A 1S84A 1UTLM 1XVOA 1GHYH 2FYRA 3A89A 1G32B 1H8DH 2A31A 1C5LH 4BANB 1H8IH 1C1OA 2Y6TA 4IMZA 5SGAE 2Y80A 5EGMA 4AGJA 1GHVH 5K0HA 2G4TA 5A2MH 2BX3A 1UJ1A 1CGIE 1G3DA 1T31A 2ESTE 3ELAH 3RLWH 1Z8GA 1OSSA 1GBLA 2AERH 1HCGA 5DP9A 2FO9A 1KXAA 1DICA 3JZ1B 4OS6A 1GMHF 3A7WA 1AQ7A 1W10U 3S7KB 1TNJA 3RXGA 2VIQA 1P11E 4FU8A 4B74A 1MBQA 1IHTH 4ABBA 3M36A 4YESB 2W5EA 2XTTB 2PUXB 3RXOA 1D3PB 1A5GH 2TIOA 4NFFA 1P2OA 4ZHAA 1CGJE 1O2JA 2C8WB 1QB9A 1AIXH 4DY7B 1FY5A 1EQ9A 2ZGHA 4ABGA 1O5EH 4K8BA 4ZHMU 4VGCC 3SJ9A 4WH8A 2QGRA 2ZFTA 1ZOMA 2NWNA 2XBXA 3M61U 4H6SB 5E8EH 3VXFH 2SGDE 1OP8A 1T8NA 1V2NT 3ZZ7A 3P8FA 1AWHB 3MNBA 2G81E 2BOKA 1W14U 3RXRA 2ZPSA 2HNTF 3NKKA 1PQAA 4X1PU 1QRWA 1LMWB 2W7SA 4E05H 2JH6D 4IN2A 3OX7U 4OS7A 2FOFA 2VVCA 2O8WA 1MBMA 1P02A 4Q80A 2ANKH 3LGVA 5C5NA 2VGCB 1OPHB 2AFQB 1XVMA 3SU0A 1GHBF 1D6RA 4M7GA 3VB5A 4ISHH 1V2TT 1MTSA 2P93A 3DFLA 1SR5C 2PSXA 4Y76A 1S6HA 3E8LA 4FVBA 1K1JA 3T25A 1N1LA 2AMQA 3MO6A 1J14A 3VB6A 2ZU5A 1UTOA 1F0SA 2D8WA 3EAJA 3GCHC 1Z71A 7GCHF 4AFZA 1OOKB 2QF3A 4Y8ZA 3HPTB 2QY0B 1O2GH 3NZIA 1JOUB 1NRNH 4O03A 4MNXA 5L30H 2H5DA 1UK4A 1G3BA 4X1RU 3PLBA 2VIOA 1OYQA 1TE0A 2A4RA 4K1EA 2ZHWH 3ZVEA 2R0KA 1GI2A 4HGCA 1A46H 3ODFA 4GCHF 1BDAA 1QQUA 1TNHA 3LJJA 4CH8B 1LKBA 5BPEA 4BXWA 3TJUA 2FYQA 3QWCH 2WPHS 2FXRA 4BAMB 5A8ZA 3GDVA 4Y7BA 1AN1E 2FM2A 1C5QA 2P59A 1PYTD 3PROA 1GHXH 1MTUA 1ZJDA 3TVJB 1L0ZA 3UOUA 2PGQB 2FWWA 1UMAH 2ZGCA 1FI8A 1O2NA 3NXPA 1Y3YA 2EI6A 3LONA 1O2MA 1GGDC 4NZLA 4KKDA 1AWFH 4F49A 3M5NA 4TYDA 1KLTA 4GHTA 1HJAB 4CREA 4GLYA 1IOEA 1J17T 3TK6A 3Q3XA 3O8CA 1G3CA 3F68H 2PUQH 2A2XH 3BTQE 2J4IA 1ESAA 1SGYE 4R8TB 5JBCS 1E38B 3UWIA 1QL8A 1GG6B 1O3CA 6ESTA 1NFXA 1OWIA 3ZZDA 3QN7A 2RG3A 1A7SA 1NPMA 1ELDE 1O2XA 1CA0C 5TCCA 4X2YA 3BIUH 4ZHLU 2FIRH 1YM0A 2BVRH 2Q6GA 4FUDA 2GMTC 2GTBA 3F6UH 4ISOA 4ZH8A 1BBRK 2QIQA 3DD2H 1AFEH 2XW9A 1QB1A 4E06H 1GBHA 4FU9A 3EQ0H 3N7OA 3PB1E 2P8OB 1N6YA 3SQEE 1TMTH 1WTGH 5C2ZA 1MUEB 1V2UT 2DUCA 3SI4H 2GZ7A 2J94A 5DP7A 2M5TA 4ESTE 3TNTA 3MI4A 3Q76A 1MZAA 4YOGA 3Q3YA 4U2WA 2GD4B 3EA8A 2A5AA 2AIQA 3A8BA 1J9CH 4CHAB 1TFXA 1ETRH 1BTWA 1WCZA 2GV6A 1C1MA 2ANMH 3CENA 1ZYOA 3LGWA 3PLPA 3SHAH 2D1JA 2R2WU 1SOTA 2K1QA 3KF2A 2QCYA 2GX4A 1QRXA 3MH5A 3A7YA 3TJNA 1KLIH 1TLDA 1HAVA 3GDUA 5AFYH 3V3MA 3RU4E 3SV8A 4U01A 3TGIE 1A0JA 3GCNA 2ZDKA 2G5NA 1DS2E 3CS7A 2J92A 2ZCLP 1DXWA 4U32A 1P2JA 1S6FA 1HJ9A 2PKSB 4IC5A 3ZZ4A 3ZV8A 1RRKA 4NZQA 1ZHMA 3RM0H 2BXUH 2J38A 2AGGX 2BLWA 3GY2A 1P2NA 3GY5A 1V2VT 3ENSB 5DP3A 2PSYA 1GMDF 1DFPA 1DT2A 3HK6B 1F5RA 3B9FH 1TGSZ 1PQ5A 5F6MA 3MNXA 2F9VA 1TBZH 5GPIB 4MG3A 1LPGB 2ZU2A 3WY8A 6LPRA 3K9XB 3M5OA 1K2I1 3TITA 4JK5A 1C5XB 5HM2A 2QXHA 3R0FA 4OS2A 1OS8A 1ZMLA 1UVTH 5JBTA 1ABJH 1VJAU 1TOMH 1KXFA 3ODDA 4NSVA 4NGAH 3MFJA 3O8BA 1BRUP 1THRH 1RS0A 1EKBB 2VINA 1IQHA 1DE7H 1GJ5H 1AKSB 2TGTA 4Z6AH 1OYTH 1LVBA 1SHYA 2KAIB 1D9IA 1KXEA 2FMJA 3RM2H 2ZQ2A 2A5KA 1S82A 2H9EH 3KN2A 5DG6A 1ZLRA 5GIBA 3MH6A 1F5LA 3P17H 1NROH 3S7HB 5AHGH 3RUOA 1P9SA 1BRCE 1TPOA 3H7TA 1QA0A 1P12E 1SGDE 2A4QA 1C5SA 1QJ7B 3FVFB 3DHKH 3FAOA 2JETC 1DX5M 1QA7A 2C8XB 5FCRA 2GCTC 2ZPQA 4A1XA 3SUGA 1IQJA 1FIWA 1K1PA 4WVPE 1SGTA 2CMYA 1Y3UA 1E36B 1AVXA 3RXUA 1V2LT 2CV3A 1C2GA 3SNDA 1TALA 1RTKA 1EOJA 2FLBH 1SLWB 3AAUA 3D23A 4NG9H 4X6MA 4BAKB 1GVKB 4X6NA 1A2CH 3LKWA 1QBVH 1RFNA 1BJUA 3KGPA 3SV6A 1ID5H 1VITH 3QGNB 3EE0B 1PQ8A 4I8KA 2ZDAH 3RDZA 4Y79A 1SHHB 1SGPE 1PYTC 3D49H 1ELCA 4FUIA 2OBQA 5EQRA 1E34B 4ABEA 1NC6A 1LVOA 1C5YB 1VJ9U 2AH4X 3MTYA 1KSNA 1GCTC 1V2ST 2HPPH 1VGCB 2ZGJA 2EI7A 5B6OA 1QY6A 1YGCH 2BQWB 3UY9A 3OYPA 1C1RA 4KTSA 1ORFA 2Z7FE 3DUXH 5EXNA 1WTHD 2JH0D 2OBOA 1CBWC 1TNKA 4YLUA 4X8UH 2TGDA 1HUTH 1C1PA 5E0HA 5BRRE 3SU4A 3GY8A 1GBBA 1GBAA 1J8AA 4KTCA 2ZWLH 3BN9A 2VU8E 1GI6A 3PTNA 1CSOE 1BB0B 4BAOB 1LHDH 4FXGH 2BX4A 1WYKA 1EP5A 1P2KA 4OGYA 2ZGBH 2XWBI 1PQ7A 2OQUA 3SV2H 2FOMB 1UTQA 5T3HA 1DY8A 3BTME 1DXPA 3UNQA 1TOCB 3RXMA 1O3HA 2ALPA 3BG4B 2ZCHP 1O3GA 2C8ZB 3MOCA 2WUCA 3M5MA 1JBUH 1LDTT 1SVPA 1ELAA 5EPYA 5HM9A 1EZSC 1VCPA 2Y81A 1HAIH 4ISLA 3E3TA 1BMNH 2GZ8A 3RXKA 4ZXXH 1DVAH 1GDUA 3A81A 1C5TA 4NA7A 1ZSLA 1O2OA 1Z1JA 1DANH 1MCTA 3TH2H 3SBKA 2ZKSA 1BMLA 4X6OA 2O9QA 5LPFA 4H42U 2OLGA 2XCFA 1O3NA 2BY7X 2ZU1A 2GDDA 1GI1A 3MO3A 4ISIH 4ZROA 2H1UA 3MHWU 1NM6A 3RC6A 2VH0A 1LHGH 3SJ8A 1OWDA 5H4IB 3KCGH 2CN0H 3LJOA 3ITIA 1MD7A 2YOLA 2ZA5A 3RXLA 3TJOA 2FOAA 3SU2A 3I29A 2QAAA 5EQSA 1SBWA 2PKAA 4RSPA 3KQCA 2ODQA 4LZ1H 1O3LA 3RXSA 3OSYA 1V2KT 2WYJA 1UTJA 1IQIA 2TGPZ 2F91A 3SOSA 2R0LA 2H9HA 1JMOH 1GMCG 2FOBA 1BMAA 4Y0ZE 3E1XB 1PPCE 4AFUA 2ZHEH 1F0TA 1SLXB 1V3XA 3Q77A 1F0UA 3S9BA 1MKXH 4KTUA 4JMYA 3MWIU 4ZUHA 1TQ0B 1EXFA 1Z7KA 1Y5UT 1H4WA 2ZF0H 1DWBH 2HRVA 1OKXA 1ZPZA 4Y71A 2A0QB 1S81A 1XM1A 4D7GA 3SNCA 3MH7A 3S69A 2HLCA 2Y5HA 1GBEA 1HAYB 3K65B 2ZFFH 1HB0B 3UNRA 2D26C 2ZTZA 1E37B 2FS9A 4HZHA 3AAVA 1AFQB 1QRZA 1YLCA 2VH6A 2XC5A 1XXFA 2SGAA 2GP9B 2ODYB 2G55A 3M3TA 2CHAB 1FIZA 2BY9X 2QXIA 4FVDA 1ELGA 2FI5E 2O8TA 4ABHA 4ZXYH 2VIWA 2QYIA 3U8OH 3ZZCA 2FPZA 3HK3B 1YKTA 1GL0E 1TRMA 3P8GA 1EJMA 3UREA 8ESTE 1Q31A 4Y11E 1EPTB 4FU7A 1FN8A 3TJVA 3QX5H 4WMFA 3OY5U 5I25A 1C2EA 1QURH 4AB9A 2A7HA 2AIPA 3T2NA 3P95A 3ZVCA 4B2BA 4DG4A 1MH0A 5T6FA 1PPBH 2VB0A 2V3OH 2OQ5A 2AMDA 2VWOA 1A1RA 1G2LA 1TB6H 4CRGA 4RN6A 1O39A 2O8MA 2TRMA 5C5OA 4B76A 1W3CA 2SNVA 5FX5A 4IC6A 1HRTH 1YPHC 3KIDU 4MQAA 1C5UA 2XC0A 3RXJA 2PR3A 1GHAG 1UVUH 3BTHE 1AVGH 3QK1A 5C67A 2UWPA 5CE1A 4LZ4B 1G9IE 3URCA 1TPAE 1SQAA 1NY22 2G5VA 2VIPA 3V12A 4K1SA 1BT7A 2ZHDA 3M5LA 5T6DA 4E7NA 1THPB 2XYAA 3NPSA 1ESBA 4TPIZ 2D2DA 1MQ6A 1ZSKA 3BTKE 1FUJA 4B1TA 3SGBE 1MKWH 3VGCB 3GDSA 2BLQA 1EZXC 2STBE 1EATA 1EAWA 3E90B 5F8XA 4ZKOU 4X1SU 3SU5A 1NTPA 3QO6A 4OS4A 2B7DH 4AYYB 3TK9A 1PPEE 3A85A 4GUXA 3RLYH 1Y5AT 2BLOA 1O30A 2XBYA 3U1JB 1GPZA 2ZDVH 2SFAA 1O2KA 1XUJA 5EW1H 1ZHPA 1H1BA 5FPTA 1C2JA 3AASA 5E0JA 5GXPA 2WUBA 2BD9A 4XOJA 3UWJH 1ANDA 2A7JA 4XBBA 4CBOA 2ZCKP
chains in the Genus database with same CATH superfamily
1QR3E 1XUHA 4LXBH 1BTYA 3GYMA 1GJ9B 1O2HA 1D3TB 1O2VA 2FEQH 1P8VC 2RDLA 5KECA 2C4FH 1D3QB 2BHGA 3P92A 3W94A 2OINA 4NWKA 3RMMH 5GCHG 1A5HA 2BY8X 3KEEA 1TIOA 3O8DA 3LC5A 1UHBB 1PPGE 1P2QA 1KXBA 2ASUB 3F9GA 1JRSA 1ZTLA 3U8RH 1YWUA 4D8NA 2BDHA 3VFEA 1SSXA 2ZDLA 6CHAB 3DSOA 1O5GH 2UUJB 2Q6DA 1TABE 1P57B 2PFEA 5I46H 3K6YA 2R9PA 1TONA 1WXRA 1YCPM 2OUAA 4JYUH 1VZQH 4TWWA 1RXPA 1GJAB 4MNWA 2NU2E 1VITG 1TGNA 3T29A 2YNBA 1O5DH 1YPGH 1XKAC 1GWAA 3PWBA 1GI0A 1K1NA 1BRBE 2VIDA 4INHA 1DPOA 1SGIB 2LPRA 5EXLA 4MPVA 1WQSA 2UWLA 3TU7H 2ALVA 4K69A 4Q7YA 3WW7A 3ZVBA 1AB9B 4I31A 2PTNA 1O5CB 2Z3EA 3SHCH 1OWJA 1GJCB 1EZQA 3OTPA 1T8LA 1TX6A 1C5MD 2QN5T 2HGTH 4R0IA 3FP7E 5FX6A 1O2PA 4P02A 1V2PT 1U6QA 3A88A 2XNIA 4BTTB 2YMSD 1WUNH 3P6ZB 1AI8H 2VWNA 4LK4A 1A3EH 1FMGA 2JIZD 2PW8H 5DKMA 2A2QH 1GBCA 1L4ZA 1C9TA 8LPRA 2ZI2H 1UVPA 1YBWA 3ZV9A 3UQVA 1AZZA 5C17A 3RC5A 4ACAA 1Z8JB 2KCOA 2ZU3A 3LOXA 1TAWA 1O33A 1AUJA 3UIRA 3SV9A 4YT7H 1Y3VA 1HAPH 3VEQB 5JB8S 3PO1C 1GMHG 1XXDA 4TT3D 5DP6A 1P09A 2ZTYA 3SW2B 1C1NA 1IQLA 3RU4D 3W95A 1UCYE 3U1IB 2J95A 1AGJA 3HKIB 1MTNC 1UVOA 4K60A 1SGFG 1BRAA 1CHOG 4B73A 3ZYEA 3ATMA 1Y5BT 2FDAA 1EB1H 1OXGA 1V2JT 1F7ZA 4MNYA 3RMOH 5C3NA 1L1JA 3N99A 1JXPA 1NRRH 2STAE 1B5GH 3LPRA 3ZIAD 5FPSA 1A5IA 2GVFA 4MTBA 1LQDB 3SI3H 1CT0E 2XWAA 3LU9B 4CBNA 1SL3A 4A6LA 2ZNKH 3ESTA 2HNTC 1KDQB 1O2ZA 2AHME 3HATH 1TNGA 2ZPRA 2Z3DA 1BHXB 2FI3E 3F0PA 1ZSJA 4INKA 1YCPH 2WINI 1DOJA 1T4UH 4DT4A 1MU6B 2NU4E 4X2VA 1O35A 1BTUA 2IJD1 1O5FH 2ZDNA 3SN8A 3TGJE 2WPMS 3A7XA 4AN7A 1SOZA 1V2WT 1TNIA 2FODA 1YPJH 3A8AA 2ZECA 1WSSH 3MYWA 3SYJA 2VVVA 3KL6A 5TCAA 1QBOA 5FHTA 2BZ6H 1O3EA 1V2OT 3V13A 1YPEH 4K2YA 3ZVAA 2XXLA 1MKXK 2H2ZA 5A09A 3AK5A 1O32A 2BDCA 2RDEA 4JCNA 1Y59T 4THNH 2R3YA 5C1UA 2FESH 2BDYA 3P8OA 3RU4T 5LGOA 5E2OA 3SUFA 2UUFB 2F9NA 1MU8B 2AGEX 5CHAC 1GBTA 1GJ7B 2OCVB 2DE9A 2VWLA 2W7UA 2JJ2D 5HYOA 2C3SA 1K22H 2A4GA 1SGRE 3MU4A 3TLOA 5EJ1A 1RIWC 1BTPA 1N8OC 2F3CE 2RCEA 1XKBC 1AE5A 1AUTC 4J1YA 3P70B 1TQ7B 1A3BH 4DIHH 3UNSA 5AF9H 2V35A 1Q2WA 3BTFE 3LH3A 4DT7B 4WWYA 3D65E 4MVNA 2JKHA 4F55A 4GSOA 1P06A 3AW1A 1JIRA 1GJ4H 2BD2A 1ETTH 3DSGA 4FOUC 5A0BA 2W3IA 4XDEA 3CP7A 1Y3WA 2FTLE 3FKSD 3RXIA 4ABJA 1SMFE 1O3FA 1TGTA 5J4SA 1MCVA 3DSPA 1ZRBA 1MD8A 1CE5A 3STJA 5L2ZH 1YY3A 1B0EA 1E1QD 2FTMA 3IWMA 3ATLA 4YLQH 3PM3A 2J98A 4IMQA 4O9VA 5EJLA 1NU9A 4CRCA 1WDIA 4Y0YE 5PTPA 4ASUD 5T6GA 3UTUH 2WYGA 3GCHB 3PMAB 4UEHH 8GCHG 1BTXA 3CNRA 3CS0A 3BTWE 3PMHB 4LOYH 2V7QD 2UWOA 3SU6A 4ACBA 1GJDB 2ANWA 2LNCA 1GI9B 1MKWK 1KXCA 1XUKA 4KELA 1GL1A 3KQBA 1C5RA 1BUIA 2B0FA 1VCWA 1YPLH 4HFPB 1HBTH 3EDXB 2VIVA 1FXYA 3H7OA 2PLXA 1IQNA 1F2SE 1SLVB 1QQ4A 1LTOA 4MPWA 4AC9A 5L2YH 1L4DA 4DCDA 4OS5A 1FV9A 5FAHA 4TWYA 2G52A 1TMBH 1CA8B 2JH5D 1NS3A 3B23B 4AB8A 1F5KU 3A86A 1SPJA 5JDUB 1EX3A 3QZQA 4I8LA 3RXPA 3BEUA 4A5TS 3KNXA 1TGBA 1GCDA 3A83A 1GBDA 2L6OA 2RA0A 2A32A 1XMNB 2FS8A 1T7CA 4AGKA 1GJBB 1A0HB 1GGDB 5F8TA 3A7VA 2Y5GA 2P95A 4D9QA 1HAZB 2QV1A 2FX6A 2GT7A 4KGAA 1GBIA 2CGAA 1GMCF 1CQQA 4UONA 1EJAA 4OS1A 2ZZUH 1MZDA 4CH2B 2A7CA 2EEKA 3GISB 4XE4A 3WWBA 4ZKRU 5CHBA 4RI0A 5EPNA 1XX9A 1AKSA 1GHWH 1INCA 4CR5A 4JZIA 1X7AC 3AVZA 1HDTH 3FN8A 4O3UA 2KAIA 1HIAA 4CRFA 3GY3A 2O8LA 5B6LA 3RXAA 1Z6EA 1UTMA 5IYTA 1YLDA 5FPYA 4A7IB 4D7FA 1GVZA 1V2QT 1FJSA 1KTSB 1O2IA 2B9LA 5ETXA 1FAKH 1BZXE 1F0RA 4INLA 4WH6A 1SGQE 4X6PA 1EAUA 2TBSA 3BTEE 4Y6DA 1MMJN 1CA0B 3EGKH 3M7QA 3MO9A 1NRQH 4FUJA 5AFZH 1ZPBA 2FX4A 2BDBA 4DOQA 2GMTB 1ARCA 3GCTG 1G30B 2YNAA 3FP8E 1TA2A 1BMFD 1HJ8A 3A84A 1AD8H 4YZUA 1P2MA 2KCPA 1GMDG 1LVMA 1NRSH 2FOEA 5F8ZA 5JBBS 4H6TA 1N6XA 1DSTA 2ZHQH 3MU5A 4I7YH 3N7DA 3M3VA 4ABIA 2F43B 2VGCC 2AYWA 1YPHE 1B0FA 1QL7A 4BTUB 4JYVH 3GCOA 4X8SH 1FQ3A 2NU0E 3RMLH 2F83A 2FOGA 1FPCH 1UW7A 4DVAU 6GCHG 1YYY1 1GHAF 3EYDA 2V0BA 2PGBB 4AZ2B 3V7TA 2FI4E 4X8VH 1QJ6B 3RXFA 4UFEH 4BAHB 3RP2A 4GAWA 5C0UA 2UUYA 3RXQA 2XBVA 1C5NH 2HVXA 4J2YB 2BMGB 1C5ZB 1Z8RA 4XBDA 1Y3XA 5EQQA 1P03A 4IW4E 5ESTE 2WSSD 1SQOA 3F2FA 2ILNA 1HAXB 4B2CA 1S0QA 3RXEA 3KQEA 1ZGVA 5C1YA 3E6PH 3SJIA 1TWXB 1O2QA 1BCUH 4JZ1A 5F53A 5IDKA 2B8OH 1TYNA 3OTJE 2CXVA 1DY9A 3QGJA 5JBAS 3SU1A 1C2HA 3T28A 1ZPCA 3TPIZ 4MPUA 1K1OA 1ELVA 3K2UA 2VJ1A 1W8BH 3GY6A 1P9UA 1YF4A 1W2KH 2H5CA 4NCYA 1MAXA 1MABB 1DSUA 1YCPK 1ZTKA 3GICB 3FP6E 1TRYA 1G2MA 1IAUA 1Y8TA 3RXHA 1EJNA 1OWEA 1KTTB 1QBNA 3L33A 1H8HD 1SGEE 1IQMA 2J9NA 4HTCH 5GCHF 2GKVE 3E16B 4Z1MD 1HJAC 4OM9A 3MU0A 3R3GB 3ATWA 5DSFA 2Z6BD 1W12U 5DK1A 3LGUA 2C8YB 2A45B 4FUEA 3T27A 2KFWA 3LT3A 2ZGXH 4K1TA 2XC4A 3RXCA 1GBMA 3SQHE 3PMBB 1QJ1B 4GHQA 4K5ZA 1GG6C 4BTIB 3ZZ3A 3HKJB 1GJ6A 1PFXC 1VITF 1K1MA 4TPYA 1FONA 5A8YA 1OWKA 1IHSH 1RTFB 1OWHA 4YOJA 4I33A 2Z94A 1HNEE 1KMHB 3LGIA 4HG6A 3H5CB 4GPGA 2Z9LA 2PP6A 1LVYA 2JETB 2SNWA 5JB9S 2GCTB 4ZAEA 1PPHE 1O3IA 2V3MA 1TRNA 1BIOA 3QLPH 1XUGA 1O5AB 3UB0A 3FZDA 1BTZA 3I77A 4NFEA 2AS9A 2WV4A 5K7RA 1AY6H 3VXEH 2P8OC 4D76A 1FPHH 3KQDA 3OU0A 9ESTA 1BA8B 1TMUH 1UCYH 2R3UA 4WXVA 2KZ4A 2Y7ZA 4YTAA 3SO3A 3ZZAA 4UFGH 4NIWA 1C1WH 3T26A 5LH8A 4NA8A 4BAQB 3NUMA 5DJ7A 1C1VH 1O2LA 2GZ9A 4YOIA 3U98H 4CHAC 3M3SA 1YPMH 3P8NA 5DP5A 1QFKH 2XCNA 1TGCA 1E0FD 2QF0A 8KME2 3LH1A 5FBEA 3RXBA 1TX8A 3NWUA 3SJOA 1GVLA 1NU7B 2IJOB 1GCTB 2Z9JA 1W0ZU 1LPZB 5C1XA 3SNAA 1O3MA 4CRDA 1BQYA 4UFDH 2BYAX 1COWD 3UFAA 1AE8H 1FX0B 2FOCA 1CHOF 1LPKB 3VB4A 4X1NU 3ZZ5A 2G4UA 3S0NA 1SFQB 1AZ8A 2W3KA 3FANA 1CBWB 2PKSC 5DGJA 1IQKA 1HXEH 1C4V2 5ABWA 4AFQA 5AVDA 2HNTE 3KYFA 3UR6A 1P0SH 2I6QA 4HI3A 4SGBE 1NT1A 7LPRA 1S0RA 2ODPA 1QL9A 3OAAD 5EODA 1C9PA 2A1DB 3LC3A 4MNVA 2ZO3H 1EPTA 1DDJA 1NFWA 1PJPA 1H8ED 1A4WH 1EOLA 4WJG2 2BVSH 2QF5A 2IOTA 1O31A 1UTNA 4AG2A 2K0QA 3DA9B 1DWDH 1WV7H 2GCHG 2O8UA 2FP7B 5J4QA 5LPEA 1K21H 1UTPA 2H9TH 3Q3KA 1O38A 1G37A 4FUFA 4AYVB 2FLRH 1H9IE 1FZZA 5CDFE 1EASA 4ABDA 1FN6A 1BBRE 3HGNA 1HFDA 3IITA 3TIUA 2IPQX 2Q6FA 2ZFSA 1WBGB 2Y82A 1W13U 1MAYA 1ZJKA 3DT0H 3E0PB 1C5PA 1VCQA 3MNCA 4WMDA 4B2AA 1SGNE 2BB4A 1O3PB 1O2RA 2BDIA 1ABIH 1ELBA 4X2XA 4YM9A 2BQ6B 1GHZA 3BV9B 3TH3H 1HAOH 3RXVA 3ZVGA 3LGTA 1WU1A 2QF4A 1D3DB 1P10A 2BY6X 1WAYB 1W7XH 1A0LA 1J16A 1DLEA 1SGCA 1K28D 5E2PA 2BQ7B 4X2WA 2H6MA 2OD3B 2RFKC 1JRTA 1OX1A 1C2MA 1O3DA 4D9RA 1GDNA 2P94A 3NK8A 1FY3A 3ZZ8A 4ZMAH 2BD7A 3S9AA 3G01A 2P16A 3UR9A 3U8TH 2GDEH 1QHRB 2IPHA 4WMEA 4TY6A 1T32A 4ZKNU 3SU3A 3F1SB 1SI5H 3ATIA 1UHBA 2BD4A 1EAIA 1W0YH 3VB7A 4FUHA 1T8OA 4DW2U 4H4FA 2TPIZ 1C2KA 2P3TB 4BNRA 4ZCNA 3MU1A 1YPKH 1UK2A 3JZ2B 1NFUA 3F9EA 3FO8D 2GGVB 5ESBA 1O2YA 2Z3CA 4Q7XA 5CMXH 5JPMH 1VGCC 2ANYA 1NFYA 5L6NH 1ZRKA 2SGQE 1HAVB 3BF6H 4WF8A 8GCHF 5HXFA 1DM4B 1ESTA 4NIYA 3C1KA 3UPEA 2XRCA 3T5FH 1M9UA 4F48B 4WXIA 3I78A 1GBJA 3QTOH 4F4OC 5A0AE 4Y7AA 4Z0KA 3LIWA 3TNSA 1CT4E 3SUDA 2G00A 4CRAA 2OC8A 4ABFA 1BMMH 2BD8A 4AFSA 2SGEE 1FDPA 2ZG0H 1XUIA 2ZEBA 2WPIS 3BG8A 3BIVH 2SGPE 1SFIA 1KLJH 2F4LA 3RMNH 3MH4A 1ZGIA 3L6PA 4DGJA 5HGGA 1ELFA 9LPRA 3PMJA 3T62A 2W26A 1AHTH 4K3JA 3PLKA 1YC0A 1TPSA 3RC4A 1MTVA 5FXLA 4Q4LA 3BEFB 4ISNA 3RXDA 1ELEE 2SGFE 4OGXA 4FUBA 1LO6A 2LP6A 3KQ5A 1O36A 1ETSH 1C4U2 4E7RG 4YO9A 1GBKA 5EW2H 1NESE 1O2SA 2ZFPH 1P05A 4Y8XA 4FUCA 3BG4C 3V0XA 1GHBG 4A1VA 1SC8U 1W0JD 2UUKB 5LPRA 3SZEA 2HOBA 1ANBA 3MU8A 4JZEH 1D4PB 1ZTJA 5KEDA 2KCAA 4IS5A 3SUEA 1FLEE 5FBIA 7ESTE 2Z9GA 4NIVA 1HPGA 4B75A 4MLFB 2ZTXA 4Y10E 4XFQA 3GYLB 7GCHG 3F9FA 2OK5A 1LHEH 5DP8A 1J15A 1GBFA 2ZQ1A 1IQEA 4DJZB 2GV7A 4NA9H 2EA3A 1IQFA 4VGCB 1SQRA 2F9OA 2NU3E 4XSKU 2OC7A 2FZZA 5G4BA 2HLDD 2Z9IA 3BEIB 2AEIH 1P2IA 3EA7A 1FY8E 3SNEA 4WY3A 4SGAE 1GI5A 5EU8A 1GI8B 3QDZB 1PPFE 4Q7ZA 1ARBA 4GCHG 2Z9KA 1C4Y2 5EIYA 2V3HH 3GY4A 2OXSA 1AU8A 4RT0A 5F03A 5GJ4B 3OY6U 2BTCE 3PYHA 3SJKA 1TA6A 3SORA 2WPLS 1YP9A 2Y7XA 1KDQA 4UFFH 2F9UA 1C2FA 1Q3XA 4CRBA 3GCTF 2AMPA 2ZFQH 1V2MT 1K9OE 1S5SA 2A5IA 3A7ZA 1GJ8B 1H9LB 2ULLA 1FNIA 1NRPH 5E0GA 1AVWA 1NBME 4QT8C 3A80A 3UAIC 5EXMA 4BXSA 2HALA 2WPKS 3TK5A 1UCYK 3STIA 1QGFA 4XBCA 2ZC9H 3L3TA 2V6NA 1ZMNA 1HXFH 1YLNA 4NWLA 5HMAA 3RXTA 1DITH 2VWMA 1O5BB 4IGDA 3S9CA 3LGYA 4FUGA 2ZP0H 2EC9H 1O3KA 3MMGA 6GCHF 1C2LA 3ATKA 4AOQA 4ZKSU 1O34A 4B71A 3O8RA 2ZU4A 2QXJA 1C1SA 2CF8H 1GI7B 2F9BH 2OC1A 4MDSA 1K1IA 1HIAB 1O3BA 4RKOB 1AFQC 3A8CA 2BY5X 3ZYDA 1TPPA 3FFGA 1TNLA 4I8HA 1C5VA 2C93B 5HKKD 3U69H 4MPXA 1CO7E 1GI4A 4IBLH 2CHAC 5JYIA 4CR9A 3ZZ9A 5C94A 1P01A 3LDXH 3HGPA 2PHBA 3M7UA 4BOHA 1E35B 1HAGE 1LKAA 3F2GA 3MNSA 3D62A 3GY7A 3A87A 1DLKB 2P3UB 1BOQA 3IG6B 4O97A 1EPTC 4FETA 2J34A 1BITA 1VKYA 2NU1E 3QTVH 2LELA 3E0NB 1G36A 1ANCA 3SNBA 2QC2A 1QTFA 1ZZZA 2J2UA 2TGAA 3BTTE 1FAXA 2OC0A 1DUEA 4GVUA 4A92A 2YMSC 5KGOA 1O3OA 3TGKE 1OP2A 1SG8B 1RGQA 1PPZA 1O2UA 1CT2E 4I32A 1WQVH 2XNDD 1RJXB 4KP0A 1O0DH 3BTDE 1LQEA 1HYLA 1L2EA 1LCYA 2QA9E 3BSQA 3PO1B 3BTGE 2BZAA 3A82A 3F9HA 4DURA 1IQGA 4AG1A 4X1QU 2R2MB 1P3CA 1HAHH 2F9PA 1C5WB 2I6SA 2ZFRH 2PV9B 1MTNB 1E1RD 3VGCC 3KHVA 1QNJA 1LHCH 1DUAA 3PV5A 1QB6A 1A61H 3A8DA 2FOHA 3M35A 1K1LA 1EUFA 1T8MA 2HWLB 4I8GA 2A4OA 4NSYA 3B8JA 2WHXA 2WPDD 1DWEH 1S83A 2XBWA 1HGTH 1C1TA 1EP6A 4RKJB 1UK3A 1HV7A 3E91A 2BDGA 2DE8A 3A7TA 2BVXH 1BHXF 2BXTH 2HPQH 2BDAA 1GI3A 1KYNA 3URDA 4X0WU 1LHFH 1CHGA 3DFJA 3M7TA 2XOKD 1C2IA 2G51A 1QCPA 1HLTH 1L1NA 4TY7A 1DWCH 1CGHA 1ZHRA 2BOHB 1O37A 2PKAB 2AGIX 1C1UH 3Q00A 1FY1A 2BM2A 2OTVA 4JZDH 1O3AA 1H9HE 4X8TH 1W7GH 3QUMP 3ZVDA 2BD5A 1ACBE 4UDWH 5C0TA 1L1GA 3U9AH 5EG4A 1UO6A 1UTKA 1TBQH 2GT8A 3M37A 1EB2A 1B7XB 3N7EA 7KMEH 6CHAC 4Y8YA 1JIMA 2B5TB 1KY9A 5TJXA 3ZZBA 1MQ5A 3K6ZA 1EAXA 1Z1IA 1XUFA 1MTWA 4UD9H 1CU1A 1BJVA 4U30A 1V2RT 1V6DA 1SLUB 1G3EA 2VVUA 1O2TA 4IN1A 1TBRH 1FY4A 1NO9H 5CHAB 3NCLA 4AORA 1SGFA 1Z6JH 1VR1H 1SB1H 2RA3A 4JYTA 3AW0A 3SZNA 2Y5FA 3VB3A 3PWCA 4I8JA 5GDSH 2WV5A 5C20A 5DPAA 4UE7H 1AB9C 5A8XA 1RIWB 1N8OB 2HVYB 4JZFH 2OP9A 1RTLA 5FCKA 2EI8A 1BBRH 5A0CA 1RD3B 2WPJS 2QXGA 4ASHA 2THFB 1C1QA 4NIXA 1T4VH 1O3JA 2P3FH 3SGAE 3ZVFA 5GWZA 2BD3A 3EA9A 3UUZA 2BLVA 1GDQA 2VNTA 2J5UA 4YT6H 2GCHF 4PROA 3VPKA 2ZIQH 1ZMJA 2PWXA 1BTHH 3UOPA 3C27B 2CJIA 2PTCE 1KIGH 1NZQH 2C90B 3TH4H 4DIIH 2Q1JA 2CF9H 3PV4A 1EZUC 3FZZA 1OP0A 3SGQE 5EOKA 3PTBA 1TX7A 2ZDMA 3NRLA 4I86A 2ZHFH 3KYGA 1KXDA 2IN2A 5DO4H 3F2HA 1ELTA 4K8YA 1UVSH 3SV7A 4AX9H 1F92A 2J97A 3UQOA 4JK6A 1D6WA 1WOFA 1P04A 4Q2KA 1W11U 1AO5A 1C5OH 1THSH 1W0KD 1P3EA 1ANEA 1C2DA 1Z8IB 5DP4A 2G8TA 4ABAA 1JWTA 1S85A 3GOVB 1CVWH 3PRBA 4O3TA 4A1TA 1SQTA 3ZZ6A 1ZR0A 1AMHA 3QZRA 1QIXB 1O2WA 1NN6A 1S84A 1UTLM 1XVOA 1GHYH 3GS9A 2FYRA 3A89A 1G32B 1H8DH 3F0OA 2A31A 1C5LH 4BANB 1H8IH 1C1OA 2Y6TA 4IMZA 5SGAE 2Y80A 5EGMA 3MQKC 4AGJA 1GHVH 5K0HA 2G4TA 5A2MH 2BX3A 1UJ1A 1CGIE 1G3DA 1T31A 2ESTE 3ELAH 3RLWH 1Z8GA 2KCYA 1OSSA 1GBLA 2AERH 1HCGA 5DP9A 2FO9A 1KXAA 1DICA 3JZ1B 4OS6A 1GMHF 3A7WA 1AQ7A 1W10U 3S7KB 1TNJA 3RXGA 2VIQA 1P11E 4FU8A 4B74A 1MBQA 1IHTH 4ABBA 3M36A 4YESB 2W5EA 2XTTB 2PUXB 3RXOA 1D3PB 1A5GH 2TIOA 4NFFA 1P2OA 4ZHAA 1CGJE 1O2JA 2C8WB 5T1VA 1QB9A 1AIXH 4DY7B 1FY5A 3FOAA 1EQ9A 2ZGHA 4ABGA 1O5EH 4K8BA 4ZHMU 4VGCC 3SJ9A 4WH8A 2QGRA 2ZFTA 1ZOMA 2NWNA 2XBXA 3M61U 4H6SB 5E8EH 3VXFH 2SGDE 1OP8A 1T8NA 1V2NT 3ZZ7A 3P8FA 1AWHB 3MNBA 2G81E 2BOKA 2GJGA 1W14U 3F3BA 3RXRA 2ZPSA 2HNTF 3NKKA 1PQAA 4X1PU 1QRWA 1LMWB 1QZ8A 3VG8A 2W7SA 4E05H 2JH6D 3WWFA 4IN2A 3OX7U 4OS7A 2FOFA 2VVCA 4TSFD 2O8WA 1MBMA 4RT1A 1P02A 2W6ID 4Q80A 2ANKH 3LGVA 5C5NA 5GNDA 2VGCB 1OPHB 2AFQB 1XVMA 3SU0A 1GHBF 1D6RA 4M7GA 3VB5A 4ISHH 1V2TT 1MTSA 2L74A 2P93A 3DFLA 1SR5C 2PSXA 4Y76A 1S6HA 3E8LA 4FVBA 1K1JA 3T25A 1N1LA 2AMQA 3MO6A 1J14A 3VB6A 2ZU5A 4B6EA 1UTOA 1F0SA 2D8WA 3EAJA 3GCHC 1Z71A 7GCHF 4AFZA 1OOKB 2QF3A 4Y8ZA 3HPTB 2QY0B 1O2GH 3NZIA 1JOUB 1NRNH 4O03A 4MNXA 5L30H 2H5DA 1UK4A 1G3BA 4X1RU 3PLBA 2VIOA 1OYQA 1TE0A 2A4RA 4K1EA 2ZHWH 3ZVEA 2R0KA 1GI2A 4HGCA 1A46H 3ODFA 4GCHF 1BDAA 1QQUA 1TNHA 3LJJA 4CH8B 1LKBA 5BPEA 4BXWA 3TJUA 2FYQA 3QWCH 2WPHS 2FXRA 4BAMB 5A8ZA 3GDVA 4Y7BA 1AN1E 2FM2A 1C5QA 5IK2D 2QE7D 2P59A 1PYTD 3PROA 2KR7A 1GHXH 1ZJDA 1MTUA 3TVJB 1L0ZA 3UOUA 2PGQB 2FWWA 1UMAH 2ZGCA 1FI8A 1O2NA 3NXPA 1Y3YA 2EI6A 3LONA 1O2MA 1GGDC 4NZLA 4KKDA 1AWFH 4F49A 3M5NA 4TYDA 1KLTA 4GHTA 1HJAB 4CREA 4GLYA 1IOEA 1J17T 3TK6A 3Q3XA 3O8CA 1G3CA 3F68H 2PUQH 2A2XH 3BTQE 2J4IA 1ESAA 1SGYE 4R8TB 5JBCS 1E38B 3UWIA 1QL8A 1GG6B 1O3CA 6ESTA 1NFXA 1OWIA 3ZZDA 3QN7A 3W1EA 2RG3A 1A7SA 1NPMA 1ELDE 1O2XA 1CA0C 2WZQA 2K8IA 4X2YA 5TCCA 3BIUH 4ZHLU 2FIRH 1YM0A 2BVRH 2Q6GA 4FUDA 2GMTC 2GTBA 3F6UH 4ISOA 4ZH8A 1BBRK 2QIQA 3DD2H 1AFEH 2XW9A 1QB1A 4E06H 1GBHA 1NBMD 4FU9A 3EQ0H 3N7OA 3PB1E 2P8OB 1N6YA 3SQEE 1TMTH 1WTGH 5C2ZA 1MUEB 1V2UT 2DUCA 3SI4H 2GZ7A 2J94A 5DP7A 2M5TA 4ESTE 3TNTA 3MI4A 3Q76A 1MZAA 4YOGA 3Q3YA 4U2WA 2GD4B 3EA8A 2A5AA 2AIQA 3A8BA 1J9CH 2VBCA 2J98B 4CHAB 4YXWD 1TFXA 1ETRH 1BTWA 1WCZA 2GV6A 3OE7D 1C1MA 2ANMH 3CENA 1ZYOA 3LGWA 3PLPA 3SHAH 2D1JA 2R2WU 1SOTA 2K1QA 3KF2A 2QCYA 2GX4A 1QRXA 3MH5A 3A7YA 3TJNA 1KLIH 1TLDA 1HAVA 3GDUA 5AFYH 3V3MA 3RU4E 3SV8A 4U01A 3TGIE 1A0JA 3GCNA 2ZDKA 2G5NA 1DS2E 3CS7A 2J92A 2ZCLP 1DXWA 4U32A 1P2JA 1S6FA 1HJ9A 2PKSB 4IC5A 3ZZ4A 3ZV8A 1RRKA 4NZQA 1ZHMA 3RM0H 2BXUH 2J38A 2AGGX 2BLWA 3GY2A 1P2NA 3GY5A 1V2VT 3ENSB 5DP3A 2PSYA 1GMDF 1DFPA 1DT2A 3HK6B 3OEHD 1F5RA 3B9FH 1TGSZ 1PQ5A 5F6MA 3MNXA 2F9VA 1TBZH 5FL7D 5GPIB 4MG3A 1LPGB 2ZU2A 3WY8A 6LPRA 3K9XB 3M5OA 1K2I1 3TITA 4JK5A 1C5XB 5HM2A 2QXHA 3R0FA 4OS2A 1OS8A 1ZMLA 1UVTH 5JBTA 1ABJH 1VJAU 1TOMH 1KXFA 3ODDA 4NSVA 4M9FA 4NGAH 3MFJA 5HIZA 3O8BA 1BRUP 1THRH 1RS0A 1EKBB 2VINA 1IQHA 1DE7H 1GJ5H 1AKSB 5DN6D 2TGTA 4Z6AH 1OYTH 1LVBA 1SHYA 2KAIB 1D9IA 1KXEA 2FMJA 3RM2H 2ZQ2A 2A5KA 1S82A 2H9EH 3KN2A 5DG6A 1ZLRA 5GIBA 3MH6A 1F5LA 3P17H 1NROH 3S7HB 5AHGH 3RUOA 1P9SA 1BRCE 1TPOA 3H7TA 1QA0A 1P12E 1SGDE 2A4QA 1C5SA 1QJ7B 3FVFB 3DHKH 3FAOA 1EFRD 2JETC 1DX5M 1QA7A 2C8XB 5FCRA 2GCTC 2ZPQA 4A1XA 3SUGA 1IQJA 1FIWA 1K1PA 4WVPE 1SGTA 2CMYA 1Y3UA 1E36B 1AVXA 3RXUA 1V2LT 2CV3A 1C2GA 3SNDA 1TALA 1RTKA 1EOJA 2FLBH 1SLWB 3AAUA 3D23A 4NG9H 4X6MA 4BAKB 1GVKB 4X6NA 1A2CH 3LKWA 1QBVH 1RFNA 1BJUA 3KGPA 3SV6A 1ID5H 1VITH 3QGNB 3EE0B 1PQ8A 4I8KA 2ZDAH 3RDZA 4Y79A 1SHHB 1SGPE 1PYTC 3D49H 1ELCA 4B6FA 4FUIA 2OBQA 5EQRA 1E34B 4ABEA 1NC6A 1LVOA 1C5YB 1VJ9U 2AH4X 3MTYA 1KSNA 1GCTC 1V2ST 2HPPH 1VGCB 4Q63A 2ZGJA 2EI7A 5B6OA 1QY6A 1YGCH 2BQWB 3UY9A 3OYPA 5EJZA 1C1RA 4KTSA 1ORFA 2Z7FE 3DUXH 5EXNA 1WTHD 2JH0D 1OHHD 2OBOA 1CBWC 1TNKA 4YLUA 4X8UH 2TGDA 1HUTH 1C1PA 5E0HA 2W6JD 2KM0A 5BRRE 3SU4A 3GY8A 1GBBA 1J8AA 1GBAA 4KTCA 2ZWLH 3BN9A 2VU8E 1GI6A 3PTNA 1CSOE 1BB0B 4BAOB 1LHDH 4FXGH 2BX4A 1WYKA 1EP5A 1P2KA 4OGYA 2ZGBH 2XWBI 1PQ7A 2OQUA 3SV2H 3H09A 2FOMB 1UTQA 5T3HA 1DY8A 3BTME 1DXPA 3UNQA 1TOCB 3RXMA 1O3HA 2ALPA 3BG4B 2ZCHP 1O3GA 2C8ZB 3MOCA 2WUCA 3M5MA 1JBUH 1LDTT 1SVPA 1ELAA 5EPYA 5HM9A 1EZSC 1VCPA 2Y81A 1HAIH 4ISLA 3E3TA 1BMNH 2GZ8A 2JDID 3RXKA 4ZXXH 1DVAH 1GDUA 3A81A 1C5TA 4NA7A 1ZSLA 1O2OA 1Z1JA 1DANH 1MCTA 3TH2H 3SBKA 2ZKSA 1BMLA 4X6OA 2O9QA 2CK3D 3OEED 5LPFA 4H42U 2OLGA 2XCFA 1O3NA 2BY7X 2ZU1A 2GDDA 1GI1A 3MO3A 4ISIH 4ZROA 2H1UA 3MHWU 1NM6A 3RC6A 2VH0A 4XD7D 2KX4A 1LHGH 3SJ8A 1OWDA 5H4IB 3KCGH 2CN0H 3LJOA 3ITIA 1MD7A 2YOLA 2ZA5A 3RXLA 3TJOA 2FOAA 3SU2A 3I29A 2QAAA 5EQSA 1SBWA 1S6LA 2PKAA 4RSPA 3PV2A 3KQCA 2ODQA 4LZ1H 1O3LA 3RXSA 3OSYA 1V2KT 2WYJA 1UTJA 1IQIA 2TGPZ 2F91A 3OFND 3SOSA 2R0LA 2H9HA 1JMOH 1GMCG 2FOBA 1BMAA 4Y0ZE 5HIYA 3E1XB 1PPCE 4AFUA 2ZHEH 1F0TA 3EE7A 1SLXB 1V3XA 3Q77A 1F0UA 3S9BA 1MKXH 4KTUA 4JMYA 3MWIU 4ZUHA 1E79D 1TQ0B 1EXFA 1Z7KA 2M2AA 1Y5UT 1H4WA 2ZF0H 1DWBH 2HRVA 1OKXA 1ZPZA 4Y71A 2A0QB 1S81A 1XM1A 4D7GA 3SNCA 3MH7A 4XRNA 3S69A 2HLCA 2Y5HA 1GBEA 1HAYB 3K65B 2ZFFH 1HB0B 3UNRA 2D26C 2ZTZA 1E37B 2FS9A 4HZHA 3AAVA 1AFQB 1QRZA 1YLCA 2VH6A 2XC5A 1XXFA 2SGAA 3DCLA 2GP9B 2ODYB 2G55A 3M3TA 2CHAB 1FIZA 2BY9X 2QXIA 4FVDA 1ELGA 2FI5E 2O8TA 4ABHA 4ZXYH 2VIWA 2QYIA 3U8OH 3U28C 3ZZCA 2FPZA 3HK3B 3PRDA 1YKTA 1GL0E 1TRMA 3P8GA 1EJMA 3UREA 8ESTE 1Q31A 4Y11E 1EPTB 4FU7A 1FN8A 3TJVA 3QX5H 2JJ1D 3OY5U 4WMFA 5I25A 1C2EA 1QURH 4AB9A 2A7HA 2AIPA 3T2NA 3P95A 3ZVCA 4B2BA 4DG4A 1MH0A 5T6FA 1PPBH 2VB0A 2V3OH 1SKYE 2OQ5A 2AMDA 2EY4C 1A1RA 2VWOA 1G2LA 1TB6H 4CRGA 4RN6A 1O39A 2O8MA 2TRMA 5C5OA 2YMSB 4B76A 1W3CA 2SNVA 5FX5A 4IC6A 1HRTH 1YPHC 3KIDU 4MQAA 1C5UA 2XC0A 3RXJA 1K0HA 2PR3A 1GHAG 1UVUH 3BTHE 1AVGH 2EQNA 3QK1A 5C67A 2UWPA 5CE1A 4LZ4B 1G9IE 3URCA 1TPAE 1SQAA 1NY22 2G5VA 2VIPA 3V12A 4K1SA 1BT7A 2ZHDA 3M5LA 5T6DA 4E7NA 1THPB 2XYAA 3NPSA 1ESBA 4TPIZ 2D2DA 1MQ6A 1ZSKA 2WV9A 1FUJA 3BTKE 3SGBE 4B1TA 1MKWH 3VGCB 3GDSA 2BLQA 1EZXC 2STBE 1EATA 1EAWA 3E90B 5F8XA 4ZKOU 4X1SU 3SU5A 1NTPA 3QO6A 4OS4A 2B7DH 4AYYB 3TK9A 1PPEE 3A85A 4GUXA 3RLYH 1Y5AT 2BLOA 1O30A 2XBYA 3U1JB 1GPZA 2ZDVH 2SFAA 4P00A 1O2KA 1XUJA 5EW1H 1ZHPA 1H1BA 5FPTA 1C2JA 3AASA 5E0JA 5GXPA 2WUBA 2BD9A 4XOJA 3UWJH 1ANDA 2A7JA 4XBBA 4CBOA 2ZCKP
chains in the Genus database with same CATH topology
1QR3E 1XUHA 4LXBH 1BTYA 3GYMA 1GJ9B 1O2HA 1D3TB 1O2VA 2FEQH 1P8VC 2RDLA 2C4FH 1D3QB 2BHGA 3P92A 3W94A 2OINA 4NWKA 3RMMH 5GCHG 1A5HA 2BY8X 3KEEA 1TIOA 3O8DA 3LC5A 1UHBB 1PPGE 1P2QA 1KXBA 2ASUB 3F9GA 1JRSA 1ZTLA 3U8RH 4D8NA 2BDHA 3VFEA 1SSXA 2ZDLA 6CHAB 1O5GH 2UUJB 2Q6DA 1TABE 1P57B 2PFEA 5I46H 3K6YA 2R9PA 1TONA 1YCPM 2OUAA 4JYUH 1VZQH 4TWWA 1RXPA 1GJAB 4MNWA 2NU2E 1VITG 1TGNA 3T29A 2YNBA 1O5DH 1YPGH 1XKAC 1GWAA 3PWBA 1GI0A 1K1NA 1BRBE 2VIDA 4INHA 1DPOA 1SGIB 2LPRA 5EXLA 4MPVA 1WQSA 2UWLA 3TU7H 2ALVA 4K69A 4Q7YA 3ZVBA 1AB9B 4I31A 2PTNA 1O5CB 2Z3EA 3SHCH 1OWJA 1GJCB 1EZQA 1T8LA 1TX6A 1C5MD 2QN5T 2HGTH 4R0IA 3FP7E 5FX6A 1O2PA 1V2PT 1U6QA 3A88A 2XNIA 4BTTB 1WUNH 3P6ZB 1AI8H 2VWNA 4LK4A 1A3EH 1FMGA 2PW8H 5DKMA 2A2QH 1GBCA 1L4ZA 1C9TA 8LPRA 2ZI2H 1UVPA 1YBWA 3ZV9A 3UQVA 1AZZA 3RC5A 1Z8JB 2ZU3A 3LOXA 1TAWA 1O33A 1AUJA 3UIRA 3SV9A 4YT7H 1Y3VA 1HAPH 3VEQB 5JB8S 3PO1C 1GMHG 1XXDA 5DP6A 1P09A 2ZTYA 3SW2B 1C1NA 1IQLA 3RU4D 3W95A 1UCYE 3U1IB 2J95A 1AGJA 3HKIB 1MTNC 1UVOA 4K60A 1SGFG 1BRAA 1CHOG 4B73A 3ZYEA 3ATMA 1Y5BT 2FDAA 1EB1H 1OXGA 1V2JT 1F7ZA 4MNYA 3RMOH 5C3NA 1L1JA 1JXPA 1NRRH 2STAE 1B5GH 3LPRA 5FPSA 1A5IA 2GVFA 4MTBA 1LQDB 3SI3H 1CT0E 2XWAA 3LU9B 4CBNA 1SL3A 4A6LA 2ZNKH 3ESTA 2HNTC 1KDQB 1O2ZA 3HATH 1TNGA 2ZPRA 2Z3DA 1BHXB 2FI3E 1ZSJA 4INKA 1YCPH 2WINI 1DOJA 1T4UH 1MU6B 2NU4E 4X2VA 1O35A 1BTUA 1O5FH 2ZDNA 3SN8A 3TGJE 2WPMS 3A7XA 4AN7A 1SOZA 1V2WT 1TNIA 2FODA 1YPJH 3A8AA 2ZECA 1WSSH 3MYWA 2VVVA 3KL6A 5TCAA 1QBOA 5FHTA 2BZ6H 1O3EA 1V2OT 3V13A 1YPEH 4K2YA 3ZVAA 2XXLA 1MKXK 2H2ZA 5A09A 1O32A 2BDCA 4JCNA 1Y59T 4THNH 2R3YA 5C1UA 2FESH 2BDYA 3P8OA 3RU4T 5LGOA 5E2OA 3SUFA 2UUFB 2F9NA 1MU8B 2AGEX 5CHAC 1GBTA 1GJ7B 2OCVB 2DE9A 2VWLA 2W7UA 5HYOA 2C3SA 1K22H 2A4GA 1SGRE 3MU4A 3TLOA 1RIWC 1BTPA 1N8OC 2F3CE 2RCEA 1XKBC 1AE5A 1AUTC 4J1YA 3P70B 1TQ7B 1A3BH 4DIHH 3UNSA 5AF9H 2V35A 1Q2WA 3BTFE 3LH3A 4DT7B 4WWYA 3D65E 4MVNA 2JKHA 4GSOA 1P06A 3AW1A 1JIRA 1GJ4H 2BD2A 1ETTH 5A0BA 2W3IA 4XDEA 3CP7A 1Y3WA 2FTLE 3RXIA 4ABJA 1SMFE 1O3FA 1TGTA 5J4SA 1MCVA 1ZRBA 1MD8A 1CE5A 3STJA 5L2ZH 1B0EA 2FTMA 3IWMA 3ATLA 4YLQH 3PM3A 4IMQA 4O9VA 1NU9A 4CRCA 4Y0YE 5PTPA 5T6GA 3UTUH 2WYGA 3GCHB 3PMAB 4UEHH 8GCHG 1BTXA 3CS0A 3BTWE 3PMHB 4LOYH 2UWOA 3SU6A 1GJDB 2ANWA 2LNCA 1GI9B 1MKWK 1KXCA 1XUKA 4KELA 1GL1A 3KQBA 1C5RA 1BUIA 2B0FA 1VCWA 1YPLH 4HFPB 1HBTH 3EDXB 2VIVA 1FXYA 3H7OA 2PLXA 1IQNA 1F2SE 1SLVB 1QQ4A 1LTOA 4MPWA 5L2YH 1L4DA 4DCDA 4OS5A 1FV9A 5FAHA 4TWYA 2G52A 1TMBH 1CA8B 2JH5D 1NS3A 3B23B 4AB8A 1F5KU 3A86A 1SPJA 5JDUB 1EX3A 3QZQA 4I8LA 3RXPA 3BEUA 4A5TS 3KNXA 1TGBA 1GCDA 3A83A 1GBDA 2RA0A 2A32A 1XMNB 2FS8A 1T7CA 4AGKA 1GJBB 1A0HB 1GGDB 5F8TA 3A7VA 2Y5GA 2P95A 4D9QA 1HAZB 2QV1A 2FX6A 2GT7A 4KGAA 1GBIA 2CGAA 1GMCF 1CQQA 4UONA 1EJAA 4OS1A 2ZZUH 1MZDA 4CH2B 2A7CA 2EEKA 3GISB 4XE4A 4ZKRU 5EPNA 1XX9A 1AKSA 1GHWH 1INCA 4CR5A 4JZIA 1X7AC 3AVZA 1HDTH 4O3UA 2KAIA 1HIAA 4CRFA 3GY3A 2O8LA 3RXAA 1Z6EA 1UTMA 5IYTA 1YLDA 5FPYA 4A7IB 4D7FA 1GVZA 1V2QT 1FJSA 1KTSB 1O2IA 2B9LA 5ETXA 1FAKH 1BZXE 1F0RA 4INLA 4WH6A 1SGQE 4X6PA 1EAUA 2TBSA 3BTEE 4Y6DA 1MMJN 1CA0B 3EGKH 3M7QA 3MO9A 1NRQH 4FUJA 5AFZH 1ZPBA 2FX4A 2BDBA 4DOQA 2GMTB 1ARCA 3GCTG 1G30B 2YNAA 3FP8E 1TA2A 1HJ8A 3A84A 1AD8H 4YZUA 1P2MA 1GMDG 1LVMA 1NRSH 2FOEA 5F8ZA 5JBBS 4H6TA 1N6XA 1DSTA 2ZHQH 3MU5A 4I7YH 3M3VA 4ABIA 2VGCC 2AYWA 1YPHE 1B0FA 1QL7A 4BTUB 4JYVH 3GCOA 4X8SH 1FQ3A 2NU0E 3RMLH 2F83A 2FOGA 1FPCH 4DVAU 6GCHG 1YYY1 1GHAF 3EYDA 2V0BA 2PGBB 4AZ2B 3V7TA 2FI4E 4X8VH 1QJ6B 3RXFA 4UFEH 4BAHB 3RP2A 4GAWA 2UUYA 3RXQA 2XBVA 1C5NH 2HVXA 4J2YB 2BMGB 1C5ZB 1Z8RA 4XBDA 1Y3XA 5EQQA 1P03A 4IW4E 5ESTE 1SQOA 2ILNA 1HAXB 4B2CA 1S0QA 3RXEA 3KQEA 1ZGVA 5C1YA 3E6PH 3SJIA 1TWXB 1O2QA 1BCUH 4JZ1A 5IDKA 2B8OH 1TYNA 3OTJE 2CXVA 1DY9A 3QGJA 5JBAS 3SU1A 1C2HA 3T28A 1ZPCA 3TPIZ 4MPUA 1K1OA 1ELVA 3K2UA 2VJ1A 1W8BH 3GY6A 1P9UA 1YF4A 1W2KH 2H5CA 4NCYA 1MAXA 1YCPK 1DSUA 1ZTKA 3GICB 3FP6E 1TRYA 1G2MA 1IAUA 1Y8TA 3RXHA 1EJNA 1OWEA 1KTTB 1QBNA 3L33A 1SGEE 1IQMA 2J9NA 4HTCH 5GCHF 2GKVE 3E16B 1HJAC 3MU0A 3R3GB 3ATWA 2Z6BD 1W12U 5DK1A 3LGUA 2C8YB 2A45B 4FUEA 3T27A 3LT3A 2ZGXH 4K1TA 2XC4A 3RXCA 1GBMA 3SQHE 3PMBB 1QJ1B 4GHQA 4K5ZA 1GG6C 4BTIB 3ZZ3A 3HKJB 1GJ6A 1PFXC 1VITF 1K1MA 4TPYA 1FONA 5A8YA 1OWKA 1IHSH 1RTFB 1OWHA 4YOJA 4I33A 2Z94A 1HNEE 3LGIA 3H5CB 4GPGA 2Z9LA 1LVYA 2JETB 2SNWA 5JB9S 2GCTB 4ZAEA 1PPHE 1O3IA 1TRNA 1BIOA 3QLPH 1XUGA 1O5AB 3FZDA 1BTZA 3I77A 4NFEA 2AS9A 2WV4A 5K7RA 1AY6H 3VXEH 2P8OC 4D76A 1FPHH 3KQDA 3OU0A 9ESTA 1BA8B 1TMUH 1UCYH 2R3UA 4WXVA 2Y7ZA 4YTAA 3SO3A 3ZZAA 4UFGH 4NIWA 1C1WH 3T26A 5LH8A 4NA8A 4BAQB 3NUMA 5DJ7A 1C1VH 1O2LA 2GZ9A 4YOIA 3U98H 4CHAC 3M3SA 1YPMH 3P8NA 5DP5A 1QFKH 2XCNA 1TGCA 1E0FD 2QF0A 8KME2 3LH1A 5FBEA 3RXBA 1TX8A 3NWUA 3SJOA 1GVLA 1NU7B 2IJOB 1GCTB 2Z9JA 1W0ZU 1LPZB 5C1XA 3SNAA 1O3MA 4CRDA 1BQYA 4UFDH 2BYAX 3UFAA 1AE8H 2FOCA 1CHOF 1LPKB 3VB4A 4X1NU 3ZZ5A 2G4UA 3S0NA 1SFQB 1AZ8A 2W3KA 3FANA 1CBWB 2PKSC 5DGJA 1IQKA 1HXEH 1C4V2 5ABWA 4AFQA 5AVDA 2HNTE 3UR6A 1P0SH 2I6QA 4HI3A 4SGBE 1NT1A 7LPRA 1S0RA 2ODPA 1QL9A 5EODA 1C9PA 2A1DB 3LC3A 4MNVA 2ZO3H 1EPTA 1DDJA 1NFWA 1PJPA 1A4WH 1EOLA 4WJG2 2BVSH 2IOTA 1O31A 1UTNA 4AG2A 3DA9B 1DWDH 1WV7H 2GCHG 2O8UA 2FP7B 5J4QA 5LPEA 1K21H 1UTPA 2H9TH 3Q3KA 1O38A 1G37A 4FUFA 4AYVB 2FLRH 1H9IE 1FZZA 1EASA 4ABDA 1FN6A 1BBRE 3HGNA 1HFDA 3IITA 3TIUA 2Q6FA 2ZFSA 1WBGB 2Y82A 1W13U 1MAYA 1ZJKA 3DT0H 3E0PB 1C5PA 1VCQA 3MNCA 4WMDA 4B2AA 1SGNE 2BB4A 1O3PB 1O2RA 2BDIA 1ABIH 1ELBA 4X2XA 4YM9A 2BQ6B 1GHZA 3BV9B 3TH3H 1HAOH 3RXVA 3ZVGA 3LGTA 1WU1A 1D3DB 1P10A 2BY6X 1WAYB 1W7XH 1A0LA 1J16A 1DLEA 1SGCA 1K28D 5E2PA 2BQ7B 4X2WA 2H6MA 2OD3B 1JRTA 1OX1A 1C2MA 1O3DA 4D9RA 1GDNA 2P94A 3NK8A 1FY3A 3ZZ8A 4ZMAH 2BD7A 3S9AA 3G01A 2P16A 3UR9A 3U8TH 2GDEH 1QHRB 2IPHA 4WMEA 4TY6A 1T32A 4ZKNU 3SU3A 3F1SB 1SI5H 3ATIA 1UHBA 2BD4A 1EAIA 1W0YH 3VB7A 4FUHA 1T8OA 4DW2U 4H4FA 2TPIZ 1C2KA 2P3TB 4BNRA 3MU1A 1YPKH 1UK2A 3JZ2B 1NFUA 3F9EA 2GGVB 5ESBA 1O2YA 2Z3CA 4Q7XA 5CMXH 5JPMH 1VGCC 2ANYA 1NFYA 5L6NH 1ZRKA 2SGQE 1HAVB 3BF6H 4WF8A 8GCHF 5HXFA 1DM4B 1ESTA 4NIYA 3C1KA 3UPEA 2XRCA 3T5FH 1M9UA 4WXIA 3I78A 1GBJA 3QTOH 4F4OC 5A0AE 4Y7AA 4Z0KA 3LIWA 3TNSA 1CT4E 3SUDA 2G00A 4CRAA 2OC8A 4ABFA 1BMMH 2BD8A 4AFSA 2SGEE 1FDPA 2ZG0H 1XUIA 2ZEBA 2WPIS 3BG8A 3BIVH 2SGPE 1SFIA 1KLJH 3RMNH 3MH4A 1ZGIA 3L6PA 4DGJA 5HGGA 1ELFA 9LPRA 3PMJA 3T62A 2W26A 1AHTH 4K3JA 3PLKA 1YC0A 1TPSA 3RC4A 1MTVA 5FXLA 3BEFB 4ISNA 3RXDA 1ELEE 2SGFE 4OGXA 4FUBA 1LO6A 1O36A 1ETSH 1C4U2 4E7RG 4YO9A 1GBKA 5EW2H 1NESE 1O2SA 2ZFPH 1P05A 4Y8XA 4FUCA 3BG4C 3V0XA 1GHBG 4A1VA 1SC8U 2UUKB 5LPRA 2HOBA 1ANBA 3MU8A 4JZEH 1D4PB 1ZTJA 4IS5A 3SUEA 1FLEE 5FBIA 7ESTE 2Z9GA 4NIVA 1HPGA 4B75A 4MLFB 2ZTXA 4Y10E 4XFQA 3GYLB 7GCHG 3F9FA 1LHEH 5DP8A 1J15A 1GBFA 2ZQ1A 1IQEA 4DJZB 2GV7A 4NA9H 2EA3A 1IQFA 4VGCB 2F9OA 2NU3E 4XSKU 2OC7A 2FZZA 5G4BA 2Z9IA 3BEIB 2AEIH 1P2IA 3EA7A 1FY8E 3SNEA 4WY3A 4SGAE 1GI5A 5EU8A 1GI8B 3QDZB 1PPFE 4Q7ZA 1ARBA 4GCHG 2Z9KA 1C4Y2 2V3HH 3GY4A 2OXSA 1AU8A 5F03A 5GJ4B 3OY6U 2BTCE 3PYHA 3SJKA 1TA6A 3SORA 2WPLS 1YP9A 2Y7XA 1KDQA 4UFFH 2F9UA 1C2FA 1Q3XA 4CRBA 3GCTF 2AMPA 2ZFQH 1V2MT 1K9OE 1S5SA 2A5IA 3A7ZA 1GJ8B 1H9LB 2ULLA 1FNIA 1NRPH 5E0GA 1AVWA 4QT8C 3A80A 5EXMA 4BXSA 2HALA 2WPKS 3TK5A 1UCYK 3STIA 1QGFA 4XBCA 2ZC9H 3L3TA 2V6NA 1ZMNA 1HXFH 4NWLA 5HMAA 3RXTA 1DITH 2VWMA 1O5BB 4IGDA 3S9CA 3LGYA 4FUGA 2ZP0H 2EC9H 1O3KA 3MMGA 6GCHF 1C2LA 3ATKA 4AOQA 4ZKSU 1O34A 4B71A 3O8RA 2ZU4A 2QXJA 1C1SA 2CF8H 1GI7B 2F9BH 2OC1A 4MDSA 1K1IA 1HIAB 1O3BA 4RKOB 1AFQC 3A8CA 2BY5X 3ZYDA 1TPPA 3FFGA 1TNLA 4I8HA 1C5VA 2C93B 3U69H 4MPXA 1CO7E 1GI4A 4IBLH 2CHAC 5JYIA 4CR9A 3ZZ9A 1P01A 3LDXH 3HGPA 2PHBA 3M7UA 4BOHA 1E35B 1HAGE 1LKAA 3MNSA 3D62A 3GY7A 3A87A 1DLKB 2P3UB 1BOQA 3IG6B 4O97A 1EPTC 2J34A 1BITA 2NU1E 3QTVH 3E0NB 1G36A 1ANCA 3SNBA 2QC2A 1QTFA 1ZZZA 2J2UA 2TGAA 3BTTE 1FAXA 2OC0A 1DUEA 4GVUA 4A92A 1O3OA 3TGKE 1OP2A 1