1GJ9B

Engineering inhibitors highly selective for the s1 sites of ser190 trypsin-like serine protease drug targets
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEASTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting, hydrolase
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
publication title Engineering inhibitors highly selective for the S1 sites of Ser190 trypsin-like serine protease drug targets.
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2001-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gj9B02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gj9B01
3GCTG 1GBFA 2TGPZ 1B7XB 4UFGH 3S9BA 2DE8A 1KLTA 1ZSLA 4DW2U 1V2JT 2BDYA 3HPTB 3A8BA 2J2UA 3SU1A 1AI8H 1KXEA 5ABWA 1V2UT 3EE0B 1OWIA 3L6PA 1WOFA 1TPOA 1P2MA 1HV7A 2GDDA 1AU8A 1VITF 5F6MA 1L1GA 1S81A 2XWBI 1MBMA 3OY6U 5HGGA 2D1JA 5T6FA 1BJUA 1DLKB 2OC1A 1YC0A 3M35A 1ZRBA 4WMEA 4BAOB 1F7ZA 2F91A 2J34A 3SNDA 1AUTC 1UVPA 3SJ8A 1LDTT 2ZU4A 3OSYA 5E2PA 1T8LA 4Q7XA 3LH3A 1ETTH 4IN2A 1PQAA 3SUEA 4CRGA 1GI9B 1KSNA 3EYDA 4ABHA 5EPNA 2F9VA 5DP7A 1PPFE 2G5VA 1SVPA 1ORFA 2VIPA 2NU2E 4RKJB 3DD2H 2GCTB 5HM2A 1TA6A 1GBCA 1O2SA 5DK1A 4INHA 2XBXA 4ZKSU 2OP9A 1QGFA 1EPTC 4X0WU 5G4BA 2BTCE 1TABE 1Q3XA 3SU3A 4K8BA 1ANEA 1C5RA 4AX9H 4Q2KA 4CRFA 1SLXB 5PTPA 2A2QH 2BDCA 5AVDA 1AN1E 1UTLM 1GCTC 5FHTA 4O3TA 1GHYH 1NU7B 1TBQH 2Y81A 1UHBA 3ZVGA 2BMGB 1DT2A 4DG4A 1N1LA 5CHAB 1C5ZB 3UNQA 2R0LA 1FUJA 1MTWA 1O2KA 5JBAS 1A1RA 5TCCA 3W94A 2C3SA 3T28A 3M5OA 3CS7A 2LPRA 1THSH 1F5RA 4NWKA 3TH4H 5C20A 1NS3A 1BCUH 3N7OA 1O2XA 1ARBA 4ZXXH 1MZDA 1FY8E 2TRMA 5GCHG 1GMDG 3P17H 1FAKH 3UFAA 4AOQA 1NROH 3A82A 1DVAH 4UFFH 2RDLA 2F9OA 2ILNA 4X8TH 4D7FA 4ZHAA 1AIXH 3GICB 2GZ7A 1E34B 5DGJA 2Q6FA 2V35A 1A5IA 1F0UA 4R8TB 1CHOF 2PWXA 1IQNA 2QF3A 2V3HH 1HJ9A 1C2GA 1H8DH 1IHTH 1ZTLA 2BLOA 4XSKU 2CMYA 3MHWU 4YLQH 2FOMB 2VVCA 3H7TA 4X1NU 1VCPA 2O8MA 1O2ZA 3NZIA 1CO7E 3MTYA 4IC6A 1TAWA 1O3FA 3M3TA 2JETB 2ZFSA 4DOQA 4DJZB 2FEQH 1W8BH 6LPRA 1MTNB 1GBLA 3T62A 2FP7B 1O5AB 2A5KA 1BTYA 3BTTE 3PWBA 2P94A 2CXVA 3TJNA 4JZIA 1CA0B 1UO6A 1UCYH 2J95A 2WPLS 2VWMA 1O5BB 2TGTA 2VH0A 1BITA 4XE4A 1GI0A 1QURH 1MD8A 2I6QA 1GBIA 1O2NA 4ZHMU 1C5VA 4HZHA 1E38B 2VVUA 4VGCC 1DDJA 2AS9A 3M7UA 3RLYH 4MDSA 1SGDE 3BTKE 4X2VA 2R2WU 3RXEA 1OWKA 3V3MA 1N6YA 5FAHA 3A88A 3R3GB 4XDEA 3RXMA 5A0CA 1GJCB 4WXIA 4X2YA 5A0BA 1QBVH 1K1NA 2Y6TA 3F9HA 1N6XA 2G52A 2ASUB 4OS1A 4XBDA 1P2NA 5EXNA 1C1OA 3U1JB 1NRQH 2GV7A 4DVAU 1ZGVA 3MH5A 1O3NA 4MNVA 1W7GH 2B0FA 2P93A 1O2GH 1C1SA 3LGIA 1O3OA 3UQOA 4BAQB 1GI8B 4JZ1A 1AB9B 1P05A 1K28D 5E0HA 1AY6H 2H9TH 2ZHQH 4E7RG 3MOCA 1GMHF 2Z9KA 4AB9A 1BTHH 1DXWA 1VCWA 4JZFH 4U2WA 1UVSH 3MU4A 1XUHA 4MPWA 3LPRA 3F9EA 3MO9A 2B9LA 3MO6A 4LK4A 4X6NA 3RP2A 4YM9A 1V6DA 2VVVA 2PKSC 1BTWA 3VXEH 1AQ7A 3PB1E 3P8FA 3PTNA 4D8NA 3GY8A 2Z3EA 1SLWB 1LCYA 2ZIQH 4XOJA 4AGKA 1FPCH 1C1PA 2C90B 1O3LA 2BQ6B 1O2JA 2W5EA 5ESBA 3VB5A 3SV2H 4X1QU 3MH7A 2QC2A 5HYOA 1MTVA 3PMHB 4ZKOU 1ZPCA 3ZYEA 5DP5A 1GJ7B 1DUEA 4PROA 1JXPA 1HAVB 2VGCB 1RTKA 1K1PA 3ZZBA 2HPPH 4ASHA 5EQRA 4B73A 1L1NA 1OWDA 2A4OA 3UUZA 1UK2A 2BZ6H 2ZGJA 5GDSH 1P8VC 3SO3A 2VIQA 1B5GH 1PPHE 1TOMH 2FS9A 2ZU3A 1ELAA 1DICA 1TPAE 2ZDKA 3BV9B 3BTHE 4AYVB 1C9TA 1ZTJA 4CHAB 2NWNA 2FTMA 4MPVA 2BDHA 3EDXB 4NIXA 3V0XA 2BY7X 4WH6A 3KQBA 2ZFFH 2A4GA 1K1MA 2DUCA 5AHGH 1T8MA 3MYWA 5LPRA 1ZZZA 3QX5H 1YM0A 1JRTA 1K1IA 4QT8C 2G81E 2O8UA 3ZVFA 2VH6A 3SZNA 4O03A 1PYTC 1XUJA 3RM2H 4D9QA 1L0ZA 1P9SA 1UTQA 1CVWH 4HI3A 4GCHF 4ZHLU 2JKHA 2GCHF 1QIXB 1PPGE 2BY9X 1NFUA 5FX6A 1ELVA 1RS0A 3MNSA 1DWCH 1Y3XA 5CE1A 1HJ8A 4MLFB 1AVWA 1O2YA 2ZHWH 1H1BA 1P2IA 1DY8A 3A7WA 1RXPA 4AB8A 1VCQA 2TGDA 4CREA 1PYTD 1P06A 2R2MB 2TBSA 1CT2E 2SGQE 1O3KA 2W26A 1LPGB 4YOIA 4B1TA 2JH6D 4K8YA 1SQOA 3RXBA 4THNH 3K2UA 4ISHH 1O2PA 1FXYA 3JZ2B 1PQ5A 5DKMA 2O8TA 2GCTC 3U98H 1AFQB 3PMBB 1FDPA 4JYTA 3BN9A 1D4PB 4OS6A 1TQ0B 2SGDE 4ISOA 3DHKH 3F1SB 2R3UA 3BTGE 3DFLA 2HRVA 2ZQ1A 4WVPE 2PFEA 5T6DA 3CP7A 1AO5A 2QF0A 1G2MA 1SGQE 4K60A 2Q6DA 1C5UA 1UVOA 2PHBA 2WUBA 1QRXA 1P03A 4FUDA 3URDA 3AVZA 3P8NA 2J9NA 1MQ6A 1RRKA 1YPJH 4Q80A 3SUGA 2WINI 5CHAC 5EW2H 1NM6A 3T29A 4ISLA 1DLEA 1BUIA 1JBUH 2B5TB 2UUJB 1FY4A 5EGMA 4FUGA 1ZHRA 4X8UH 4X6MA 4ZMAH 2STAE 1Y3VA 1MUEB 1L4DA 1IQLA 1YPMH 5F03A 4CR9A 1FN8A 3ATMA 3D23A 3VB7A 3U69H 3HKIB 3LGYA 1KTTB 4CRAA 3A87A 3HGPA 2BB4A 2IOTA 4YT6H 3TJOA 3VXFH 4OS2A 4YOJA 1HRTH 2FWWA 2PR3A 1P04A 1GHBF 5T3HA 5LGOA 3T26A 3RXUA 4HTCH 2F9PA 1DPOA 3RMMH 1GVLA 1H9HE 5JDUB 1P3EA 3PYHA 5JBBS 1EAWA 2JETC 5DP8A 4D9RA 5J4SA 3RU4D 6GCHG 1NT1A 1MTNC 3E3TA 1F0TA 3UR6A 3RMNH 1TX7A 5J4QA 1HXFH 2F9UA 2UWPA 2Z94A 8ESTE 1BTUA 1CA0C 4X8VH 1FLEE 4YT7H 1NZQH 3TPIZ 1GBAA 2EC9H 3A89A 5GIBA 4UONA 1Z1IA 1O5GH 2PSXA 3RXHA 4WF8A 3LGTA 1SLUB 2A31A 2WV5A 1E36B 4IW4E 1YYY1 2J94A 2BZAA 4NA8A 1HGTH 1YLCA 4I8GA 1DX5M 2Q1JA 3HKJB 1EOLA 2SNWA 2Z9IA 1FQ3A 4DIHH 5TJXA 2GGVB 1BBRH 1QTFA 9LPRA 1HLTH 2CV3A 2Z7FE 4ABIA 1O3BA 4Y7BA 3I77A 2ANKH 4JYVH 1G36A 1Z71A 1W10U 1UTOA 1C4V2 4CH2B 3BTWE 3SU6A 1LPZB 1DE7H 2VINA 1IOEA 1QL8A 1YCPK 2VWOA 2PUXB 4NCYA 1AB9C 1HAVA 1O3AA 1TGCA 1GBTA 1OPHB 5L2ZH 3RM0H 1S6HA 4MNXA 4K5ZA 3SV6A 1C1RA 4K69A 1QB6A 4KGAA 1G9IE 1CBWB 5AFYH 3O8CA 4KTUA 2HVXA 3QTOH 1TMTH 1O2LA 4XBBA 3ZZ8A 1HPGA 4Q7YA 1XXDA 3ATIA 1NRRH 1Y3UA 4DURA 4FVDA 1S83A 1MAXA 1ZGIA 4Q7ZA 4X2WA 1J16A 2ZWLH 1MD7A 1NFXA 4U30A 4GHQA 1DWDH 2FIRH 3TK9A 3K9XB 5GJ4B 1WTHD 1W3CA 4ABFA 3PLPA 1MKWH 4I31A 2VGCC 1QB1A 1O31A 2FLBH 2Z9GA 4MG3A 1T4VH 3LC5A 2GT8A 1BT7A 1OP8A 1KY9A 1ZLRA 2HGTH 1LHDH 2Y82A 4D7GA 1OYQA 2XNIA 1DFPA 4ZUHA 1IQHA 1KTSB 1NY22 3UPEA 1TRYA 1Y5BT 1E35B 5TCAA 1INCA 1O2QA 1WYKA 3ZVDA 1EZQA 1SG8B 4I8LA 2ZCLP 1LHEH 1QB9A 1MCTA 1SBWA 2DE9A 3TNSA 2RG3A 4NIVA 1SFQB 3Q3XA 1C5LH 2AGGX 1C2MA 1TBZH 4FUBA 3NXPA 5DG6A 3A83A 3QGJA 3RDZA 3A7ZA 4B2AA 3M7QA 2BXUH 1C4U2 1O5EH 2FPZA 2Z3CA 1AE5A 1C1NA 3VFEA 4ISNA 1Y3YA 2LNCA 1TMBH 2Q6GA 2OC0A 1G3EA 1J8AA 1ZMNA 4AFZA 3SOSA 1K1LA 3E0NB 2ANYA 2W3KA 1C2EA 2BQWB 3ITIA 5JYIA 4H6TA 1GVZA 3FAOA 2UWOA 1BOQA 4Z6AH 1NO9H 4CRCA 4IS5A 2XCNA 2ZHFH 3QLPH 3FZDA 3UNSA 3E6PH 3SGQE 3BF6H 4K1EA 4NA9H 2R3YA 1KDQB 2XC0A 2SGFE 1F2SE 2AMPA 4UE7H 2H1UA 4ZXYH 1WQSA 1T8NA 1BZXE 1GG6B 1ZHPA 5A8ZA 2CGAA 2A4RA 1XXFA 4FUCA 2XTTB 5DP9A 1CHOG 2F9NA 1AFQC 1XUFA 1FY3A 1O2UA 1NRPH 2C8ZB 5FPSA 1M9UA 3M36A 1GJ8B 1O2HA 1QJ6B 2BLQA 1C1UH 3ZZ9A 4GPGA 1C2FA 1S85A 1FN6A 3QN7A 4WMDA 3PO1B 1FJSA 3M37A 2OCVB 1A3BH 4UFDH 4TYDA 2GMTB 4BAKB 1P09A 2STBE 2ZGCA 1S0QA 2BHGA 1IHSH 2A2XH 4F4OC 1CGHA 3LT3A 5DO4H 4MQAA 3GY6A 4INLA 2OLGA 3SI4H 2EI8A 1OWJA 3OYPA 1TNGA 6CHAB 1TLDA 2ZDNA 2AGEX 2BD9A 1LQEA 2G55A 4X1RU 3KQDA 5E0JA 5GXPA 3DA9B 4X1SU 2BDIA 3UNRA 4XBCA 2GDEH 1LQDB 1AKSB 1YCPM 1V2RT 4YESB 4A5TS 3K65B 4AFSA 2P59A 2BLVA 3KNXA 1O2TA 4WWYA 1O3MA 1W12U 1Q31A 1ABIH 2G8TA 3RXPA 1SGEE 1SGIB 1G3DA 1C5QA 3RXTA 5EXMA 2P3TB 3RLWH 1RGQA 1AMHA 5EXLA 4E05H 2ZG0H 1ESBA 3F9FA 3MMGA 2A7HA 2O9QA 1UK4A 3RXLA 1KXDA 2BDGA 3SNBA 4B74A 1QCPA 2ZQ2A 1EXFA 2V3OH 4B75A 5BRRE 1ELTA 3AW1A 2OBQA 5K7RA 2UUKB 1B0EA 5JBCS 1CQQA 1GMHG 2HOBA 4NZQA 1SL3A 2BXTH 3NUMA 4JZDH 3MU0A 5DP3A 4XFQA 2B8OH 4BOHA 2VIWA 1WV7H 5FXLA 2BX4A 2QXGA 4JZEH 5EU8A 8GCHF 1BRCE 2PGBB 4OS5A 2A1DB 1LVOA 1ZYOA 1HCGA 1S0RA 2AIPA 4K3JA 1O39A 4IGDA 2ZU5A 1GMCG 4NA7A 2V0BA 2BLWA 4LZ1H 3SGBE 7GCHF 3RMLH 4INKA 3UWIA 3ELAH 2KAIB 1LKAA 1GGDB 1N8OC 5DP4A 1O2RA 1SC8U 3RXAA 2ZZUH 3GOVB 2VB0A 1MZAA 2BD7A 2G00A 2Y5FA 5IYTA 3PMJA 1ZJKA 5FBIA 1GPZA 3C1KA 5C67A 3ZZ4A 5F8XA 4FU8A 4AORA 5B6OA 2AMDA 4YLUA 1EZSC 3ZVBA 4UFEH 3FP8E 1A0HB 3GCOA 4UD9H 4B2BA 1EJAA 4I7YH 1MBQA 1P10A 4ESTE 1FAXA 2Y7ZA 4FUFA 3S7HB 1C1TA 1A61H 2GX4A 3V7TA 1BJVA 2ZFPH 2H2ZA 3GCNA 2K1QA 5DPAA 5L2YH 1CBWC 2FYRA 1O2IA 4GCHG 2I6SA 1C1QA 1AHTH 2PTNA 4HGCA 1SHHB 3KIDU 1TQ7B 4H42U 4H6SB 1GI3A 2BOHB 5DJ7A 2W3IA 5A2MH 1GJ4H 1V2VT 5A09A 1YPKH 1CT4E 3VEQB 2IN2A 3A7TA 1V2WT 3T2NA 4TWWA 3SUFA 3MH4A 2OC8A 5C5NA 3CENA 1GJBB 1Q2WA 3PLBA 1EKBB 1PJPA 4NSVA 4IC5A 2HNTC 1FNIA 3IWMA 2AH4X 2SGPE 4WJG2 1O36A 2G51A 3NPSA 3SW2B 3GYMA 4JMYA 2FXRA 2B7DH 1O2VA 1OYTH 2OTVA 4IBLH 1RD3B 1WSSH 2P8OB 1V2TT 1JIRA 1JOUB 1LHCH 1O5FH 4GUXA 2ZCHP 4DY7B 1S84A 2WPKS 3RXKA 4ABBA 1EX3A 1V2LT 1ZMLA 5EW1H 1KYNA 2A7CA 3UREA 4RKOB 3NWUA 1HAXB 5C5OA 4ABGA 2H5DA 1KDQA 1P02A 1EP5A 1PQ7A 1A0LA 2BD2A 1QA0A 2XXLA 2QYIA 1SGTA 2A4QA 2QCYA 1A5HA 5C1YA 3KGPA 4NG9H 1MAYA 1QBNA 3U8OH 1MQ5A 3VGCB 1O3CA 3Q76A 3QZRA 1D3DB 1O3GA 5C2ZA 1ELDE 1DUAA 4BAMB 1UVTH 1BIOA 5IDKA 3P92A 3V12A 1MH0A 1OXGA 2V6NA 1AFEH 1TYNA 4IMZA 1BHXB 3OU0A 4FVBA 2BVSH 2C8YB 1YF4A 5FCKA 1EASA 5HM9A 2XC4A 2UUFB 4IMQA 1G3BA 4KTSA 4A92A 2FOGA 5A0AE 3URCA 1XM1A 5HMAA 2BY6X 1THRH 1NRSH 7ESTE 2NU1E 2TGAA 1O5DH 1P57B 2A32A 3G01A 3MWIU 3SQHE 1HYLA 1D6RA 3OTJE 1IQEA 3D62A 4TY7A 1G30B 2H6MA 4NIWA 1HFDA 3T27A 3RU4E 1GG6C 5K0HA 3GY7A 3BEFB 1AKSA 1SSXA 3HGNA 4JYUH 1FMGA 2FM2A 3BG8A 1TNHA 3TJUA 4R0IA 1EZUC 3LONA 1SGYE 2FI4E 4AFQA 1XKAC 2ALPA 2WYGA 5EQQA 2ZDVH 1MCVA 3R0FA 7KMEH 2ODPA 1S5SA 3TU7H 4LZ4B 2FS8A 1BMLA 1V2MT 1DSUA 3PO1C 1TGBA 1V2OT 1AZZA 3LDXH 4NWLA 3DFJA 3T25A 3RC4A 3M5LA 1Z8RA 3RXVA 1GI7B 1J17T 2Y7XA 2GMTC 1HAGE 2GKVE 1SGCA 2C4FH 3P70B 4B2CA 3RXQA 4FUHA 3LH1A 1S82A 2VJ1A 1HNEE 2GP9B 3RXDA 1TFXA 1Z7KA 6CHAC 3A7YA 1QY6A 5FX5A 2XBWA 1BTZA 2YNBA 1VJAU 1A46H 3RC5A 3U8RH 5SGAE 3B23B 1BB0B 1GDQA 1K1OA 4MPXA 5EQSA 5E2OA 1O3IA 2D26C 3K6YA 1SQAA 1UVUH 1EAUA 3ATLA 4JK6A 1TGSZ 5F8ZA 3TH2H 2QIQA 4FU9A 4E06H 5LPFA 1GVKB 3LC3A 2RCEA 1RIWB 1DWEH 3A7VA 2FESH 4K1SA 1BBRE 2FDAA 3MNBA 4BXSA 1QQ4A 4WH8A 2PTCE 1CU1A 1V2KT 1ZTKA 2ANWA 3BEUA 1K21H 2KAIA 2FX6A 4NSYA 1ESTA 1SLVB 3RXOA 1SR5C 1GHAG 1ELFA 1ELGA 2WYJA 3GY3A 2HPQH 1H8IH 2PLXA 4VGCB 2GT7A 1GI4A 1OS8A 2ULLA 2ZF0H 2UUYA 3EA9A 3T5FH 1BQYA 1UTKA 3U9AH 4CRDA 3M3SA 1GL1A 4I8KA 1LMWB 3BIVH 3EAJA 4YOGA 2Y5HA 3RUOA 1HJAB 1LPKB 2P3FH 3SV9A 1Z8JB 1YKTA 3Q3KA 2VIOA 3UY9A 1TNIA 2ESTE 2AMQA 2ZA5A 2BY8X 4I33A 4X6PA 3SN8A 4AYYB 1BRUP 3KF2A 1EJMA 2BM2A 1SOZA 1FONA 1GGDC 4BANB 1O38A 3KEEA 2GVFA 1FPHH 1MKXK 3VB4A 5AF9H 3AAVA 1SB1H 4Y6DA 2BY5X 3RXRA 4D76A 4O97A 1AVGH 2HWLB 1EAXA 3SNCA 3RXJA 6GCHF 4AFUA 4SGAE 3P8OA 2AFQB 2ODYB 1LKBA 2M5TA 1X7AC 1Z6EA 1UCYK 1IQIA 1Y8TA 1G3CA 1MTUA 2FI5E 1V3XA 2HALA 3EQ0H 3SBKA 4DGJA 3E1XB 1O2MA 1SGFG 3ZVEA 1AWHB 4M7GA 1EATA 1NFWA 3NKKA 1YP9A 3FFGA 3MH6A 3KL6A 1VITG 4GSOA 2QGRA 1QL7A 5FBEA 3SJ9A 1QBOA 1HAOH 3DT0H 2SGAA 4U32A 3L33A 3LJOA 1FI8A 4KTCA 4Y0ZE 1TALA 1L2EA 3IITA 1O33A 2VIVA 2QN5T 1W0YH 5LPEA 3KHVA 2ZCKP 3PLKA 2G5NA 1YPHC 1ZPZA 2ZU2A 2FX4A 4X2XA 2A7JA 3M7TA 3TK6A 1EUFA 3ZZ6A 2OD3B 1FZZA 4TPIZ 1NU9A 1P2KA 3Q77A 1Z1JA 1ELEE 2XBYA 3P95A 8LPRA 1WBGB 3MU5A 1TGTA 1BRAA 2EA3A 1K9OE 1TONA 2GTBA 4MVNA 4CHAC 1LHGH 2P8OC 3GDSA 9ESTA 3O8BA 2QV1A 1O3DA 2R9PA 2VWNA 1EB1H 3UR9A 5FPTA 2D8WA 2FOBA 4NGAH 1Y5UT 3ZZ7A 2D2DA 3MFJA 1GJ9B 3M3VA 1NESE 1P2JA 1TNLA 1SGFA 3GDVA 2R0KA 1EPTA 3GDUA 1SPJA 1BMMH 1EAIA 4MNYA 3ZVAA 1RJXB 1LVBA 4AG2A 5FCRA 1QJ7B 4U01A 1ZSJA 3QDZB 5ETXA 1SHYA 1GCDA 1ELBA 4X8SH 4HFPB 1O32A 2Z9LA 2ZGHA 2A5AA 1GBMA 3VGCC 1C5OH 1YLDA 1GHXH 1K22H 1TIOA 2FI3E 5GWZA 5DP6A 5A8YA 3MNCA 4YTAA 1ETSH 1EP6A 2OBOA 4ABJA 2F3CE 1D9IA 3SQEE 2OXSA 3E8LA 4FU7A 4Y8YA 4E7NA 4J2YB 1YBWA 3RXCA 3LJJA 4A1VA 2P3UB 2ZTXA 1A4WH 2GZ8A 3LU9B 3GCTF 1DS2E 2QY0B 3BTFE 2CF8H 5L30H 2ZPRA 1H9IE 8KME2 1VITH 1PFXC 3GY2A 1YGCH 4I32A 1HAHH 3BTEE 5EPYA 3E90B 3PV4A 2FO9A 4JCNA 2FOAA 1MU6B 1HAZB 1GI5A 1P2QA 3A8DA 1ZMJA 2NU3E 2PW8H 4H4FA 2P95A 4AZ2B 1ZPBA 1VGCB 3LOXA 3SJOA 1W7XH 4F49A 4ABAA 2ZO3H 1RTLA 3VPKA 2ZFRH 1SGRE 5CMXH 4AG1A 1KXAA 1C1MA 1A5GH 3BTME 1T8OA 2Y80A 4ZKNU 2ZDAH 4LOYH 1A0JA 3SU0A 1Y3WA 1QL9A 2IPHA 4NFFA 1J15A 1OSSA 1Y5AT 3D49H 3M61U 1P01A 1UCYE 3ZZDA 2GD4B 1O3PB 2W7UA 4WMFA 3STIA 1TRMA 2QAAA 1QJ1B 2FLRH 2PKAB 1HB0B 1O35A 1WU1A 2XCFA 3ATWA 2BOKA 2EEKA 3BTDE 3SV7A 3TH3H 3UWJH 1DOJA 2AERH 1LHFH 1T4UH 8GCHG 1AZ8A 1TGNA 3STJA 3A86A 2FMJA 1A7SA 1DWBH 4Y76A 1WCZA 1ZRKA 1OWEA 4CBOA 1UTPA 3E0PB 1TNKA 4JK5A 1GBBA 4Y79A 7GCHG 1SMFE 3BSQA 1HXEH 3AASA 2P16A 3ZV9A 4NZLA 3F68H 4BTIB 1J14A 1YCPH 2BD4A 3EA7A 3P8GA 1TPPA 1CA8B 1QNJA 1GL0E 3M5NA 2ZI2H 1D3QB 4DT7B 3QZQA 1SGPE 1MKXH 1TX8A 1CHGA 1RIWC 3FP6E 2UWLA 3SU4A 3UQVA 2PSYA 1ZHMA 3SU5A 3U8TH 1BA8B 2O8WA 1BTXA 1CSOE 3TIUA 5EODA 1YPLH 3BG4B 4KELA 1VZQH 2ZHDA 3RU4T 3VB3A 1Z6JH 4ZH8A 2A45B 1GHVH 1SI5H 3CS0A 5GCHF 2ZKSA 1GMDF 4I8HA 6ESTA 2XYAA 4ZKRU 1P3CA 2H5CA 4BTTB 1IQMA 1J9CH 5HXFA 2G4TA 1AD8H 2ZFQH 2CHAB 3B8JA 2EI6A 4CR5A 3Q3YA 1NRNH 1FY1A 3B9FH 3SHCH 1HIAA 3RXIA 1XKBC 1P9UA 3IG6B 1KLJH 1FY5A 3I29A 4WY3A 1O2OA 2IJOB 2ZPQA 3KQEA 1ANDA 1UJ1A 4X1PU 1HJAC 1QR3E 1KXBA 5T6GA 3A84A 1GI6A 3H7OA 1TRNA 4X6OA 1BMNH 1HAPH 3MI4A 1KXCA 4FUIA 1IAUA 3I78A 3LKWA 1G2LA 1SOTA 3UOPA 3EA8A 4RN6A 5C1UA 2OQUA 2HNTF 1G32B 4ABDA 1O37A 4DCDA 1TMUH 1ARCA 3ZZCA 3LGUA 5I25A 2XRCA 4K2YA 3TITA 4Y11E 3TGIE 2YNAA 2HNTE 1C5NH 1DITH 1JMOH 2FOFA 1C5MD 3ZZ3A 1BMAA 2GV6A 1QHRB 2XBVA 1O34A 3QO6A 4Y71A 3GYLB 1FIZA 4MTBA 3U1IB 5JPMH 1O30A 2FOEA 2RA0A 2GCHG 1TX6A 2ZDMA 3ODFA 1C5YB 4ZROA 3SGAE 1JWTA 3SUDA 3ZVCA 1O3HA 2WPMS 1GBJA 3H5CB 1DXPA 1NN6A 1GWAA 1DM4B 3A81A 3GCHB 1AUJA 5A8XA 4CH8B 2ZTZA 1GMCF 1EQ9A 1MMJN 2OQ5A 1PQ8A 1A2CH 1SQTA 1BBRK 1MU8B 1BRBE 2ZHEH 5JB8S 1PPBH 3GY4A 3ZZAA 1FV9A 1WTGH 1K2I1 3BTQE 1C2HA 1H9LB 2AEIH 3E16B 3C27B 3FVFB 4AN7A 1XUIA 4BAHB 1RFNA 3A85A 1CGIE 2WV4A 1ZR0A 2SGEE 3ZV8A 1V2PT 2BD5A 3KCGH 3PROA 1SGNE 1F92A 4TPYA 3PMAB 1C1VH 1C5TA 3M5MA 1IQGA 3RXGA 1W14U 4UDWH 1QA7A 1AVXA 3TNTA 1C5XB 1FIWA 1W2KH 3FZZA 2BYAX 2QXHA 2QXJA 2Y5GA 4B76A 2AYWA 1BDAA 1C9PA 2SNVA 1ELCA 1AGJA 1V2NT 3ESTA 5BPEA 1C5PA 1QFKH 2THFB 2ZP0H 1JIMA 4A7IB 3QWCH 3AAUA 2ZGXH 4YO9A 2CN0H 2ZEBA 3UOUA 1DY9A 3A8AA 2BVRH 2Z3DA 3UTUH 2H9EH 4OGYA 2AIQA 2XWAA 4OS7A 1HAIH 1S6FA 4Y8ZA 1ANCA 1CT0E 1O0DH 1WAYB 2ZC9H 3HK6B 2XC5A 2J4IA 3LIWA 2F9BH 2TIOA 4UEHH 5I46H 1MKWK 1EJNA 1EOJA 1TB6H 1NPMA 3O8DA 1CE5A 3LGWA 1XVMA 1C2JA 1ZJDA 3TJVA 4LXBH 4GAWA 1Y59T 1EPTB 2G4UA 3Q00A 1PPEE 2ZNKH 1EB2A 2ZPSA 2O8LA 5FPYA 2FYQA 1C2DA 3BEIB 4CRBA 1SFIA 1O2WA 3F6UH 3OY5U 1HUTH 3K6ZA 1GI2A 2VIDA 2PKAA 1GJ6A 1JRSA 3NK8A 3QK1A 1GCTB 1GHBG 1PPZA 1L4ZA 3TLOA 3TGKE 3MO3A 4A1TA 2RA3A 1E37B 2C93B 1TWXB 1P0SH 3VB6A 3GY5A 1ABJH 1GDNA 2J38A 3KQCA 1HAYB 4YZUA 2BD8A 2JH0D 1QRWA 4Y10E 3A7XA 2ANMH 1XUGA 3SHAH 2H9HA 3HK3B 1TOCB 2XW9A 1BTPA 3DUXH 3D65E 1TNJA 1ESAA 1GBEA 1Z8IB 1IQKA 3EGKH 3JZ1B 4FXGH 1OP2A 3QUMP 2W7SA 1NTPA 1A3EH 1KLIH 1NC6A 2BVXH 2HLCA 2JH5D 3SNAA 1VGCC 2BX3A 5F8TA 4Z0KA 2WPHS 2FOCA 4A6LA 4K1TA 4TY6A 5EOKA 3SI3H 1HDTH 1THPB 3S69A 4O9VA 3WY8A 4KKDA 1GHWH 4FUEA 1GJ5H 3QGNB 5JB9S 3ZYDA 2FTLE 3S7KB 1C2KA 3S9AA 2CF9H 4MPUA 2BQ7B 2Z9JA 3NCLA 4GHTA 2TPIZ 3TVJB 1T31A 5E8EH 4AGJA 1T7CA 1GHZA 1UTJA 1ZSKA 3MU1A 4NIYA 3HATH 1O5CB 2NU0E 1T32A 3V13A 1XVOA 3AW0A 1UHBB 2A5IA 5ESTE 2ODQA 1GBKA 1HBTH 1GI1A 1V2ST 2OUAA 1LO6A 1P2OA 2QA9E 2ZDLA 4J1YA 3GISB 4TWYA 3SV8A 1K1JA 5LH8A 4OGXA 2C8XB 4WXVA 2BD3A 2WPJS 1UMAH 2EI7A 1UK3A 1QRZA 1GJAB 3UIRA 1KXFA 4Y0YE 4IN1A 3TK5A 1IQFA 4RSPA 1LVYA 1D3TB 1C4Y2 1F0SA 2ZECA 4MNWA 1ACBE 5GPIB 3BG4C 3ATKA 3BIUH 1V2QT 1P12E 2VWLA 2BDBA 3QTVH 1D6WA 1TPSA 2SFAA 1AE8H 3FANA 1PPCE 2QXIA 3ENSB 1C2IA 1OP0A 1GJDB 3RXSA 5C3NA 3MNXA 1W13U 3FP7E 2CHAC 1NFYA 1YPGH 1E0FD 4ZAEA 5C1XA 2FOHA 3ZZ5A 3RMOH 1N8OB 3P6ZB 4BTUB 2ZGBH 1KIGH 4CBNA 1XMNB 2AGIX 2J92A 1ID5H 2FZZA 5AFZH 4SGBE 1LVMA 1F5KU 1ETRH 2ALVA 1UTNA 2PV9B 5E0GA 3ODDA 1OKXA 1ANBA 5L6NH 1XUKA 1C1WH 3W95A 2PKSB 1AWFH 1YPHE 4ISIH 3KN2A 2CJIA 4KP0A 1TE0A 1HIAB 1MTSA 1IQJA 2NU4E 3L3TA 1CGJE 4Y8XA 1LTOA 1O3EA 5H4IB 4GLYA 2PGQB 3A8CA 1VJ9U 4I8JA 1GHAF 3O8RA 1P11E 1F5LA 1C2LA 1TBRH 3LGVA 4Y7AA 3SJKA 1O3JA 1OOKB 1VR1H 2A0QB 2OINA 3PWCA 1DANH 3PM3A 7LPRA 1D3PB 3SNEA 1GBDA 1H4WA 2F83A 2ZU1A 4B71A 1XX9A 4FUJA 5JBTA 3SU2A 2PUQH 1W11U 1UTMA 3S0NA 3A80A 1G37A 4A1XA 1C5WB 2FODA 3SJIA 4BXWA 2BDAA 4GVUA 3OX7U 3RXFA 1EZXC 1GDUA 4ABEA 2WUCA 2OC7A 1TA2A 2GZ9A 3GCHC 4O3UA 3RC6A 1WQVH 1ZOMA 4OS4A 2ZFTA 1OX1A 2Z6BD 2VNTA 4BNRA 1L1JA 1QQUA 1Z8GA 3TGJE 1YPEH 1B0FA 4DIIH 1OWHA 1WUNH 3E91A 3F9GA 3SORA 1DSTA 1GBHA 2VU8E 2C8WB 3MU8A 1C5SA 2YOLA 1U6QA 2ZTYA 3S9CA 1F0RA 1W0ZU 3PTBA 4NFEA 5EG4A 1BHXF 2WPIS 1RTFB
chains in the Genus database with same CATH superfamily
3GCTG 1GBFA 2TGPZ 1B7XB 4UFGH 3S9BA 1SQRA 2DE8A 1KLTA 5C0TA 1ZSLA 1FX0B 4DW2U 1V2JT 2BDYA 3HPTB 3A8BA 2J2UA 3SU1A 1AI8H 1KXEA 5EJ1A 5ABWA 1V2UT 4Q63A 3EE0B 1OWIA 3L6PA 1WOFA 1TPOA 1P2MA 1HV7A 2GDDA 1AU8A 1VITF 5F6MA 1L1GA 1S81A 2XWBI 1MBMA 3OY6U 5HGGA 2D1JA 5T6FA 1BJUA 1DLKB 2OC1A 1YC0A 3M35A 1ZRBA 4WMEA 4BAOB 1F7ZA 4YXWD 2F91A 2J34A 3SNDA 2W6ID 1AUTC 1UVPA 3SJ8A 1LDTT 2ZU4A 3OSYA 5E2PA 1T8LA 4Q7XA 3LH3A 1ETTH 4IN2A 1PQAA 3SUEA 4CRGA 1SKYE 1GI9B 3OEHD 1KSNA 3EYDA 4ABHA 4P00A 5EPNA 2F9VA 5DP7A 1PPFE 2G5VA 1SVPA 1ORFA 2VIPA 2NU2E 4RKJB 3DD2H 2GCTB 5HM2A 1TA6A 1GBCA 1O2SA 5DK1A 4INHA 2XBXA 4ZKSU 2OP9A 1QGFA 1E1RD 1EPTC 4X0WU 5G4BA 2BTCE 1TABE 1Q3XA 3SU3A 4K8BA 1ANEA 1C5RA 4AX9H 4Q2KA 4CRFA 1SLXB 5PTPA 2A2QH 2BDCA 5AVDA 1AN1E 1UTLM 1GCTC 5FHTA 4O3TA 1GHYH 1NU7B 1TBQH 2Y81A 1UHBA 3ZVGA 2BMGB 1DT2A 4DG4A 1N1LA 5CHAB 1C5ZB 3UNQA 2R0LA 1FUJA 1MTWA 1O2KA 5JBAS 1A1RA 5TCCA 3WW7A 3W94A 2C3SA 3T28A 3M5OA 3CS7A 2LPRA 1THSH 1F5RA 4NWKA 3TH4H 5C20A 1NS3A 1BCUH 5HKKD 3N7OA 1O2XA 1ARBA 4ZXXH 1MZDA 1FY8E 2TRMA 5GCHG 1GMDG 3P17H 1FAKH 3UFAA 4AOQA 1NROH 3A82A 1DVAH 4UFFH 2RDLA 2F9OA 2ILNA 4X8TH 4D7FA 4ZHAA 1AIXH 3EE7A 3GICB 2GZ7A 1E34B 5DGJA 2Q6FA 2V35A 1A5IA 1F0UA 4OM9A 4R8TB 1CHOF 2PWXA 5FL7D 1IQNA 2QF3A 2V3HH 1HJ9A 1C2GA 1H8DH 1IHTH 1ZTLA 2BLOA 4XSKU 2CMYA 3MHWU 4YLQH 2FOMB 2VVCA 3H7TA 4X1NU 1VCPA 2O8MA 1O2ZA 3NZIA 1CO7E 3MTYA 4IC6A 1TAWA 1O3FA 3M3TA 2JETB 2ZFSA 2RDEA 4DOQA 3UB0A 4DJZB 2FEQH 1W8BH 6LPRA 1MTNB 1GBLA 3T62A 2KCAA 2FP7B 1O5AB 2A5KA 1BTYA 3BTTE 2HLDD 3PWBA 2P94A 2CXVA 3TJNA 2IPQX 1CA0B 1UO6A 1UCYH 2J95A 2WPLS 2VWMA 4JZIA 1O5BB 2TGTA 2VH0A 1BITA 4XE4A 1GI0A 1QURH 1MD8A 2I6QA 1GBIA 1O2NA 4ZHMU 1C5VA 4HZHA 1E38B 2VVUA 4VGCC 1DDJA 2AS9A 3M7UA 3RLYH 4MDSA 1SGDE 3BTKE 4X2VA 2R2WU 3RXEA 1OWKA 3V3MA 1N6YA 5FAHA 3A88A 3R3GB 4XDEA 3RXMA 1NBME 1GJCB 5A0CA 4WXIA 4X2YA 5A0BA 1QBVH 1K1NA 2Y6TA 3F9HA 1N6XA 2G52A 2ASUB 4OS1A 4XBDA 1P2NA 5EXNA 1C1OA 3U1JB 1NRQH 2GV7A 4DVAU 1ZGVA 3MH5A 1O3NA 4MNVA 1W7GH 2B0FA 2P93A 1O2GH 1C1SA 3LGIA 1O3OA 3UQOA 4BAQB 1GI8B 4JZ1A 1AB9B 1P05A 1K28D 5E0HA 1AY6H 2H9TH 2ZHQH 4E7RG 3MOCA 5KECA 1GMHF 2Z9KA 4AB9A 1BTHH 1DXWA 1VCWA 4JZFH 4U2WA 1UVSH 3MU4A 1XUHA 4MPWA 3LPRA 3F9EA 3MO9A 2B9LA 3MO6A 4LK4A 4X6NA 4XRNA 3RP2A 4YM9A 1V6DA 2VVVA 2PKSC 1BTWA 3VXEH 1AQ7A 3PB1E 3P8FA 3PTNA 4D8NA 3GY8A 2Z3EA 1SLWB 3SZEA 1LCYA 2ZIQH 4XOJA 4AGKA 1FPCH 1C1PA 2C90B 1O3LA 2BQ6B 1O2JA 2W5EA 5ESBA 3VB5A 3SV2H 4X1QU 3MH7A 2QC2A 5HYOA 1MTVA 3PMHB 4ZKOU 1ZPCA 3ZYEA 5DP5A 1GJ7B 1DUEA 4PROA 1JXPA 1HAVB 2VGCB 1RTKA 1K1PA 3ZZBA 2HPPH 4ASHA 5EQRA 4B73A 1L1NA 1OWDA 2KR7A 2A4OA 3UUZA 1UK2A 2BZ6H 2ZGJA 5GDSH 1P8VC 3SO3A 2VIQA 1B5GH 1PPHE 1TOMH 2FS9A 2ZU3A 1ELAA 1DICA 1TPAE 2ZDKA 3BV9B 3BTHE 4AYVB 1C9TA 1ZTJA 4CHAB 2NWNA 2FTMA 4MPVA 2BDHA 3EDXB 4NIXA 3V0XA 2BY7X 4WH6A 3KQBA 2ZFFH 2A4GA 1K1MA 2DUCA 5AHGH 1T8MA 3MYWA 5LPRA 1ZZZA 3QX5H 1YM0A 1JRTA 1K1IA 4QT8C 2G81E 2O8UA 3ZVFA 2VH6A 3SZNA 2F43B 1PYTC 4O03A 1XUJA 3RM2H 4D9QA 1L0ZA 1P9SA 1UTQA 1CVWH 4HI3A 4GCHF 4ZHLU 2JKHA 2GCHF 4M9FA 1QIXB 1PPGE 2BY9X 1NFUA 5FX6A 1ELVA 1RS0A 3MNSA 4TT3D 1DWCH 1Y3XA 5CE1A 1HJ8A 4MLFB 1AVWA 1O2YA 2ZHWH 1H1BA 1W0JD 1P2IA 1YLNA 1DY8A 3A7WA 1RXPA 4AB8A 1VCQA 2TGDA 4CREA 1PYTD 1P06A 2R2MB 2TBSA 1CT2E 2SGQE 1O3KA 2W26A 1LPGB 4YOIA 4B1TA 2JH6D 4K8YA 1SQOA 3RXBA 5EIYA 4THNH 3K2UA 4ISHH 1O2PA 1FXYA 3JZ2B 1PQ5A 5DKMA 2O8TA 2GCTC 3U98H 1AFQB 2F4LA 3PMBB 1FDPA 4JYTA 3BN9A 1D4PB 4OS6A 1TQ0B 2SGDE 4ISOA 3DHKH 3F1SB 2R3UA 3BTGE 3DFLA 2HRVA 2ZQ1A 2V7QD 4WVPE 2PFEA 5T6DA 3CP7A 1AO5A 2QF0A 1G2MA 1SGQE 4K60A 2Q6DA 1C5UA 1UVOA 2PHBA 2WUBA 1QRXA 1P03A 4FUDA 3URDA 3AVZA 3P8NA 2J9NA 1MQ6A 1RRKA 1YPJH 4Q80A 3SUGA 2WINI 5CHAC 5EW2H 1NM6A 3N99A 3T29A 4ISLA 1DLEA 1BUIA 1JBUH 2B5TB 2UUJB 1FY4A 5EGMA 4FUGA 1ZHRA 4X8UH 4X6MA 4ZMAH 2STAE 1Y3VA 1MUEB 1L4DA 1IQLA 1YPMH 5F03A 4CR9A 1FN8A 3ATMA 3D23A 3VB7A 3U69H 3HKIB 3LGYA 1KTTB 4CRAA 3A87A 3HGPA 5T1VA 2BB4A 2IOTA 4YT6H 3TJOA 3VXFH 4OS2A 4YOJA 1HRTH 2FWWA 2PR3A 1P04A 1GHBF 5T3HA 5LGOA 3T26A 3RXUA 4HTCH 2F9PA 1DPOA 3RMMH 1GVLA 1H9HE 5JDUB 1P3EA 2WPDD 3PYHA 5JBBS 1EAWA 2JETC 5DP8A 4D9RA 5J4SA 3RU4D 6GCHG 1NT1A 1MTNC 3E3TA 1F0TA 3UR6A 3RMNH 1TX7A 5J4QA 1HXFH 2F9UA 2UWPA 2Z94A 8ESTE 1BTUA 1CA0C 4X8VH 1FLEE 4YT7H 1NZQH 3TPIZ 1E1QD 1GBAA 2EC9H 3A89A 5GIBA 4UONA 1Z1IA 1O5GH 2PSXA 3RXHA 1H8ED 4WF8A 3LGTA 1SLUB 2A31A 2WV5A 2XOKD 1E36B 4IW4E 1OHHD 1YYY1 3WWBA 2J94A 2BZAA 4NA8A 1HGTH 1YLCA 4I8GA 1DX5M 4FOUC 2Q1JA 3HKJB 1EOLA 2SNWA 2Z9IA 1FQ3A 4DIHH 5TJXA 2GGVB 1BBRH 1QTFA 9LPRA 1HLTH 2CV3A 2Z7FE 4ABIA 1O3BA 4Y7BA 3I77A 2ANKH 4JYVH 1G36A 1Z71A 1W10U 1UTOA 1C4V2 4CH2B 3BTWE 3SU6A 1LPZB 1DE7H 2VINA 1IOEA 1QL8A 1YCPK 2K8IA 3OEED 2VWOA 2PUXB 4NCYA 1AB9C 1HAVA 3UAIC 1O3AA 1TGCA 1GBTA 1OPHB 5L2ZH 3RM0H 2YMSD 1S6HA 4MNXA 4K5ZA 3SV6A 1C1RA 4K69A 1QB6A 4KGAA 1G9IE 1CBWB 4FETA 5AFYH 3O8CA 4KTUA 2HVXA 3QTOH 1TMTH 1O2LA 4XBBA 3ZZ8A 1HPGA 4Q7YA 1XXDA 3ATIA 1NRRH 3WWFA 1Y3UA 4DURA 4FVDA 1S83A 1MAXA 1ZGIA 4Q7ZA 4X2WA 1J16A 2ZWLH 1MD7A 1NFXA 4U30A 4GHQA 1DWDH 2FIRH 3TK9A 3K9XB 5GJ4B 1WTHD 1W3CA 4ABFA 3PLPA 1MKWH 4I31A 2VGCC 1QB1A 1O31A 2FLBH 4I86A 2Z9GA 4MG3A 1T4VH 3LC5A 2GT8A 1BT7A 1OP8A 1KY9A 1ZLRA 2HGTH 1LHDH 2Y82A 4D7GA 1OYQA 2XNIA 1DFPA 4ZUHA 1IQHA 1KTSB 1NY22 3UPEA 1TRYA 1Y5BT 1E35B 5TCAA 1INCA 1O2QA 1WYKA 3ZVDA 1EZQA 1SG8B 4I8LA 2ZCLP 1LHEH 1QB9A 1MCTA 1SBWA 2DE9A 3TNSA 2RG3A 4NIVA 1SFQB 3Q3XA 1C5LH 2AGGX 1C2MA 1TBZH 4FUBA 3NXPA 5DG6A 3A83A 3QGJA 3RDZA 3A7ZA 4B2AA 3M7QA 2BXUH 1C4U2 1O5EH 2FPZA 2Z3CA 1AE5A 1C1NA 3VFEA 4ISNA 1Y3YA 2LNCA 1TMBH 2Q6GA 2OC0A 1G3EA 1J8AA 1ZMNA 4AFZA 3SOSA 1K1LA 3E0NB 2ANYA 2W3KA 1C2EA 2BQWB 3ITIA 5JYIA 4H6TA 1E79D 2WV9A 1GVZA 3FAOA 2UWOA 1BOQA 4Z6AH 1NO9H 4CRCA 4IS5A 2XCNA 2ZHFH 3F3BA 4P02A 3FZDA 3UNSA 3E6PH 3SGQE 3QLPH 3BF6H 4K1EA 2KCOA 4NA9H 2R3YA 1KDQB 2XC0A 2SGFE 1F2SE 3FN8A 2AMPA 4UE7H 2H1UA 4ZXYH 1WQSA 1T8NA 1BZXE 1GG6B 1ZHPA 5A8ZA 2CGAA 2A4RA 1XXFA 4FUCA 2XTTB 2XNDD 5DP9A 1CHOG 2F9NA 1AFQC 1XUFA 4RT0A 1FY3A 1O2UA 1NRPH 2C8ZB 5FPSA 1M9UA 3M36A 5GNDA 1GJ8B 1O2HA 1QJ6B 2BLQA 1C1UH 3ZZ9A 4GPGA 1C2FA 1S85A 1FN6A 3QN7A 4WMDA 3PO1B 1FJSA 3M37A 2OCVB 1A3BH 4UFDH 4TYDA 2GMTB 4BAKB 1P09A 2STBE 2ZGCA 1S0QA 2BHGA 1IHSH 2AHME 2A2XH 4F4OC 1CGHA 3LT3A 5DO4H 4MQAA 3GY6A 4INLA 2OLGA 3SI4H 2EI8A 1OWJA 3OYPA 1TNGA 6CHAB 1TLDA 2ZDNA 2AGEX 2BD9A 1LQEA 2G55A 4X1RU 3KQDA 5E0JA 5GXPA 3DA9B 4X1SU 2BDIA 3UNRA 4XBCA 2GDEH 1LQDB 1AKSB 1YCPM 1V2RT 4YESB 4A5TS 3K65B 4AFSA 2P59A 2BLVA 3KNXA 1O2TA 4WWYA 1O3MA 1W12U 1Q31A 1ABIH 2G8TA 3RXPA 1SGEE 1SGIB 1G3DA 1C5QA 3RXTA 3NRLA 5EXMA 2P3TB 3RLWH 1RGQA 1AMHA 5EXLA 4E05H 2ZG0H 1ESBA 3F9FA 3MMGA 2A7HA 2O9QA 1UK4A 3RXLA 1KXDA 2BDGA 3SNBA 4B74A 1QCPA 2ZQ2A 1EXFA 2V3OH 4B75A 5BRRE 1ELTA 3AW1A 2OBQA 5K7RA 5KEDA 2UUKB 1B0EA 5JBCS 1CQQA 1GMHG 2HOBA 4NZQA 1SL3A 2BXTH 3NUMA 4JZDH 3MU0A 5DP3A 4XFQA 2B8OH 4BOHA 2VIWA 1WV7H 5FXLA 2BX4A 2QXGA 4JZEH 2YMSB 5EU8A 8GCHF 1BRCE 2PGBB 4OS5A 2A1DB 1LVOA 1ZYOA 1HCGA 1S0RA 2AIPA 4K3JA 1O39A 4IGDA 2ZU5A 1GMCG 4NA7A 2V0BA 2BLWA 4LZ1H 2W6JD 3SGBE 7GCHF 3RMLH 4INKA 3UWIA 3ELAH 2KAIB 1LKAA 1GGDB 2WSSD 1N8OC 5DP4A 1O2RA 1SC8U 3RXAA 2ZZUH 3GOVB 2VB0A 1MZAA 2BD7A 2G00A 2Y5FA 5IYTA 3PMJA 1ZJKA 5FBIA 1GPZA 3C1KA 5C67A 2WHXA 3ZZ4A 5F8XA 4FU8A 4AORA 5B6OA 2QE7D 2AMDA 4YLUA 1EZSC 3ZVBA 4UFEH 3FP8E 1A0HB 3GCOA 4UD9H 4B2BA 1EJAA 4I7YH 1MBQA 1P10A 4ESTE 1FAXA 2Y7ZA 4FUFA 3S7HB 1C1TA 1A61H 2GX4A 3V7TA 1BJVA 2ZFPH 2H2ZA 3GCNA 2K1QA 5DPAA 5L2YH 1CBWC 2FYRA 1O2IA 4GCHG 2I6SA 1C1QA 1WXRA 1AHTH 2PTNA 4HGCA 1SHHB 3KIDU 2OK5A 1TQ7B 4H42U 4H6SB 1GI3A 2BOHB 5DJ7A 2W3IA 5A2MH 1GJ4H 1V2VT 4Q4LA 5A09A 1YPKH 1CT4E 3VEQB 2IN2A 3A7TA 1V2WT 3T2NA 4TWWA 3SUFA 3MH4A 2OC8A 5C5NA 3CENA 1GJBB 1Q2WA 3PLBA 1EKBB 1PJPA 3ZIAD 4NSVA 4IC5A 1KMHB 1FNIA 2HNTC 2AH4X 2SGPE 3IWMA 1O36A 2G51A 3NPSA 4WJG2 3SW2B 1NBMD 3GYMA 4JMYA 2FXRA 2B7DH 1O2VA 1OYTH 2OTVA 4IBLH 1RD3B 1WSSH 2P8OB 1V2TT 1JIRA 1JOUB 3OE7D 1LHCH 1O5FH 4GUXA 2ZCHP 3CNRA 4DY7B 1S84A 2WPKS 3RXKA 4ABBA 1EX3A 1V2LT 1ZMLA 5EW1H 1KYNA 2A7CA 3UREA 4RKOB 3NWUA 1HAXB 5C5OA 4ABGA 5IK2D 2H5DA 1KDQA 1P02A 1EP5A 1PQ7A 1A0LA 2BD2A 1QA0A 2XXLA 5B6LA 2QYIA 1SGTA 2A4QA 2QCYA 1A5HA 5C1YA 3KGPA 4NG9H 1MAYA 1QBNA 3U8OH 1MQ5A 1EFRD 3VGCB 1O3CA 3Q76A 3QZRA 1D3DB 1O3GA 5C2ZA 1ELDE 1DUAA 4BAMB 1UVTH 1BIOA 5IDKA 3P92A 5CHBA 3V12A 5KGOA 1MH0A 1OXGA 2V6NA 2KCYA 1AFEH 3FOAA 1TYNA 4IMZA 1BHXB 3OU0A 4FVBA 2BVSH 2C8YB 1YF4A 5EJZA 5FCKA 1EASA 5HM9A 2XC4A 2UUFB 4IMQA 1G3BA 4KTSA 4A92A 2FOGA 5A0AE 3URCA 1XM1A 5HMAA 2BY6X 1THRH 1NRSH 7ESTE 2NU1E 2TGAA 1O5DH 1P57B 2A32A 3G01A 3MWIU 3SQHE 3F2GA 1HYLA 1D6RA 3OTJE 1IQEA 3D62A 4TY7A 1G30B 2H6MA 4NIWA 1HFDA 3T27A 3RU4E 1GG6C 5K0HA 3GY7A 3BEFB 1AKSA 1SSXA 3HGNA 4JYUH 1FMGA 2FM2A 3BG8A 1TNHA 2KX4A 3TJUA 4R0IA 1EZUC 3LONA 1SGYE 3W1EA 2FI4E 4AFQA 1XKAC 2ALPA 4XD7D 4TSFD 2WYGA 5EQQA 2ZDVH 1MCVA 3R0FA 7KMEH 2ODPA 1S5SA 2KM0A 3TU7H 2FS8A 4LZ4B 1BMLA 1V2MT 1DSUA 2EQNA 3PO1C 1TGBA 1V2OT 1AZZA 3LDXH 4NWLA 3DFJA 3T25A 3RC4A 3M5LA 1Z8RA 3RXVA 1GI7B 1J17T 2Y7XA 2GMTC 1HAGE 2GKVE 1SGCA 2C4FH 3P70B 4B2CA 3RXQA 4FUHA 3LH1A 1S82A 2VJ1A 1HNEE 2GP9B 3RXDA 1TFXA 2JJ2D 1Z7KA 6CHAC 3A7YA 1QY6A 5FX5A 2XBWA 1BTZA 2YNBA 1VJAU 1A46H 3RC5A 3U8RH 5SGAE 3B23B 1BB0B 1BMFD 1GDQA 1K1OA 2LP6A 4MPXA 5EQSA 2K0QA 5E2OA 5DN6D 1O3IA 2D26C 3K6YA 1SQAA 1UVUH 1EAUA 3ATLA 4JK6A 1TGSZ 4ACAA 5F8ZA 4B6FA 3TH2H 2QIQA 4FU9A 4E06H 5LPFA 1GVKB 3LC3A 2RCEA 1RIWB 1DWEH 3A7VA 2FESH 4K1SA 1BBRE 2FDAA 3MNBA 4BXSA 1QQ4A 4WH8A 2PTCE 1CU1A 1V2KT 1ZTKA 2ANWA 3BEUA 1K21H 2KAIA 2FX6A 4NSYA 1ESTA 1SLVB 5HIYA 3RXOA 1SR5C 1GHAG 1ELFA 1ELGA 2WYJA 3DSGA 3GY3A 2HPQH 1H8IH 2PLXA 4VGCB 2GT7A 1GI4A 1OS8A 2ULLA 3VG8A 2ZF0H 2UUYA 3EA9A 1UW7A 3T5FH 1BQYA 1UTKA 3U9AH 4CRDA 3M3SA 2YMSC 1GL1A 4I8KA 1LMWB 3BIVH 3EAJA 4YOGA 2Y5HA 3RUOA 1HJAB 1LPKB 2P3FH 3SV9A 1Z8JB 1YKTA 3Q3KA 2VIOA 3UY9A 1TNIA 1YWUA 2ESTE 2AMQA 2ZA5A 3FO8D 4F55A 2BY8X 3SV7A 4I33A 4X6PA 3SN8A 4AYYB 1BRUP 3KF2A 1EJMA 2BM2A 1SOZA 1FONA 1GGDC 4BANB 3KQ5A 1O38A 3KEEA 2GVFA 1FPHH 1MKXK 3VB4A 5AF9H 3AAVA 1SB1H 4Y6DA 2BY5X 3RXRA 4D76A 4O97A 1AVGH 2HWLB 1EAXA 3SNCA 3RXJA 6GCHF 4AFUA 4SGAE 3P8OA 2AFQB 2ODYB 1LKBA 2M5TA 1X7AC 5F53A 1Z6EA 1UCYK 1IQIA 1Y8TA 1G3CA 1MTUA 2FI5E 1V3XA 2HALA 3EQ0H 3SBKA 4DGJA 3E1XB 1O2MA 1SGFG 3ZVEA 1AWHB 4M7GA 1EATA 1NFWA 3NKKA 4ZCNA 1YP9A 3FFGA 3MH6A 3KL6A 1VITG 4GSOA 2QGRA 1QL7A 5FBEA 3SJ9A 1QBOA 1HAOH 3DT0H 2SGAA 4U32A 3L33A 3LJOA 1FI8A 4KTCA 4Y0ZE 1TALA 1L2EA 3FKSD 1O33A 3IITA 2VIVA 2J98A 2QN5T 1W0YH 5LPEA 3KHVA 2ZCKP 3PLKA 2G5NA 1YPHC 2KCPA 3PV5A 1ZPZA 2ZU2A 2FX4A 4X2XA 2A7JA 3M7TA 3TK6A 1EUFA 3ZZ6A 2OD3B 1FZZA 4TPIZ 1NU9A 1P2KA 3Q77A 1Z1JA 1ELEE 2XBYA 3P95A 8LPRA 1WBGB 3MU5A 1TGTA 1BRAA 2EA3A 1K9OE 1TONA 2GTBA 2QF4A 4MVNA 4CHAC 1LHGH 2P8OC 3GDSA 9ESTA 3O8BA 2QV1A 1O3DA 2R9PA 2VWNA 1EB1H 3UR9A 5FPTA 2D8WA 2FOBA 4NGAH 1Y5UT 3ZZ7A 2D2DA 3MFJA 1GJ9B 3M3VA 3F2HA 1NESE 1P2JA 1TNLA 1SGFA 3GDVA 4B6EA 2R0KA 1EPTA 3GDUA 1SPJA 4HG6A 1BMMH 1EAIA 4MNYA 3ZVAA 1RJXB 1LVBA 4AG2A 5FCRA 1QJ7B 4U01A 1ZSJA 3QDZB 5ETXA 2LELA 1SHYA 1GCDA 1ELBA 4X8SH 4HFPB 1O32A 2Z9LA 2ZGHA 5C0UA 3PRDA 2A5AA 1GBMA 3VGCC 1C5OH 1YLDA 1GHXH 1K22H 1TIOA 2FI3E 5GWZA 5DP6A 5A8YA 3MNCA 4YTAA 1ETSH 1EP6A 2OBOA 4ABJA 3PRBA 2F3CE 3OFND 1D9IA 3SQEE 2OXSA 3E8LA 4FU7A 4Y8YA 4E7NA 4J2YB 1YBWA 3RXCA 3LJJA 4A1VA 2P3UB 2ZTXA 1A4WH 2GZ8A 3LU9B 3GCTF 1DS2E 2CK3D 2RFKC 2QY0B 3BTFE 2CF8H 5L30H 2ZPRA 1H9IE 8KME2 1VITH 2J97A 1PFXC 3GY2A 3DCLA 2KZ4A 1YGCH 4I32A 1HAHH 3BTEE 5EPYA 3E90B 3PV4A 2FO9A 4JCNA 2FOAA 1MU6B 1HAZB 1GI5A 1P2QA 3A8DA 1ZMJA 2NU3E 2PW8H 4H4FA 2P95A 4AZ2B 1ZPBA 1VGCB 3LOXA 3SJOA 1W7XH 4F49A 4ABAA 2ZO3H 1RTLA 3VPKA 2ZFRH 1SGRE 5CMXH 4AG1A 1KXAA 1K0HA 1C1MA 1A5GH 3BTME 3F2FA 1T8OA 2Y80A 4ZKNU 2ZDAH 4LOYH 1A0JA 3SU0A 1Y3WA 1QL9A 2IPHA 4ASUD 4NFFA 1J15A 1OSSA 1Y5AT 3D49H 3M61U 5C17A 1P01A 1UCYE 3ZZDA 2GD4B 1O3PB 2W7UA 4WMFA 3STIA 1TRMA 2QAAA 2J5UA 1QJ1B 2FLRH 1HB0B 1O35A 1WU1A 2PKAB 2XCFA 2BOKA 2EEKA 3ATWA 3BTDE 3TH3H 3UWJH 1DOJA 2AERH 1LHFH 1T4UH 8GCHG 1AZ8A 1TGNA 3STJA 3A86A 2FMJA 1A7SA 1DWBH 4Y76A 1WCZA 1ZRKA 1OWEA 4CBOA 1UTPA 3E0PB 1TNKA 4JK5A 1GBBA 5EJLA 4Y79A 7GCHG 1SMFE 3BSQA 1HXEH 3AASA 2P16A 3ZV9A 4NZLA 3F68H 4BTIB 1J14A 1YY3A 1MABB 1YCPH 2BD4A 3EA7A 3P8GA 1TPPA 1CA8B 3N7DA 1QNJA 1GL0E 3M5NA 2ZI2H 1D3QB 4DT7B 3QZQA 1SGPE 1MKXH 1TX8A 2L74A 1CHGA 1RIWC 3H09A 3FP6E 2UWLA 3SU4A 3UQVA 2PSYA 1ZHMA 3SU5A 3U8TH 1BA8B 2O8WA 1BTXA 1CSOE 3TIUA 2WZQA 5EODA 1YPLH 3BG4B 4KELA 4DT4A 1VZQH 2ZHDA 2HVYB 3RU4T 3VB3A 1Z6JH 4ZH8A 4RI0A 2A45B 3KYGA 1GHVH 1SI5H 3CS0A 5GCHF 2ZKSA 1GMDF 4I8HA 6ESTA 2XYAA 4ZKRU 1P3CA 2H5CA 4BTTB 1IQMA 1J9CH 5HXFA 2G4TA 1AD8H 2ZFQH 1W0KD 2CHAB 3B8JA 2EI6A 4CR5A 3Q3YA 1NRNH 1FY1A 3B9FH 3F0OA 3SHCH 1HIAA 3RXIA 1XKBC 1P9UA 3IG6B 3DSOA 1KLJH 1VKYA 3AK5A 1FY5A 2JIZD 3I29A 4WY3A 1O2OA 2IJOB 2ZPQA 3KQEA 1ANDA 1UJ1A 4X1PU 1HJAC 1QR3E 1KXBA 5T6GA 3A84A 1GI6A 3H7OA 1TRNA 4X6OA 1BMNH 1HAPH 3MI4A 1KXCA 4FUIA 1IAUA 3I78A 3LKWA 1G2LA 1SOTA 3UOPA 3EA8A 4RN6A 5C1UA 2OQUA 2HNTF 1G32B 4ABDA 1O37A 4DCDA 1TMUH 1ARCA 3ZZCA 3LGUA 5I25A 2XRCA 4K2YA 3TITA 4Y11E 3TGIE 2YNAA 2HNTE 1C5NH 1DITH 2QF5A 1JMOH 2FOFA 1C5MD 3ZZ3A 1BMAA 2GV6A 1QHRB 2XBVA 1O34A 3QO6A 4Y71A 3GYLB 1FIZA 4MTBA 3U1IB 5JPMH 1O30A 2FOEA 2RA0A 2GCHG 1TX6A 2ZDMA 3ODFA 1C5YB 4ZROA 3SGAE 1WDIA 1JWTA 3SUDA 3ZVCA 1O3HA 2WPMS 1GBJA 2EY4C 3H5CB 1DXPA 1NN6A 1GWAA 3KYFA 1DM4B 3A81A 3GCHB 1AUJA 5A8XA 2V3MA 3F0PA 2VBCA 3U28C 4CH8B 2ZTZA 1GMCF 1EQ9A 1MMJN 2OQ5A 1PQ8A 1A2CH 1SQTA 1BBRK 1MU8B 1BRBE 2ZHEH 5JB8S 1PPBH 3GY4A 3ZZAA 1FV9A 1WTGH 1K2I1 3BTQE 1C2HA 4AC9A 1H9LB 2AEIH 3E16B 3C27B 3FVFB 4AN7A 1XUIA 4BAHB 1RFNA 3A85A 1CGIE 2WV4A 1ZR0A 2SGEE 3ZV8A 1V2PT 2BD5A 3KCGH 3PROA 1SGNE 1F92A 4TPYA 3PMAB 1C1VH 1C5TA 3M5MA 1IQGA 3RXGA 3MQKC 1W14U 4UDWH 1QA7A 1AVXA 3TNTA 1C5XB 1FIWA 1W2KH 2J98B 3FZZA 2BYAX 3N7EA 2QXHA 2QXJA 2Y5GA 4B76A 2AYWA 1BDAA 1C9PA 2SNVA 1ELCA 1AGJA 1V2NT 3ESTA 5BPEA 1C5PA 1QFKH 2THFB 2ZP0H 1JIMA 4A7IB 3QWCH 3AAUA 2ZGXH 4YO9A 2CN0H 2ZEBA 3UOUA 1DY9A 3A8AA 2BVRH 2Z3DA 3UTUH 2H9EH 4OGYA 2AIQA 2XWAA 4OS7A 1HAIH 1S6FA 4ACBA 4Y8ZA 1ANCA 1CT0E 1O0DH 1WAYB 2ZC9H 2IJD1 3HK6B 2XC5A 2J4IA 3LIWA 2F9BH 2TIOA 2GJGA 4UEHH 5I46H 1MKWK 1EJNA 1EOJA 1TB6H 1NPMA 3O8DA 1CE5A 3LGWA 1XVMA 1C2JA 1ZJDA 3TJVA 4LXBH 4GAWA 1Y59T 1EPTB 2G4UA 3Q00A 1PPEE 2ZNKH 1EB2A 2ZPSA 2O8LA 5FPYA 2FYQA 1C2DA 3BEIB 4CRBA 1SFIA 1O2WA 3F6UH 3OY5U 5CDFE 1HUTH 3K6ZA 1GI2A 2VIDA 2PKAA 1GJ6A 1JRSA 3NK8A 3QK1A 5HIZA 1GCTB 1GHBG 3PV2A 1PPZA 1L4ZA 3TLOA 3TGKE 3MO3A 4A1TA 2RA3A 1E37B 2C93B 1TWXB 1P0SH 3VB6A 3GY5A 1ABJH 1GDNA 2J38A 3KQCA 1HAYB 4YZUA 2BD8A 2JH0D 1QRWA 4Y10E 3A7XA 2ANMH 1XUGA 3SHAH 2H9HA 5C94A 3HK3B 1TOCB 2XW9A 1BTPA 3DUXH 3D65E 1TNJA 1ESAA 1GBEA 1Z8IB 1IQKA 3EGKH 3JZ1B 4FXGH 1OP2A 3QUMP 2W7SA 1NTPA 1A3EH 2L6OA 1KLIH 1NC6A 2BVXH 2HLCA 2JH5D 3SNAA 1VGCC 2BX3A 5F8TA 4Z0KA 2WPHS 2FOCA 4A6LA 4K1TA 4TY6A 5EOKA 3SI3H 1HDTH 1THPB 3S69A 4O9VA 3WY8A 4KKDA 1GHWH 4FUEA 1GJ5H 3QGNB 5JB9S 1COWD 3ZYDA 2FTLE 3S7KB 1C2KA 3S9AA 2CF9H 4MPUA 2BQ7B 2Z9JA 3NCLA 4GHTA 2TPIZ 3TVJB 1T31A 5E8EH 4AGJA 1T7CA 1GHZA 1UTJA 1ZSKA 4F48B 3MU1A 4NIYA 3HATH 1O5CB 2NU0E 1T32A 3V13A 1XVOA 3AW0A 1UHBB 2A5IA 5ESTE 2ODQA 1GBKA 1HBTH 1GI1A 1V2ST 2OUAA 1LO6A 2PP6A 1P2OA 2QA9E 3SYJA 2ZDLA 4J1YA 3GISB 4TWYA 3SV8A 1K1JA 5LH8A 4OGXA 2C8XB 4WXVA 2BD3A 2WPJS 1UMAH 1QZ8A 2EI7A 1UK3A 1QRZA 1GJAB 3OTPA 1KXFA 2M2AA 3UIRA 4Y0YE 4IN1A 3TK5A 1IQFA 4RSPA 1LVYA 1D3TB 1C4Y2 1F0SA 2ZECA 4MNWA 1ACBE 5GPIB 3BG4C 3ATKA 3BIUH 1V2QT 1P12E 2VWLA 2BDBA 3QTVH 1D6WA 1TPSA 2SFAA 1AE8H 3FANA 1PPCE 2QXIA 3ENSB 1C2IA 1OP0A 1GJDB 3RXSA 5C3NA 2JDID 3MNXA 4RT1A 1W13U 1H8HD 3FP7E 2CHAC 1NFYA 1YPGH 1E0FD 4ZAEA 5C1XA 2FOHA 3ZZ5A 3RMOH 1N8OB 3P6ZB 4BTUB 2ZGBH 1KIGH 4CBNA 1XMNB 2AGIX 2J92A 1ID5H 2FZZA 5AFZH 4SGBE 1LVMA 1F5KU 1ETRH 2ALVA 1UTNA 2PV9B 5E0GA 3ODDA 5DSFA 1OKXA 1ANBA 5L6NH 1XUKA 1C1WH 1S6LA 3W95A 2PKSB 1AWFH 1YPHE 4ISIH 3KN2A 2CJIA 4KP0A 1TE0A 1HIAB 1MTSA 1IQJA 2NU4E 3L3TA 1CGJE 4Y8XA 1LTOA 1O3EA 5H4IB 4GLYA 2PGQB 3A8CA 1VJ9U 4I8JA 1GHAF 3O8RA 1P11E 1F5LA 2JJ1D 1C2LA 1TBRH 3GS9A 3LGVA 4Y7AA 3SJKA 1O3JA 1OOKB 3DSPA 1VR1H 2A0QB 2OINA 3PWCA 1DANH 3PM3A 7LPRA 1D3PB 3SNEA 1GBDA 1H4WA 2F83A 2ZU1A 4B71A 1XX9A 4FUJA 5JBTA 3SU2A 2PUQH 1W11U 1UTMA 3S0NA 3A80A 1G37A 4A1XA 1C5WB 2FODA 3SJIA 4BXWA 2BDAA 4GVUA 3OX7U 3RXFA 1EZXC 1GDUA 4ABEA 2WUCA 2OC7A 1TA2A 2GZ9A 3GCHC 4O3UA 3RC6A 1WQVH 1ZOMA 4OS4A 2ZFTA 1OX1A 2Z6BD 2VNTA 4BNRA 3OAAD 1L1JA 1QQUA 1Z8GA 3TGJE 1YPEH 1B0FA 4DIIH 1OWHA 1WUNH 3E91A 3F9GA 3SORA 1DSTA 1GBHA 2VU8E 2C8WB 3MU8A 1C5SA 2YOLA 1U6QA 2ZTYA 4Z1MD 3S9CA 2KFWA 1F0RA 1W0ZU 3PTBA 4NFEA 5EG4A 1BHXF 2WPIS 1RTFB
chains in the Genus database with same CATH topology
3GCTG 1GBFA 2TGPZ 1B7XB 4UFGH 3S9BA 2DE8A 1KLTA 1ZSLA 4DW2U 1V2JT 2BDYA 3HPTB 3A8BA 2J2UA 3SU1A 1AI8H 1KXEA 5ABWA 1V2UT 3EE0B 1OWIA 3L6PA 1WOFA 1TPOA 1P2MA 1HV7A 2GDDA 1AU8A 1VITF 5F6MA 1L1GA 1S81A 2XWBI 1MBMA 3OY6U 5HGGA 2D1JA 5T6FA 1BJUA 1DLKB 2OC1A 1YC0A 3M35A 1ZRBA 4WMEA 4BAOB 1F7ZA 2F91A 2J34A 3SNDA 1AUTC 1UVPA 3SJ8A 1LDTT 2ZU4A 3OSYA 5E2PA 1T8LA 4Q7XA 3LH3A 1ETTH 4IN2A 1PQAA 3SUEA 4CRGA 1GI9B 1KSNA 3EYDA 4ABHA 5EPNA 2F9VA 5DP7A 1PPFE 2G5VA 1SVPA 1ORFA 2VIPA 2NU2E 4RKJB 3DD2H 2GCTB 5HM2A 1TA6A 1GBCA 1O2SA 5DK1A 4INHA 2XBXA 4ZKSU 2OP9A 1QGFA 1EPTC 4X0WU 5G4BA 2BTCE 1TABE 1Q3XA 3SU3A 4K8BA 1ANEA 1C5RA 4AX9H 4Q2KA 4CRFA 1SLXB 5PTPA 2A2QH 2BDCA 5AVDA 1AN1E 1UTLM 1GCTC 5FHTA 4O3TA 1GHYH 1NU7B 1TBQH 2Y81A 1UHBA 3ZVGA 2BMGB 1DT2A 4DG4A 1N1LA 5CHAB 1C5ZB 3UNQA 2R0LA 1FUJA 1MTWA 1O2KA 5JBAS 1A1RA 5TCCA 3W94A 2C3SA 3T28A 3M5OA 3CS7A 2LPRA 1THSH 1F5RA 4NWKA 3TH4H 5C20A 1NS3A 1BCUH 3N7OA 1O2XA 1ARBA 4ZXXH 1MZDA 1FY8E 2TRMA 5GCHG 1GMDG 3P17H 1FAKH 3UFAA 4AOQA 1NROH 3A82A 1DVAH 4UFFH 2RDLA 2F9OA 2ILNA 4X8TH 4D7FA 4ZHAA 1AIXH 3GICB 2GZ7A 1E34B 5DGJA 2Q6FA 2V35A 1A5IA 1F0UA 4R8TB 1CHOF 2PWXA 1IQNA 2QF3A 2V3HH 1HJ9A 1C2GA 1H8DH 1IHTH 1ZTLA 2BLOA 4XSKU 2CMYA 3MHWU 4YLQH 2FOMB 2VVCA 3H7TA 4X1NU 1VCPA 2O8MA 1O2ZA 3NZIA 1CO7E 3MTYA 4IC6A 1TAWA 1O3FA 3M3TA 2JETB 2ZFSA 4DOQA 4DJZB 2FEQH 1W8BH 6LPRA 1MTNB 1GBLA 3T62A 2FP7B 1O5AB 2A5KA 1BTYA 3BTTE 3PWBA 2P94A 2CXVA 3TJNA 4JZIA 1CA0B 1UO6A 1UCYH 2J95A 2WPLS 2VWMA 1O5BB 2TGTA 2VH0A 1BITA 4XE4A 1GI0A 1QURH 1MD8A 2I6QA 1GBIA 1O2NA 4ZHMU 1C5VA 4HZHA 1E38B 2VVUA 4VGCC 1DDJA 2AS9A 3M7UA 3RLYH 4MDSA 1SGDE 3BTKE 4X2VA 2R2WU 3RXEA 1OWKA 3V3MA 1N6YA 5FAHA 3A88A 3R3GB 4XDEA 3RXMA 5A0CA 1GJCB 4WXIA 4X2YA 5A0BA 1QBVH 1K1NA 2Y6TA 3F9HA 1N6XA 2G52A 2ASUB 4OS1A 4XBDA 1P2NA 5EXNA 1C1OA 3U1JB 1NRQH 2GV7A 4DVAU 1ZGVA 3MH5A 1O3NA 4MNVA 1W7GH 2B0FA 2P93A 1O2GH 1C1SA 3LGIA 1O3OA 3UQOA 4BAQB 1GI8B 4JZ1A 1AB9B 1P05A 1K28D 5E0HA 1AY6H 2H9TH 2ZHQH 4E7RG 3MOCA 1GMHF 2Z9KA 4AB9A 1BTHH 1DXWA 1VCWA 4JZFH 4U2WA 1UVSH 3MU4A 1XUHA 4MPWA 3LPRA 3F9EA 3MO9A 2B9LA 3MO6A 4LK4A 4X6NA 3RP2A 4YM9A 1V6DA 2VVVA 2PKSC 1BTWA 3VXEH 1AQ7A 3PB1E 3P8FA 3PTNA 4D8NA 3GY8A 2Z3EA 1SLWB 1LCYA 2ZIQH 4XOJA 4AGKA 1FPCH 1C1PA 2C90B 1O3LA 2BQ6B 1O2JA 2W5EA 5ESBA 3VB5A 3SV2H 4X1QU 3MH7A 2QC2A 5HYOA 1MTVA 3PMHB 4ZKOU 1ZPCA 3ZYEA 5DP5A 1GJ7B 1DUEA 4PROA 1JXPA 1HAVB 2VGCB 1RTKA 1K1PA 3ZZBA 2HPPH 4ASHA 5EQRA 4B73A 1L1NA 1OWDA 2A4OA 3UUZA 1UK2A 2BZ6H 2ZGJA 5GDSH 1P8VC 3SO3A 2VIQA 1B5GH 1PPHE 1TOMH 2FS9A 2ZU3A 1ELAA 1DICA 1TPAE 2ZDKA 3BV9B 3BTHE 4AYVB 1C9TA 1ZTJA 4CHAB 2NWNA 2FTMA 4MPVA 2BDHA 3EDXB 4NIXA 3V0XA 2BY7X 4WH6A 3KQBA 2ZFFH 2A4GA 1K1MA 2DUCA 5AHGH 1T8MA 3MYWA 5LPRA 1ZZZA 3QX5H 1YM0A 1JRTA 1K1IA 4QT8C 2G81E 2O8UA 3ZVFA 2VH6A 3SZNA 4O03A 1PYTC 1XUJA 3RM2H 4D9QA 1L0ZA 1P9SA 1UTQA 1CVWH 4HI3A 4GCHF 4ZHLU 2JKHA 2GCHF 1QIXB 1PPGE 2BY9X 1NFUA 5FX6A 1ELVA 1RS0A 3MNSA 1DWCH 1Y3XA 5CE1A 1HJ8A 4MLFB 1AVWA 1O2YA 2ZHWH 1H1BA 1P2IA 1DY8A 3A7WA 1RXPA 4AB8A 1VCQA 2TGDA 4CREA 1PYTD 1P06A 2R2MB 2TBSA 1CT2E 2SGQE 1O3KA 2W26A 1LPGB 4YOIA 4B1TA 2JH6D 4K8YA 1SQOA 3RXBA 4THNH 3K2UA 4ISHH 1O2PA 1FXYA 3JZ2B 1PQ5A 5DKMA 2O8TA 2GCTC 3U98H 1AFQB 3PMBB 1FDPA 4JYTA 3BN9A 1D4PB 4OS6A 1TQ0B 2SGDE 4ISOA 3DHKH 3F1SB 2R3UA 3BTGE 3DFLA 2HRVA 2ZQ1A 4WVPE 2PFEA 5T6DA 3CP7A 1AO5A 2QF0A 1G2MA 1SGQE 4K60A 2Q6DA 1C5UA 1UVOA 2PHBA 2WUBA 1QRXA 1P03A 4FUDA 3URDA 3AVZA 3P8NA 2J9NA 1MQ6A 1RRKA 1YPJH 4Q80A 3SUGA 2WINI 5CHAC 5EW2H 1NM6A 3T29A 4ISLA 1DLEA 1BUIA 1JBUH 2B5TB 2UUJB 1FY4A 5EGMA 4FUGA 1ZHRA 4X8UH 4X6MA 4ZMAH 2STAE 1Y3VA 1MUEB 1L4DA 1IQLA 1YPMH 5F03A 4CR9A 1FN8A 3ATMA 3D23A 3VB7A 3U69H 3HKIB 3LGYA 1KTTB 4CRAA 3A87A 3HGPA 2BB4A 2IOTA 4YT6H 3TJOA 3VXFH 4OS2A 4YOJA 1HRTH 2FWWA 2PR3A 1P04A 1GHBF 5T3HA 5LGOA 3T26A 3RXUA 4HTCH 2F9PA 1DPOA 3RMMH 1GVLA 1H9HE 5JDUB 1P3EA 3PYHA 5JBBS 1EAWA 2JETC 5DP8A 4D9RA 5J4SA 3RU4D 6GCHG 1NT1A 1MTNC 3E3TA 1F0TA 3UR6A 3RMNH 1TX7A 5J4QA 1HXFH 2F9UA 2UWPA 2Z94A 8ESTE 1BTUA 1CA0C 4X8VH 1FLEE 4YT7H 1NZQH 3TPIZ 1GBAA 2EC9H 3A89A 5GIBA 4UONA 1Z1IA 1O5GH 2PSXA 3RXHA 4WF8A 3LGTA 1SLUB 2A31A 2WV5A 1E36B 4IW4E 1YYY1 2J94A 2BZAA 4NA8A 1HGTH 1YLCA 4I8GA 1DX5M 2Q1JA 3HKJB 1EOLA 2SNWA 2Z9IA 1FQ3A 4DIHH 5TJXA 2GGVB 1BBRH 1QTFA 9LPRA 1HLTH 2CV3A 2Z7FE 4ABIA 1O3BA 4Y7BA 3I77A 2ANKH 4JYVH 1G36A 1Z71A 1W10U 1UTOA 1C4V2 4CH2B 3BTWE 3SU6A 1LPZB 1DE7H 2VINA 1IOEA 1QL8A 1YCPK 2VWOA 2PUXB 4NCYA 1AB9C 1HAVA 1O3AA 1TGCA 1GBTA 1OPHB 5L2ZH 3RM0H 1S6HA 4MNXA 4K5ZA 3SV6A 1C1RA 4K69A 1QB6A 4KGAA 1G9IE 1CBWB 5AFYH 3O8CA 4KTUA 2HVXA 3QTOH 1TMTH 1O2LA 4XBBA 3ZZ8A 1HPGA 4Q7YA 1XXDA 3ATIA 1NRRH 1Y3UA 4DURA 4FVDA 1S83A 1MAXA 1ZGIA 4Q7ZA 4X2WA 1J16A 2ZWLH 1MD7A 1NFXA 4U30A 4GHQA 1DWDH 2FIRH 3TK9A 3K9XB 5GJ4B 1WTHD 1W3CA 4ABFA 3PLPA 1MKWH 4I31A 2VGCC 1QB1A 1O31A 2FLBH 2Z9GA 4MG3A 1T4VH 3LC5A 2GT8A 1BT7A 1OP8A 1KY9A 1ZLRA 2HGTH 1LHDH 2Y82A 4D7GA 1OYQA 2XNIA 1DFPA 4ZUHA 1IQHA 1KTSB 1NY22 3UPEA 1TRYA 1Y5BT 1E35B 5TCAA 1INCA 1O2QA 1WYKA 3ZVDA 1EZQA 1SG8B 4I8LA 2ZCLP 1LHEH 1QB9A 1MCTA 1SBWA 2DE9A 3TNSA 2RG3A 4NIVA 1SFQB 3Q3XA 1C5LH 2AGGX 1C2MA 1TBZH 4FUBA 3NXPA 5DG6A 3A83A 3QGJA 3RDZA 3A7ZA 4B2AA 3M7QA 2BXUH 1C4U2 1O5EH 2FPZA 2Z3CA 1AE5A 1C1NA 3VFEA 4ISNA 1Y3YA 2LNCA 1TMBH 2Q6GA 2OC0A 1G3EA 1J8AA 1ZMNA 4AFZA 3SOSA 1K1LA 3E0NB 2ANYA 2W3KA 1C2EA 2BQWB 3ITIA 5JYIA 4H6TA 1GVZA 3FAOA 2UWOA 1BOQA 4Z6AH 1NO9H 4CRCA 4IS5A 2XCNA 2ZHFH 3QLPH 3FZDA 3UNSA 3E6PH 3SGQE 3BF6H 4K1EA 4NA9H 2R3YA 1KDQB 2XC0A 2SGFE 1F2SE 2AMPA 4UE7H 2H1UA 4ZXYH 1WQSA 1T8NA 1BZXE 1GG6B 1ZHPA 5A8ZA 2CGAA 2A4RA 1XXFA 4FUCA 2XTTB 5DP9A 1CHOG 2F9NA 1AFQC 1XUFA 1FY3A 1O2UA 1NRPH 2C8ZB 5FPSA 1M9UA 3M36A 1GJ8B 1O2HA 1QJ6B 2BLQA 1C1UH 3ZZ9A 4GPGA 1C2FA 1S85A 1FN6A 3QN7A 4WMDA 3PO1B 1FJSA 3M37A 2OCVB 1A3BH 4UFDH 4TYDA 2GMTB 4BAKB 1P09A 2STBE 2ZGCA 1S0QA 2BHGA 1IHSH 2A2XH 4F4OC 1CGHA 3LT3A 5DO4H 4MQAA 3GY6A 4INLA 2OLGA 3SI4H 2EI8A 1OWJA 3OYPA 1TNGA 6CHAB 1TLDA 2ZDNA 2AGEX 2BD9A 1LQEA 2G55A 4X1RU 3KQDA 5E0JA 5GXPA 3DA9B 4X1SU 2BDIA 3UNRA 4XBCA 2GDEH 1LQDB 1AKSB 1YCPM 1V2RT 4YESB 4A5TS 3K65B 4AFSA 2P59A 2BLVA 3KNXA 1O2TA 4WWYA 1O3MA 1W12U 1Q31A 1ABIH 2G8TA 3RXPA 1SGEE 1SGIB 1G3DA 1C5QA 3RXTA 5EXMA 2P3TB 3RLWH 1RGQA 1AMHA 5EXLA 4E05H 2ZG0H 1ESBA 3F9FA 3MMGA 2A7HA 2O9QA 1UK4A 3RXLA 1KXDA 2BDGA 3SNBA 4B74A 1QCPA 2ZQ2A 1EXFA 2V3OH 4B75A 5BRRE 1ELTA 3AW1A 2OBQA 5K7RA 2UUKB 1B0EA 5JBCS 1CQQA 1GMHG 2HOBA 4NZQA 1SL3A 2BXTH 3NUMA 4JZDH 3MU0A 5DP3A 4XFQA 2B8OH 4BOHA 2VIWA 1WV7H 5FXLA 2BX4A 2QXGA 4JZEH 5EU8A 8GCHF 1BRCE 2PGBB 4OS5A 2A1DB 1LVOA 1ZYOA 1HCGA 1S0RA 2AIPA 4K3JA 1O39A 4IGDA 2ZU5A 1GMCG 4NA7A 2V0BA 2BLWA 4LZ1H 3SGBE 7GCHF 3RMLH 4INKA 3UWIA 3ELAH 2KAIB 1LKAA 1GGDB 1N8OC 5DP4A 1O2RA 1SC8U 3RXAA 2ZZUH 3GOVB 2VB0A 1MZAA 2BD7A 2G00A 2Y5FA 5IYTA 3PMJA 1ZJKA 5FBIA 1GPZA 3C1KA 5C67A 3ZZ4A 5F8XA 4FU8A 4AORA 5B6OA 2AMDA 4YLUA 1EZSC 3ZVBA 4UFEH 3FP8E 1A0HB 3GCOA 4UD9H 4B2BA 1EJAA 4I7YH 1MBQA 1P10A 4ESTE 1FAXA 2Y7ZA 4FUFA 3S7HB 1C1TA 1A61H 2GX4A 3V7TA 1BJVA 2ZFPH 2H2ZA 3GCNA 2K1QA 5DPAA 5L2YH 1CBWC 2FYRA 1O2IA 4GCHG 2I6SA 1C1QA 1AHTH 2PTNA 4HGCA 1SHHB 3KIDU 1TQ7B 4H42U 4H6SB 1GI3A 2BOHB 5DJ7A 2W3IA 5A2MH 1GJ4H 1V2VT 5A09A 1YPKH 1CT4E 3VEQB 2IN2A 3A7TA 1V2WT 3T2NA 4TWWA 3SUFA 3MH4A 2OC8A 5C5NA 3CENA 1GJBB 1Q2WA 3PLBA 1EKBB 1PJPA 4NSVA 4IC5A 2HNTC 1FNIA 3IWMA 2AH4X 2SGPE 4WJG2 1O36A 2G51A 3NPSA 3SW2B 3GYMA 4JMYA 2FXRA 2B7DH 1O2VA 1OYTH 2OTVA 4IBLH 1RD3B 1WSSH 2P8OB 1V2TT 1JIRA 1JOUB 1LHCH 1O5FH 4GUXA 2ZCHP 4DY7B 1S84A 2WPKS 3RXKA 4ABBA 1EX3A 1V2LT 1ZMLA 5EW1H 1KYNA 2A7CA 3UREA 4RKOB 3NWUA 1HAXB 5C5OA 4ABGA 2H5DA 1KDQA 1P02A 1EP5A 1PQ7A 1A0LA 2BD2A 1QA0A 2XXLA 2QYIA 1SGTA 2A4QA 2QCYA 1A5HA 5C1YA 3KGPA 4NG9H 1MAYA 1QBNA 3U8OH 1MQ5A 3VGCB 1O3CA 3Q76A 3QZRA 1D3DB 1O3GA 5C2ZA 1ELDE 1DUAA 4BAMB 1UVTH 1BIOA 5IDKA 3P92A 3V12A 1MH0A 1OXGA 2V6NA 1AFEH 1TYNA 4IMZA 1BHXB 3OU0A 4FVBA 2BVSH 2C8YB 1YF4A