1O5CB

Dissecting and designing inhibitor selectivity determinants at the s1 site using an artificial ala190 protease (ala190 upa)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEASTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDACQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Dissecting and designing inhibitor selectivity determinants at the S1 site using an artificial Ala190 protease (Ala190 uPA)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting, hydrolase
total genus 54
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2003-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o5cB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o5cB01
2ZU4A 1O3EA 2O9QA 1HAVA 2ZFFH 6GCHF 2B0FA 1TYNA 4JYTA 1HAGE 2JH5D 1XUJA 3MU5A 1Q2WA 4ASHA 5FPYA 1GI2A 3FZZA 3I77A 1O3OA 1RD3B 1KLJH 1P2IA 3LGVA 1GBAA 1E38B 1MU8B 1PPBH 2RDLA 3EDXB 3RXAA 1HFDA 3SBKA 2D2DA 5HGGA 4DURA 1TRMA 2ZPSA 1C1QA 1ZJDA 1MKWK 1DWEH 2BYAX 2TIOA 1O30A 3RP2A 2F3CE 3E8LA 4A6LA 3GY7A 4OS5A 3TNSA 3T29A 2OTVA 2HALA 1KDQA 3RXCA 3UREA 1LPKB 1PPFE 2HPPH 2FZZA 5HM2A 1UMAH 1NROH 1WSSH 4D9QA 2H5DA 3UUZA 2Y80A 4RN6A 5EODA 2VWOA 3MO3A 3ZZ5A 1QQ4A 5IYTA 5A0AE 4JZEH 4UDWH 3UQVA 5CHAC 1NS3A 1A3EH 3QLPH 1E37B 4TY7A 1BMMH 2ZDMA 3DFLA 1EOJA 1AFQB 3OTJE 1H1BA 1O33A 1GI5A 2J2UA 2Z3CA 2BY9X 1G9IE 1TX8A 1Y5UT 2A45B 2V3HH 1K22H 5EW1H 1QQUA 1HGTH 1O3JA 2FOEA 2Z9LA 3MOCA 8GCHF 4B76A 2VJ1A 4U30A 3RLYH 1AI8H 1AZZA 1BMLA 3D49H 5FBEA 1O2SA 3NK8A 1TLDA 4AORA 1TGSZ 1GBDA 1P2KA 1AHTH 5A09A 1CT0E 2AMDA 3ZZ6A 1O2RA 3RXUA 2BQ6B 3MH6A 4OS2A 1ZSJA 1MKXH 1O3NA 1O32A 2FI5E 4TYDA 1JOUB 3L6PA 3TGKE 2QXJA 2ZGBH 3MO9A 1CGIE 1QRXA 1TONA 2BD2A 4E05H 4Q80A 4X6PA 3RXJA 1THPB 2C8YB 5E0GA 1TGNA 1CGJE 1YPJH 1H9LB 5E0JA 1NFUA 2PKAB 3UOUA 1BBRE 5JBTA 3LKWA 5E2PA 5G4BA 2OQ5A 3HPTB 4O3TA 1CQQA 2PR3A 2GD4B 1O2GH 1YPKH 9ESTA 4Y8ZA 2J94A 3QZQA 2HNTE 2CMYA 1ELEE 1NFXA 3MYWA 2QIQA 1FY8E 1OWIA 3V13A 1LTOA 3OSYA 3A88A 1GVKB 2AIQA 3BSQA 4O97A 3T28A 1L4DA 2VINA 2HRVA 1ZZZA 2PHBA 4IN1A 2J4IA 3V0XA 5FCRA 4D7FA 3SJ8A 2EC9H 2O8UA 2ZFTA 4OGYA 1UTLM 2WPKS 5DP3A 1DE7H 2WPJS 3PMAB 5FPTA 2YNBA 5E0HA 3M37A 3ZZ3A 1V2RT 4X8UH 3H7OA 4B75A 1VITF 4BXWA 1TPAE 3K6YA 2XBWA 4Y6DA 3SU4A 1ZYOA 1EB2A 5EW2H 1SOTA 2FTLE 2DE9A 2F9PA 1EP6A 3VXFH 2FYQA 5SGAE 7KMEH 1P03A 3MNSA 3UWIA 1Y8TA 4LXBH 2PUQH 2OD3B 3SGBE 2FESH 3GY4A 1AFQC 1JRTA 2QGRA 1C2MA 1N6XA 2VWMA 1FV9A 1KTTB 1AVGH 1C5PA 2QYIA 1F0UA 3ATKA 4GVUA 4YESB 2Y82A 2O8TA 3Q3XA 1G3EA 1KLTA 1ACBE 1W0ZU 2ZCKP 1GJDB 1TPSA 3MU1A 4Y8YA 3ZZ4A 4B2CA 1GMHG 4AFSA 2F9BH 2QN5T 4NCYA 1HAYB 3E0NB 3SV9A 1HXFH 1S0RA 4JMYA 4SGAE 1YCPK 2JETC 1GI1A 1V6DA 4MVNA 2KAIB 1EAUA 1Z8JB 1Z8IB 2WYGA 3RXSA 5DJ7A 1FI8A 5BPEA 1OWKA 3SJKA 1O38A 1OXGA 2GV6A 1LDTT 2M5TA 1NRNH 2AYWA 1P9SA 1O2WA 2G4TA 2J38A 2CN0H 1KLIH 3GDSA 3D65E 1SGCA 1F7ZA 1UTPA 1ESTA 2P3UB 1KXEA 2VWLA 5FX6A 2ALVA 1GGDB 2ZCLP 2Z9KA 2ZKSA 1HAPH 1PYTD 2G81E 1PPCE 2D8WA 4WH6A 4A1TA 1HB0B 3STIA 2PTCE 2TGDA 1YF4A 4DY7B 4AB9A 4VGCB 2PSYA 2IJOB 1EATA 1C4Y2 1DS2E 1E36B 3M5OA 1RJXB 1LVYA 1V2TT 1W14U 2ZFPH 2FLBH 3NUMA 3UQOA 4ZMAH 1EXFA 3A7ZA 1V2VT 4ABDA 1SGFG 1RTFB 3RUOA 1NTPA 4FVDA 4M7GA 1UCYH 1O2IA 4TWYA 5C3NA 1H4WA 4BTTB 2Y81A 1O3LA 4QT8C 1HBTH 5JBAS 4WXVA 4ZAEA 1C2EA 3U98H 1FY5A 4ZHLU 1DSUA 2JKHA 3KCGH 4H6TA 3LGIA 1BTXA 1H9HE 1BUIA 2ZP0H 2Z9JA 4MPXA 1AVXA 2SGAA 2BD4A 2BXTH 2XBVA 1QL7A 2AEIH 1QJ1B 1F5RA 1O34A 2J95A 1ESAA 1VR1H 1O3FA 4XBDA 4XE4A 2Y6TA 8LPRA 4INKA 4K1SA 2J9NA 1O2ZA 2I6SA 3F9HA 3M5LA 4F4OC 1BOQA 2SFAA 2ESTE 1SC8U 4IGDA 1K1LA 4ABBA 3BTQE 1K1NA 4K1EA 1GHYH 1EZUC 1SLVB 1G32B 2BX4A 3M3TA 1MQ5A 3ZZCA 4B2BA 2HGTH 2Z3DA 3BTKE 1GDQA 1C2IA 4YO9A 2AGGX 3RXPA 2ANMH 2FOFA 1FAXA 1HRTH 1P8VC 1SFIA 5FAHA 1FY3A 3AW0A 5GPIB 5CE1A 1A5HA 5DP8A 3Q00A 4HTCH 1ZSLA 1TBZH 5GIBA 4E06H 3MO6A 5DKMA 2ZQ1A 3BTEE 4DW2U 1GJ4H 4X1SU 1C5UA 1EX3A 1G2MA 3RU4T 2LNCA 3BG4B 5EGMA 1TOCB 4JK6A 3ELAH 5TCAA 4GCHG 2XXLA 3E1XB 1AU8A 1C5VA 1PJPA 1S6HA 1GGDC 1KSNA 2R3YA 1C5LH 2P94A 2QF3A 3TNTA 1HIAA 4IN2A 1T31A 1O2YA 2WUBA 4ZHMU 1XKAC 4VGCC 5DO4H 4AB8A 3L33A 1IHSH 1B0EA 1EZXC 1FY1A 3OYPA 1TGTA 1TRYA 1O2OA 2AS9A 4UFFH 1Q31A 5TCCA 1OKXA 2XCFA 3U69H 1GHWH 1DWCH 3SW2B 3IWMA 3VB6A 4JYUH 3E90B 2FMJA 2XWBI 4JCNA 2XNIA 3BTGE 3U1JB 4AFUA 3MHWU 4WF8A 4ABHA 2OLGA 4GPGA 1GBTA 2W5EA 5DGJA 1BZXE 1S85A 3MTYA 1V2LT 3RMMH 4Y0YE 3M5MA 1IQLA 1U6QA 1XUIA 1ELFA 1V2QT 1ZTLA 1ABIH 1D3TB 3GCHB 2STBE 1UO6A 1CT2E 1O36A 1MTNC 1UTMA 3RC4A 3MU0A 4X6MA 3TJOA 3SHAH 3T26A 1THSH 1LHFH 1A2CH 3KGPA 1UHBB 1ZGIA 1C5NH 1O2HA 2ZWLH 1GG6B 3SO3A 1FAKH 2ANYA 1J9CH 3GICB 3KIDU 1GBEA 2VIOA 1BRUP 1MUEB 3EA7A 3T2NA 1HJAB 4ISNA 1ELAA 1GMCF 2GX4A 6GCHG 3ZVDA 1QCPA 1XM1A 2ZU3A 4BAOB 1SLXB 1MCTA 1GBJA 5F8ZA 1HPGA 5FPSA 3QZRA 1GWAA 1OX1A 2ALPA 2GMTB 2WYJA 3BEIB 3SORA 5C1UA 3LGUA 1O35A 3S9CA 3UY9A 5I46H 2FXRA 1CSOE 4B1TA 1SMFE 2P3FH 1IHTH 2CF9H 4HFPB 1P2OA 1SHYA 1P2NA 2ODYB 1ELCA 1UJ1A 3HATH 3TH4H 3RMNH 3VGCB 2ZGHA 2FOAA 2WPHS 1TX7A 3LH1A 4Y7AA 4UE7H 4Y10E 4HGCA 4A1VA 1W2KH 4DT7B 1SGPE 1HAZB 3BG4C 3WY8A 3PROA 1GJ6A 3SGQE 4MG3A 2ZHQH 1GCTB 5EOKA 2XBXA 1Y3YA 1HXEH 2ZFQH 3LGTA 4JYVH 1UVSH 3LGWA 1AZ8A 1OWDA 4LK4A 1AWFH 1AD8H 4GUXA 2BVSH 3TGIE 3FZDA 2W7UA 2VGCC 1TQ7B 2Y5FA 1BTYA 2Y5GA 3QX5H 4INHA 3CP7A 1OYTH 5IDKA 1A1RA 1KXFA 2SGPE 1NN6A 2WV5A 1XUGA 3BTFE 1SL3A 3MH4A 1UK2A 1TBRH 1G3CA 2G5NA 1Y3UA 1YPHC 4INLA 1XVMA 2YNAA 1QJ6B 2BY7X 3GCHC 4ZKNU 1CT4E 1QURH 2ANKH 2GCHF 3A8DA 4X1NU 2G00A 1NM6A 3ENSB 1C2KA 3KHVA 3TH2H 1IQMA 5AF9H 1YM0A 3H7TA 2VIVA 1WTHD 4ZKRU 1MTSA 2PSXA 1ZMLA 4BOHA 3P8OA 1AY6H 2C93B 1BJVA 1GG6C 3QN7A 5JPMH 2O8LA 2VB0A 1EKBB 3ITIA 1RFNA 1J15A 3I29A 3GY2A 3M61U 1MQ6A 4Y7BA 1BMAA 1MCVA 5F03A 1O2XA 4I8GA 1BDAA 1T8OA 2CHAB 5C1YA 2CGAA 4UFEH 3RXLA 1OP8A 3UPEA 2GMTC 2XYAA 1ZRKA 2ZU1A 5T6FA 4AYYB 1ZRBA 1NT1A 2H9TH 3AAUA 4JZ1A 2BDIA 2XRCA 3LT3A 3TJUA 1CO7E 1P3EA 1SQOA 1T4UH 2ZDVH 4I8KA 5AVDA 2BTCE 1IQEA 5C20A 1SI5H 2ZIQH 3SQEE 2Z7FE 1TNGA 2EEKA 3P8GA 1C4U2 2GDEH 4FU7A 1UVOA 3E3TA 2FO9A 4NZLA 5L30H 1O2KA 4XFQA 6LPRA 2OQUA 1AVWA 1NZQH 3BN9A 2VVCA 1RIWC 3SUDA 1L0ZA 2BLWA 2ZEBA 1TGBA 4AOQA 3PTBA 1O0DH 2FOBA 5T6DA 1AKSA 1LQDB 1VITG 4KP0A 1GCTC 1C5MD 1O3GA 1X7AC 1VGCC 2Z94A 2C90B 4CRFA 2Z9IA 1QBVH 3U8RH 3UIRA 2PGQB 1SG8B 1HAIH 1A0HB 3MNBA 1D3QB 6CHAB 1GBFA 2A4GA 3LIWA 1INCA 1PPHE 1Y3WA 2Z3EA 1TX6A 2Y5HA 1DXWA 1IQGA 3O8RA 4CRDA 1FIWA 4WWYA 1J16A 4FU8A 3RXTA 1QB6A 5EQSA 1H8DH 4ESTE 3F9FA 1VZQH 2QCYA 1MZDA 3M7UA 4KTUA 1ETTH 1P11E 1XXDA 2KAIA 1EAIA 4X1RU 5CMXH 2WPLS 3A7YA 2Z6BD 9LPRA 4IC5A 1C1VH 1NRRH 1W3CA 1EPTC 2FODA 1K1PA 2ANWA 1C5QA 1GI3A 2ZHEH 1N1LA 1BMNH 5GCHG 5JB9S 2ZTXA 3DT0H 4Z6AH 4AYVB 5F8TA 2RCEA 1NPMA 1IQNA 4X2XA 2BDGA 3HGPA 1KXBA 3KEEA 4Q2KA 2A5AA 4BAHB 2FOCA 5DG6A 2PWXA 4CRAA 1GJCB 1SGDE 2UUFB 2ZPQA 1GI8B 1DUAA 1Y5BT 1AGJA 2ZTZA 5ETXA 1GVZA 2FS9A 2FYRA 3RXEA 1C5RA 2B7DH 1K28D 3FP7E 4U2WA 1KXAA 1W11U 3RXFA 1ZLRA 2XC5A 3K6ZA 1D4PB 2UUKB 2XTTB 5DP4A 5A0CA 1Y5AT 2CHAC 1PPGE 2FWWA 3UTUH 2OC7A 2A2XH 1ETSH 2WUCA 2BD3A 1W7XH 1WBGB 4OS1A 2TPIZ 4FUBA 1BTHH 3KQEA 3Q3KA 2VU8E 2SGFE 3K9XB 2QF0A 3UWJH 3O8CA 4FUHA 7LPRA 3T5FH 1SSXA 4UFGH 5A8XA 3AAVA 3P95A 4Y8XA 5DPAA 5A8YA 4X1PU 4UD9H 1AB9B 2ZO3H 3TGJE 2ZU5A 2H9EH 4NG9H 1SQTA 1NY22 2PFEA 1HJ8A 3W94A 1Q3XA 1PQ7A 3BTDE 1NC6A 4K8BA 1CHOG 2YOLA 1BT7A 3TK9A 2EI6A 2Q6FA 3RXMA 2VIQA 2BLVA 1SGYE 4IS5A 3VXEH 1O3HA 2BDYA 1DLEA 4Z0KA 1V2WT 1FDPA 3M36A 1SGRE 2VH6A 3PMHB 1FPHH 1TRNA 5B6OA 1GCDA 1WQVH 3SI3H 3UNQA 1DPOA 2BDCA 1C1OA 2ZECA 4ABEA 2GZ7A 6CHAC 2A7HA 4ISHH 2J34A 1BRCE 1TIOA 3Q77A 4X0WU 4ZUHA 3ESTA 1YLCA 3PMBB 1V2KT 1C1NA 3TVJB 2K1QA 3ATIA 4IC6A 4YT7H 4WMFA 1DX5M 2OCVB 2I6QA 2F91A 5FHTA 1KDQB 1P2MA 4SGBE 3P70B 4FUGA 1UTQA 2OXSA 3B8JA 3PO1B 2BMGB 4WY3A 1BTWA 4H6SB 4MPWA 1C5XB 3UNSA 4CREA 1OWHA 4BANB 5GCHF 3LU9B 3GDUA 3GY3A 4H42U 1JBUH 3U9AH 4HI3A 2GZ8A 1P57B 3M3VA 2V35A 4UONA 1ARCA 1GBIA 3U8TH 1BHXF 1IOEA 1TB6H 2P16A 2ZFRH 3VB4A 1MBQA 2RA3A 2STAE 1QGFA 1G2LA 3IG6B 3LGYA 1WU1A 1O5DH 4TPYA 1P04A 5FCKA 1DWDH 5DP5A 4D9RA 1RGQA 1UVTH 2F9NA 4AGJA 2SNWA 3S7KB 2ZQ2A 1QHRB 3EGKH 3RXKA 1NU9A 2ULLA 2PKSB 3FP8E 2QAAA 1XXFA 3JZ2B 1YKTA 3A8CA 1C5WB 1GL0E 1P2JA 3SGAE 3LJJA 1MTVA 4FUIA 3SV6A 2BD9A 3QGJA 1A46H 1VCWA 1MAYA 1EB1H 1YCPM 1SGIB 1AUJA 1O31A 1CVWH 1C4V2 1W13U 5GXPA 1C5ZB 3SNEA 5GWZA 1AB9C 1QBOA 4TPIZ 5FXLA 1YGCH 4JZIA 1O5CB 1QTFA 1XKBC 3LC3A 4FUEA 5TJXA 4CR5A 1A7SA 1A4WH 1AE8H 1CHOF 1FQ3A 1BTPA 3LOXA 1EP5A 1UHBA 2V6NA 1TQ0B 1YPLH 1C2HA 3KF2A 3OY5U 3FP6E 3ZZAA 1YBWA 1ZMNA 5HYOA 2EI8A 3KQDA 2Y7XA 1ZPZA 4X8SH 1BBRH 1HAHH 2B8OH 3GY5A 2NU3E 3UNRA 2HWLB 3ZYEA 3BEFB 3QTVH 4CH2B 3FVFB 1SVPA 3QDZB 2FX6A 4OS7A 1P06A 4O03A 1GMCG 1ZHMA 1GHBG 1GBMA 4NWLA 3R0FA 4YLQH 1BHXB 2O8WA 2R2MB 5C5OA 2C8WB 2BD8A 3QUMP 3O8DA 1UK3A 3LDXH 4BXSA 2PV9B 4NIYA 3SV7A 3MNCA 3UR9A 3LC5A 1D6RA 1KYNA 1ANBA 3BIVH 3RXBA 1F5KU 1LHGH 4D7GA 1O2VA 5AFZH 1TAWA 3H5CB 5L6NH 1IQIA 4CHAB 1GL1A 1DT2A 3TU7H 1XUKA 3L3TA 2OP9A 1SGFA 1SFQB 2ZHWH 1MKXK 2FEQH 3SNAA 2H6MA 3DUXH 4BAQB 4PROA 5C5NA 4DIIH 3EA9A 2H2ZA 2VIDA 3GCTF 1GI6A 2WINI 3RXVA 4LZ4B 2BY6X 2ZZUH 3B23B 2BXUH 1GDUA 2P59A 5PTPA 2AMPA 3Q76A 2GKVE 2GT8A 1FY4A 3BIUH 3LPRA 4ISOA 1D6WA 3IITA 3KNXA 1V2ST 4DGJA 1ZSKA 3A7XA 1ANDA 5F6MA 1TA6A 3F68H 5J4QA 2JH0D 1EPTA 1SBWA 2ZF0H 3ATWA 1Z8RA 1A61H 3BEUA 2FPZA 2QA9E 1YP9A 1ELTA 4ZXYH 1O5AB 1FMGA 1ZPCA 2Y7ZA 1ELVA 1C1PA 1IQKA 5LPRA 1QB1A 1YC0A 1GBLA 4K1TA 7ESTE 2EA3A 1ANEA 4X2WA 3TK5A 4I32A 1AO5A 5HM9A 4UFDH 2QY0B 3NPSA 5EPNA 1VCPA 3ZZ8A 3RXQA 3STJA 1OSSA 2FOMB 2GCHG 4THNH 4A92A 1QBNA 2G8TA 5A0BA 1CHGA 4IBLH 1EJNA 3MFJA 2R9PA 2W3KA 2HLCA 2FOGA 2HOBA 3PYHA 1YYY1 3GDVA 3TITA 2A32A 5JB8S 2BZ6H 3A8BA 1ZR0A 4I8LA 5EU8A 1JIMA 1GHBF 2P8OB 1CA0B 2ZPRA 3NZIA 2A0QB 2BLOA 4Y11E 1Z71A 5EPYA 1S5SA 1TBQH 3E16B 1Z1JA 2NU4E 1ELDE 1Z6EA 3RXOA 2A4QA 3SQHE 3U8OH 4FU9A 2R0KA 1JWTA 3KN2A 1C5YB 4YLUA 3UFAA 2GDDA 3HK3B 1AUTC 1O3IA 3GISB 2FLRH 4YM9A 2ZGJA 3HKJB 2D1JA 3F9GA 2FIRH 1TNLA 3C1KA 1O2TA 2BZAA 1DANH 1LVBA 1B7XB 4IW4E 2LPRA 2ZFSA 5EXLA 1B5GH 3RC5A 1K21H 3OU0A 4JK5A 1LKBA 4ZHAA 1S82A 1DVAH 3HKIB 1PQ8A 3ATMA 2AGEX 1WUNH 1GI9B 1WV7H 1ETRH 1A0JA 5JYIA 4Y79A 2XC0A 1P0SH 3PLKA 2PTNA 4KKDA 3HK6B 3VPKA 1HCGA 3E0PB 3ZVGA 1YPHE 1KY9A 1BA8B 5LPFA 2PUXB 2VVUA 5A8ZA 3VEQB 5JDUB 2V0BA 1CBWB 3W95A 2B9LA 4AGKA 1WYKA 3KQCA 4GSOA 1C5OH 1GHZA 4DJZB 1W8BH 3HGNA 3RMLH 1BITA 3CS7A 4ISLA 3PLBA 2BQWB 1P9UA 2F9UA 3SN8A 2BX3A 1UCYK 4CBNA 3UOPA 2UWOA 2QXHA 3A84A 3G01A 2ZTYA 4NA7A 1KXDA 1O2JA 4ABJA 2IOTA 1ARBA 1DLKB 1SPJA 2BM2A 1C1WH 3A86A 5DP9A 2VWNA 2HNTF 2CF8H 1GBKA 2ZDNA 4XBCA 1TMBH 5DK1A 1GHAG 2PKAA 3GYLB 3R3GB 5E2OA 2ZI2H 4I33A 1YCPH 1HAOH 1NRPH 1OS8A 1T7CA 1GHVH 3ZVBA 4WVPE 3NXPA 1TPPA 2A4RA 1KXCA 1DM4B 1MAXA 4I31A 3RXIA 4CH8B 1HJAC 2BB4A 3KL6A 3SI4H 2P8OC 3SU2A 4YTAA 2OBOA 5C1XA 1FLEE 2ZDKA 1H9IE 1PPZA 1ABJH 1GBBA 1NU7B 1MD8A 2WPIS 2R0LA 2FI3E 2ZGXH 3GCOA 1BRBE 1G36A 4OS4A 3JZ1B 1QJ7B 3DA9B 4A7IB 3A8AA 3DHKH 2BD7A 1HJ9A 3VB3A 1XVOA 4NA8A 1HAXB 4R0IA 4D76A 1SHHB 3LJOA 1TE0A 1E35B 3MWIU 1YLDA 2DUCA 1DSTA 1TABE 4K5ZA 4FUJA 4B74A 1AWHB 4I8HA 2RA0A 2BOKA 1FN6A 1W12U 3D23A 3N7OA 3VGCC 1GMDG 1MZAA 1YPGH 2GZ9A 1FNIA 1LHCH 2QXGA 3NWUA 4Y71A 3SV8A 2GGVB 3KQBA 1L1JA 1OWEA 2A5IA 2SNVA 2ODPA 1IAUA 1CA8B 1RTLA 2UUJB 2ZDLA 5T6GA 2Q6GA 2P93A 1FONA 4WXIA 1CGHA 3ZZ7A 1TNJA 4I7YH 1PQAA 2WV4A 4OGXA 7GCHG 1O3AA 1C1UH 1D3PB 3VB5A 1ZPBA 2BHGA 3PWCA 3BTTE 2HVXA 3BTWE 1V2NT 3MH7A 2P3TB 4Q7ZA 1NO9H 2CJIA 3PB1E 1CBWC 3AVZA 4LZ1H 2VH0A 1ZTKA 5C67A 1C1TA 1EJAA 1LHDH 1TMUH 1P12E 3URCA 3TH3H 1QRZA 4KTSA 4FUCA 1O2MA 1SGQE 4NIVA 3V7TA 1TFXA 6ESTA 1UTOA 1VCQA 2ILNA 3A81A 1T8MA 4AG1A 1QIXB 1TA2A 2SGQE 2THFB 5LPEA 4NSYA 2PW8H 1ZMJA 4AFZA 2H1UA 1SGNE 4MPVA 1DITH 2P95A 2PLXA 3M3SA 1DY8A 3DFJA 1V2PT 4GAWA 4LOYH 1Z8GA 3URDA 1O5BB 2PGBB 3MH5A 4RKOB 3LONA 4TWWA 2TGTA 1GHAF 1GI0A 1TNIA 1MD7A 2ZC9H 5ABWA 1A0LA 4K69A 1GJ5H 1QFKH 4X8VH 1J14A 4FUDA 1O39A 1T4VH 2W7SA 5HMAA 3P8NA 2JETB 4X8TH 3SNDA 1D9IA 1UCYE 4XSKU 1LVOA 5EXMA 1Z7KA 4WJG2 2F83A 1LVMA 1Z1IA 4DCDA 3F1SB 4YZUA 1L2EA 1A5GH 1C1SA 1DOJA 1C2DA 1L4ZA 1WTGH 1TNKA 1ELGA 1WOFA 2ASUB 2GV7A 1LCYA 1UTKA 1TOMH 2EI7A 2GCTB 1O2UA 1N8OB 3SU0A 1W7GH 1RXPA 3MU4A 5LGOA 1LMWB 4MNXA 3RM2H 2JH6D 1GMDF 3EAJA 1HAVB 1W10U 4Q7YA 3O8BA 2BQ7B 1GHXH 3SOSA 4ZKSU 3FANA 2C8ZB 3RDZA 5T3HA 1T8NA 1O3CA 1ESBA 3DD2H 2IN2A 1DXPA 3T27A 2SGDE 1T32A 1WAYB 1AFEH 2W26A 1UK4A 1V2JT 2R2WU 4BAMB 3ZZDA 4F49A 1SQAA 1CU1A 1FXYA 1O2PA 2G5VA 7GCHF 4FVBA 1L1GA 1SGTA 3PWBA 2Z9GA 1QL8A 1PPEE 1P02A 1FUJA 2HPQH 3RLWH 3RC6A 1F0SA 3ODDA 1O2NA 3A7VA 1DUEA 2Q6DA 1K2I1 4FXGH 2QV1A 2A4OA 1Y3XA 1NFYA 2HNTC 1BIOA 2FP7B 2SGEE 2J92A 5I25A 3EYDA 1NFWA 3EE0B 3M7TA 3MU8A 1FZZA 1P3CA 3TJVA 4H4FA 1RS0A 1AKSB 2GP9B 1HV7A 4X2VA 3RXGA 1AE5A 1MBMA 1V2MT 1QNJA 4WMDA 2XWAA 3T62A 1HYLA 1OOKB 1ANCA 1DWBH 3A7WA 4NIXA 2FTMA 1K1MA 3RMOH 2OINA 8KME2 1WCZA 1G37A 1DDJA 5DP7A 3S69A 3GYMA 1NRSH 3TLOA 1AIXH 4NFFA 2TGPZ 5ESBA 1SLWB 1KIGH 2XCNA 2UWLA 1C2LA 1MTWA 1THRH 3GCTG 1S81A 1L1NA 1T8LA 1C1RA 4TY6A 2F9OA 1OWJA 1BQYA 3ODFA 1PYTC 1C5TA 1S84A 2G4UA 4X1QU 1Y3VA 3P6ZB 3M5NA 1SB1H 1G3BA 3RXRA 1QY6A 3CS0A 1HUTH 4I8JA 2A7CA 3RU4E 4HZHA 3K65B 4XBBA 5DP6A 3UR6A 2D26C 2A7JA 2RG3A 4BTIB 5H4IB 2ZHDA 1AQ7A 1DFPA 3ZZ9A 4ZKOU 1C9PA 3PM3A 3A82A 5EG4A 4CR9A 5C2ZA 4GHTA 5JBCS 4E7NA 3Q3YA 1IQFA 1HLTH 2GCTC 1RTKA 1HDTH 1XMNB 2FI4E 1CE5A 1N8OC 3BTHE 2ZCHP 3GCNA 3ZZBA 3TPIZ 1C9TA 4IMZA 1C2FA 4NIWA 1F2SE 3SJ9A 2A1DB 1F0RA 4BAKB 2QXIA 3F6UH 5EQQA 1C5SA 3ZV9A 1E34B 2UUYA 4O9VA 1P2QA 3F9EA 5F8XA 1EQ9A 2A5KA 1FIZA 2W3IA 2G51A 2VNTA 3B9FH 4GLYA 1K1OA 3BG8A 3SHCH 2OC8A 1G30B 2G55A 5L2YH 1J8AA 2G52A 1PQ5A 1J17T 3QTOH 2ZHFH 2NU1E 4J1YA 5EXNA 4MNWA 3QO6A 2UWPA 3A85A 3CENA 1ELBA 5E8EH 1BTUA 4Y76A 2XBYA 3S0NA 3QGNB 2XW9A 1MTNB 4RKJB 3OX7U 3ZVEA 2TGAA 1E0FD 1GI4A 4Q7XA 2CXVA 2NU2E 1ZOMA 4FUFA 1S0QA 3RU4D 2H5CA 3BF6H 2A31A 2ODQA 3NCLA 1V2OT 2BOHB 1GDNA 4DOQA 2BY8X 3PO1C 1Y59T 1BCUH 3BTME 5GJ4B 2FDAA 3S7HB 2C3SA 4D8NA 3MMGA 1O3BA 4R8TB 1OP2A 5AHGH 1P09A 5JBBS 1UVUH 1AMHA 1ZGVA 1N6YA 3M35A 4CRBA 4KELA 3SU6A 3V12A 4WMEA 1EZQA 1MKWH 2C8XB 1GMHF 3E91A 1JMOH 3PTNA 2AMQA 3LH3A 1XUFA 5A2MH 4MPUA 1EZSC 1A3BH 4CRGA 1ZTJA 3SUGA 1ZHPA 3QWCH 1UTNA 5HXFA 1GJ8B 1QA0A 1YPEH 5FX5A 1Z6JH 3ATLA 3ZVAA 2Q1JA 4ISIH 1O3KA 2OC0A 2PKSC 1M9UA 1XX9A 4AZ2B 1BRAA 1LQEA 3EA8A 1GJAB 1DICA 4K2YA 4X6NA 3A80A 1B0FA 3RXDA 4NZQA 2ZG0H 4KGAA 3SJIA 1SOZA 1A5IA 2A2QH 5FBIA 3RM0H 4IMQA 1P01A 1O2QA 3MNXA 3U1IB 4OS6A 2GVFA 2FM2A 2WPMS 3PLPA 5EQRA 2VVVA 3M7QA 3I78A 1MU6B 3FFGA 5GDSH 2GT7A 2AH4X 4K8YA 4YOJA 2NU0E 4AX9H 4AN7A 1O5EH 3P92A 1GBHA 1ORFA 1XUHA 2ZU2A 5J4SA 2OC1A 3SU3A 3TJNA 2H9HA 3A87A 1F92A 2VGCB 1TMTH 1BTZA 2AGIX 3VFEA 5LH8A 3ZVFA 3A89A 4YOIA 1OPHB 1QA7A 2IPHA 3SNBA 1EAXA 1S83A 1H8IH 1C1MA 1F0TA 2AERH 1QR3E 1JXPA 3TK6A 3SJOA 5K7RA 2FOHA 3SNCA 1IQJA 5ESTE 1LPZB 2ZA5A 1KTSB 2VIPA 1IQHA 3P8FA 4Y0ZE 4K60A 3SUFA 2DE8A 1O3DA 4NA9H 1UTJA 3BV9B 3MI4A 2OUAA 4AFQA 4U32A 5K0HA 4U01A 2TRMA 4DIHH 1LHEH 5AFYH 1V2UT 2VIWA 4KTCA 1O3PB 2GTBA 1K1JA 3RXHA 4CBOA 2BDAA 1LKAA 4UEHH 1EASA 4ABAA 3PV4A 4ABIA 3AW1A 1P05A 3OY6U 4ABGA 1K9OE 3P17H 8ESTE 4JZFH 4ZXXH 4NGAH 4GHQA 4XOJA 4BNRA 1TGCA 4CHAC 2V3OH 4A5TS 1QB9A 1FJSA 4YOGA 1EUFA 2B5TB 3SUEA 1DY9A 4E7RG 3K2UA 3GOVB 3AASA 2BY5X 5L2ZH 5BRRE 1RRKA 1FPCH 1GJ9B 1GJ7B 1TALA 2CV3A 3GY8A 2AIPA 2C4FH 4B73A 4BTUB 4DVAU 4DG4A 4ZH8A 2BDBA 3E6PH 2ZNKH 1ZHRA 1TNHA 3A83A 1RIWB 1O2LA 3PMJA 3SZNA 4MNYA 2O8MA 4ZROA 4ABFA 1GVLA 2R3UA 4A1XA 2BLQA 1C2GA 1LPGB 1HNEE 4RSPA 4B2AA 1QRWA 4GCHF 3V3MA 1VGCB 1ZJKA 3A7TA 5CHAB 1TWXB 1GI7B 1BB0B 1G3DA 3GY6A 1O5FH 1GPZA 1VITH 1VJAU 1OP0A 1MH0A 4NWKA 4MLFB 4WH8A 1JIRA 1AN1E 4NSVA 1NESE 4MQAA 3D62A 1TPOA 1BJUA 1EAWA 3SU1A 2TBSA 2BVRH 3FAOA 8GCHG 1JRSA 1HIAB 4X2YA 3ZV8A 2OBQA 4YT6H 1UVPA 4O3UA 2ZGCA 2FS8A 1GBCA 1F5LA 1W0YH 1O5GH 1SLUB 3NKKA 1PFXC 1EPTB 4AG2A 1WQSA 4J2YB 4X6OA 1NRQH 1O37A 4MDSA 1LO6A 3QK1A 3S9AA 1K1IA 4CRCA 3SV2H 1EOLA 1MMJN 3SU5A 3T25A 4K3JA 1C2JA 1QL9A 1BBRK 2QC2A 1D3DB 1SR5C 3EQ0H 1YPMH 2BDHA 2AFQB 3C27B 1CA0C 3VB7A 2F9VA 1GJBB 2BD5A 4XDEA 1SGEE 1P10A 4NFEA 1FN8A 1ID5H 1V3XA 3TIUA 1MTUA 3S9BA 1OYQA 4B71A 2FX4A 2XC4A 4MTBA 1VJ9U 2BVXH 2NWNA 4MNVA 1S6FA 1EJMA 2ZDAH 3ZVCA 4JZDH 1O3MA 3ZYDA
chains in the Genus database with same CATH superfamily
2ZU4A 1O3EA 2O9QA 1HAVA 2ZFFH 6GCHF 2B0FA 1TYNA 4JYTA 1HAGE 2JH5D 5EJLA 1XUJA 3MU5A 1Q2WA 4ASHA 5FPYA 1GI2A 3FZZA 2OK5A 3I77A 1O3OA 1RD3B 1KLJH 1P2IA 3LGVA 1GBAA 1E38B 1MU8B 1PPBH 2RDLA 3EDXB 3RXAA 1HFDA 3SBKA 2D2DA 3WW7A 5HGGA 4DURA 1TRMA 2ZPSA 1C1QA 1ZJDA 1MKWK 2F4LA 1DWEH 2BYAX 5KEDA 2TIOA 1O30A 3RP2A 2F3CE 3E8LA 4A6LA 3GY7A 4OS5A 2KR7A 3TNSA 3T29A 2OTVA 2HALA 1KDQA 3RXCA 3UREA 1LPKB 1PPFE 2HPPH 2FZZA 5HM2A 1UMAH 1NROH 1WSSH 4D9QA 2H5DA 3UUZA 2J97A 1NBME 2Y80A 4RN6A 5EODA 2VWOA 3MO3A 3ZZ5A 1QQ4A 5IYTA 5A0AE 4JZEH 4UDWH 3UQVA 5CHAC 1NS3A 1A3EH 3QLPH 1E37B 4TY7A 1KMHB 1BMMH 2ZDMA 3DFLA 1EOJA 1AFQB 3OTJE 1H1BA 1O33A 1GI5A 2J2UA 2Z3CA 2BY9X 1G9IE 1TX8A 1Y5UT 2A45B 2V3HH 3FOAA 1K22H 5EW1H 1QQUA 1HGTH 1O3JA 2FOEA 2Z9LA 3MOCA 8GCHF 4B76A 2VJ1A 2JIZD 4U30A 1K0HA 3RLYH 1AI8H 1AZZA 1BMLA 3D49H 5FBEA 1O2SA 3NK8A 1TLDA 4AORA 1TGSZ 1GBDA 1P2KA 2QF5A 1AHTH 5A09A 1CT0E 2AMDA 3ZZ6A 1O2RA 3RXUA 2BQ6B 3MH6A 1E1RD 4OS2A 1ZSJA 1MKXH 1QZ8A 1O3NA 1O32A 3AK5A 2FI5E 4TYDA 1JOUB 3L6PA 3TGKE 2QXJA 2ZGBH 3MO9A 2EY4C 1CGIE 1QRXA 1TONA 2BD2A 4E05H 4Q80A 4X6PA 3RXJA 1THPB 1UW7A 2C8YB 5E0GA 1TGNA 1NBMD 1CGJE 1YPJH 1H9LB 5E0JA 1NFUA 2PKAB 3UOUA 1BBRE 5JBTA 3LKWA 5E2PA 5G4BA 2OQ5A 3HPTB 4O3TA 1CQQA 2PR3A 2GD4B 1O2GH 1YPKH 9ESTA 4Y8ZA 2J94A 3QZQA 2HNTE 2CMYA 1ELEE 1NFXA 3MYWA 2QIQA 1FY8E 1OWIA 3V13A 1LTOA 3OSYA 3A88A 1GVKB 2AIQA 3BSQA 4O97A 3T28A 1L4DA 2VINA 2HRVA 1ZZZA 2PHBA 4IN1A 2J4IA 3V0XA 5FCRA 4D7FA 3SJ8A 2EC9H 2O8UA 2ZFTA 4OGYA 1UTLM 2WPKS 5DP3A 1DE7H 2WPJS 3PMAB 5FPTA 2YNBA 5E0HA 3M37A 1E79D 3ZZ3A 1V2RT 4X8UH 3H7OA 4B75A 1VITF 4BXWA 1TPAE 3K6YA 2XBWA 4Y6DA 3SU4A 1ZYOA 1EB2A 5EW2H 1SOTA 2FTLE 2DE9A 2F9PA 1EP6A 3VXFH 2FYQA 5SGAE 7KMEH 1P03A 3MNSA 3UWIA 1Y8TA 4LXBH 2PUQH 2OD3B 3SGBE 2FESH 3GY4A 1AFQC 1JRTA 2QGRA 1SQRA 1C2MA 1N6XA 2VWMA 1FV9A 1KTTB 1W0KD 1AVGH 1C5PA 2QYIA 1F0UA 3ATKA 4GVUA 4YESB 2Y82A 2O8TA 3Q3XA 1G3EA 1KLTA 1ACBE 1W0ZU 2ZCKP 1GJDB 1TPSA 3MU1A 2K0QA 4Y8YA 3ZZ4A 4B2CA 1GMHG 4AFSA 2F9BH 2QN5T 4NCYA 1HAYB 3E0NB 3SV9A 1HXFH 1S0RA 4JMYA 4SGAE 1YCPK 2JETC 1GI1A 1V6DA 4MVNA 2KAIB 1EAUA 1Z8JB 1Z8IB 2WYGA 3RXSA 5DJ7A 1FI8A 5BPEA 1OWKA 3SJKA 1O38A 1OXGA 2GV6A 1LDTT 2M5TA 1NRNH 2AYWA 1P9SA 1O2WA 2G4TA 2J38A 2CN0H 1KLIH 3GDSA 3D65E 1SGCA 1F7ZA 1UTPA 1ESTA 2P3UB 1KXEA 2VWLA 5FX6A 2ALVA 1GGDB 2ZCLP 2Z9KA 2ZKSA 1HAPH 1PYTD 2G81E 1PPCE 2D8WA 4WH6A 4A1TA 1HB0B 3STIA 2PTCE 2TGDA 3PRDA 1YF4A 4DY7B 4AB9A 4VGCB 2PSYA 2IJOB 1EATA 1C4Y2 1DS2E 1E36B 3M5OA 1RJXB 1LVYA 1V2TT 1W14U 2ZFPH 2FLBH 3NUMA 3UQOA 4ZMAH 1EXFA 3A7ZA 1V2VT 4ABDA 1SGFG 1RTFB 2J98B 3RUOA 1NTPA 4FVDA 4M7GA 3UAIC 1UCYH 1O2IA 4TWYA 5C3NA 1H4WA 4BTTB 2Y81A 1O3LA 4QT8C 1HBTH 5JBAS 4WXVA 4ZAEA 1C2EA 3U98H 1FY5A 4ZHLU 1DSUA 2JKHA 3PRBA 3KCGH 4H6TA 3LGIA 1BTXA 1H9HE 1BUIA 2ZP0H 2Z9JA 4MPXA 1AVXA 2SGAA 2BD4A 2BXTH 2XBVA 1QL7A 2AEIH 1QJ1B 5T1VA 1F5RA 1O34A 2J95A 1ESAA 1VR1H 1O3FA 4XBDA 4XE4A 2Y6TA 8LPRA 4INKA 4K1SA 2J9NA 1O2ZA 2I6SA 3F9HA 3M5LA 4F4OC 1H8ED 1BOQA 2SFAA 2ESTE 1SC8U 4IGDA 1K1LA 4ABBA 3BTQE 1K1NA 4K1EA 1GHYH 1EZUC 1SLVB 1G32B 2BX4A 3M3TA 1MQ5A 3ZZCA 4B2BA 2HGTH 2Z3DA 3BTKE 3KQ5A 1GDQA 4F48B 1C2IA 4YO9A 2AGGX 3RXPA 2ANMH 2FOFA 1FAXA 1HRTH 2VBCA 1P8VC 1SFIA 5FAHA 1FY3A 3AW0A 5GPIB 5CE1A 1A5HA 5DP8A 3Q00A 4HTCH 1ZSLA 1TBZH 5GIBA 4E06H 3MO6A 5DKMA 2ZQ1A 3BTEE 4DW2U 1GJ4H 4X1SU 1C5UA 1EX3A 2KCYA 1G2MA 3RU4T 2LNCA 3BG4B 3U28C 5EGMA 3WWBA 1TOCB 4JK6A 3ELAH 5TCAA 2J5UA 4GCHG 2XXLA 3E1XB 1AU8A 1C5VA 1PJPA 1S6HA 1GGDC 1KSNA 2R3YA 1C5LH 1YLNA 2P94A 2QF3A 3TNTA 1HIAA 4IN2A 1T31A 1O2YA 2WUBA 4ZHMU 1XKAC 4VGCC 5DO4H 3N7DA 4AB8A 3L33A 1IHSH 1B0EA 1EZXC 1FY1A 4HG6A 3OYPA 1TGTA 1TRYA 1O2OA 2AS9A 4UFFH 1Q31A 5TCCA 1OKXA 2XCFA 3U69H 1GHWH 1DWCH 3SW2B 3IWMA 3VB6A 4JYUH 3E90B 2FMJA 2XWBI 3N7EA 4JCNA 2XNIA 3BTGE 3U1JB 4AFUA 3MHWU 4WF8A 4ABHA 2OLGA 4GPGA 1GBTA 2W5EA 5DGJA 1BZXE 1S85A 3F2FA 3MTYA 1V2LT 3RMMH 4Y0YE 3SYJA 3M5MA 1IQLA 1U6QA 1XUIA 1ELFA 1V2QT 1ZTLA 1ABIH 1D3TB 3GCHB 2STBE 3DSPA 1UO6A 1CT2E 1O36A 1MTNC 1UTMA 3RC4A 3MU0A 2AHME 4X6MA 3TJOA 3SHAH 3T26A 1THSH 1LHFH 1A2CH 3KGPA 1UHBB 1ZGIA 1C5NH 1O2HA 3W1EA 2ZWLH 1GG6B 3SO3A 1FAKH 3F2HA 2ANYA 1J9CH 3GICB 3KIDU 1GBEA 2VIOA 1BRUP 1MUEB 3EA7A 3T2NA 1HJAB 4ISNA 1ELAA 1GMCF 2GX4A 6GCHG 3ZVDA 5EIYA 1QCPA 1XM1A 2ZU3A 4BAOB 1SLXB 1MCTA 1GBJA 5F8ZA 1HPGA 5FPSA 3QZRA 1GWAA 1OX1A 2ALPA 2GMTB 2WYJA 3BEIB 3SORA 5C1UA 3LGUA 1O35A 3S9CA 3UY9A 5I46H 2FXRA 1CSOE 4B1TA 1SMFE 2P3FH 1IHTH 2CF9H 4HFPB 1P2OA 2CK3D 2EQNA 1SHYA 1P2NA 2ODYB 4TSFD 1ELCA 1UJ1A 3HATH 3TH4H 3RMNH 3VGCB 2ZGHA 2FOAA 2WPHS 1TX7A 2IJD1 3LH1A 4Y7AA 4UE7H 4Y10E 4HGCA 4A1VA 3DSOA 1W2KH 4DT7B 1SGPE 1HAZB 3BG4C 3WY8A 3PROA 1GJ6A 3SGQE 4MG3A 2ZHQH 1GCTB 5EOKA 2XBXA 2KFWA 1Y3YA 1HXEH 2ZFQH 3LGTA 3OEED 4JYVH 1UVSH 3LGWA 1AZ8A 1OWDA 4LK4A 1AWFH 1AD8H 4GUXA 2BVSH 3TGIE 3FZDA 2W7UA 2VGCC 1TQ7B 2Y5FA 1BTYA 2Y5GA 3QX5H 4INHA 3CP7A 1OYTH 5IDKA 1A1RA 1KXFA 4B6EA 2SGPE 1NN6A 4P02A 3OE7D 2WV5A 1XUGA 3BTFE 1SL3A 3MH4A 1UK2A 1TBRH 1SKYE 1G3CA 2G5NA 1Y3UA 1YPHC 4FETA 4INLA 1XVMA 2YNAA 1QJ6B 2BY7X 3GCHC 4ZKNU 1CT4E 1QURH 2ANKH 2GCHF 3A8DA 4X1NU 2G00A 1NM6A 3ENSB 1C2KA 3KHVA 3TH2H 3PV5A 1IQMA 5AF9H 1YM0A 3H7TA 2VIVA 1WTHD 4ZKRU 1MTSA 2PSXA 1ZMLA 4AC9A 4BOHA 3P8OA 1AY6H 2C93B 1BJVA 1GG6C 3QN7A 5JPMH 2O8LA 2VB0A 1EKBB 3ITIA 1RFNA 1J15A 3I29A 3GY2A 3M61U 1MQ6A 4Y7BA 1BMAA 1MCVA 3H09A 5F03A 1O2XA 4I8GA 2WHXA 1BDAA 1T8OA 2CHAB 5C1YA 2CGAA 4UFEH 3RXLA 1OP8A 3UPEA 2GMTC 2XYAA 1ZRKA 2ZU1A 5T6FA 4AYYB 3DSGA 1ZRBA 1NT1A 2H9TH 3AAUA 4JZ1A 2BDIA 2XRCA 3LT3A 3TJUA 1CO7E 1P3EA 1SQOA 1T4UH 2ZDVH 4I8KA 5AVDA 2BTCE 2LP6A 1IQEA 5C20A 1SI5H 2ZIQH 3SQEE 2Z7FE 1TNGA 2EEKA 3P8GA 1C4U2 2GDEH 4FU7A 1UVOA 3E3TA 2FO9A 4NZLA 5L30H 1O2KA 4XFQA 6LPRA 2OQUA 1AVWA 1NZQH 3BN9A 2VVCA 1RIWC 3SUDA 1L0ZA 2BLWA 2ZEBA 1TGBA 4AOQA 3PTBA 1O0DH 2FOBA 5T6DA 1AKSA 1LQDB 1VITG 4P00A 4KP0A 1GCTC 1C5MD 1O3GA 1X7AC 1VGCC 2Z94A 2C90B 4CRFA 2Z9IA 1QBVH 3U8RH 3UIRA 5KECA 2PGQB 4FOUC 1SG8B 1HAIH 1A0HB 3MNBA 1D3QB 6CHAB 1GBFA 2A4GA 3LIWA 1INCA 1PPHE 1Y3WA 4OM9A 2Z3EA 1TX6A 2Y5HA 1DXWA 1IQGA 3O8RA 4CRDA 1FIWA 4WWYA 1J16A 4FU8A 3RXTA 1QB6A 5EQSA 1H8DH 4ESTE 3F9FA 1VZQH 2QCYA 1MZDA 3M7UA 4KTUA 1ETTH 1P11E 1XXDA 2KAIA 1EAIA 4X1RU 5CMXH 2WPLS 3A7YA 2Z6BD 9LPRA 4IC5A 1C1VH 1NRRH 1W3CA 1EPTC 2FODA 1K1PA 2ANWA 1C5QA 1GI3A 2ZHEH 1N1LA 1BMNH 5GCHG 5JB9S 2ZTXA 3DT0H 4Z6AH 4AYVB 5F8TA 2RCEA 1NPMA 1IQNA 4X2XA 2BDGA 3HGPA 1KXBA 3KEEA 4Q2KA 2A5AA 4BAHB 2FOCA 5DG6A 2PWXA 4CRAA 1GJCB 1SGDE 2UUFB 2ZPQA 1GI8B 1DUAA 1Y5BT 1AGJA 2ZTZA 5ETXA 1GVZA 2FS9A 2FYRA 3RXEA 1C5RA 1VKYA 2B7DH 1K28D 3FP7E 4U2WA 1KXAA 1W11U 3RXFA 1ZLRA 2XC5A 3K6ZA 1D4PB 2UUKB 2XTTB 5DP4A 5A0CA 1Y5AT 2CHAC 1PPGE 2FWWA 3UTUH 2OC7A 2A2XH 1ETSH 2WUCA 2BD3A 1W7XH 1WBGB 4OS1A 2TPIZ 4FUBA 1BTHH 3KQEA 3Q3KA 2VU8E 2SGFE 3K9XB 2QF0A 3UWJH 3O8CA 4FUHA 7LPRA 3T5FH 1SSXA 5FL7D 4UFGH 5A8XA 3AAVA 3P95A 4Y8XA 5DPAA 5A8YA 4X1PU 4UD9H 1AB9B 2ZO3H 3FO8D 3TGJE 2ZU5A 2H9EH 4NG9H 1SQTA 1NY22 2PFEA 1HJ8A 3W94A 1Q3XA 1PQ7A 3BTDE 1NC6A 4K8BA 1CHOG 4RT0A 2YOLA 1BT7A 3TK9A 2EI6A 2Q6FA 3RXMA 2VIQA 2BLVA 1SGYE 4IS5A 3VXEH 1O3HA 2BDYA 1DLEA 4Z0KA 1V2WT 1FDPA 3M36A 1SGRE 2VH6A 3PMHB 1FPHH 5C0TA 1TRNA 5B6OA 1GCDA 1WQVH 3SI3H 3UNQA 1DPOA 2BDCA 1C1OA 2XOKD 2ZECA 4ABEA 2GZ7A 6CHAC 2A7HA 4ISHH 2J34A 1BRCE 1TIOA 3Q77A 4X0WU 4ZUHA 3ESTA 1YLCA 3PMBB 1V2KT 1C1NA 3TVJB 2K1QA 3ATIA 4IC6A 4YT7H 4WMFA 1DX5M 2OCVB 2I6QA 2F91A 5FHTA 1KDQB 1P2MA 4SGBE 3P70B 1EFRD 4FUGA 1UTQA 2OXSA 3B8JA 3PO1B 2BMGB 4WY3A 1BTWA 4H6SB 4MPWA 1C5XB 3UNSA 4CREA 1OWHA 4BANB 5GCHF 3LU9B 3GDUA 3GY3A 4H42U 1JBUH 3U9AH 4HI3A 2GZ8A 1P57B 3M3VA 2V35A 4UONA 1ARCA 1GBIA 3U8TH 1BHXF 1IOEA 1TB6H 2P16A 2ZFRH 3VB4A 1MBQA 2RA3A 2STAE 1QGFA 1G2LA 3IG6B 3LGYA 1WU1A 4DT4A 1O5DH 4TPYA 1P04A 5FCKA 1DWDH 5DP5A 4D9RA 1RGQA 1UVTH 2F9NA 4AGJA 2SNWA 3S7KB 2ZQ2A 2RFKC 1QHRB 3EGKH 3RXKA 1NU9A 2ULLA 2PKSB 3FP8E 2QAAA 1XXFA 3JZ2B 1YKTA 3A8CA 1C5WB 1GL0E 1P2JA 3SGAE 4Q4LA 3LJJA 1MTVA 4FUIA 3SV6A 2BD9A 3QGJA 1A46H 1VCWA 1MAYA 1EB1H 1YCPM 1SGIB 1AUJA 1O31A 1CVWH 1C4V2 3GS9A 1W13U 5GXPA 1C5ZB 3SNEA 5GWZA 1AB9C 1QBOA 4TPIZ 5FXLA 1YGCH 4JZIA 1O5CB 1QTFA 1XKBC 3LC3A 4FUEA 5TJXA 4CR5A 1A7SA 1A4WH 1AE8H 1CHOF 1FQ3A 1BTPA 3LOXA 1EP5A 2M2AA 1UHBA 2V6NA 1TQ0B 1YPLH 1C2HA 3KF2A 3OY5U 3FP6E 3ZZAA 1YBWA 1ZMNA 5HYOA 2EI8A 3KQDA 2Y7XA 1ZPZA 4X8SH 1BBRH 1HAHH 2B8OH 3GY5A 2NU3E 3UNRA 1COWD 2HWLB 3ZYEA 3BEFB 3QTVH 4CH2B 3FVFB 1SVPA 3QDZB 2FX6A 4OS7A 1P06A 4O03A 5EJZA 1GMCG 1ZHMA 1GHBG 1GBMA 4NWLA 3R0FA 4YLQH 1BHXB 2YMSB 2O8WA 2R2MB 5C5OA 2C8WB 3MQKC 2BD8A 3QUMP 3O8DA 1UK3A 3LDXH 4BXSA 2PV9B 4NIYA 3SV7A 3MNCA 3UR9A 3LC5A 1D6RA 1KYNA 1ANBA 3BIVH 3RXBA 1F5KU 1LHGH 4D7GA 1O2VA 5AFZH 1TAWA 3H5CB 2LELA 5L6NH 1IQIA 4CHAB 1GL1A 1DT2A 3TU7H 1XUKA 3L3TA 2OP9A 1SGFA 2L74A 1SFQB 2ZHWH 1MKXK 2FEQH 3SNAA 2H6MA 3FN8A 3DUXH 4BAQB 4PROA 5C5NA 4DIIH 3EA9A 2H2ZA 2VIDA 3GCTF 1GI6A 2WINI 3RXVA 4LZ4B 2BY6X 2ZZUH 3B23B 2BXUH 1GDUA 2P59A 2WZQA 5PTPA 2AMPA 3Q76A 2GKVE 2GT8A 1FY4A 3BIUH 3LPRA 4ISOA 3CNRA 1D6WA 3IITA 3KNXA 1V2ST 4DGJA 1ZSKA 3A7XA 1ANDA 5F6MA 1TA6A 3F68H 5J4QA 2JH0D 1EPTA 1SBWA 2ZF0H 3ATWA 1Z8RA 1A61H 3BEUA 2FPZA 2QA9E 1YP9A 1ELTA 4ZXYH 1O5AB 1FMGA 1ZPCA 2Y7ZA 1ELVA 1C1PA 1IQKA 5LPRA 2KM0A 1QB1A 1YC0A 1GBLA 4K1TA 7ESTE 2EA3A 1ANEA 4X2WA 1YWUA 3TK5A 3NRLA 4I32A 1AO5A 5HM9A 4UFDH 2QY0B 3NPSA 5EPNA 1VCPA 1WDIA 3ZZ8A 3RXQA 4F55A 3STJA 1OSSA 2FOMB 2GCHG 4THNH 4A92A 1QBNA 2WSSD 3EE7A 2G8TA 5A0BA 1CHGA 4IBLH 1EJNA 3MFJA 2R9PA 2W3KA 2HLCA 2FOGA 2HOBA 3PYHA 1YYY1 3GDVA 3TITA 2A32A 5JB8S 2BZ6H 3A8BA 1ZR0A 4I8LA 5EU8A 1JIMA 1GHBF 2P8OB 1CA0B 2ZPRA 3NZIA 2A0QB 2BLOA 4Y11E 1Z71A 5EPYA 1S5SA 1TBQH 3E16B 1Z1JA 2NU4E 3SZEA 1ELDE 1Z6EA 3RXOA 2A4QA 3SQHE 3U8OH 4FU9A 2R0KA 5HIZA 1JWTA 2PP6A 1C5YB 3KN2A 4YLUA 3UFAA 2GDDA 3HK3B 1AUTC 1O3IA 3GISB 2FLRH 4YM9A 2ZGJA 3HKJB 2D1JA 3F9GA 2FIRH 1TNLA 3C1KA 1O2TA 2BZAA 1DANH 1LVBA 1B7XB 4IW4E 2LPRA 2ZFSA 5EXLA 1B5GH 3RC5A 1K21H 3OU0A 4JK5A 1LKBA 4ZHAA 1S82A 1DVAH 3HKIB 1PQ8A 3ATMA 2AGEX 1WUNH 1GI9B 1WV7H 1ETRH 1A0JA 3OEHD 5JYIA 4Y79A 2XC0A 1P0SH 2W6JD 2PTNA 3PLKA 4KKDA 3HK6B 3VPKA 1HCGA 3E0PB 3ZVGA 1YPHE 1KY9A 1BA8B 5LPFA 2PUXB 2K8IA 2VVUA 5A8ZA 3VEQB 5JDUB 2V0BA 1CBWB 2KZ4A 1H8HD 3W95A 2B9LA 4AGKA 1WYKA 3KQCA 4GSOA 1C5OH 1GHZA 4DJZB 3VG8A 1W8BH 3HGNA 3RMLH 5B6LA 1BITA 3CS7A 4ISLA 3PLBA 2BQWB 1P9UA 2F9UA 3SN8A 2BX3A 1UCYK 3OFND 4CBNA 3UOPA 2UWOA 2QXHA 3A84A 3G01A 2ZTYA 4NA7A 1KXDA 1O2JA 4ABJA 2IOTA 1ARBA 1DLKB 1SPJA 2BM2A 1C1WH 3A86A 5DP9A 2VWNA 2HNTF 2CF8H 1GBKA 2ZDNA 4XBCA 1TMBH 5DK1A 1GHAG 2PKAA 3GYLB 3R3GB 5E2OA 2ZI2H 4I33A 1YCPH 1HAOH 1NRPH 1OS8A 1T7CA 1GHVH 3UB0A 3ZVBA 4ASUD 4WVPE 3NXPA 1TPPA 2A4RA 1KXCA 1DM4B 1MAXA 4I31A 3RXIA 4CH8B 1HJAC 2BB4A 3KL6A 3SI4H 2P8OC 3SU2A 4YTAA 2OBOA 5C1XA 1FLEE 2ZDKA 1H9IE 1PPZA 2KCOA 1ABJH 1GBBA 1NU7B 1MD8A 2WPIS 2R0LA 2FI3E 2ZGXH 3GCOA 1BRBE 1G36A 4OS4A 3JZ1B 1QJ7B 3DA9B 4A7IB 3A8AA 3DHKH 2BD7A 1HJ9A 3VB3A 1XVOA 4NA8A 1HAXB 5DSFA 4R0IA 4D76A 1SHHB 3F3BA 3LJOA 1TE0A 1E35B 3MWIU 1YLDA 2DUCA 1DSTA 1TABE 4K5ZA 4FUJA 4B74A 1AWHB 4I8HA 2RA0A 2BOKA 1FN6A 1W12U 5HKKD 3D23A 3N7OA 3VGCC 1GMDG 1MZAA 1YPGH 2GZ9A 1FNIA 1LHCH 2QXGA 3NWUA 4Y71A 3SV8A 2GGVB 5KGOA 3KQBA 1L1JA 1OWEA 2A5IA 2SNVA 2ODPA 1IAUA 1CA8B 1RTLA 2UUJB 2ZDLA 5T6GA 2Q6GA 2P93A 3ZIAD 1FONA 5F53A 4WXIA 1CGHA 3ZZ7A 1TNJA 4I7YH 1PQAA 2WV4A 4Q63A 2JJ2D 4OGXA 7GCHG 1O3AA 1C1UH 1D3PB 3VB5A 1ZPBA 2BHGA 3PWCA 3BTTE 2HVXA 3BTWE 1V2NT 3MH7A 2P3TB 4Q7ZA 1NO9H 2CJIA 3PB1E 1CBWC 3AVZA 4LZ1H 2VH0A 1ZTKA 5C67A 1C1TA 1EJAA 1LHDH 1TMUH 1P12E 3URCA 3TH3H 1QRZA 4KTSA 4FUCA 1O2MA 1SGQE 4NIVA 3V7TA 1TFXA 6ESTA 1UTOA 1VCQA 2ILNA 5CDFE 3A81A 1T8MA 4AG1A 1QIXB 1TA2A 2SGQE 2THFB 5LPEA 4NSYA 2PW8H 1ZMJA 4AFZA 2H1UA 1SGNE 4MPVA 1DITH 2P95A 2PLXA 3M3SA 3WWFA 1DY8A 3DFJA 3KYGA 1V2PT 4GAWA 4LOYH 1Z8GA 3URDA 1O5BB 2PGBB 3MH5A 2RDEA 4RKOB 3LONA 4TWWA 2TGTA 1GHAF 1GI0A 1TNIA 1MD7A 2ZC9H 5ABWA 1A0LA 4K69A 1GJ5H 1QFKH 4X8VH 1J14A 4FUDA 1O39A 1T4VH 2W7SA 5IK2D 5HMAA 2L6OA 3P8NA 2JETB 4X8TH 3SNDA 1D9IA 1UCYE 4XSKU 1LVOA 5EXMA 1Z7KA 4WJG2 2F83A 1LVMA 1Z1IA 4DCDA 3F1SB 4YZUA 2J98A 1L2EA 4XD7D 1A5GH 1C1SA 1DOJA 1C2DA 1L4ZA 1WTGH 1TNKA 1ELGA 1WOFA 2ASUB 2GV7A 1LCYA 4RT1A 5HIYA 1UTKA 4YXWD 1TOMH 5C94A 2EI7A 2GCTB 1O2UA 1N8OB 3SU0A 1W7GH 1RXPA 3MU4A 5LGOA 1LMWB 4MNXA 3RM2H 2JH6D 1GMDF 2QF4A 3EAJA 1HAVB 1W10U 4Q7YA 3O8BA 2BQ7B 1GHXH 3SOSA 4ZKSU 3FANA 2C8ZB 3RDZA 5T3HA 1T8NA 1O3CA 1ESBA 2QE7D 3DD2H 2IN2A 1DXPA 3T27A 2SGDE 1T32A 1WAYB 1AFEH 2W26A 1OHHD 1UK4A 1V2JT 2R2WU 4BAMB 3ZZDA 4F49A 1WXRA 1SQAA 1CU1A 1FXYA 1O2PA 2G5VA 7GCHF 4FVBA 1L1GA 1SGTA 3PWBA 2Z9GA 1QL8A 1PPEE 1P02A 1FUJA 2HPQH 3RLWH 3RC6A 1F0SA 3ODDA 3F0PA 1O2NA 3A7VA 1DUEA 2Q6DA 1K2I1 4FXGH 2QV1A 2A4OA 1Y3XA 1NFYA 2HNTC 1BIOA 2FP7B 2SGEE 2J92A 5I25A 3EYDA 1NFWA 3EE0B 3M7TA 3MU8A 1FZZA 1P3CA 5EJ1A 3TJVA 4H4FA 1RS0A 5DN6D 1AKSB 3F2GA 2GP9B 1HV7A 4X2VA 3RXGA 1AE5A 1MBMA 1V2MT 1QNJA 4WMDA 4ACBA 2XWAA 3T62A 1HYLA 1OOKB 1ANCA 1DWBH 3A7WA 4NIXA 2FTMA 1K1MA 3RMOH 2OINA 8KME2 1WCZA 1G37A 1DDJA 5DP7A 3S69A 3GYMA 1NRSH 3TLOA 1AIXH 4NFFA 2TGPZ 5ESBA 1SLWB 1KIGH 2XCNA 4ACAA 2UWLA 1C2LA 1MTWA 1THRH 2KCAA 3GCTG 1S81A 1L1NA 1T8LA 1C1RA 4TY6A 2F9OA 1OWJA 1BQYA 3ODFA 1PYTC 1C5TA 1S84A 2G4UA 4X1QU 1Y3VA 3P6ZB 3M5NA 1SB1H 1G3BA 3RXRA 1QY6A 3CS0A 1HUTH 4I8JA 2A7CA 3RU4E 4HZHA 3K65B 4XBBA 5DP6A 3UR6A 2D26C 2A7JA 2RG3A 4BTIB 5H4IB 2ZHDA 1AQ7A 1DFPA 3ZZ9A 4B6FA 4ZKOU 1C9PA 3PM3A 3A82A 5EG4A 4CR9A 5C2ZA 4GHTA 5JBCS 4E7NA 3Q3YA 1IQFA 1HLTH 2GCTC 1RTKA 2HLDD 1HDTH 1XMNB 2FI4E 1CE5A 1N8OC 3BTHE 2ZCHP 3GCNA 3ZZBA 3TPIZ 1C9TA 4IMZA 1C2FA 4NIWA 1F2SE 3SJ9A 2A1DB 1F0RA 4BAKB 2QXIA 3F6UH 5EQQA 1C5SA 3ZV9A 1E34B 2UUYA 4O9VA 1P2QA 3F9EA 5F8XA 1EQ9A 2A5KA 1FIZA 2W3IA 2G51A 2VNTA 3KYFA 3B9FH 4GLYA 1K1OA 3BG8A 3SHCH 2OC8A 1G30B 4ZCNA 2G55A 5L2YH 1J8AA 2G52A 1PQ5A 1J17T 3QTOH 2ZHFH 5C17A 2NU1E 4J1YA 5EXNA 4MNWA 3QO6A 2UWPA 3A85A 3CENA 1ELBA 5E8EH 4I86A 1BTUA 4Y76A 2XBYA 3S0NA 3QGNB 2XW9A 1MTNB 4RI0A 4RKJB 3OX7U 3ZVEA 2TGAA 1E0FD 1GI4A 4Q7XA 2CXVA 2NU2E 1ZOMA 4FUFA 1S0QA 3RU4D 2H5CA 4Z1MD 3BF6H 2A31A 2ODQA 3NCLA 1V2OT 2BOHB 1GDNA 4DOQA 1E1QD 2BY8X 3PO1C 1Y59T 1BCUH 3BTME 5GJ4B 2FDAA 3S7HB 2C3SA 4D8NA 3MMGA 1O3BA 4R8TB 1OP2A 5AHGH 1P09A 2JJ1D 5JBBS 1UVUH 1AMHA 1ZGVA 1N6YA 3M35A 4CRBA 4KELA 2GJGA 3SU6A 3V12A 4WMEA 1EZQA 1MKWH 2C8XB 1GMHF 3E91A 1JMOH 3PTNA 2AMQA 3LH3A 1XUFA 2IPQX 5A2MH 4MPUA 1EZSC 1A3BH 4CRGA 1ZTJA 3SUGA 1ZHPA 3QWCH 1UTNA 5HXFA 1GJ8B 1QA0A 1YPEH 5FX5A 1Z6JH 3ATLA 3ZVAA 1FX0B 2Q1JA 4ISIH 1O3KA 2OC0A 2PKSC 1M9UA 1XX9A 4AZ2B 1BRAA 1LQEA 3EA8A 1GJAB 1DICA 4K2YA 4X6NA 3A80A 1B0FA 3RXDA 4NZQA 3F0OA 2ZG0H 4KGAA 3N99A 3SJIA 1SOZA 1A5IA 2A2QH 5FBIA 3RM0H 4IMQA 1P01A 1O2QA 3MNXA 4M9FA 3U1IB 4OS6A 2GVFA 2FM2A 2WPMS 3PLPA 5EQRA 2VVVA 5C0UA 3M7QA 3I78A 1MU6B 3FFGA 5GDSH 2GT7A 2AH4X 4K8YA 4YOJA 2NU0E 4AX9H 4AN7A 1O5EH 3P92A 1GBHA 1ORFA 1XUHA 2ZU2A 5J4SA 2OC1A 3SU3A 3TJNA 2H9HA 3A87A 1F92A 2VGCB 1TMTH 1BTZA 2AGIX 3VFEA 1MABB 5LH8A 3ZVFA 3A89A 4YOIA 1OPHB 1QA7A 2IPHA 3SNBA 1EAXA 1S83A 1H8IH 1C1MA 1F0TA 2AERH 1QR3E 1JXPA 3TK6A 3SJOA 5K7RA 2XNDD 2FOHA 3SNCA 1IQJA 5ESTE 1LPZB 2ZA5A 1KTSB 2VIPA 1IQHA 3P8FA 4Y0ZE 4K60A 3SUFA 2DE8A 1O3DA 4NA9H 1UTJA 2W6ID 3BV9B 3MI4A 2OUAA 4AFQA 4U32A 5K0HA 4U01A 2TRMA 2KCPA 4DIHH 1LHEH 5AFYH 1V2UT 2VIWA 2YMSC 4KTCA 5GNDA 1O3PB 2GTBA 5CHBA 1K1JA 3RXHA 4CBOA 2BDAA 1LKAA 4UEHH 3OAAD 1EASA 4ABAA 3PV4A 4ABIA 3AW1A 1P05A 3OY6U 4ABGA 1K9OE 4TT3D 3P17H 8ESTE 2WPDD 4JZFH 4ZXXH 4NGAH 4GHQA 4XOJA 4BNRA 1TGCA 1S6LA 2V3OH 4A5TS 1BMFD 4CHAC 1QB9A 1FJSA 4YOGA 1EUFA 2B5TB 3SUEA 1DY9A 4E7RG 2YMSD 3K2UA 3PV2A 3GOVB 3AASA 2BY5X 5L2ZH 5BRRE 1RRKA 2HVYB 1FPCH 1GJ9B 1GJ7B 1TALA 2CV3A 3GY8A 2AIPA 2C4FH 4B73A 4BTUB 4DVAU 4DG4A 4ZH8A 2BDBA 3E6PH 2ZNKH 2KX4A 1ZHRA 1TNHA 3A83A 2WV9A 1RIWB 1O2LA 3PMJA 3SZNA 4MNYA 2O8MA 4ZROA 4ABFA 4XRNA 2JDID 1GVLA 2R3UA 4A1XA 2BLQA 1C2GA 1LPGB 2V7QD 1HNEE 4RSPA 4B2AA 1QRWA 4GCHF 3V3MA 1VGCB 1ZJKA 3A7TA 5CHAB 1TWXB 1GI7B 1BB0B 1G3DA 3GY6A 2F43B 1O5FH 1GPZA 1VITH 1VJAU 1OP0A 1MH0A 4NWKA 4MLFB 4WH8A 1JIRA 1AN1E 4NSVA 1NESE 4MQAA 3D62A 1TPOA 1BJUA 1EAWA 3SU1A 2TBSA 2BVRH 3FAOA 3DCLA 8GCHG 1JRSA 1HIAB 4X2YA 3ZV8A 2OBQA 4YT6H 3OTPA 1UVPA 4O3UA 3FKSD 2ZGCA 2FS8A 1GBCA 1F5LA 1W0YH 1O5GH 1SLUB 1YY3A 3NKKA 1PFXC 1EPTB 4AG2A 1WQSA 4J2YB 4X6OA 1NRQH 1O37A 4MDSA 1LO6A 3QK1A 3S9AA 1K1IA 4CRCA 3SV2H 1EOLA 1MMJN 3SU5A 3T25A 2V3MA 4K3JA 1C2JA 1QL9A 1BBRK 2QC2A 1D3DB 1SR5C 3EQ0H 1YPMH 2BDHA 2AFQB 3C27B 1CA0C 3VB7A 2F9VA 1GJBB 2BD5A 4XDEA 1SGEE 1P10A 4NFEA 1FN8A 1ID5H 1V3XA 3TIUA 1MTUA 3S9BA 1OYQA 4B71A 2FX4A 2XC4A 4MTBA 1VJ9U 2BVXH 2NWNA 4MNVA 1S6FA 1EJMA 2ZDAH 3ZVCA 1W0JD 4JZDH 1O3MA 3ZYDA
chains in the Genus database with same CATH topology
2ZU4A 1O3EA 2O9QA 1HAVA 2ZFFH 6GCHF 2B0FA 1TYNA 4JYTA 1HAGE 2JH5D 1XUJA 3MU5A 1Q2WA 4ASHA 5FPYA 1GI2A 3FZZA 3I77A 1O3OA 1RD3B 1KLJH 1P2IA 3LGVA 1GBAA 1E38B 1MU8B 1PPBH 2RDLA 3EDXB 3RXAA 1HFDA 3SBKA 2D2DA 5HGGA 4DURA 1TRMA 2ZPSA 1C1QA 1ZJDA 1MKWK 1DWEH 2BYAX 2TIOA 1O30A 3RP2A 2F3CE 3E8LA 4A6LA 3GY7A 4OS5A 3TNSA 3T29A 2OTVA 2HALA 1KDQA 3RXCA 3UREA 1LPKB 1PPFE 2HPPH 2FZZA 5HM2A 1UMAH 1NROH 1WSSH 4D9QA 2H5DA 3UUZA 2Y80A 4RN6A 5EODA 2VWOA 3MO3A 3ZZ5A 1QQ4A 5IYTA 5A0AE 4JZEH 4UDWH 3UQVA 5CHAC 1NS3A 1A3EH 3QLPH 1E37B 4TY7A 1BMMH 2ZDMA 3DFLA 1EOJA 1AFQB 3OTJE 1H1BA 1O33A 1GI5A 2J2UA 2Z3CA 2BY9X 1G9IE 1TX8A 1Y5UT 2A45B 2V3HH 1K22H 5EW1H 1QQUA 1HGTH 1O3JA 2FOEA 2Z9LA 3MOCA 8GCHF 4B76A 2VJ1A 4U30A 3RLYH 1AI8H 1AZZA 1BMLA 3D49H 5FBEA 1O2SA 3NK8A 1TLDA 4AORA 1TGSZ 1GBDA 1P2KA 1AHTH 5A09A 1CT0E 2AMDA 3ZZ6A 1O2RA 3RXUA 2BQ6B 3MH6A 4OS2A 1ZSJA 1MKXH 1O3NA 1O32A 2FI5E 4TYDA 1JOUB 3L6PA 3TGKE 2QXJA 2ZGBH 3MO9A 1CGIE 1QRXA 1TONA 2BD2A 4E05H 4Q80A 4X6PA 3RXJA 1THPB 2C8YB 5E0GA 1TGNA 1CGJE 1YPJH 1H9LB 5E0JA 1NFUA 2PKAB 3UOUA 1BBRE 5JBTA 3LKWA 5E2PA 5G4BA 2OQ5A 3HPTB 4O3TA 1CQQA 2PR3A 2GD4B 1O2GH 1YPKH 9ESTA 4Y8ZA 2J94A 3QZQA 2HNTE 2CMYA 1ELEE 1NFXA 3MYWA 2QIQA 1FY8E 1OWIA 3V13A 1LTOA 3OSYA 3A88A 1GVKB 2AIQA 3BSQA 4O97A 3T28A 1L4DA 2VINA 2HRVA 1ZZZA 2PHBA 4IN1A 2J4IA 3V0XA 5FCRA 4D7FA 3SJ8A 2EC9H 2O8UA 2ZFTA 4OGYA 1UTLM 2WPKS 5DP3A 1DE7H 2WPJS 3PMAB 5FPTA 2YNBA 5E0HA 3M37A 3ZZ3A 1V2RT 4X8UH 3H7OA 4B75A 1VITF 4BXWA 1TPAE 3K6YA 2XBWA 4Y6DA 3SU4A 1ZYOA 1EB2A 5EW2H 1SOTA 2FTLE 2DE9A 2F9PA 1EP6A 3VXFH 2FYQA 5SGAE 7KMEH 1P03A 3MNSA 3UWIA 1Y8TA 4LXBH 2PUQH 2OD3B 3SGBE 2FESH 3GY4A 1AFQC 1JRTA 2QGRA 1C2MA 1N6XA 2VWMA 1FV9A 1KTTB 1AVGH 1C5PA 2QYIA 1F0UA 3ATKA 4GVUA 4YESB 2Y82A 2O8TA 3Q3XA 1G3EA 1KLTA 1ACBE 1W0ZU 2ZCKP 1GJDB 1TPSA 3MU1A 4Y8YA 3ZZ4A 4B2CA 1GMHG 4AFSA 2F9BH 2QN5T 4NCYA 1HAYB 3E0NB 3SV9A 1HXFH 1S0RA 4JMYA 4SGAE 1YCPK 2JETC 1GI1A 1V6DA 4MVNA 2KAIB 1EAUA 1Z8JB 1Z8IB 2WYGA 3RXSA 5DJ7A 1FI8A 5BPEA 1OWKA 3SJKA 1O38A 1OXGA 2GV6A 1LDTT 2M5TA 1NRNH 2AYWA 1P9SA 1O2WA 2G4TA 2J38A 2CN0H 1KLIH 3GDSA 3D65E 1SGCA 1F7ZA 1UTPA 1ESTA 2P3UB 1KXEA 2VWLA 5FX6A 2ALVA 1GGDB 2ZCLP 2Z9KA 2ZKSA 1HAPH 1PYTD 2G81E 1PPCE 2D8WA 4WH6A 4A1TA 1HB0B 3STIA 2PTCE 2TGDA 1YF4A 4DY7B 4AB9A 4VGCB 2PSYA 2IJOB 1EATA 1C4Y2 1DS2E 1E36B 3M5OA 1RJXB 1LVYA 1V2TT 1W14U 2ZFPH 2FLBH 3NUMA 3UQOA 4ZMAH 1EXFA 3A7ZA 1V2VT 4ABDA 1SGFG 1RTFB 3RUOA 1NTPA 4FVDA 4M7GA 1UCYH 1O2IA 4TWYA 5C3NA 1H4WA 4BTTB 2Y81A 1O3LA 4QT8C 1HBTH 5JBAS 4WXVA 4ZAEA 1C2EA 3U98H 1FY5A 4ZHLU 1DSUA 2JKHA 3KCGH 4H6TA 3LGIA 1BTXA 1H9HE 1BUIA 2ZP0H 2Z9JA 4MPXA 1AVXA 2SGAA 2BD4A 2BXTH 2XBVA 1QL7A 2AEIH 1QJ1B 1F5RA 1O34A 2J95A 1ESAA 1VR1H 1O3FA 4XBDA 4XE4A 2Y6TA 8LPRA 4INKA 4K1SA 2J9NA 1O2ZA 2I6SA 3F9HA 3M5LA 4F4OC 1BOQA 2SFAA 2ESTE 1SC8U 4IGDA 1K1LA 4ABBA 3BTQE 1K1NA 4K1EA 1GHYH 1EZUC 1SLVB 1G32B 2BX4A 3M3TA 1MQ5A 3ZZCA 4B2BA 2HGTH 2Z3DA 3BTKE 1GDQA 1C2IA 4YO9A 2AGGX 3RXPA 2ANMH 2FOFA 1FAXA 1HRTH 1P8VC 1SFIA 5FAHA 1FY3A 3AW0A 5GPIB 5CE1A 1A5HA 5DP8A 3Q00A 4HTCH 1ZSLA 1TBZH 5GIBA 4E06H 3MO6A 5DKMA 2ZQ1A 3BTEE 4DW2U 1GJ4H 4X1SU 1C5UA 1EX3A 1G2MA 3RU4T 2LNCA 3BG4B 5EGMA 1TOCB 4JK6A 3ELAH 5TCAA 4GCHG 2XXLA 3E1XB 1AU8A 1C5VA 1PJPA 1S6HA 1GGDC 1KSNA 2R3YA 1C5LH 2P94A 2QF3A 3TNTA 1HIAA 4IN2A 1T31A 1O2YA 2WUBA 4ZHMU 1XKAC 4VGCC 5DO4H 4AB8A 3L33A 1IHSH 1B0EA 1EZXC 1FY1A 3OYPA 1TGTA 1TRYA 1O2OA 2AS9A 4UFFH 1Q31A 5TCCA 1OKXA 2XCFA 3U69H 1GHWH 1DWCH 3SW2B 3IWMA 3VB6A 4JYUH 3E90B 2FMJA 2XWBI 4JCNA 2XNIA 3BTGE 3U1JB 4AFUA 3MHWU 4WF8A 4ABHA 2OLGA 4GPGA 1GBTA 2W5EA 5DGJA 1BZXE 1S85A 3MTYA 1V2LT 3RMMH 4Y0YE 3M5MA 1IQLA 1U6QA 1XUIA 1ELFA 1V2QT 1ZTLA 1ABIH 1D3TB 3GCHB 2STBE 1UO6A 1CT2E 1O36A 1MTNC 1UTMA 3RC4A 3MU0A 4X6MA 3TJOA 3SHAH 3T26A 1THSH 1LHFH 1A2CH 3KGPA 1UHBB 1ZGIA 1C5NH 1O2HA 2ZWLH 1GG6B 3SO3A 1FAKH 2ANYA 1J9CH 3GICB 3KIDU 1GBEA 2VIOA 1BRUP 1MUEB 3EA7A 3T2NA 1HJAB 4ISNA 1ELAA 1GMCF 2GX4A 6GCHG 3ZVDA 1QCPA 1XM1A 2ZU3A 4BAOB 1SLXB 1MCTA 1GBJA 5F8ZA 1HPGA 5FPSA 3QZRA 1GWAA 1OX1A 2ALPA 2GMTB 2WYJA 3BEIB 3SORA 5C1UA 3LGUA 1O35A 3S9CA 3UY9A 5I46H 2FXRA 1CSOE 4B1TA 1SMFE 2P3FH 1IHTH 2CF9H 4HFPB 1P2OA 1SHYA 1P2NA 2ODYB 1ELCA 1UJ1A 3HATH 3TH4H 3RMNH 3VGCB 2ZGHA 2FOAA 2WPHS 1TX7A 3LH1A 4Y7AA 4UE7H 4Y10E 4HGCA 4A1VA 1W2KH 4DT7B 1SGPE 1HAZB 3BG4C 3WY8A 3PROA 1GJ6A 3SGQE 4MG3A 2ZHQH 1GCTB 5EOKA 2XBXA 1Y3YA 1HXEH 2ZFQH 3LGTA 4JYVH 1UVSH 3LGWA 1AZ8A 1OWDA 4LK4A 1AWFH 1AD8H 4GUXA 2BVSH 3TGIE 3FZDA 2W7UA 2VGCC 1TQ7B 2Y5FA 1BTYA 2Y5GA 3QX5H 4INHA 3CP7A 1OYTH 5IDKA 1A1RA 1KXFA 2SGPE 1NN6A 2WV5A 1XUGA 3BTFE 1SL3A 3MH4A 1UK2A 1TBRH 1G3CA 2G5NA 1Y3UA 1YPHC 4INLA 1XVMA 2YNAA 1QJ6B 2BY7X 3GCHC 4ZKNU 1CT4E 1QURH 2ANKH 2GCHF 3A8DA 4X1NU 2G00A 1NM6A 3ENSB 1C2KA 3KHVA 3TH2H 1IQMA 5AF9H 1YM0A 3H7TA 2VIVA 1WTHD 4ZKRU 1MTSA 2PSXA 1ZMLA 4BOHA 3P8OA 1AY6H 2C93B 1BJVA 1GG6C 3QN7A 5JPMH 2O8LA 2VB0A 1EKBB 3ITIA 1RFNA 1J15A 3I29A 3GY2A 3M61U 1MQ6A 4Y7BA 1BMAA 1MCVA 5F03A 1O2XA 4I8GA 1BDAA 1T8OA 2CHAB 5C1YA 2CGAA 4UFEH 3RXLA 1OP8A 3UPEA 2GMTC 2XYAA 1ZRKA 2ZU1A 5T6FA 4AYYB 1ZRBA 1NT1A 2H9TH 3AAUA 4JZ1A 2BDIA 2XRCA 3LT3A 3TJUA 1CO7E 1P3EA 1SQOA 1T4UH 2ZDVH 4I8KA 5AVDA 2BTCE 1IQEA 5C20A 1SI5H 2ZIQH 3SQEE 2Z7FE 1TNGA 2EEKA 3P8GA 1C4U2 2GDEH 4FU7A 1UVOA 3E3TA 2FO9A 4NZLA 5L30H 1O2KA 4XFQA 6LPRA 2OQUA 1AVWA 1NZQH 3BN9A 2VVCA 1RIWC 3SUDA 1L0ZA 2BLWA 2ZEBA 1TGBA 4AOQA 3PTBA 1O0DH 2FOBA 5T6DA 1AKSA 1LQDB 1VITG 4KP0A 1GCTC 1C5MD 1O3GA 1X7AC 1VGCC 2Z94A 2C90B 4CRFA 2Z9IA 1QBVH 3U8RH 3UIRA 2PGQB 1SG8B 1HAIH 1A0HB 3MNBA 1D3QB 6CHAB 1GBFA 2A4GA 3LIWA 1INCA 1PPHE 1Y3WA 2Z3EA 1TX6A 2Y5HA 1DXWA 1IQGA 3O8RA 4CRDA 1FIWA 4WWYA 1J16A 4FU8A 3RXTA 1QB6A 5EQSA 1H8DH 4ESTE 3F9FA 1VZQH 2QCYA 1MZDA 3M7UA 4KTUA 1ETTH 1P11E 1XXDA 2KAIA 1EAIA 4X1RU 5CMXH 2WPLS 3A7YA 2Z6BD 9LPRA 4IC5A 1C1VH 1NRRH 1W3CA 1EPTC 2FODA 1K1PA 2ANWA 1C5QA 1GI3A 2ZHEH 1N1LA 1BMNH 5GCHG 5JB9S 2ZTXA 3DT0H 4Z6AH 4AYVB 5F8TA 2RCEA 1NPMA 1IQNA 4X2XA 2BDGA 3HGPA 1KXBA 3KEEA 4Q2KA 2A5AA 4BAHB 2FOCA 5DG6A 2PWXA 4CRAA 1GJCB 1SGDE 2UUFB 2ZPQA 1GI8B 1DUAA 1Y5BT 1AGJA 2ZTZA 5ETXA 1GVZA 2FS9A 2FYRA 3RXEA 1C5RA 2B7DH 1K28D 3FP7E 4U2WA 1KXAA 1W11U 3RXFA 1ZLRA 2XC5A 3K6ZA 1D4PB 2UUKB 2XTTB 5DP4A 5A0CA 1Y5AT 2CHAC 1PPGE 2FWWA 3UTUH 2OC7A 2A2XH 1ETSH 2WUCA 2BD3A 1W7XH 1WBGB 4OS1A 2TPIZ 4FUBA 1BTHH 3KQEA 3Q3KA 2VU8E 2SGFE 3K9XB 2QF0A 3UWJH 3O8CA 4FUHA 7LPRA 3T5FH 1SSXA 4UFGH 5A8XA 3AAVA 3P95A 4Y8XA 5DPAA 5A8YA 4X1PU 4UD9H 1AB9B 2ZO3H 3TGJE 2ZU5A 2H9EH 4NG9H 1SQTA 1NY22 2PFEA 1HJ8A 3W94A 1Q3XA 1PQ7A 3BTDE 1NC6A 4K8BA 1CHOG 2YOLA 1BT7A 3TK9A 2EI6A 2Q6FA 3RXMA 2VIQA 2BLVA 1SGYE 4IS5A 3VXEH 1O3HA 2BDYA 1DLEA 4Z0KA 1V2WT 1FDPA 3M36A 1SGRE 2VH6A 3PMHB 1FPHH 1TRNA 5B6OA 1GCDA 1WQVH 3SI3H 3UNQA 1DPOA 2BDCA 1C1OA 2ZECA 4ABEA 2GZ7A 6CHAC 2A7HA 4ISHH 2J34A 1BRCE 1TIOA 3Q77A 4X0WU 4ZUHA 3ESTA 1YLCA 3PMBB 1V2KT 1C1NA 3TVJB 2K1QA 3ATIA 4IC6A 4YT7H 4WMFA 1DX5M 2OCVB 2I6QA 2F91A 5FHTA 1KDQB 1P2MA 4SGBE 3P70B 4FUGA 1UTQA 2OXSA 3B8JA 3PO1B 2BMGB 4WY3A 1BTWA 4H6SB 4MPWA 1C5XB 3UNSA 4CREA 1OWHA 4BANB 5GCHF 3LU9B 3GDUA 3GY3A 4H42U 1JBUH 3U9AH 4HI3A 2GZ8A 1P57B 3M3VA 2V35A 4UONA 1ARCA 1GBIA 3U8TH 1BHXF 1IOEA 1TB6H 2P16A 2ZFRH 3VB4A 1MBQA 2RA3A 2STAE 1QGFA 1G2LA 3IG6B 3LGYA 1WU1A 1O5DH 4TPYA 1P04A 5FCKA 1DWDH 5DP5A 4D9RA 1RGQA 1UVTH 2F9NA 4AGJA 2SNWA 3S7KB 2ZQ2A 1QHRB 3EGKH 3RXKA 1NU9A 2ULLA 2PKSB 3FP8E 2QAAA 1XXFA 3JZ2B 1YKTA 3A8CA 1C5WB 1GL0E 1P2JA 3SGAE 3LJJA 1MTVA 4FUIA 3SV6A 2BD9A 3QGJA 1A46H 1VCWA 1MAYA 1EB1H 1YCPM 1SGIB 1AUJA 1O31A 1CVWH 1C4V2 1W13U 5GXPA 1C5ZB 3SNEA 5GWZA 1AB9C 1QBOA 4TPIZ 5FXLA 1YGCH 4JZIA 1O5CB 1QTFA 1XKBC 3LC3A 4FUEA 5TJXA 4CR5A 1A7SA 1A4WH 1AE8H 1CHOF 1FQ3A 1BTPA 3LOXA 1EP5A 1UHBA 2V6NA 1TQ0B 1YPLH 1C2HA 3KF2A 3OY5U 3FP6E 3ZZAA 1YBWA 1ZMNA 5HYOA 2EI8A 3KQDA 2Y7XA 1ZPZA 4X8SH 1BBRH 1HAHH 2B8OH 3GY5A 2NU3E 3UNRA 2HWLB 3ZYEA 3BEFB 3QTVH 4CH2B 3FVFB 1SVPA 3QDZB 2FX6A