1GJ9B

Engineering inhibitors highly selective for the s1 sites of ser190 trypsin-like serine protease drug targets
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEASTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
publication title Engineering inhibitors highly selective for the S1 sites of Ser190 trypsin-like serine protease drug targets.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting, hydrolase
total genus 51
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2001-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gj9B02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gj9B01
1XUHA 2RDLA 1CA0B 5JB9S 5A0AE 1OWIA 1NO9H 2Y5HA 3M61U 5E8EH 2EI6A 1KLIH 3ZZ8A 1WQVH 3E91A 2V35A 4RKOB 2GTBA 2BLQA 1QTFA 1O0DH 1O2MA 4X2XA 1DVAH 3LH1A 4K8BA 1P2IA 1VCPA 1AKSB 1P11E 4WMEA 3MO9A 4ABAA 3QK1A 1HLTH 1YPLH 3V0XA 4AGKA 3MH5A 2A31A 3KQDA 1LQDB 4MVNA 1WYKA 2B9LA 1H1BA 2WV4A 1UCYE 4X8UH 1NY22 1RFNA 3C27B 1Z71A 3E16B 1YC0A 3S7HB 1O39A 4K3JA 3O8BA 1TBZH 1C2JA 1C5SA 3LGIA 1C5UA 1FIWA 1TBRH 2ZCLP 3SGAE 2BZ6H 4JYVH 1O5CB 3F68H 1YM0A 1ABIH 2FTLE 1DWCH 2PUQH 1BRUP 4TWYA 1N8OC 1O35A 1WU1A 2GKVE 3SHAH 1GJ8B 1AB9B 5DJ7A 1ACBE 4K1TA 1THSH 2ZA5A 1GG6B 4F49A 2VIVA 1EAXA 2FZZA 3QO6A 5I25A 1K9OE 5L2ZH 2V6NA 1BTYA 4YLQH 5JDUB 1DITH 2J38A 1P0SH 3UR6A 1O3IA 2FYRA 1X7AC 4MQAA 4ZHAA 3KL6A 1AY6H 1V2LT 4IGDA 1O3NA 1TX6A 2SGDE 3A83A 3HK6B 5F6MA 3KHVA 4UFEH 2ZFSA 3E1XB 2J95A 1CE5A 3O8RA 4NA7A 2XCFA 1IQGA 1GI8B 3PB1E 1FY4A 2HPPH 4YZUA 2EEKA 3SGBE 1YCPK 4OS5A 8ESTE 1ZHPA 1ETSH 1HIAB 4Y71A 2BLWA 4HTCH 2BD4A 1W14U 5FAHA 2FX4A 3HPTB 3RXTA 3SI3H 2OC0A 1GHAG 3P8FA 4KELA 2H5CA 3MU1A 1THPB 1EB1H 4NZLA 5B6OA 1O2SA 2WINI 3M5NA 1E37B 2A4RA 3P92A 2HGTH 2SNVA 1ELTA 5CHAC 3VXEH 4K5ZA 3NUMA 4Y8XA 4NSYA 3GYMA 3FFGA 2OINA 1SMFE 1OWEA 3SU0A 3QUMP 5G4BA 4DJZB 5LH8A 4JYTA 1YGCH 1D4PB 1FY3A 1FJSA 3Q76A 2ZGJA 3DD2H 4JZDH 2GV6A 1ZSJA 4J1YA 4CH8B 3S9BA 4ZMAH 2Z9GA 1ZPBA 4NWLA 4YT7H 5L6NH 2QV1A 3SV2H 1VITG 2V3OH 3SNDA 1S81A 2FOHA 2AGIX 3KQEA 1TGNA 2JKHA 3SW2B 1D3PB 1O5DH 5C1XA 4UEHH 1KXCA 1P3CA 2F9PA 1TNGA 4NZQA 2RCEA 1EJMA 1SGTA 3ZVBA 2JETB 4X6MA 1BMLA 3A81A 2JH5D 1C2HA 4DG4A 1TA2A 5C1YA 4FUGA 4K1SA 4LXBH 4K2YA 2A4QA 1CGIE 2HNTF 1SGNE 4TWWA 2BD8A 2BD5A 3FZZA 4ZROA 1H4WA 3ZV8A 1EUFA 5DP5A 1SQTA 2Y7ZA 3E0NB 5EPNA 1SGFA 1UK2A 2A7HA 2VWNA 2C93B 2Z6BD 1GI4A 4X2VA 4FUBA 1YLCA 2XBWA 1K2I1 1UTOA 2C3SA 4FVBA 5J4QA 1ANDA 5CE1A 3DHKH 1P2NA 3SUFA 3A7XA 4ABGA 5JBCS 3ZZ5A 2UWLA 3BSQA 5CHAB 1EPTC 3TK5A 3SUEA 3Q00A 1CT0E 4I8JA 1GMHG 1GJ7B 2TIOA 1KXEA 1G32B 5H4IB 3RXSA 4ABHA 5DGJA 1KTSB 1YPJH 1RTKA 4GHTA 4Q7XA 3K9XB 2OQUA 1EB2A 5L2YH 5FCRA 1CHGA 5EG4A 1GMDG 2WPIS 3EGKH 4BXSA 1U6QA 1TALA 2B5TB 1GHAF 5IDKA 2FOCA 1TGTA 3TNTA 1HAVB 3GDSA 4AYYB 4BTUB 3W94A 6CHAC 4E7RG 1DLEA 2ZGBH 3VPKA 3T25A 3NCLA 3DUXH 2SGPE 1MTWA 2I6SA 3TJVA 3SNAA 4AB8A 1ESBA 1TB6H 1L0ZA 3UNQA 3U1IB 2STAE 2PGBB 1HAIH 3TJUA 2O8UA 1GHWH 1MAXA 1F0UA 3SU3A 1TPSA 1ELEE 4Y79A 2YNBA 1AWHB 2VWOA 5EOKA 1LQEA 1P2QA 1VITF 1O3MA 1SQAA 2FOBA 3QZRA 3B8JA 2XBXA 3E3TA 4Q80A 2PSXA 1C1RA 1TNKA 1T31A 1RJXB 1O2OA 3ELAH 1TBQH 1TA6A 2GT8A 4JMYA 1ZGIA 1C5LH 1TQ7B 1SB1H 3ESTA 1KXDA 1PQAA 3D23A 3EA8A 3S69A 1RS0A 2ESTE 1J8AA 3HK3B 3V7TA 5LPEA 1Z1IA 5HGGA 1B5GH 2P94A 1O3JA 1HB0B 3RXDA 1S6FA 1KTTB 3LOXA 1MKWK 3U98H 2QA9E 1QJ7B 3A82A 4IN2A 1HXFH 3BTQE 2AERH 5FPSA 3MH6A 4NA9H 1C4V2 3I78A 1UTNA 1P04A 2GV7A 1YPMH 1C1OA 1GHYH 1HAYB 4UE7H 4DCDA 1O2KA 3PO1C 4Q7YA 1MH0A 1SHYA 2BY9X 5DKMA 2CXVA 4INKA 1IQMA 1FXYA 1T4VH 3SHCH 3F9EA 3KQCA 4A1TA 3FVFB 1CGJE 1W0ZU 1G2LA 1KLJH 1Q2WA 3V12A 3STIA 4BAMB 2QY0B 1F5KU 2BX3A 4U2WA 4DY7B 3CS0A 1GMHF 1MU8B 2W3KA 1K1PA 1EAUA 2G52A 3BTHE 3E8LA 3RXVA 3RM2H 1BTPA 4IS5A 5EXMA 4FXGH 5DP9A 2FYQA 3PLPA 1O5BB 3LJOA 4NIVA 4GLYA 1GBTA 1C5VA 4FUDA 3OX7U 2G5NA 1P2MA 1K1LA 2THFB 1JIRA 1RD3B 3TK6A 4CRCA 1CA8B 1C5PA 1GJDB 3I77A 2VWLA 1GBIA 1Z6JH 1O2WA 1GMDF 1PPHE 1B7XB 1EZSC 4ZXYH 4RSPA 5K0HA 2CHAC 1HFDA 2VGCC 3UOUA 2ZDNA 4MDSA 1ETRH 3MWIU 1CQQA 1C1TA 1PPBH 1OP8A 2BY6X 1BMAA 1SSXA 3K2UA 3BTWE 1GJ9B 5DK1A 1GI5A 4RN6A 3PLBA 1ZMNA 2OBOA 2WPLS 4NIWA 2WYJA 3ZZ7A 1TMUH 1D6RA 2FI3E 1E35B 2ZU2A 3BTEE 1XVMA 3TGKE 3A7ZA 1GI6A 1YLDA 4WVPE 1V2MT 1O30A 4BTIB 1MTVA 1TYNA 1IOEA 3PTNA 1E34B 4MNVA 3JZ2B 1ANBA 1A7SA 2ZTXA 5DPAA 1S82A 4A6LA 5EQSA 4WY3A 2SGAA 3JZ1B 1GJ4H 1TRMA 2GX4A 1GBHA 5HM2A 1FQ3A 1C5XB 4Z6AH 2ULLA 3PLKA 2B7DH 3M37A 1IHSH 3WY8A 1S5SA 3TGJE 1O38A 1WSSH 1Y3YA 2P16A 1UCYK 2Z9KA 1Z8IB 3LH3A 4YOJA 1SGIB 3QZQA 4OGYA 1SGCA 1GCTC 2G5VA 2VVCA 3ATWA 4ABEA 3LC3A 1XUGA 2HALA 1HYLA 1KDQA 1PQ8A 3GCTG 3ZYEA 2BDCA 2RA3A 4NWKA 3QTOH 1RTLA 4TY7A 1EASA 3HGNA 4I8HA 3OYPA 2A7CA 2ALVA 2BY8X 2BDHA 1VCWA 3SNEA 2J34A 2W26A 3ZZ6A 2O8WA 4TPYA 1WTHD 2PTNA 2FPZA 2O8TA 1W10U 4FUCA 1P10A 2AS9A 1F2SE 5J4SA 4MNYA 4ABBA 4A1XA 1BUIA 3F9FA 2W7UA 1DWBH 1C5NH 3M5MA 3MNBA 1O3GA 3TH2H 3MHWU 5T6DA 3Q3KA 4Q2KA 4XSKU 2XC0A 1FPCH 3E6PH 3T5FH 2BZAA 1LVBA 1GVKB 1XUFA 1AO5A 3UUZA 1QL8A 4OGXA 3PYHA 2WPHS 3VB4A 2HRVA 3TIUA 3SV9A 4OS1A 3RU4E 4Y11E 2ZDLA 3LONA 1GHZA 1ARCA 3A85A 1PPEE 2KAIB 1A2CH 1INCA 1EATA 1GHVH 2WYGA 2FXRA 1YBWA 5IYTA 1OWJA 4F4OC 4OS2A 1Z8RA 3R3GB 4FVDA 1ZTJA 4NSVA 4TPIZ 4OS6A 5GDSH 3HKJB 2OC8A 1P03A 4X1QU 1NN6A 2J4IA 1GDQA 1ZHMA 3P8NA 3S7KB 2TBSA 4NCYA 1TRNA 1QA0A 1BTHH 1MU6B 5DP7A 1FDPA 2R3YA 3SU4A 2ZDMA 2XRCA 3BEUA 2VH0A 4I8KA 2WPMS 6LPRA 4AFZA 3RLYH 1A1RA 3U8RH 3GY4A 4U30A 4FU9A 4Y7AA 2ZI2H 1NTPA 3SUGA 7LPRA 3QWCH 1IQLA 1GBFA 1TAWA 1MTSA 1RIWC 3GY6A 3GDVA 1LHDH 1O32A 1SG8B 3MO6A 3GCTF 1AWFH 1O3LA 3BG4B 4Y7BA 2VIWA 1O2JA 4E06H 4SGBE 1O3OA 5A2MH 4MPUA 2PFEA 3M36A 5FBIA 3AASA 5BRRE 2F9VA 2BLVA 1ZOMA 4LOYH 3NXPA 1BT7A 1C9PA 1OPHB 1SL3A 2OQ5A 1FI8A 2W7SA 3OU0A 1TX7A 1DOJA 1AU8A 3RP2A 4H6TA 2PWXA 3T28A 1BRCE 3ENSB 1MQ5A 5CMXH 1NESE 1P2OA 1A0LA 5ESBA 1WUNH 1CO7E 3RC4A 1L1GA 3P8GA 1SLVB 1N6XA 4BAOB 1UTLM 1FAKH 5FPTA 1YPEH 1C1NA 2TGAA 4KKDA 1G30B 4AFQA 3UFAA 3E90B 3GICB 1QURH 1GBBA 1V2NT 3RXGA 4WJG2 2GCHG 1BIOA 1EOJA 1RRKA 2FS8A 2XTTB 4H6SB 5HM9A 1AIXH 5TJXA 4D76A 2XXLA 3S0NA 1RIWB 2BD3A 1NM6A 1ELAA 4X8TH 1OP0A 3T27A 1QNJA 3IITA 2O8MA 1ANCA 2WPJS 5F03A 1G3BA 1O2LA 1NRRH 2QXIA 3SN8A 5E2OA 1LO6A 3KCGH 2ZQ1A 1OYTH 4XDEA 1UTJA 1OXGA 4WWYA 5SGAE 3M35A 1SGDE 3A80A 1DE7H 2AMDA 1GBJA 2RA0A 2UUJB 1A5GH 4E05H 1SQOA 3RXPA 2PUXB 3VEQB 1OWKA 3QDZB 3RDZA 3LT3A 1LMWB 1L1NA 2ZIQH 3CP7A 1V2QT 2PGQB 2VU8E 3RU4T 3PROA 2IPHA 1OKXA 2G4UA 4JZFH 2GCTC 4DIIH 3H7TA 4CBNA 1Y59T 4ESTE 2FIRH 1G3CA 1EZQA 1ZR0A 8GCHF 3A7TA 1HJ9A 2CJIA 1GPZA 1C9TA 2PKSC 3B9FH 1SVPA 2R3UA 1EAIA 2GD4B 3HGPA 4ABDA 5GPIB 5LPRA 4FUIA 3UIRA 1JBUH 1C1MA 1BA8B 4B71A 3A7WA 2FEQH 4D7FA 1QFKH 3K6ZA 1UK3A 5FXLA 2A45B 3RXHA 1KXBA 1MKXK 2R2WU 5AFZH 1TONA 1QA7A 3TJNA 1A4WH 1AHTH 1AN1E 3A88A 4JCNA 1O2RA 4ZKOU 1VR1H 2ANKH 1ELGA 1MTNC 1ZGVA 4ISIH 3RLWH 2CF9H 1NROH 1N8OB 1G2MA 2A5KA 2BQ6B 3HKIB 4WH8A 1J16A 3VB5A 3PMJA 1VITH 1O3KA 1OP2A 5E0HA 3BTKE 2JH0D 5JBAS 1DXPA 3RM0H 4XE4A 1ARBA 1BCUH 1KXFA 1NU7B 2PSYA 2PR3A 3NKKA 4QT8C 1BHXB 1JOUB 2OUAA 1H8IH 5PTPA 2TGDA 2ZDKA 3GCOA 2GCHF 2AGGX 1VJ9U 2Q6DA 3FP8E 1O2YA 1TPPA 3SGQE 4D9QA 5GCHG 1GVLA 2GCTB 1OYQA 3OY6U 1P9UA 1GHXH 2D1JA 2ZC9H 2NWNA 1ZHRA 4X1SU 1V2ST 3VB3A 2AEIH 1ABJH 1XUIA 2BMGB 1SLWB 1Y8TA 2FLRH 1WBGB 4FUJA 2FOGA 2ZEBA 4BXWA 3SNBA 1D9IA 3GY8A 3ZYDA 1FN6A 2GZ7A 4GUXA 1AKSA 1QJ6B 4DOQA 3VB6A 2CV3A 3TH3H 4AB9A 1C5MD 3Q77A 3VXFH 2XC4A 2OXSA 4AOQA 1ESTA 2ZGCA 1GJCB 1VGCC 4HI3A 4CR5A 4ASHA 3R0FA 2ZHQH 1P2KA 1TNLA 1AMHA 1Y5UT 2J92A 3G01A 3RMOH 3AVZA 3UREA 2BVRH 3MTYA 1C4Y2 1O5FH 2NU1E 1MCTA 1MTNB 2Z3DA 2OCVB 1YKTA 1TQ0B 1UHBB 2XC5A 2Y7XA 2J94A 4ZH8A 1TGBA 3RXLA 3MOCA 1G3EA 1CSOE 1UVOA 1TPAE 1IQJA 4Y8YA 3A84A 2FI4E 1PPZA 3MU0A 5E0JA 2ZFPH 2NU0E 2ZFQH 5AF9H 3LPRA 3ATMA 1EZXC 3K65B 4Y0YE 1TWXB 2P59A 5C2ZA 1LVYA 2FI5E 4ISNA 2D2DA 1SOZA 2Y6TA 1VJAU 3NPSA 1CHOG 2ZPSA 2F3CE 1ZJKA 1S83A 3LU9B 1GBMA 3SU6A 1ZMJA 1MUEB 4K1EA 4ZKRU 1FONA 3SJKA 3TPIZ 5HXFA 3UY9A 4KTUA 4I7YH 1AFQC 5A0CA 3F6UH 3KQBA 1PQ7A 1GI0A 1EJAA 1GI9B 1QY6A 1WAYB 1YCPH 2Y82A 2VINA 2FLBH 1DWDH 1PPGE 1MCVA 1BBRK 4MPWA 3SJ9A 1DS2E 2AH4X 4THNH 3GDUA 4INHA 3E0PB 1EPTB 3NWUA 2ZNKH 2UWOA 5AVDA 2Z7FE 5GCHF 2H9HA 4CBOA 2ALPA 2EI7A 2TPIZ 3ATKA 1T7CA 3SOSA 4FUFA 3LGYA 1IHTH 2HLCA 1H9IE 5C1UA 1BMNH 2VIOA 2H9EH 4H4FA 1UTQA 1Y5BT 3Q3YA 3M3SA 2XNIA 2ZHEH 1LKBA 1KSNA 1AUJA 2G00A 4TYDA 3SU1A 4JZIA 1TGSZ 4WXVA 1YPKH 3SQEE 5JBTA 1QBOA 4KGAA 4IMZA 5TCAA 1TMBH 2OBQA 4AG2A 6CHAB 4CHAC 1C2FA 3GOVB 3P6ZB 3AW1A 1DICA 5LGOA 1NS3A 3SV7A 2H1UA 3TGIE 2ANMH 1B0EA 3EAJA 1IQFA 1NRSH 1HJAC 4OS7A 1EXFA 1F0TA 1J9CH 2QYIA 1C5OH 3SO3A 1CU1A 4MNWA 1C2DA 4WF8A 4A5TS 4X2WA 5E2PA 5C67A 5ABWA 2CN0H 1TFXA 1LHFH 2HPQH 2QGRA 1P2JA 1SC8U 2J9NA 1FY1A 4DIHH 1GI7B 5EXLA 3URCA 3VGCC 2A4OA 2ZHFH 3A89A 1BZXE 1JRSA 3SU2A 1JRTA 1L1JA 4I32A 4AN7A 1LPKB 3M7UA 1DSUA 2ASUB 1DWEH 3URDA 4B2CA 1FY5A 2YNAA 2UUYA 2HOBA 4IC6A 1PQ5A 1G37A 2P93A 1GMCG 1CHOF 1TOMH 4CRAA 2IOTA 1HBTH 4BAKB 1ZTLA 7KMEH 2PKAB 4XBBA 2F9OA 4UFGH 1OSSA 1QB6A 5JPMH 3BTFE 2GZ8A 3MNXA 1P12E 3SORA 1P09A 1GDUA 2F9BH 3RMLH 1W2KH 1N1LA 1AVWA 2SFAA 1MMJN 1PYTC 1T8NA 4E7NA 3LGVA 3PO1B 3KIDU 2OTVA 3ZVGA 3I29A 3BEIB 3GCHC 4X6OA 1K28D 4HFPB 4MG3A 2Z9IA 4B74A 4RKJB 1FLEE 1E0FD 1GL0E 1EZUC 2ZU3A 4Y8ZA 5EU8A 1HAVA 3BN9A 4XFQA 1AE8H 5GJ4B 3LGTA 2C8YB 1OWDA 4CRGA 3MI4A 3ODFA 2Y5FA 4Z0KA 1GBAA 3SBKA 3LJJA 4YLUA 1PJPA 1QIXB 3GY2A 4AORA 1C2LA 1BHXF 2Q6GA 1SI5H 3PTBA 4NA8A 1C1QA 2BM2A 2C90B 2CMYA 1P06A 1BTXA 1S0RA 3U8TH 3UQOA 1V2TT 1QBVH 1C5RA 4HZHA 2CHAB 2BDBA 2VGCB 5GWZA 3EDXB 1ZPCA 2FOEA 1W3CA 1OX1A 4IW4E 1Z1JA 5JBBS 1SOTA 2C8XB 1Z8GA 2HNTC 4ZHMU 2P8OC 9ESTA 1THRH 3PWCA 3U69H 2H9TH 1UVTH 4GHQA 4X6PA 1UVUH 3BEFB 3D65E 4A1VA 8KME2 2WUCA 1Y3XA 1MKWH 1NRQH 1TPOA 2BDAA 3DFLA 3RXIA 1EQ9A 5A8YA 4AFSA 4IN1A 2EI8A 1O31A 1GGDC 7GCHG 3QGNB 3LGUA 3ZVDA 3GY7A 1G9IE 4CR9A 1DSTA 1E38B 2EA3A 1SHHB 1C1VH 4DGJA 2CGAA 1LVOA 1FPHH 1GMCF 1OOKB 4BAHB 1O3AA 1W7GH 4CH2B 1A5IA 1V6DA 2HWLB 5I46H 3PMHB 2ZGHA 1PFXC 3UNRA 3MNSA 4AGJA 1O2NA 1C5QA 2IN2A 2ZG0H 5F8XA 1EJNA 2UWPA 3AW0A 1TX8A 3LDXH 4MLFB 1QB1A 1QRZA 1DFPA 2Y80A 3B23B 2ZTZA 1Y3VA 4I31A 1C2MA 1GCTB 1QCPA 1SR5C 3UWIA 3ODDA 1ESAA 2PW8H 1P3EA 2H5DA 1XXDA 5EW1H 4DVAU 1Y3WA 1UTKA 4O03A 2J2UA 1DLKB 3PM3A 1OWHA 1HAZB 1KLTA 2FDAA 2WV5A 2FO9A 1IQEA 3V13A 2ZWLH 1O3FA 1O5EH 2BYAX 1XXFA 3RXAA 1IAUA 1UTMA 4I8LA 1C5WB 3TNSA 1FAXA 3KGPA 4GPGA 4NGAH 4ISLA 3SJ8A 1CVWH 3FP7E 1TMTH 1BOQA 3U8OH 2BTCE 2G55A 1O3PB 1YCPM 4CRFA 2WUBA 1ZPZA 1QL7A 4MPXA 2XCNA 2G81E 4FUHA 1SLUB 3A7VA 3H7OA 2ZPRA 1F5RA 8GCHG 1GWAA 1MBQA 3MNCA 2AGEX 1GBKA 2A1DB 4INLA 1Z7KA 3KNXA 4X6NA 2VIQA 1W13U 1H9HE 1RTFB 2C4FH 2BXTH 3SV8A 3MH7A 4KP0A 3RXFA 2FMJA 4WMDA 1GJ6A 1LDTT 2HVXA 2QF0A 1EX3A 4D7GA 1GBDA 1MZAA 1TNHA 2QIQA 3MU4A 1FY8E 3OSYA 4YESB 2XW9A 1UCYH 1HAPH 1DDJA 1A0HB 1V2RT 4GAWA 1SLXB 1GL1A 3EA7A 5C3NA 2ANWA 5JB8S 2ZQ2A 3DT0H 4X1RU 1O3EA 6GCHG 7GCHF 3BIVH 1GBLA 1L4ZA 1AB9C 3OTJE 1LVMA 1GI2A 1HRTH 1T32A 1F5LA 1T8MA 1GG6C 1QQUA 1GHBG 3ITIA 1AVGH 1LHGH 2ZFTA 2AIQA 1W8BH 4O97A 4YT6H 1S85A 2P3FH 2VH6A 1V2VT 9LPRA 2JH6D 3Q3XA 1JWTA 3SJIA 1NFXA 2NU2E 2QF3A 2WPKS 2A0QB 4MNXA 3ZZAA 3M3TA 4Q7ZA 1EKBB 4JK5A 2VWMA 1W12U 3EE0B 1NRPH 1FMGA 2PHBA 1WCZA 1O36A 1F0RA 4A7IB 1ETTH 1O2QA 5DO4H 1ZYOA 3D49H 2VIDA 1YPHE 4FU7A 4XBDA 5TCCA 1ELBA 1BRAA 1FZZA 2GT7A 3T2NA 4NFEA 1O2ZA 1NC6A 2ZGXH 1ELCA 4DURA 5JYIA 1ID5H 2BVSH 4NG9H 1DX5M 1RGQA 1ZJDA 2ZFRH 4YOGA 3PWBA 2Z3CA 1AE5A 2BDGA 4LK4A 3RUOA 1ZLRA 2TGTA 3MH4A 2QXGA 1V2UT 1AQ7A 1TOCB 3CS7A 1AFEH 5T3HA 1XKBC 4ZKNU 4JZ1A 1HDTH 5FHTA 2KAIA 1YPGH 2GMTC 1C1SA 3RXUA 1P01A 3NZIA 4KTCA 1ELFA 2FOMB 4ZKSU 4UDWH 1C2IA 4CRBA 1TIOA 1Z8JB 2DE8A 2VVUA 3GYLB 1CT4E 2D26C 1BTZA 4XBCA 3DA9B 4Y6DA 1T4UH 1PYTD 1XX9A 2R0LA 4ABIA 1K1IA 3A8DA 1FUJA 2HNTE 3U9AH 4ZAEA 3FZDA 2QCYA 1HAHH 3M3VA 1AD8H 1K1NA 1XUJA 2H6MA 4VGCC 5E0GA 5GIBA 2VIPA 1TE0A 2JETC 2OP9A 3W95A 1BRBE 2F91A 1XVOA 4X1NU 1E36B 1XMNB 3RXJA 6ESTA 1IQKA 4XOJA 2P3UB 3BTDE 4K69A 3RC5A 1SPJA 6GCHF 4DT7B 2A32A 3ZVFA 2Z3EA 5EXNA 4YM9A 1GHBF 1L4DA 2ZU4A 3M7QA 4HGCA 2AMPA 5F8TA 4DW2U 1UMAH 3A86A 1UJ1A 4X0WU 2FESH 1WOFA 3TVJB 1LPZB 2O9QA 2GMTB 3P70B 1IQHA 1A5HA 3UQVA 4I33A 1KYNA 5FCKA 1ELVA 2BOHB 2RG3A 2ZU5A 1QQ4A 4GCHG 3S9AA 4FU8A 2GVFA 1V2WT 1PPCE 1O34A 2Z9JA 3A8AA 2PKSB 4AX9H 1Q31A 2BY5X 2XBYA 3RXCA 2BB4A 4YOIA 1BMMH 1O2GH 3AAUA 1P57B 1ZMLA 1O2XA 4O9VA 1CBWC 5A0BA 1IQIA 4VGCB 5EW2H 2FWWA 1QR3E 3UR9A 1JMOH 2V3HH 4JYUH 4KTSA 2NU3E 1GVZA 1UVPA 2FX6A 1SGFG 1F7ZA 4GVUA 1S0QA 2ODYB 1HUTH 2AMQA 2VB0A 2D8WA 1G3DA 3PMBB 1LTOA 5FBEA 1QB9A 4Y0ZE 1DUEA 3UPEA 1LCYA 3K6YA 4Y76A 1SFQB 1A61H 3GCNA 1DM4B 4K60A 4I8GA 3RC6A 5C5NA 3LGWA 2BQ7B 5AHGH 5DP4A 2BDYA 4K8YA 1CGHA 1O3CA 1V3XA 4A92A 2ZCKP 3RXQA 1K1OA 2ZDAH 5A8XA 1BQYA 1ZTKA 2A4GA 3MYWA 3HATH 1NRNH 1DT2A 4FUEA 2ZKSA 2ANYA 1V2JT 1H9LB 2BDIA 3BV9B 1K1JA 3A8BA 1DY9A 2FOAA 3MO3A 1MQ6A 1UO6A 4WXIA 3OY5U 4CRDA 1AUTC 2GDEH 1FNIA 2ZO3H 1O5AB 1O33A 4O3UA 3L3TA 3ZVAA 1V2KT 1ELDE 3SUDA 2BD7A 2BQWB 1JXPA 3RXKA 2BVXH 4O3TA 1J17T 4BAQB 2QXJA 1KXAA 1KY9A 3M5LA 1BITA 1K22H 3ZV9A 3A8CA 3TK9A 1YYY1 3EQ0H 2QN5T 1CBWB 3L33A 3L6PA 1O37A 3QX5H 1O3DA 1VGCB 3BTME 2I6QA 3F1SB 1HIAA 1GI1A 4IC5A 1MD8A 4R0IA 4AZ2B 4ABJA 2VNTA 4X8VH 3F9HA 3BG8A 1MKXH 2R0KA 4NFFA 3RXMA 1DUAA 1O3HA 2M5TA 1SGYE 1AZ8A 2R2MB 5EGMA 4GCHF 1C1PA 3UWJH 2W5EA 2ZPQA 1ZSLA 3LC5A 1KDQB 5EPYA 3SU5A 4TY6A 1GI3A 5DG6A 2GP9B 1ZZZA 2AFQB 2FP7B 1J15A 2C8WB 1TRYA 1BTUA 2ZECA 4JK6A 3GY5A 2PTCE 3O8CA 3RXRA 1S6HA 2A2XH 5HMAA 4U32A 5FPYA 2C8ZB 1TNJA 2F9NA 2B0FA 4ZUHA 4H42U 4UFFH 3P95A 2Z94A 3BTGE 1AI8H 4MPVA 5LPFA 4NIXA 3S9CA 3FANA 2Y5GA 1TGCA 4M7GA 1S84A 1AFQB 2ILNA 1CT2E 2ZFFH 4D8NA 1BJVA 1EP6A 1Q3XA 1EP5A 1J14A 1KIGH 2F9UA 3ZZ4A 3TITA 2SGQE 5C5OA 2IJOB 2Q1JA 5T6FA 2TGPZ 4WMFA 2SNWA 1T8OA 2BOKA 1M9UA 1HNEE 5DP8A 2LNCA 2DUCA 3PV4A 5ESTE 2XWBI 2BD2A 5FX5A 1GJ5H 1O3BA 3IG6B 1MZDA 2FS9A 1GJAB 1H8DH 2BD9A 2BX4A 3T62A 4BOHA 2BY7X 2A7JA 2B8OH 3DFJA 2OLGA 4ISOA 3EA9A 4OS4A 3U1JB 1MTUA 1YF4A 3QN7A 3SJOA 4D9RA 2UUFB 1UHBA 7ESTE 1YP9A 1LHCH 2GDDA 3LKWA 1AZZA 1A3EH 2STBE 4BNRA 1ANEA 1YPHC 3SQHE 1HGTH 1HAXB 3RMMH 3TJOA 1DPOA 2A5IA 4ZHLU 3T29A 1VZQH 3M7TA 3ZZBA 4CHAB 4X8SH 1AVXA 1MBMA 1SGEE 1O2PA 4B75A 3ZZ9A 3O8DA 2OD3B 1VCQA 3TH4H 3QTVH 1HJAB 2W3IA 5BPEA 5EQQA 1PPFE 2QAAA 4UONA 1XKAC 3KF2A 1F92A 2A2QH 3TLOA 5HYOA 1QGFA 1TNIA 1TLDA 3STJA 1HXEH 4R8TB 3PMAB 3ZVCA 4AG1A 3SV6A 2UUKB 4YO9A 1NFUA 2GGVB 3VGCB 1GJBB 2BXUH 1K1MA 4JZEH 3FAOA 3FP6E 3UNSA 2ZHWH 2ZU1A 1Y5AT 1BBRH 1A0JA 2QXHA 1HAOH 2FOFA 1O2UA 1IQNA 3M5OA 1NFWA 2GZ9A 1QJ1B 5AFYH 3GISB 4AYVB 1NPMA 1QHRB 1P05A 1LPGB 4YTAA 2V0BA 1BB0B 2PLXA 3A7YA 1C1WH 1BTWA 1SFIA 2Y81A 3KEEA 1EPTA 4LZ1H 1O5GH 1G36A 2DE9A 3ATLA 1D3QB 1C5TA 3C1KA 3BTTE 3RXEA 1HPGA 2AIPA 1MAYA 1HJ8A 2ZP0H 4GSOA 1P02A 2ZCHP 1W7XH 3CENA 1QRXA 1QBNA 1W0YH 4X2YA 4AFUA 2ODPA 3T26A 1XM1A 1F0SA 1C4U2 2FODA 4UD9H 4X1PU 3KN2A 3SNCA 2XBVA 3GCHB 3ZZ3A 5EODA 2Q6FA 2AYWA 2F83A 4NIYA 1EOLA 1ZSKA 3LIWA 5F8ZA 4MTBA 3QLPH 1O2TA 1HAGE 1GDNA 3ATIA 1O2HA 1C2EA 1TABE 1Z6EA 1NFYA 1FV9A 3IWMA 1BBRE 2NU4E 3N7OA 3TU7H 2H2ZA 1O2IA 1SGPE 4SGAE 1C2KA 4BANB 3AAVA 2OC1A 8LPRA 2BHGA 1T8LA 2ZHDA 2G51A 2QC2A 2XWAA 3MFJA 1SGQE 3BG4C 1MD7A 3D62A 3SI4H 1RXPA 1FN8A 1WTGH 2Z9LA 1AGJA 4PROA 2LPRA 4ISHH 2G8TA 1HV7A 1P8VC 2ZDVH 2P8OB 1A3BH 2G4TA 5T6GA 4CREA 4U01A 3NK8A 3RXOA 1D3TB 1N6YA 1DY8A 3VFEA 1CA0C 1C5ZB 3EYDA 1NT1A 5FX6A 3ZVEA 4IBLH 1HCGA 1W11U 1BJUA 2PKAA 3QGJA 1UK4A 4LZ4B 3RXBA 2A5AA 1QRWA 1SGRE 1NU9A 3ZZCA 1LKAA 2SGEE 3P17H 3RU4D 3V3MA 1DXWA 1B0FA 1V2PT 5A8ZA 2BLOA 4J2YB 2P3TB 2ZTYA 3BIUH 1EAWA 5C20A 1GGDB 2FM2A 4ZXXH 4IMQA 1L2EA 2CF8H 5L30H 1DANH 3ZZDA 1C5YB 2R9PA 3P8OA 1GCDA 1UTPA 1WQSA 4UFDH 1BDAA 5DP3A 3UTUH 4B76A 4BTTB 2ZZUH 1D6WA 4B1TA 2FTMA 2ODQA 4WH6A 5GXPA 5EQRA 1ORFA 2OC7A 1O2VA 3RMNH 1NZQH 1SBWA 3SZNA 1OS8A 1FIZA 2TRMA 2P95A 1D3DB 2PV9B 1ZRKA 2O8LA 2ZF0H 3MU8A 3BF6H 1P9SA 3UOPA 4Y10E 5DP6A 1GBCA 1A46H 4ABFA 2VJ1A 5K7RA 2SGFE 1LHEH 3MU5A 1WV7H 5ETXA 1V2OT 1ZRBA 1K21H 3H5CB 2VVVA 3GY3A 4B2AA 3MMGA 2XYAA 3VB7A 2EC9H 2K1QA 1QL9A 4B2BA 3A87A 1C1UH 1C2GA 5A09A 1Y3UA 2YOLA 1JIMA 1XUKA 1UVSH 3F9GA 1GBEA 4B73A
chains in the Genus database with same CATH superfamily
1XUHA 2RDLA 1CA0B 5JB9S 4XRNA 5A0AE 1OWIA 1NO9H 2Y5HA 3M61U 5E8EH 2EI6A 1KLIH 3ZZ8A 1WQVH 3E91A 2V35A 4RKOB 2GTBA 2BLQA 1QTFA 1O0DH 1O2MA 4X2XA 1DVAH 3LH1A 4K8BA 1P2IA 2LP6A 1VCPA 1AKSB 1P11E 4WMEA 3MO9A 4ABAA 2XOKD 3QK1A 1HLTH 1YPLH 3V0XA 2XNDD 4AGKA 3MH5A 2A31A 3KQDA 1LQDB 4MVNA 1WYKA 2B9LA 1H1BA 2WV4A 1UCYE 4X8UH 1NY22 3DCLA 1RFNA 3C27B 1Z71A 3E16B 1YC0A 3S7HB 1O39A 4K3JA 3O8BA 1TBZH 1C2JA 1C5SA 3LGIA 1C5UA 1FIWA 1TBRH 2ZCLP 3SGAE 2BZ6H 1WDIA 4JYVH 1O5CB 3F68H 4HG6A 1YM0A 1ABIH 2FTLE 1DWCH 2PUQH 1BRUP 4TWYA 1N8OC 1O35A 1WU1A 2GKVE 3SHAH 1GJ8B 2F43B 1AB9B 5DJ7A 1ACBE 4K1TA 1E1RD 2QF4A 1THSH 2ZA5A 1GG6B 4F49A 2VIVA 1EAXA 2FZZA 3QO6A 5I25A 2L74A 1K9OE 5L2ZH 2V6NA 1BTYA 4YLQH 5JDUB 1DITH 2J38A 1P0SH 3UR6A 1O3IA 3W1EA 2FYRA 1X7AC 4MQAA 4ZHAA 3KL6A 1AY6H 1V2LT 4IGDA 1O3NA 1TX6A 2SGDE 3A83A 3HK6B 5F6MA 3KHVA 4UFEH 2ZFSA 3E1XB 2J95A 1CE5A 3O8RA 4NA7A 2XCFA 1IQGA 1GI8B 3PB1E 1FY4A 2HPPH 4YZUA 2EEKA 3SGBE 1YCPK 4OS5A 8ESTE 1ZHPA 1ETSH 1HIAB 4Y71A 2BLWA 4HTCH 2BD4A 2J5UA 1W14U 5FAHA 2FX4A 2EY4C 3HPTB 3RXTA 3SI3H 2OC0A 1GHAG 3P8FA 4KELA 2H5CA 3MU1A 1THPB 1EB1H 4NZLA 5B6OA 1O2SA 2WINI 2KZ4A 3M5NA 1E37B 2A4RA 3P92A 2HGTH 2SNVA 1ELTA 4RT0A 5CHAC 3VXEH 4K5ZA 3NUMA 4Y8XA 4NSYA 3GYMA 3FFGA 2OINA 1SMFE 1OWEA 1H8HD 3SU0A 3QUMP 5G4BA 4DJZB 5LH8A 4JYTA 1YGCH 1D4PB 1SKYE 1FY3A 1FJSA 3Q76A 2ZGJA 3DD2H 4JZDH 2GV6A 1ZSJA 4J1YA 4CH8B 3S9BA 4ZMAH 2Z9GA 1ZPBA 4NWLA 4YT7H 5L6NH 2QV1A 3SV2H 1VITG 2V3OH 3SNDA 1S81A 2FOHA 3KQ5A 2QF5A 2AGIX 3KQEA 2LELA 1TGNA 2JKHA 3SW2B 1D3PB 1O5DH 5C1XA 4UEHH 1KXCA 1P3CA 2F9PA 1TNGA 4NZQA 2RCEA 1EJMA 1SGTA 3ZVBA 2F4LA 2JETB 4X6MA 4B6EA 1BMLA 3A81A 2JH5D 1C2HA 4DG4A 1TA2A 5C1YA 4FUGA 4K1SA 4LXBH 4K2YA 2IPQX 2A4QA 1CGIE 2HNTF 1SGNE 4TWWA 3OEHD 1W0KD 2BD8A 2BD5A 3DSOA 3FZZA 4ZROA 1H4WA 3ZV8A 1EUFA 5DP5A 1SQTA 2Y7ZA 3E0NB 5EPNA 1SGFA 1UK2A 2A7HA 2VWNA 2C93B 2Z6BD 1GI4A 4X2VA 4FUBA 1YLCA 2XBWA 1K2I1 1UTOA 2C3SA 4FVBA 5J4QA 1ANDA 5CE1A 3DHKH 1P2NA 3SUFA 3A7XA 5KGOA 4ABGA 5JBCS 3ZZ5A 2UWLA 3BSQA 5CHAB 1EPTC 3TK5A 3SUEA 3Q00A 1CT0E 4I8JA 1GMHG 1GJ7B 5KECA 2TIOA 1KXEA 1G32B 5H4IB 3RXSA 4ABHA 5DGJA 1KTSB 1YPJH 1RTKA 4GHTA 4Q7XA 3K9XB 2OQUA 1EB2A 5L2YH 5FCRA 1CHGA 5EG4A 1GMDG 2WPIS 3EGKH 3H09A 4BXSA 1U6QA 1TALA 2B5TB 1GHAF 5IDKA 2FOCA 1TGTA 3TNTA 1HAVB 3GDSA 4AYYB 4BTUB 3W94A 6CHAC 4E7RG 1DLEA 2ZGBH 3VPKA 3T25A 3NCLA 3DUXH 2SGPE 1MTWA 2AHME 2I6SA 3TJVA 3SNAA 4AB8A 1ESBA 1TB6H 1L0ZA 3UNQA 3U1IB 2STAE 2PGBB 1HAIH 3TJUA 2O8UA 1GHWH 1MAXA 1F0UA 3SU3A 1TPSA 1ELEE 4Y79A 2YNBA 1AWHB 2VWOA 5EOKA 1LQEA 1P2QA 1VITF 1O3MA 1SQAA 2FOBA 3DSGA 3QZRA 3B8JA 2XBXA 3E3TA 4Q80A 2PSXA 1C1RA 1TNKA 1T31A 1RJXB 1O2OA 3ELAH 1TBQH 1TA6A 2GT8A 4JMYA 1ZGIA 1C5LH 1TQ7B 3CNRA 1SB1H 3ESTA 1KXDA 1PQAA 3D23A 3EA8A 3S69A 1RS0A 2ESTE 1J8AA 3HK3B 3V7TA 5LPEA 1Z1IA 5HGGA 1B5GH 2P94A 1O3JA 1HB0B 3RXDA 1S6FA 1KTTB 3LOXA 1MKWK 3U98H 2QA9E 1QJ7B 3A82A 4IN2A 1HXFH 3BTQE 3F0PA 2AERH 5FPSA 5C0TA 3MH6A 4NA9H 1C4V2 3I78A 1UTNA 4FOUC 1P04A 2GV7A 1YPMH 1C1OA 1GHYH 1HAYB 4UE7H 4DCDA 1O2KA 3PO1C 4Q7YA 1MH0A 1SHYA 2BY9X 5DKMA 2CXVA 4INKA 1IQMA 1FXYA 1T4VH 3SHCH 3F9EA 3KQCA 4A1TA 3FVFB 1CGJE 1W0ZU 1G2LA 1KLJH 1Q2WA 3V12A 3STIA 4BAMB 2QY0B 1F5KU 2BX3A 1E1QD 4U2WA 3CS0A 4DY7B 1GMHF 1MU8B 2W3KA 1K1PA 1EAUA 2G52A 3BTHE 3E8LA 3RXVA 3RM2H 1BTPA 4IS5A 5EXMA 4FXGH 5DP9A 5GNDA 2FYQA 3PLPA 1O5BB 3LJOA 4NIVA 4GLYA 1GBTA 1C5VA 4FUDA 3OX7U 2G5NA 1P2MA 1K1LA 2THFB 1JIRA 1RD3B 3TK6A 4CRCA 1CA8B 1C5PA 1GJDB 3I77A 2VWLA 1GBIA 1Z6JH 5C94A 1O2WA 1GMDF 1PPHE 1B7XB 1EZSC 4ZXYH 4RSPA 5K0HA 2CHAC 1HFDA 2VGCC 3UOUA 2ZDNA 4MDSA 1ETRH 3MWIU 1CQQA 1C1TA 1PPBH 4FETA 1OP8A 2BY6X 1BMAA 1SSXA 3K2UA 3BTWE 1GJ9B 5DK1A 1GI5A 4RN6A 3PLBA 1ZMNA 2OBOA 2WPLS 4NIWA 2WYJA 3ZZ7A 1TMUH 2V7QD 1D6RA 2FI3E 1E35B 2ZU2A 3BTEE 5T1VA 1XVMA 3TGKE 3A7ZA 1GI6A 1YLDA 4WVPE 1V2MT 1O30A 4BTIB 1MTVA 1TYNA 1IOEA 3PTNA 1E34B 4MNVA 3JZ2B 1ANBA 1A7SA 2ZTXA 5DPAA 1S82A 4A6LA 5EQSA 4WY3A 2SGAA 3JZ1B 1GJ4H 1TRMA 2GX4A 1GBHA 5HM2A 1FQ3A 1C5XB 4Z6AH 5EIYA 2ULLA 3PLKA 2B7DH 3M37A 1IHSH 3WY8A 1S5SA 3TGJE 1O38A 1WSSH 1Y3YA 2P16A 1UCYK 2Z9KA 1Z8IB 3LH3A 4YOJA 1SGIB 3QZQA 4OGYA 1SGCA 1GCTC 2G5VA 2VVCA 3ATWA 4ABEA 3LC3A 1XUGA 2HALA 1HYLA 1KDQA 1PQ8A 3GCTG 3ZYEA 2BDCA 2RA3A 1WXRA 4NWKA 3QTOH 1RTLA 4TY7A 1EASA 3HGNA 4I8HA 3OYPA 2A7CA 2OK5A 2ALVA 2BY8X 2BDHA 1VCWA 3SNEA 2J34A 2W26A 3ZZ6A 2O8WA 4TPYA 1WTHD 2PTNA 2FPZA 2O8TA 1W10U 4FUCA 1P10A 2AS9A 1F2SE 5J4SA 4MNYA 4ABBA 4A1XA 1BUIA 3F9FA 2W7UA 2WPDD 1DWBH 1C5NH 3M5MA 3MNBA 1O3GA 3TH2H 3MHWU 5T6DA 3Q3KA 4Q2KA 4XSKU 2XC0A 1FPCH 3E6PH 3T5FH 2BZAA 1LVBA 1GVKB 1XUFA 1AO5A 3UUZA 1QL8A 4OGXA 3PYHA 2WPHS 3VB4A 2HRVA 3TIUA 3SV9A 4OS1A 3RU4E 4Y11E 2ZDLA 3LONA 1GHZA 1ARCA 1NBMD 3A85A 1PPEE 2KAIB 1A2CH 1INCA 1EATA 1GHVH 2WYGA 2FXRA 1YBWA 5IYTA 1OWJA 4F4OC 4OS2A 1Z8RA 3R3GB 4FVDA 3FOAA 1ZTJA 4NSVA 4TPIZ 4OS6A 5GDSH 2V3MA 3HKJB 2OC8A 1P03A 4X1QU 1NN6A 2J4IA 1GDQA 1ZHMA 5DSFA 3P8NA 3S7KB 2TBSA 4NCYA 1TRNA 1QA0A 1BTHH 1MU6B 5DP7A 1FDPA 2R3YA 3SU4A 2ZDMA 2XRCA 3BEUA 2VH0A 4I8KA 2WPMS 6LPRA 4AFZA 3RLYH 1A1RA 3U8RH 3GY4A 4U30A 4FU9A 4Y7AA 2ZI2H 1NTPA 3SUGA 7LPRA 3QWCH 1IQLA 3N7DA 1GBFA 1TAWA 1MTSA 1RIWC 3GY6A 4Z1MD 2HVYB 3GDVA 1LHDH 1O32A 1SG8B 3MO6A 3GCTF 1AWFH 1O3LA 3BG4B 4Y7BA 2VIWA 1O2JA 4E06H 4SGBE 3NRLA 1COWD 1O3OA 5A2MH 4MPUA 2PFEA 3UAIC 3M36A 5FBIA 3AASA 5BRRE 2F9VA 2BLVA 1ZOMA 4LOYH 3NXPA 1BT7A 1C9PA 1OPHB 1SL3A 2OQ5A 1FI8A 2W7SA 3OU0A 1TX7A 1DOJA 1AU8A 3RP2A 4H6TA 2PWXA 5CDFE 3T28A 1BRCE 3ENSB 1MQ5A 5CMXH 1NESE 1P2OA 1A0LA 5ESBA 1WUNH 1CO7E 3RC4A 1L1GA 3P8GA 2JJ1D 1SLVB 1N6XA 2KM0A 4BAOB 1UTLM 1FAKH 1OHHD 5FPTA 1YPEH 1C1NA 2TGAA 4KKDA 1G30B 4AFQA 3UFAA 3E90B 3GICB 1QURH 1GBBA 1V2NT 3RXGA 4WJG2 2GCHG 1BIOA 1EOJA 1RRKA 2FS8A 2XTTB 4H6SB 5HM9A 1AIXH 5TJXA 4D76A 2XXLA 3S0NA 1RIWB 2BD3A 1NM6A 1ELAA 4X8TH 1OP0A 3T27A 1QNJA 3IITA 2O8MA 1ANCA 2WPJS 5F03A 1G3BA 1O2LA 1NRRH 2QXIA 3SN8A 4ACBA 2W6JD 5E2OA 1LO6A 3KCGH 2ZQ1A 1OYTH 4XDEA 1UTJA 1OXGA 4WWYA 5SGAE 3M35A 1SGDE 3A80A 1DE7H 2AMDA 1GBJA 2RA0A 2UUJB 4TT3D 1A5GH 4E05H 1SQOA 4AC9A 3RXPA 2PUXB 3VEQB 1OWKA 3QDZB 3RDZA 3LT3A 1LMWB 1L1NA 2ZIQH 3CP7A 1V2QT 2PGQB 2VU8E 3RU4T 3PROA 2IPHA 1OKXA 2G4UA 4JZFH 2GCTC 4DIIH 3H7TA 4CBNA 1Y59T 4ESTE 2FIRH 1G3CA 1EZQA 1ZR0A 8GCHF 3A7TA 1HJ9A 2CJIA 5F53A 1GPZA 1C9TA 2PKSC 3B9FH 1SVPA 2R3UA 1EAIA 2GD4B 3HGPA 4ABDA 5GPIB 5LPRA 4FUIA 3UIRA 1JBUH 1C1MA 1BA8B 4B71A 3A7WA 2FEQH 4D7FA 1QFKH 5CHBA 3K6ZA 1UK3A 5FXLA 2A45B 3RXHA 1KXBA 1MKXK 2R2WU 5AFZH 4ACAA 1TONA 1QA7A 3TJNA 1A4WH 1AHTH 1AN1E 3A88A 4JCNA 1O2RA 4ZKOU 1VR1H 5HIYA 2ANKH 1ELGA 3OFND 1MTNC 1ZGVA 4ISIH 3RLWH 2CF9H 1NROH 1N8OB 1G2MA 2A5KA 2BQ6B 3HKIB 4WH8A 1J16A 3VB5A 3PMJA 1VITH 1O3KA 1OP2A 5E0HA 3BTKE 2JH0D 5JBAS 1DXPA 3RM0H 4XE4A 1ARBA 1BCUH 1KXFA 1NU7B 2PSYA 2PR3A 3NKKA 4QT8C 1BHXB 1JOUB 2OUAA 1H8IH 5PTPA 2TGDA 2ZDKA 3GCOA 2GCHF 2AGGX 1VJ9U 2GJGA 2Q6DA 3FP8E 1O2YA 1TPPA 5EJZA 3SGQE 4D9QA 5GCHG 1GVLA 2GCTB 1OYQA 2W6ID 3OY6U 1P9UA 1GHXH 2D1JA 3F0OA 2ZC9H 2NWNA 1ZHRA 4X1SU 1V2ST 3VB3A 2WHXA 2AEIH 1ABJH 1XUIA 2BMGB 1SLWB 1Y8TA 2FLRH 1WBGB 4FUJA 2FOGA 2ZEBA 4BXWA 3SNBA 1D9IA 3GY8A 3PRBA 3ZYDA 1FN6A 1UW7A 2GZ7A 4GUXA 1AKSA 1QJ6B 4DOQA 3VB6A 2CV3A 3TH3H 4AB9A 3SYJA 1C5MD 2KFWA 3Q77A 3VXFH 2XC4A 2OXSA 4AOQA 1ESTA 2YMSC 2ZGCA 1GJCB 1VGCC 4HI3A 4CR5A 3F2HA 4ASHA 3R0FA 2ZHQH 1P2KA 1TNLA 3FKSD 1AMHA 1Y5UT 2J92A 3WWFA 3G01A 3RMOH 3AVZA 3UREA 2BVRH 3MTYA 1C4Y2 2KCOA 1O5FH 2NU1E 1MCTA 1MTNB 2Z3DA 2OCVB 1YKTA 1TQ0B 1UHBB 2XC5A 2Y7XA 2J94A 4ZH8A 1TGBA 3RXLA 3MOCA 1G3EA 1CSOE 1UVOA 4Q4LA 1TPAE 1IQJA 4Y8YA 3A84A 2FI4E 1PPZA 3MU0A 5E0JA 2ZFPH 2NU0E 2ZFQH 5AF9H 3LPRA 3ATMA 1EZXC 3K65B 4Y0YE 1TWXB 2P59A 5C2ZA 1LVYA 2FI5E 4ISNA 2D2DA 1SOZA 2Y6TA 1VJAU 3NPSA 1CHOG 2ZPSA 2F3CE 1ZJKA 1S83A 3LU9B 1GBMA 3SU6A 1ZMJA 1MUEB 4K1EA 4ZKRU 1FONA 3SJKA 3TPIZ 5HXFA 3UY9A 4KTUA 4I7YH 2J98B 1AFQC 5A0CA 3F6UH 3KQBA 1PQ7A 3N99A 1GI0A 2KCPA 1EJAA 1GI9B 1QY6A 1WAYB 1YCPH 2YMSB 2Y82A 2VINA 2FLBH 1DWDH 1PPGE 1MCVA 1BBRK 4MPWA 4OM9A 3SJ9A 2JIZD 1DS2E 2AH4X 4THNH 3GDUA 4INHA 3E0PB 1EPTB 3NWUA 2ZNKH 1QZ8A 2UWOA 5AVDA 2Z7FE 5GCHF 2H9HA 4YXWD 4CBOA 2ALPA 2EI7A 2TPIZ 3ATKA 1T7CA 3SOSA 4FUFA 3LGYA 1IHTH 2HLCA 1H9IE 5C1UA 1BMNH 2VIOA 2H9EH 4H4FA 1UTQA 1Y5BT 3Q3YA 3M3SA 2XNIA 3UB0A 2ZHEH 1LKBA 1KSNA 1AUJA 3U28C 2KCYA 2G00A 4TYDA 3SU1A 4JZIA 1TGSZ 4WXVA 1YPKH 3SQEE 5JBTA 1QBOA 4KGAA 4IMZA 5TCAA 1TMBH 2OBQA 4B6FA 4AG2A 6CHAB 3OTPA 4CHAC 1C2FA 3GOVB 3P6ZB 3AW1A 1DICA 5LGOA 1NS3A 3SV7A 2H1UA 3TGIE 2ANMH 1B0EA 3EAJA 1IQFA 1NRSH 1HJAC 4OS7A 1EXFA 1F0TA 1J9CH 2QYIA 5DN6D 1C5OH 3SO3A 1CU1A 4MNWA 1C2DA 4WF8A 4A5TS 4X2WA 5E2PA 5C67A 5ABWA 2CN0H 1TFXA 1LHFH 2HPQH 2QGRA 3F2FA 1P2JA 1SC8U 2J9NA 1FY1A 4DIHH 1GI7B 5EXLA 3URCA 3VGCC 2A4OA 2ZHFH 3A89A 1BZXE 1JRSA 3SU2A 1JRTA 1L1JA 4I32A 4AN7A 1LPKB 3M7UA 1DSUA 2ASUB 1DWEH 3URDA 4B2CA 1FY5A 2YNAA 2UUYA 3F2GA 2HOBA 4IC6A 1PQ5A 1G37A 2P93A 1GMCG 1CHOF 1TOMH 4CRAA 2IOTA 1HBTH 4BAKB 1ZTLA 2HLDD 7KMEH 2PKAB 4XBBA 2F9OA 4UFGH 1OSSA 1QB6A 5JPMH 3BTFE 2GZ8A 3MNXA 1P12E 3SORA 4DT4A 1P09A 1GDUA 2F9BH 3RMLH 1W2KH 1N1LA 1AVWA 2SFAA 1MMJN 1PYTC 1T8NA 4E7NA 3LGVA 3PO1B 3KIDU 2OTVA 3ZVGA 3I29A 3BEIB 3GCHC 4X6OA 3WW7A 1K28D 4HFPB 4MG3A 2Z9IA 4B74A 4RKJB 1FLEE 1E0FD 1GL0E 1EZUC 2ZU3A 4Y8ZA 5EU8A 1HAVA 3BN9A 4XFQA 1AE8H 5GJ4B 3LGTA 2C8YB 1OWDA 4CRGA 3MI4A 3ODFA 2Y5FA 4Z0KA 1GBAA 3SBKA 3LJJA 4YLUA 1PJPA 1QIXB 3GY2A 4M9FA 4AORA 1C2LA 1BHXF 2Q6GA 1SI5H 3PTBA 4NA8A 1C1QA 2BM2A 2C90B 2CMYA 1P06A 1BTXA 1S0RA 3U8TH 3UQOA 1V2TT 5KEDA 1QBVH 1C5RA 4HZHA 1KMHB 2CHAB 2BDBA 2VGCB 5GWZA 3EDXB 1ZPCA 2FOEA 1W3CA 1OX1A 4IW4E 1Z1JA 5JBBS 1SOTA 2C8XB 1Z8GA 2HNTC 4ZHMU 3F3BA 2P8OC 9ESTA 1THRH 3PWCA 3U69H 1H8ED 2H9TH 1K0HA 1UVTH 4GHQA 4X6PA 1UVUH 3BEFB 3D65E 4A1VA 2KX4A 8KME2 2WUCA 1Y3XA 1MKWH 1NRQH 1TPOA 2BDAA 3DFLA 3RXIA 1EQ9A 5A8YA 4AFSA 4IN1A 2EI8A 1O31A 1GGDC 7GCHG 3QGNB 3LGUA 3ZVDA 3GY7A 1NBME 1G9IE 4CR9A 1DSTA 1E38B 2EA3A 1SHHB 1C1VH 4DGJA 2CGAA 1LVOA 1FPHH 1GMCF 1OOKB 4BAHB 1O3AA 1W7GH 4F48B 4CH2B 1A5IA 2YMSD 1V6DA 2HWLB 5I46H 3PMHB 5FL7D 2ZGHA 1PFXC 3UNRA 4RT1A 4TSFD 3MNSA 4AGJA 1O2NA 1C5QA 2IN2A 2ZG0H 5F8XA 1EJNA 2UWPA 3AW0A 1TX8A 3LDXH 4MLFB 1QB1A 1QRZA 1DFPA 2Y80A 3B23B 2ZTZA 1Y3VA 4I31A 1C2MA 1GCTB 1QCPA 1SR5C 3UWIA 3ODDA 1ESAA 3GS9A 2PW8H 1P3EA 2H5DA 1XXDA 5EW1H 4DVAU 1Y3WA 1UTKA 4O03A 2J2UA 1DLKB 3PM3A 1OWHA 5HKKD 1HAZB 1KLTA 2FDAA 2WV5A 2FO9A 1IQEA 3V13A 2ZWLH 1O3FA 1O5EH 2BYAX 1XXFA 3RXAA 1IAUA 1UTMA 4I8LA 1C5WB 3TNSA 1FAXA 3KGPA 4GPGA 4NGAH 4ISLA 3SJ8A 1CVWH 3FP7E 1TMTH 1BOQA 3U8OH 2BTCE 2G55A 1O3PB 1YCPM 4CRFA 2WUBA 1ZPZA 1QL7A 4MPXA 2XCNA 2G81E 4FUHA 1SLUB 3A7VA 3H7OA 2ZPRA 1F5RA 8GCHG 1GWAA 1MBQA 3MNCA 2AGEX 1GBKA 4F55A 2A1DB 4INLA 1Z7KA 3KNXA 4X6NA 2VIQA 1W13U 1H9HE 1RTFB 2C4FH 2BXTH 3SV8A 3MH7A 4KP0A 3RXFA 2FMJA 4WMDA 1GJ6A 1LDTT 2HVXA 2QF0A 1EX3A 4D7GA 1GBDA 1MZAA 1TNHA 2QIQA 2PP6A 3MU4A 1FY8E 3OSYA 4YESB 2XW9A 1UCYH 1HAPH 1DDJA 1A0HB 1V2RT 4GAWA 1SLXB 1GL1A 3EA7A 5C3NA 2ANWA 5JB8S 2ZQ2A 3DT0H 4X1RU 1O3EA 6GCHG 7GCHF 3BIVH 1GBLA 1L4ZA 1AB9C 3OTJE 1LVMA 1GI2A 1HRTH 1T32A 1F5LA 1T8MA 1GG6C 1QQUA 1GHBG 3ITIA 1AVGH 1LHGH 2ZFTA 2AIQA 1W8BH 4O97A 4YT6H 1S85A 2P3FH 2VH6A 1V2VT 9LPRA 2JH6D 3Q3XA 1JWTA 3SJIA 1NFXA 2NU2E 2QF3A 2WPKS 2A0QB 2QE7D 4P00A 4MNXA 3ZZAA 3M3TA 4Q7ZA 1EKBB 4JK5A 2VWMA 1W12U 3EE0B 2KR7A 1NRPH 1FMGA 2PHBA 1WCZA 1O36A 1F0RA 4A7IB 1ETTH 1O2QA 5DO4H 1ZYOA 3D49H 2VIDA 1YPHE 4FU7A 4XBDA 5TCCA 1ELBA 1BRAA 1FZZA 2GT7A 3T2NA 4NFEA 1O2ZA 1NC6A 3AK5A 2ZGXH 1ELCA 4DURA 5JYIA 2IJD1 1ID5H 2BVSH 4NG9H 1DX5M 1RGQA 5C17A 1ZJDA 2ZFRH 4YOGA 3PWBA 2Z3CA 1AE5A 2BDGA 4RI0A 4LK4A 3RUOA 5HIZA 1ZLRA 2TGTA 3MH4A 2QXGA 1V2UT 1AQ7A 1TOCB 3CS7A 1AFEH 5T3HA 1XKBC 4ZKNU 4JZ1A 1HDTH 5FHTA 2KAIA 1YPGH 2GMTC 1C1SA 3RXUA 1P01A 3NZIA 4KTCA 1ELFA 2FOMB 4ZKSU 4UDWH 1C2IA 4CRBA 1TIOA 1Z8JB 2DE8A 2VVUA 3GYLB 1CT4E 2D26C 1BTZA 4XBCA 3DA9B 4Y6DA 1W0JD 1T4UH 1PYTD 1XX9A 2R0LA 4ABIA 1K1IA 3A8DA 2WV9A 1FUJA 2HNTE 5EJLA 3U9AH 4ZAEA 3FZDA 2QCYA 1HAHH 3M3VA 1AD8H 1K1NA 1XUJA 2H6MA 4VGCC 5E0GA 5GIBA 2M2AA 2VIPA 1TE0A 2JETC 2OP9A 3W95A 2EQNA 1BRBE 2F91A 1XVOA 4X1NU 1E36B 1XMNB 3RXJA 6ESTA 1IQKA 4XOJA 2P3UB 3BTDE 4K69A 3RC5A 1SPJA 6GCHF 5IK2D 1YLNA 4DT7B 2A32A 3ZVFA 2Z3EA 5EXNA 4YM9A 1GHBF 2KCAA 1L4DA 2ZU4A 3M7QA 4HGCA 2AMPA 1YY3A 5F8TA 4DW2U 1UMAH 3A86A 1UJ1A 4X0WU 2FESH 1WOFA 3TVJB 1YWUA 2RFKC 3ZIAD 1LPZB 2O9QA 2GMTB 3P70B 1IQHA 1A5HA 3UQVA 4I33A 1KYNA 5FCKA 1ELVA 2BOHB 2RG3A 2ZU5A 1QQ4A 4GCHG 3S9AA 4FU8A 2GVFA 1V2WT 1PPCE 1O34A 2Z9JA 3A8AA 2PKSB 4AX9H 1Q31A 2BY5X 2XBYA 3EE7A 3RXCA 4ZCNA 2BB4A 4YOIA 1BMMH 1O2GH 3AAUA 1P57B 1ZMLA 2K0QA 1O2XA 4O9VA 1CBWC 5A0BA 1IQIA 4VGCB 5EW2H 2FWWA 1QR3E 3UR9A 1JMOH 2V3HH 4JYUH 4KTSA 4I86A 2NU3E 1GVZA 1UVPA 2WZQA 2FX6A 1SGFG 1F7ZA 4GVUA 1S0QA 2ODYB 1HUTH 2AMQA 2VB0A 2D8WA 1G3DA 3PMBB 1LTOA 5FBEA 1QB9A 4Y0ZE 1DUEA 3UPEA 1LCYA 2JDID 3K6YA 4Y76A 1SFQB 1A61H 3GCNA 1DM4B 4K60A 4I8GA 3RC6A 5C5NA 3LGWA 2BQ7B 5AHGH 5DP4A 2BDYA 4K8YA 1CGHA 1O3CA 1V3XA 4A92A 2ZCKP 3RXQA 1K1OA 2ZDAH 5A8XA 1BQYA 1ZTKA 2A4GA 3MYWA 3HATH 1NRNH 1DT2A 4FUEA 2ZKSA 2ANYA 1V2JT 1H9LB 2BDIA 3BV9B 1K1JA 3A8BA 1DY9A 2FOAA 3MO3A 1MQ6A 1UO6A 4WXIA 3OY5U 4CRDA 1AUTC 2GDEH 1FNIA 2ZO3H 1O5AB 1O33A 4O3UA 3L3TA 3ZVAA 4P02A 1V2KT 1ELDE 3SUDA 2BD7A 2BQWB 1JXPA 2JJ2D 3RXKA 2BVXH 4O3TA 1J17T 4BAQB 3WWBA 2QXJA 1KXAA 1KY9A 3M5LA 1BITA 1K22H 3ZV9A 3A8CA 3PV5A 3TK9A 1YYY1 3EQ0H 2QN5T 1CBWB 3L33A 3L6PA 1O37A 3QX5H 1O3DA 1VGCB 3BTME 2I6QA 3F1SB 1HIAA 1GI1A 4IC5A 1MD8A 4R0IA 4AZ2B 4ABJA 2VNTA 4X8VH 3F9HA 3BG8A 1MKXH 2R0KA 4NFFA 3RXMA 1DUAA 1O3HA 2M5TA 1SGYE 1AZ8A 2R2MB 5EGMA 4GCHF 1C1PA 3UWJH 2W5EA 2ZPQA 1ZSLA 3LC5A 1KDQB 5EPYA 3SU5A 4TY6A 1GI3A 5DG6A 2GP9B 1ZZZA 1MABB 2AFQB 2FP7B 1J15A 2C8WB 1TRYA 1BTUA 2ZECA 3FN8A 4JK6A 3GY5A 2PTCE 3O8CA 3RXRA 1S6HA 2A2XH 5HMAA 4U32A 5FPYA 2C8ZB 1TNJA 2F9NA 2B0FA 4ZUHA 4H42U 4UFFH 3P95A 2Z94A 3BTGE 1AI8H 4MPVA 3SZEA 4NIXA 5LPFA 1BMFD 3S9CA 3FANA 2Y5GA 5B6LA 1TGCA 4M7GA 1S84A 3N7EA 1AFQB 2ILNA 1CT2E 2ZFFH 4D8NA 1BJVA 1EP6A 3PV2A 1Q3XA 1EP5A 1J14A 1KIGH 2F9UA 3ZZ4A 3TITA 2SGQE 5C5OA 2IJOB 2Q1JA 5T6FA 2TGPZ 4WMFA 2SNWA 1T8OA 2BOKA 1M9UA 1HNEE 5DP8A 2LNCA 2DUCA 3PV4A 5ESTE 2XWBI 2BD2A 5FX5A 1GJ5H 1O3BA 3IG6B 1MZDA 2FS9A 1GJAB 1H8DH 2BD9A 2BX4A 3T62A 4BOHA 2BY7X 2A7JA 2B8OH 3DFJA 2OLGA 4ISOA 3EA9A 4OS4A 3U1JB 1MTUA 1YF4A 3QN7A 3SJOA 4D9RA 2UUFB 1UHBA 7ESTE 2WSSD 1YP9A 1LHCH 2GDDA 3LKWA 1AZZA 1A3EH 2STBE 4BNRA 1ANEA 2J97A 1YPHC 3SQHE 1HGTH 1HAXB 1VKYA 2L6OA 3RMMH 3TJOA 1DPOA 2A5IA 4ZHLU 3T29A 1VZQH 3M7TA 3ZZBA 4CHAB 4X8SH 1AVXA 1MBMA 1SGEE 1O2PA 3OAAD 4B75A 3ZZ9A 3O8DA 2OD3B 1VCQA 3TH4H 3QTVH 1HJAB 2W3IA 5BPEA 5EQQA 1PPFE 2QAAA 4UONA 3OEED 1XKAC 3KF2A 1F92A 3KYGA 2A2QH 3TLOA 5HYOA 1QGFA 1TNIA 1TLDA 3STJA 1HXEH 2J98A 4R8TB 3PMAB 3ZVCA 4AG1A 3SV6A 2UUKB 4YO9A 1NFUA 2GGVB 3VGCB 1GJBB 3KYFA 2BXUH 1K1MA 4JZEH 3FAOA 3FP6E 3UNSA 2ZHWH 2ZU1A 1Y5AT 1BBRH 1A0JA 2QXHA 1HAOH 2FOFA 1O2UA 1IQNA 3M5OA 1NFWA 2GZ9A 1QJ1B 5AFYH 3GISB 4AYVB 1NPMA 1QHRB 1P05A 1LPGB 4YTAA 2V0BA 1BB0B 2PLXA 3A7YA 5C0UA 1C1WH 1BTWA 1SFIA 2Y81A 3KEEA 1EPTA 4LZ1H 1O5GH 1G36A 2DE9A 3ATLA 1D3QB 1C5TA 3C1KA 3BTTE 3RXEA 1HPGA 2AIPA 1MAYA 1HJ8A 2ZP0H 4GSOA 1P02A 3MQKC 2ZCHP 1W7XH 3CENA 1QRXA 1QBNA 1W0YH 4X2YA 1EFRD 4AFUA 2ODPA 3T26A 3FO8D 1XM1A 1F0SA 1C4U2 2FODA 4UD9H 4X1PU 3KN2A 3SNCA 2XBVA 3GCHB 3ZZ3A 5EODA 2Q6FA 2AYWA 2F83A 4NIYA 1EOLA 3PRDA 1ZSKA 3LIWA 5F8ZA 4MTBA 2RDEA 3QLPH 1O2TA 1HAGE 1GDNA 3ATIA 1O2HA 1C2EA 1TABE 1Z6EA 1NFYA 1FV9A 3IWMA 1BBRE 2NU4E 3N7OA 3TU7H 1FX0B 2H2ZA 2K8IA 1O2IA 1SGPE 4SGAE 1C2KA 4BANB 3AAVA 2OC1A 3OE7D 8LPRA 2BHGA 1T8LA 2ZHDA 2G51A 2QC2A 2XWAA 3MFJA 1SGQE 4ASUD 3BG4C 4XD7D 1MD7A 3D62A 3SI4H 1RXPA 1FN8A 1WTGH 2Z9LA 1AGJA 4PROA 2LPRA 4ISHH 2G8TA 1HV7A 1P8VC 2ZDVH 2P8OB 1A3BH 2G4TA 5T6GA 4CREA 4U01A 3NK8A 3RXOA 1D3TB 1N6YA 1DY8A 3DSPA 3VFEA 1CA0C 1C5ZB 3EYDA 1NT1A 5FX6A 3ZVEA 4IBLH 1HCGA 1W11U 1BJUA 2PKAA 3QGJA 1UK4A 4LZ4B 3RXBA 2A5AA 1QRWA 1SGRE 3VG8A 1NU9A 3ZZCA 1LKAA 2SGEE 3P17H 3RU4D 3V3MA 1DXWA 1B0FA 1V2PT 5A8ZA 2BLOA 4J2YB 2P3TB 1S6LA 2ZTYA 3BIUH 1EAWA 5C20A 1GGDB 2FM2A 2VBCA 4ZXXH 5EJ1A 4IMQA 1L2EA 2CF8H 5L30H 1DANH 3ZZDA 1C5YB 2R9PA 3P8OA 1GCDA 1SQRA 1UTPA 1WQSA 4UFDH 1BDAA 5DP3A 3UTUH 4B76A 4BTTB 2ZZUH 1D6WA 4B1TA 2FTMA 2ODQA 4WH6A 5GXPA 5EQRA 1ORFA 2OC7A 1O2VA 3RMNH 1NZQH 1SBWA 3SZNA 1OS8A 1FIZA 2TRMA 2P95A 1D3DB 2PV9B 1ZRKA 2O8LA 2ZF0H 3MU8A 3BF6H 1P9SA 4Q63A 3UOPA 4Y10E 5DP6A 1GBCA 1A46H 4ABFA 2VJ1A 5K7RA 2SGFE 1LHEH 3MU5A 1WV7H 1E79D 5ETXA 1V2OT 1ZRBA 1K21H 3H5CB 2VVVA 3GY3A 4B2AA 3MMGA 2XYAA 3VB7A 2EC9H 2K1QA 1QL9A 2CK3D 4B2BA 3A87A 1C1UH 1C2GA 5A09A 1Y3UA 2YOLA 1JIMA 1XUKA 1UVSH 3F9GA 1GBEA 4B73A
chains in the Genus database with same CATH topology
1XUHA 2RDLA 1CA0B 5JB9S 5A0AE 1OWIA 1NO9H 2Y5HA 3M61U 5E8EH 2EI6A 1KLIH 3ZZ8A 1WQVH 3E91A 2V35A 4RKOB 2GTBA 2BLQA 1QTFA 1O0DH 1O2MA 4X2XA 1DVAH 3LH1A 4K8BA 1P2IA 1VCPA 1AKSB 1P11E 4WMEA 3MO9A 4ABAA 3QK1A 1HLTH 1YPLH 3V0XA 4AGKA 3MH5A 2A31A 3KQDA 1LQDB 4MVNA 1WYKA 2B9LA 1H1BA 2WV4A 1UCYE 4X8UH 1NY22 1RFNA 3C27B 1Z71A 3E16B 1YC0A 3S7HB 1O39A 4K3JA 3O8BA 1TBZH 1C2JA 1C5SA 3LGIA 1C5UA 1FIWA 1TBRH 2ZCLP 3SGAE 2BZ6H 4JYVH 1O5CB 3F68H 1YM0A 1ABIH 2FTLE 1DWCH 2PUQH 1BRUP 4TWYA 1N8OC 1O35A 1WU1A 2GKVE 3SHAH 1GJ8B 1AB9B 5DJ7A 1ACBE 4K1TA 1THSH 2ZA5A 1GG6B 4F49A 2VIVA 1EAXA 2FZZA 3QO6A 5I25A 1K9OE 5L2ZH 2V6NA 1BTYA 4YLQH 5JDUB 1DITH 2J38A 1P0SH 3UR6A 1O3IA 2FYRA 1X7AC 4MQAA 4ZHAA 3KL6A 1AY6H 1V2LT 4IGDA 1O3NA 1TX6A 2SGDE 3A83A 3HK6B 5F6MA 3KHVA 4UFEH 2ZFSA 3E1XB 2J95A 1CE5A 3O8RA 4NA7A 2XCFA 1IQGA 1GI8B 3PB1E 1FY4A 2HPPH 4YZUA 2EEKA 3SGBE 1YCPK 4OS5A 8ESTE 1ZHPA 1ETSH 1HIAB 4Y71A 2BLWA 4HTCH 2BD4A 1W14U 5FAHA 2FX4A 3HPTB 3RXTA 3SI3H 2OC0A 1GHAG 3P8FA 4KELA 2H5CA 3MU1A 1THPB 1EB1H 4NZLA 5B6OA 1O2SA 2WINI 3M5NA 1E37B 2A4RA 3P92A 2HGTH 2SNVA 1ELTA 5CHAC 3VXEH 4K5ZA 3NUMA 4Y8XA 4NSYA 3GYMA 3FFGA 2OINA 1SMFE 1OWEA 3SU0A 3QUMP 5G4BA 4DJZB 5LH8A 4JYTA 1YGCH 1D4PB 1FY3A 1FJSA 3Q76A 2ZGJA 3DD2H 4JZDH 2GV6A 1ZSJA 4J1YA 4CH8B 3S9BA 4ZMAH 2Z9GA 1ZPBA 4NWLA 4YT7H 5L6NH 2QV1A 3SV2H 1VITG 2V3OH 3SNDA 1S81A 2FOHA 2AGIX 3KQEA 1TGNA 2JKHA 3SW2B 1D3PB 1O5DH 5C1XA 4UEHH 1KXCA 1P3CA 2F9PA 1TNGA 4NZQA 2RCEA 1EJMA 1SGTA 3ZVBA 2JETB 4X6MA 1BMLA 3A81A 2JH5D 1C2HA 4DG4A 1TA2A 5C1YA 4FUGA 4K1SA 4LXBH 4K2YA 2A4QA 1CGIE 2HNTF 1SGNE 4TWWA 2BD8A 2BD5A 3FZZA 4ZROA 1H4WA 3ZV8A 1EUFA 5DP5A 1SQTA 2Y7ZA 3E0NB 5EPNA 1SGFA 1UK2A 2A7HA 2VWNA 2C93B 2Z6BD 1GI4A 4X2VA 4FUBA 1YLCA 2XBWA 1K2I1 1UTOA 2C3SA 4FVBA 5J4QA 1ANDA 5CE1A 3DHKH 1P2NA 3SUFA 3A7XA 4ABGA 5JBCS 3ZZ5A 2UWLA 3BSQA 5CHAB 1EPTC 3TK5A 3SUEA 3Q00A 1CT0E 4I8JA 1GMHG 1GJ7B 2TIOA 1KXEA 1G32B 5H4IB 3RXSA 4ABHA 5DGJA 1KTSB 1YPJH 1RTKA 4GHTA 4Q7XA 3K9XB 2OQUA 1EB2A 5L2YH 5FCRA 1CHGA 5EG4A 1GMDG 2WPIS 3EGKH 4BXSA 1U6QA 1TALA 2B5TB 1GHAF 5IDKA 2FOCA 1TGTA 3TNTA 1HAVB 3GDSA 4AYYB 4BTUB 3W94A 6CHAC 4E7RG 1DLEA 2ZGBH 3VPKA 3T25A 3NCLA 3DUXH 2SGPE 1MTWA 2I6SA 3TJVA 3SNAA 4AB8A 1ESBA 1TB6H 1L0ZA 3UNQA 3U1IB 2STAE 2PGBB 1HAIH 3TJUA 2O8UA 1GHWH 1MAXA 1F0UA 3SU3A 1TPSA 1ELEE 4Y79A 2YNBA 1AWHB 2VWOA 5EOKA 1LQEA 1P2QA 1VITF 1O3MA 1SQAA 2FOBA 3QZRA 3B8JA 2XBXA 3E3TA 4Q80A 2PSXA 1C1RA 1TNKA 1T31A 1RJXB 1O2OA 3ELAH 1TBQH 1TA6A 2GT8A 4JMYA 1ZGIA 1C5LH 1TQ7B 1SB1H 3ESTA 1KXDA 1PQAA 3D23A 3EA8A 3S69A 1RS0A 2ESTE 1J8AA 3HK3B 3V7TA 5LPEA 1Z1IA 5HGGA 1B5GH 2P94A 1O3JA 1HB0B 3RXDA 1S6FA 1KTTB 3LOXA 1MKWK 3U98H 2QA9E 1QJ7B 3A82A 4IN2A 1HXFH 3BTQE 2AERH 5FPSA 3MH6A 4NA9H 1C4V2 3I78A 1UTNA 1P04A 2GV7A 1YPMH 1C1OA 1GHYH 1HAYB 4UE7H 4DCDA 1O2KA 3PO1C 4Q7YA 1MH0A 1SHYA 2BY9X 5DKMA 2CXVA 4INKA 1IQMA 1FXYA 1T4VH 3SHCH 3F9EA 3KQCA 4A1TA 3FVFB 1CGJE 1W0ZU 1G2LA 1KLJH 1Q2WA 3V12A 3STIA 4BAMB 2QY0B 1F5KU 2BX3A 4U2WA 4DY7B 3CS0A 1GMHF 1MU8B 2W3KA 1K1PA 1EAUA 2G52A 3BTHE 3E8LA 3RXVA 3RM2H 1BTPA 4IS5A 5EXMA 4FXGH 5DP9A 2FYQA 3PLPA 1O5BB 3LJOA 4NIVA 4GLYA 1GBTA 1C5VA 4FUDA 3OX7U 2G5NA 1P2MA 1K1LA 2THFB 1JIRA 1RD3B 3TK6A 4CRCA 1CA8B 1C5PA 1GJDB 3I77A 2VWLA 1GBIA 1Z6JH 1O2WA 1GMDF 1PPHE 1B7XB 1EZSC 4ZXYH 4RSPA 5K0HA 2CHAC 1HFDA 2VGCC 3UOUA 2ZDNA 4MDSA 1ETRH 3MWIU 1CQQA 1C1TA 1PPBH 1OP8A 2BY6X 1BMAA 1SSXA 3K2UA 3BTWE 1GJ9B 5DK1A 1GI5A 4RN6A 3PLBA 1ZMNA 2OBOA 2WPLS 4NIWA 2WYJA 3ZZ7A 1TMUH 1D6RA 2FI3E 1E35B 2ZU2A 3BTEE 1XVMA 3TGKE 3A7ZA 1GI6A 1YLDA 4WVPE 1V2MT 1O30A 4BTIB 1MTVA 1TYNA 1IOEA 3PTNA 1E34B 4MNVA 3JZ2B 1ANBA 1A7SA 2ZTXA 5DPAA 1S82A 4A6LA 5EQSA 4WY3A 2SGAA 3JZ1B 1GJ4H 1TRMA 2GX4A 1GBHA 5HM2A 1FQ3A 1C5XB 4Z6AH 2ULLA 3PLKA 2B7DH 3M37A 1IHSH 3WY8A 1S5SA 3TGJE 1O38A 1WSSH 1Y3YA 2P16A 1UCYK 2Z9KA 1Z8IB 3LH3A 4YOJA 1SGIB 3QZQA 4OGYA 1SGCA 1GCTC 2G5VA 2VVCA 3ATWA 4ABEA 3LC3A 1XUGA 2HALA 1HYLA 1KDQA 1PQ8A 3GCTG 3ZYEA 2BDCA 2RA3A 4NWKA 3QTOH 1RTLA 4TY7A 1EASA 3HGNA 4I8HA 3OYPA 2A7CA 2ALVA 2BY8X 2BDHA 1VCWA 3SNEA 2J34A 2W26A 3ZZ6A 2O8WA 4TPYA 1WTHD 2PTNA 2FPZA 2O8TA 1W10U 4FUCA 1P10A 2AS9A 1F2SE 5J4SA 4MNYA 4ABBA 4A1XA 1BUIA 3F9FA 2W7UA 1DWBH 1C5NH 3M5MA 3MNBA 1O3GA 3TH2H 3MHWU 5T6DA 3Q3KA 4Q2KA 4XSKU 2XC0A 1FPCH 3E6PH 3T5FH 2BZAA 1LVBA 1GVKB 1XUFA 1AO5A 3UUZA 1QL8A 4OGXA 3PYHA 2WPHS 3VB4A 2HRVA 3TIUA 3SV9A 4OS1A 3RU4E 4Y11E 2ZDLA 3LONA 1GHZA 1ARCA 3A85A 1PPEE 2KAIB 1A2CH 1INCA 1EATA 1GHVH 2WYGA 2FXRA 1YBWA 5IYTA 1OWJA 4F4OC 4OS2A 1Z8RA 3R3GB 4FVDA 1ZTJA 4NSVA 4TPIZ 4OS6A 5GDSH 3HKJB 2OC8A 1P03A 4X1QU 1NN6A 2J4IA 1GDQA 1ZHMA 3P8NA 3S7KB 2TBSA 4NCYA 1TRNA 1QA0A 1BTHH 1MU6B 5DP7A 1FDPA 2R3YA 3SU4A 2ZDMA 2XRCA 3BEUA 2VH0A 4I8KA 2WPMS 6LPRA 4AFZA 3RLYH 1A1RA 3U8RH 3GY4A 4U30A 4FU9A 4Y7AA 2ZI2H 1NTPA 3SUGA 7LPRA 3QWCH 1IQLA 1GBFA 1TAWA 1MTSA 1RIWC 3GY6A 3GDVA 1LHDH 1O32A 1SG8B 3MO6A 3GCTF 1AWFH 1O3LA 3BG4B 4Y7BA 2VIWA 1O2JA 4E06H 4SGBE 1O3OA 5A2MH 4MPUA 2PFEA 3M36A 5FBIA 3AASA 5BRRE 2F9VA 2BLVA 1ZOMA 4LOYH 3NXPA 1BT7A 1C9PA 1OPHB 1SL3A 2OQ5A 1FI8A 2W7SA 3OU0A 1TX7A 1DOJA 1AU8A 3RP2A 4H6TA 2PWXA 3T28A 1BRCE 3ENSB 1MQ5A 5CMXH 1NESE 1P2OA 1A0LA 5ESBA 1WUNH 1CO7E 3RC4A 1L1GA 3P8GA 1SLVB 1N6XA 4BAOB 1UTLM 1FAKH 5FPTA 1YPEH 1C1NA 2TGAA 4KKDA 1G30B 4AFQA 3UFAA 3E90B 3GICB 1QURH 1GBBA 1V2NT 3RXGA 4WJG2 2GCHG 1BIOA 1EOJA 1RRKA 2FS8A 2XTTB 4H6SB 5HM9A 1AIXH 5TJXA 4D76A 2XXLA 3S0NA 1RIWB 2BD3A 1NM6A 1ELAA 4X8TH 1OP0A 3T27A 1QNJA 3IITA 2O8MA 1ANCA 2WPJS 5F03A 1G3BA 1O2LA 1NRRH 2QXIA 3SN8A 5E2OA 1LO6A 3KCGH 2ZQ1A 1OYTH 4XDEA 1UTJA 1OXGA 4WWYA 5SGAE 3M35A 1SGDE 3A80A 1DE7H 2AMDA 1GBJA 2RA0A 2UUJB 1A5GH 4E05H 1SQOA 3RXPA 2PUXB 3VEQB 1OWKA 3QDZB 3RDZA 3LT3A 1LMWB 1L1NA 2ZIQH 3CP7A 1V2QT 2PGQB 2VU8E 3RU4T 3PROA 2IPHA 1OKXA 2G4UA 4JZFH 2GCTC 4DIIH 3H7TA 4CBNA 1Y59T 4ESTE 2FIRH 1G3CA 1EZQA 1ZR0A 8GCHF 3A7TA 1HJ9A 2CJIA 1GPZA 1C9TA 2PKSC 3B9FH 1SVPA 2R3UA 1EAIA 2GD4B 3HGPA 4ABDA 5GPIB 5LPRA 4FUIA 3UIRA 1JBUH 1C1MA 1BA8B 4B71A 3A7WA 2FEQH 4D7FA 1QFKH 3K6ZA 1UK3A 5FXLA 2A45B 3RXHA 1KXBA 1MKXK 2R2WU 5AFZH 1TONA 1QA7A 3TJNA 1A4WH 1AHTH 1AN1E 3A88A 4JCNA 1O2RA 4ZKOU 1VR1H 2ANKH 1ELGA 1MTNC 1ZGVA 4ISIH 3RLWH 2CF9H 1NROH 1N8OB 1G2MA 2A5KA 2BQ6B 3HKIB 4WH8A 1J16A 3VB5A 3PMJA 1VITH 1O3KA 1OP2A 5E0HA 3BTKE 2JH0D 5JBAS 1DXPA 3RM0H 4XE4A 1ARBA 1BCUH 1KXFA 1NU7B 2PSYA 2PR3A 3NKKA 4QT8C 1BHXB 1JOUB 2OUAA 1H8IH 5PTPA 2TGDA 2ZDKA 3GCOA 2GCHF 2AGGX 1VJ9U 2Q6DA 3FP8E 1O2YA 1TPPA 3SGQE 4D9QA 5GCHG 1GVLA 2GCTB 1OYQA 3OY6U 1P9UA 1GHXH 2D1JA 2ZC9H 2NWNA 1ZHRA 4X1SU 1V2ST 3VB3A 2AEIH 1ABJH 1XUIA 2BMGB 1SLWB 1Y8TA 2FLRH 1WBGB 4FUJA 2FOGA 2ZEBA 4BXWA 3SNBA 1D9IA 3GY8A 3ZYDA 1FN6A 2GZ7A 4GUXA 1AKSA 1QJ6B 4DOQA 3VB6A 2CV3A 3TH3H 4AB9A 1C5MD 3Q77A 3VXFH 2XC4A 2OXSA 4AOQA 1ESTA 2ZGCA 1GJCB 1VGCC 4HI3A 4CR5A 4ASHA 3R0FA 2ZHQH 1P2KA 1TNLA 1AMHA 1Y5UT 2J92A 3G01A 3RMOH 3AVZA 3UREA 2BVRH 3MTYA 1C4Y2 1O5FH 2NU1E 1MCTA 1MTNB 2Z3DA 2OCVB 1YKTA 1TQ0B 1UHBB 2XC5A 2Y7XA 2J94A 4ZH8A 1TGBA 3RXLA 3MOCA 1G3EA 1CSOE 1UVOA 1TPAE 1IQJA 4Y8YA 3A84A 2FI4E 1PPZA 3MU0A 5E0JA 2ZFPH 2NU0E 2ZFQH 5AF9H 3LPRA 3ATMA 1EZXC 3K65B 4Y0YE 1TWXB 2P59A 5C2ZA 1LVYA 2FI5E 4ISNA 2D2DA 1SOZA 2Y6TA 1VJAU 3NPSA 1CHOG 2ZPSA 2F3CE 1ZJKA 1S83A 3LU9B 1GBMA 3SU6A 1ZMJA 1MUEB 4K1EA 4ZKRU 1FONA 3SJKA 3TPIZ 5HXFA 3UY9A 4KTUA 4I7YH 1AFQC 5A0CA 3F6UH 3KQBA 1PQ7A 1GI0A 1EJAA 1GI9B 1QY6A 1WAYB 1YCPH 2Y82A 2VINA 2FLBH 1DWDH 1PPGE 1MCVA 1BBRK 4MPWA 3SJ9A 1DS2E 2AH4X 4THNH 3GDUA 4INHA 3E0PB 1EPTB 3NWUA 2ZNKH 2UWOA 5AVDA 2Z7FE 5GCHF 2H9HA 4CBOA 2ALPA 2EI7A 2TPIZ 3ATKA 1T7CA 3SOSA 4FUFA 3LGYA 1IHTH 2HLCA 1H9IE 5C1UA 1BMNH 2VIOA 2H9EH 4H4FA 1UTQA 1Y5BT 3Q3YA 3M3SA 2XNIA 2ZHEH 1LKBA 1KSNA 1AUJA 2G00A 4TYDA 3SU1A 4JZIA 1TGSZ 4WXVA 1YPKH 3SQEE 5JBTA 1QBOA 4KGAA 4IMZA 5TCAA 1TMBH 2OBQA 4AG2A 6CHAB 4CHAC 1C2FA 3GOVB 3P6ZB 3AW1A 1DICA 5LGOA 1NS3A 3SV7A 2H1UA 3TGIE 2ANMH 1B0EA 3EAJA 1IQFA 1NRSH 1HJAC