1GJ9B

Engineering inhibitors highly selective for the s1 sites of ser190 trypsin-like serine protease drug targets
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEASTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering inhibitors highly selective for the S1 sites of Ser190 trypsin-like serine protease drug targets.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting, hydrolase
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
total genus 51
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2001-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gj9B02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gj9B01
3ZZ6A 4AORA 3QTVH 3UWIA 3RXQA 3ZVBA 1FPCH 1PQ8A 3TGJE 1ANEA 2QXHA 1ZJDA 2GDEH 1TGNA 2HVXA 3ESTA 2ZFTA 1N8OC 1SGQE 1CHOF 4XSKU 1VJAU 1E34B 1C1WH 1P05A 2BY5X 5GIBA 5AFZH 4IMQA 3LJOA 4NGAH 1C5YB 2WV5A 1P12E 1DWBH 3A89A 4OS6A 1QJ6B 1BTHH 1S5SA 3RLWH 1C1UH 1FY3A 1QGFA 1ELTA 3OTJE 1PPZA 1V6DA 3MU5A 4BXSA 1OWHA 2BLWA 1AB9C 1NRNH 2JETB 2ALVA 3ODFA 3RXCA 5J4QA 2ZDMA 1A7SA 5EW2H 3D23A 2Z9JA 3T28A 1RIWB 1V2PT 3L33A 4WMFA 1KLTA 1P9SA 1K21H 4ISIH 1SOTA 3TK6A 3MMGA 4YLQH 3P8NA 5DKMA 1QIXB 2OC8A 1NPMA 1EB1H 1BTZA 2AGGX 2FODA 3D62A 1JBUH 1V2MT 5CE1A 2HLCA 1BTXA 3BN9A 1VITG 1RS0A 1QJ7B 5BPEA 2CMYA 1LHEH 3N7OA 4YOJA 2P93A 2VB0A 5J4SA 3GY2A 3MU4A 3CENA 2AFQB 1CA0C 3E90B 3VXFH 4ZROA 3ENSB 2GT7A 3CP7A 4U32A 3W94A 1HAZB 1CGIE 1TQ7B 4TWYA 1GI8B 1IQIA 1IQLA 2OC7A 1DXWA 1A5IA 1P04A 1KTSB 1TBQH 1EUFA 3TU7H 1IQEA 2ZTZA 3GY4A 1QFKH 1GHWH 3MO9A 2ZHWH 4I31A 1DWEH 1Q3XA 4Y10E 5L30H 1OX1A 2V3OH 1A46H 2FX6A 3Q77A 1C2JA 1NC6A 1QBVH 2SGEE 4ZUHA 2FPZA 1XMNB 2VH0A 1GJDB 4K69A 3TJNA 3ZZ9A 1HYLA 4BAKB 3EDXB 5SGAE 1AN1E 4ZKNU 1HJ8A 1WUNH 2A4QA 2A2QH 1NRQH 1SGEE 1VCPA 1OWIA 2G51A 3M61U 1P01A 1P9UA 1FDPA 5DG6A 3RC6A 3TH4H 2PKSC 4BTTB 2FYRA 3RM2H 1O3HA 1BRAA 1XUKA 3HPTB 4KP0A 1GVLA 1UCYH 5E0GA 3SNAA 1NY22 4OGYA 1S0QA 3VFEA 4DJZB 2JH6D 1LVMA 1C1QA 1S82A 2AERH 2NU1E 2OCVB 1BBRK 1Y5BT 1WU1A 1A0JA 2W7SA 1A4WH 1CSOE 1AHTH 3GYLB 4JZEH 3M7UA 5EU8A 1QY6A 1W10U 4E7NA 3KEEA 2QN5T 2ASUB 4D9RA 2G4UA 1BTPA 4BAOB 4HGCA 4B2CA 1JIRA 2AYWA 1HAVA 2EI7A 3LC3A 1IAUA 4GLYA 4AG2A 3BTKE 1V2KT 1AB9B 1IQHA 4WH8A 1CHOG 3HK3B 1SGNE 3A7XA 2GCTB 5F8ZA 2AGEX 4ABIA 3SO3A 7LPRA 1NTPA 1O3PB 1DY9A 2BVRH 1RTFB 7GCHG 3TGKE 2F9PA 4A1TA 3GCHC 2GDDA 1YC0A 4NSYA 1DPOA 4X6MA 1V2NT 3OSYA 1BMMH 1O5CB 1SLXB 2C8ZB 2HNTF 5HXFA 1WAYB 4YESB 1SFIA 1EOLA 2B5TB 1V2LT 4OS1A 3KQDA 3U1JB 5C1UA 1G36A 1SHYA 1BBRH 3GY5A 4GPGA 1QCPA 3BTFE 1O5DH 3PMAB 1YCPM 1AI8H 1DOJA 1WOFA 2A7JA 4WH6A 3SUGA 3TIUA 4I8HA 3Q76A 3KIDU 2ZTXA 1K28D 3PMHB 4OGXA 2TIOA 3LGTA 3SU3A 1QBOA 2VIWA 2VIOA 5FX6A 2AIPA 1T4UH 3HGPA 1G32B 2P8OC 5JPMH 2BQ7B 1TRYA 3FVFB 3M5NA 3A84A 3RMLH 2BY7X 5T6DA 4UD9H 2FTLE 1XUHA 2O8WA 1A3EH 1XUGA 1FI8A 1HXEH 1FMGA 1TNJA 4K1TA 3SV6A 1ZJKA 4H6SB 3KQBA 3HKIB 1YGCH 1Y8TA 1TWXB 1TPPA 1SR5C 2YOLA 4K60A 3H7TA 1GBTA 1YPLH 1HGTH 1AVGH 2GZ9A 3MWIU 1CO7E 3A8DA 1DS2E 1GBAA 1GDNA 1TFXA 2ZDVH 3LOXA 1RIWC 1TMUH 1ZMLA 3LH1A 1BA8B 1ETSH 2KAIA 5GCHF 3ATLA 1T8MA 2BHGA 2FOMB 4CH2B 1OPHB 3RXIA 1AIXH 2FLRH 1XX9A 4KTUA 4B1TA 2YNBA 4F49A 3ZVCA 2XWBI 1O2GH 2G52A 1C1OA 5AHGH 1NU7B 1EX3A 3EYDA 5LH8A 2SGFE 5L6NH 5L2YH 3F9HA 4AFQA 1Y3VA 3RDZA 4YT7H 1Y3WA 1DSTA 2ZDNA 1CT0E 2I6QA 2A31A 3A7YA 2PLXA 2FO9A 1JWTA 1XVMA 4B2BA 4I33A 1S0RA 2A45B 5DP5A 2PKAA 4Q80A 2FOFA 1DFPA 1K1PA 1YYY1 1V3XA 4INKA 4TYDA 3D49H 3T26A 2F9OA 1F92A 2ZFQH 4MPUA 1IQJA 1UJ1A 4GAWA 1TA2A 2FOCA 3VGCC 1AWFH 3GY7A 3LU9B 3ZZDA 6ESTA 3RMMH 1HBTH 1KDQB 1Y5UT 1C9PA 1O2TA 8ESTE 2TGAA 1P09A 4I8JA 3EGKH 1EPTA 1GGDB 3P8OA 1O32A 2GCTC 1HPGA 1HV7A 2A7HA 1GI4A 3ZZ7A 1JMOH 1KIGH 3NXPA 4CRFA 1BMNH 4FUIA 1C2MA 1HCGA 1W7GH 3M37A 1OOKB 1MMJN 4MPXA 3MNBA 2J4IA 3TH3H 3K6ZA 4K8BA 3UQVA 3FZDA 1EJNA 5K7RA 3M3SA 2BY8X 2OXSA 1P06A 1EAXA 4Y76A 3RP2A 3SU4A 3O8RA 1P2JA 1KSNA 3QTOH 3ZYDA 4A92A 1QR3E 1UK4A 1KTTB 2OLGA 1KLIH 5GJ4B 4WF8A 3RU4E 4IW4E 3KHVA 5A8ZA 3TITA 1MBMA 1NFUA 2WUBA 1KYNA 1O36A 2FZZA 2BLVA 1CA0B 3RC5A 1BJVA 4AYYB 1RFNA 2ANMH 1IQMA 4JZDH 2WUCA 1GMDF 2FOGA 2A32A 4WWYA 2TPIZ 1P02A 1ZOMA 1Z71A 1Z8RA 4ABBA 1O5BB 1FLEE 2WYJA 1BTYA 1LVBA 1W7XH 1O3MA 1QB9A 4Y0ZE 3SV8A 1UVPA 2AEIH 3MNCA 4Z6AH 1ELFA 1AE5A 1TNGA 2TGDA 3BG8A 1QL8A 2Y7XA 4MDSA 1C1MA 3RMNH 2PUXB 1C2KA 2O8MA 3SUFA 1WTHD 1C5RA 1C5WB 3FP7E 2BLOA 5C3NA 3BIUH 2P8OB 2A7CA 2GMTC 1AD8H 3OX7U 3I78A 1Y59T 1DE7H 1K1JA 5A09A 1V2OT 1GJBB 1AKSA 1N6XA 1GMCG 1O2YA 3R0FA 1G2LA 4J2YB 5EG4A 3SUEA 2BD3A 4X6OA 1SBWA 2BD2A 4AFZA 2IN2A 2H6MA 3A7VA 4FUBA 3QK1A 1P3EA 1D3QB 1GHAG 4LXBH 1GI5A 1DT2A 2H9HA 4DURA 4AX9H 1YLCA 5JB9S 1HAHH 2PKSB 3QZRA 2TGTA 5FBIA 1NZQH 1O5EH 2VIVA 1SLUB 1OS8A 2Z9LA 4X1QU 2FYQA 1RRKA 2SGPE 5EPYA 1GBLA 1AO5A 1O2JA 2ZGXH 4U01A 1FONA 4LZ1H 3E6PH 3A85A 3SJKA 3LDXH 2VVCA 2XC0A 1NS3A 4FU9A 1P2NA 2CGAA 1WSSH 1O2OA 1SLWB 3GCTG 4K3JA 1SOZA 1GHBF 3H5CB 1Z6JH 1C1SA 3O8DA 4Q7YA 1FY1A 6GCHF 8GCHF 2ZGHA 1UTMA 2WPMS 1ID5H 3V7TA 4ZKOU 5LGOA 2UUFB 1GMHG 2FS9A 2UWOA 3IWMA 1A3BH 2FIRH 2R0LA 1TMTH 5LPEA 5IDKA 1WBGB 5FHTA 1FN6A 3BTEE 2GT8A 1C5VA 1Z7KA 1P03A 3A83A 3E3TA 3F1SB 3EE0B 4UEHH 2I6SA 4CBOA 1GJ8B 1ZTJA 3LPRA 3UUZA 4U30A 2ZC9H 4OS5A 1P3CA 1AE8H 1GG6C 3P70B 3KF2A 1TGSZ 3SQEE 5CMXH 1EZXC 1EASA 4HFPB 3OU0A 1MTWA 3V0XA 2Z9IA 1S84A 4XDEA 3VXEH 2J2UA 2ANYA 2NU4E 1HXFH 4ISHH 1TPSA 1NU9A 4IGDA 4K1SA 4ZH8A 4D76A 1LKBA 3K2UA 1W8BH 2OD3B 1ETRH 1EAIA 1GBMA 2Z6BD 2BZAA 2QYIA 3SNDA 2HGTH 2A5AA 3RXLA 1GI0A 1PPEE 2PGQB 2VGCC 4HZHA 2FLBH 1C1NA 4Q7ZA 4TY6A 2CN0H 4H42U 1DXPA 1PPCE 1C5XB 3GY8A 2Q6DA 1O3DA 3EAJA 5EXMA 3RXPA 1KXFA 1NFXA 1CU1A 1T8NA 3GICB 4D8NA 1YPEH 2BYAX 4WMDA 2Q6GA 1UTLM 1UVTH 2CXVA 3VB5A 2R3YA 2ZCHP 1O2PA 4IC5A 3Q3XA 2B8OH 1MH0A 1GJ7B 2J92A 2XBVA 1G37A 1OYTH 3LT3A 3PO1B 1W2KH 1ELGA 4QT8C 2ZFRH 3PROA 1A2CH 3SBKA 3STJA 1ZSKA 1BMAA 2FX4A 3DD2H 3E0NB 1F7ZA 2ODPA 2HRVA 9ESTA 1DICA 4NWLA 1OWJA 1LHFH 3ZV9A 2ZU1A 2AMPA 4IC6A 1DUAA 2BD8A 1IQFA 1TE0A 2TRMA 3B9FH 3OY6U 2BMGB 5HYOA 1LQDB 1EPTC 2Z9GA 3ZZ8A 2EC9H 1NRRH 3GCTF 1TA6A 1TQ0B 3M3TA 1TMBH 3M7TA 2H5DA 4D7GA 3QO6A 4OS4A 4MNWA 4UE7H 1GL1A 4M7GA 2BXTH 1ZGIA 1BDAA 1SFQB 3STIA 1F2SE 5AVDA 2XCFA 3ZVDA 2D26C 1YKTA 1QL9A 2F91A 3PYHA 1MZAA 3KN2A 1GBCA 1ARBA 3E0PB 2W7UA 5FCRA 1ACBE 3RUOA 1AVWA 2BQWB 3E16B 3RXSA 1NN6A 1EZSC 1KDQA 2F83A 1MTNB 4ABAA 3BEUA 3K65B 2C3SA 1ANDA 3AW1A 1Y5AT 1SC8U 1ZRBA 1BRCE 4KTSA 1GMDG 1LHGH 4DIHH 1SQAA 1ZSJA 1ZHMA 1ANCA 5DP7A 3O8BA 2OQ5A 2H2ZA 3GOVB 4X2YA 1LTOA 4I8LA 1E37B 5DK1A 3PWCA 1OYQA 1ZPZA 1TX8A 4ZXXH 3TNTA 4GVUA 1N8OB 3FAOA 2VU8E 5A8YA 3PV4A 2P59A 2QAAA 1SLVB 4JCNA 1EAWA 4I32A 1O2KA 3G01A 1DX5M 4B71A 2ZNKH 2ZA5A 2VNTA 2BD9A 1C2LA 2W5EA 3U8RH 3RXHA 1PYTD 1C1RA 1H9IE 2VJ1A 3PLPA 3SU0A 1W0ZU 4OS7A 3SHAH 2JKHA 2ESTE 1J17T 2GKVE 1C5QA 1BT7A 1QTFA 4TPYA 1G9IE 1GL0E 1UO6A 1FN8A 3EA7A 1AFQC 3U98H 2FTMA 4XOJA 1W3CA 1F5LA 1SGFA 1E0FD 1N6YA 4AYVB 4YTAA 1DWDH 3M7QA 2CF9H 4TWWA 3U69H 3F9FA 1B0EA 3SI3H 3ZZAA 1O39A 3BEIB 3GDUA 1IHSH 3A7ZA 4K1EA 1ABIH 2GD4B 4I7YH 3P8GA 3SI4H 4CREA 1K1NA 2G00A 4Y11E 3VEQB 1IHTH 5DO4H 3M5MA 1O0DH 3VB4A 2GP9B 2CF8H 1O3OA 2A5IA 1GHAF 4NIWA 1F0UA 4FVDA 1MTSA 1AQ7A 3QGNB 4WY3A 6GCHG 6LPRA 1BTWA 3F9GA 3LC5A 4NA7A 1H1BA 1O3IA 2ZKSA 1K1OA 1MCTA 1F0TA 2D2DA 3A8CA 4AB8A 1CBWB 1ZLRA 1O2WA 4Y0YE 3LGUA 3W95A 2C8WB 3BTGE 1K1MA 2PR3A 1DVAH 3SU2A 1JXPA 5A0AE 1FY8E 1ZGVA 3SHCH 3SNCA 1G3CA 1WQSA 1Y3YA 2B0FA 4WXIA 1DY8A 3BTHE 2XWAA 4X1NU 4CH8B 3T29A 5EPNA 1O2XA 1SMFE 1XXDA 3S9CA 1ESAA 2XYAA 2ZDAH 2VVUA 3PTBA 2FI3E 3SU6A 2TBSA 1J14A 1MD7A 1MUEB 2RDLA 5FX5A 1YPGH 1L1JA 4X0WU 1A1RA 4MVNA 1TBZH 3PTNA 4FUGA 3U9AH 2NU2E 3I77A 3LKWA 2DE9A 4X8VH 2CHAC 4X1SU 3PM3A 4YOGA 3RU4T 2Y82A 1E38B 3UNRA 1HB0B 2BDHA 3UNSA 1T4VH 1UVSH 3TPIZ 1K9OE 4BXWA 2G5VA 4CR9A 4BTIB 3A81A 1YM0A 1X7AC 2OTVA 2XC5A 1EJAA 4LZ4B 5C1YA 4AG1A 2RA0A 1P2OA 3MU0A 1HAGE 3A7TA 5F03A 1O3JA 2ALPA 2Z94A 2FEQH 1XUFA 1ELVA 1IQKA 2ZPQA 3P17H 2RG3A 3NZIA 2F9VA 2P16A 4SGBE 2J38A 1HDTH 1RGQA 1ORFA 3IG6B 2NWNA 2VIDA 5EQSA 1TYNA 2PGBB 4CRBA 2FM2A 1MKXK 4FVBA 2EEKA 1O2UA 4DIIH 3ZVAA 1CVWH 1GMHF 1ZTLA 1ARCA 1HAOH 1M9UA 1TX7A 3QDZB 1KXDA 1B5GH 1EKBB 2ANWA 1GJ4H 2Q6FA 1SGRE 4H4FA 2P94A 1HRTH 2BLQA 1O2ZA 1OP0A 1UTKA 4GHTA 2C93B 3SU5A 1HAIH 1PQAA 2HPQH 1FY4A 3D65E 1Z6EA 5C5OA 2PW8H 3P8FA 3KQCA 1FXYA 1O2HA 3MFJA 5EOKA 3GDVA 2C8YB 3PLBA 5HM2A 1ZPCA 3BIVH 4MNXA 1SGPE 1F5RA 1ZSLA 1GCTC 2SNWA 4CR5A 1C1PA 2PTNA 4E7RG 3WY8A 1CGJE 2BY9X 4JK5A 1HIAB 1SGYE 1MZDA 2EI6A 5DP9A 2ZHFH 4XBDA 2WINI 1S6HA 1V2TT 4A1XA 3QN7A 3MU1A 4VGCC 3UOPA 4ZHLU 1ZMJA 1IQGA 2J9NA 1C5ZB 2BTCE 3BTTE 1HAYB 2BDBA 1UCYE 4FUJA 1K2I1 3NPSA 1L1NA 1LQEA 2O8TA 1KXAA 5C2ZA 2A0QB 5T6GA 1U6QA 5T3HA 4X8TH 3GY3A 4ISOA 4O03A 4GHQA 2BY6X 2WV4A 1LO6A 2Z3CA 3V13A 1NROH 1VITH 1O2RA 4NFEA 3MO3A 1QJ1B 2FOHA 1GJ6A 1DUEA 4JYTA 1EXFA 4AGKA 1HNEE 2QCYA 2CHAB 4E06H 1AKSB 2XTTB 3S9BA 1EQ9A 4A7IB 4MNVA 4K2YA 1T8LA 5FAHA 3U1IB 1P2KA 3UWJH 5DGJA 1AUJA 3MO6A 5C1XA 1EAUA 1WQVH 4NFFA 1W11U 1UHBB 5EGMA 3P95A 4FUEA 4NIVA 3MH4A 1O2MA 1GDUA 2GV6A 3T5FH 2BXUH 2IJOB 4GUXA 1BBRE 3MH7A 1A0HB 5G4BA 1BRUP 3ZZ5A 1PPFE 4FXGH 1C5TA 1GBKA 3MH6A 2ZP0H 1GI1A 2UUYA 1KXEA 4NIXA 4ZMAH 1J15A 1O3AA 4UFEH 3KL6A 2F9NA 3BG4C 3I29A 7KMEH 2VH6A 3EA8A 1OSSA 2BZ6H 1ZHRA 5F6MA 4IN2A 4JMYA 1ZR0A 4X6NA 1BUIA 4RKJB 1C2IA 4BTUB 5L2ZH 4NA8A 4Y8ZA 3SV2H 2D8WA 1L4ZA 2Z3DA 1YPJH 4JZIA 5A0BA 3SGBE 1P57B 1UTQA 3TJVA 2KAIB 2A4RA 1Z8JB 4IMZA 4X2WA 3A80A 4JYUH 3T2NA 3K9XB 1LHCH 2AMQA 3UFAA 2D1JA 1G3DA 3DHKH 4NA9H 5JYIA 4Y6DA 4B75A 5HGGA 5DPAA 2A5KA 2QXGA 2GVFA 1Z8GA 5C67A 4LK4A 7GCHF 4IN1A 3S0NA 2HPPH 1MKWH 1UHBA 1O3BA 3Q00A 1J9CH 2OP9A 3KNXA 2BB4A 3FFGA 2ULLA 1EB2A 2RA3A 1QQ4A 1DWCH 1GBIA 1HFDA 1S85A 4KELA 1CQQA 3BV9B 1BCUH 2ZO3H 5I25A 3HATH 1QURH 5EXLA 3V3MA 1QA7A 4FU8A 1ELCA 1RXPA 1GGDC 3AASA 3NCLA 1O3KA 1UCYK 1VGCC 3RXEA 5TJXA 1ELDE 2G55A 1H4WA 5FXLA 5BRRE 1GI3A 3TVJB 5E2OA 2Y5GA 3GCOA 3A7WA 4XBCA 2Y5HA 2ZU2A 3LGVA 1O2NA 1TRNA 1Z1JA 3PMJA 1AVXA 4GCHG 4NZQA 1V2RT 3A8BA 2SGDE 5ABWA 4J1YA 2FS8A 7ESTE 4MG3A 1O3NA 1ELBA 1XUJA 1A5GH 2HALA 2BM2A 4B73A 2Y7ZA 2ZFPH 4Y8XA 4JZ1A 5JBBS 2FP7B 3UR9A 4ZAEA 2OINA 4LOYH 3AVZA 4B2AA 1DLEA 1GVKB 1L4DA 2C4FH 3GYMA 1E35B 3FP8E 1D9IA 2ZQ1A 4NZLA 2JETC 2F9BH 4FUHA 4OS2A 5HMAA 1A61H 1XM1A 1LVOA 3FP6E 3Q3YA 3ATIA 4VGCB 2DUCA 1TALA 1O3GA 4ABDA 1VCWA 1V2UT 1WTGH 2IOTA 1O3CA 4ABFA 1CA8B 3T25A 1KLJH 1VITF 3E8LA 4ISNA 1HIAA 2VGCB 4TY7A 1EOJA 2V6NA 4YM9A 3F6UH 1LVYA 2ZHDA 1BIOA 3MNXA 1HJAC 1QHRB 5JBTA 5F8TA 4YLUA 4KTCA 3ODDA 4BAHB 2B7DH 1LHDH 2BX4A 5JB8S 4ASHA 3ZVGA 2RCEA 1SI5H 2AIQA 3SV7A 1GI9B 3ATKA 1MD8A 2LNCA 4I8KA 1RJXB 1TGBA 1INCA 3SQHE 3TLOA 1AU8A 1D3PB 3SZNA 5TCAA 3B23B 2QV1A 2OBQA 1TNKA 1ELAA 3RXFA 2WPHS 6CHAC 3E91A 1T7CA 1O38A 5A2MH 3KGPA 2ZEBA 3URCA 1XKBC 3HGNA 1JRSA 1C5NH 1AZ8A 1AGJA 2W26A 3T62A 3SNEA 1H8IH 5JBAS 4UONA 1C5LH 1GVZA 1V2VT 1UTJA 1QNJA 2V35A 3SV9A 4AN7A 2G4TA 3NKKA 1FAKH 4MPWA 1Z8IB 3FANA 4GCHF 3SJIA 2OBOA 3BEFB 4X8UH 4DGJA 1Y3UA 2ZU5A 1ETTH 1O2QA 4RKOB 4THNH 1GBBA 1AY6H 5EW1H 2R2WU 2FOEA 2ZGBH 3VB3A 3RXMA 2QF3A 4Y8YA 1SGTA 1UVUH 1VJ9U 1PPBH 4CHAB 1MKWK 4X1RU 2XW9A 1LMWB 1BRBE 1L0ZA 3UNQA 3EQ0H 2ZQ2A 1GJ5H 2A4OA 1BB0B 1NT1A 1BOQA 1O3EA 1GMCF 4FUFA 2QC2A 2XBWA 1TRMA 3P6ZB 1QRWA 3RXOA 1T31A 5CHAC 1Z1IA 2ZHEH 4BANB 1SG8B 1BITA 2GZ8A 1YPHC 5T6FA 1MKXH 2EA3A 1BMLA 1FZZA 1O2LA 1AUTC 1QRZA 1F0RA 1HJAB 1GI7B 1C2GA 1WYKA 3LH3A 3UY9A 2WYGA 3TGIE 1OWKA 1C1TA 1PYTC 1ZRKA 4ZKSU 1TB6H 2J34A 3ZVEA 1SGFG 1SPJA 4UFFH 5EQRA 1BTUA 1O37A 4X2VA 1YPKH 3FZZA 5EODA 1ZMNA 1BQYA 4Y7AA 3MU8A 4MNYA 1ZHPA 3OY5U 3PWBA 1GBHA 3ZZ4A 5TCCA 1DITH 3IITA 2G81E 3RXBA 2C8XB 2VVVA 2W3IA 2C90B 1CBWC 2DE8A 1WV7H 1RTLA 1H9HE 1SGDE 4ESTE 3LGYA 5FPYA 1FUJA 4YOIA 1BJUA 3RU4D 2ZDKA 2ZFFH 3ATMA 1AWHB 4UDWH 1HAPH 3TJUA 2SGQE 2XBXA 3LIWA 2ZWLH 2F9UA 1KXBA 1QL7A 2BDAA 4D9QA 1KY9A 1D6WA 4I8GA 1LKAA 1QRXA 4ABHA 2O8LA 1IOEA 1S6FA 3F68H 4CRGA 9LPRA 3ZZCA 1OP8A 1S81A 5DP6A 1GHVH 2OUAA 4O3TA 3QGJA 4CBNA 1HLTH 3M5LA 1AFEH 1YPHE 1FPHH 4ABGA 4GSOA 4SGAE 8LPRA 5ESBA 5H4IB 1MQ6A 2R9PA 2PHBA 2TGPZ 1HAVB 8KME2 4A1VA 2H1UA 2P95A 2ZI2H 3KQEA 3QX5H 3BSQA 1NRSH 2ODQA 2VWOA 1B7XB 1TNIA 1GHZA 1GBDA 2PTCE 1O5FH 1GG6B 4FUDA 3U8OH 1XVOA 4YT6H 1TGTA 2XC4A 3ZV8A 4XE4A 1O31A 1THSH 3VGCB 1YPMH 1O2IA 2QGRA 1DSUA 1GCDA 2FI4E 1MTUA 5B6OA 3JZ2B 1UTNA 2AGIX 2ZFSA 5GXPA 4K5ZA 2UUJB 3SN8A 2A2XH 4DVAU 1GJCB 1MCVA 2EI8A 3CS7A 1VR1H 1PPGE 4ZKRU 4CHAC 2K1QA 1FQ3A 1EJMA 4IS5A 1OWEA 2ZGCA 3RXUA 4Q7XA 2AMDA 1O2VA 3SU1A 2BDIA 4XBBA 2BVXH 2UUKB 5EXNA 3MH5A 2R2MB 5FBEA 1GJ9B 3ELAH 1EPTB 1CHGA 1MAXA 3LGWA 2ZF0H 2ZPRA 1FIWA 1NO9H 1QA0A 1H8DH 3AAVA 4RN6A 4Z0KA 1THRH 2H9TH 3ATWA 4X6PA 2PSXA 3URDA 5LPFA 5EQQA 3T27A 1C5MD 4X1PU 1C4U2 1ESTA 2AS9A 1MTNC 1C2FA 6CHAB 1ZZZA 1O34A 2OC0A 1O3LA 3BTME 3TH2H 4U2WA 3DFLA 3RM0H 1C9TA 2XXLA 2BDYA 1GHYH 4A5TS 2STAE 3A86A 4NCYA 1C2HA 5DP3A 4X8SH 3S7HB 2H5CA 3NWUA 4ISLA 4JYVH 4ZHAA 1P0SH 3GCNA 2BD7A 3RXDA 1W0YH 2NU3E 1P2QA 3LGIA 3AAUA 3RXTA 1SGIB 3K6YA 1GHXH 1QQUA 3L3TA 3ZZBA 4JZFH 2VIQA 5ESTE 5LPRA 2FWWA 2O9QA 1ZYOA 3UPEA 1EZUC 1DLKB 1FNIA 1T32A 2ZZUH 1MAYA 3L6PA 2LPRA 1ZPBA 1Q31A 4WXVA 1QB1A 1L2EA 1O33A 3SORA 4BOHA 4AFUA 1L1GA 3DFJA 4FUCA 2THFB 1MQ5A 5FPTA 3HK6B 2Z9KA 5ETXA 1JIMA 3TK9A 1AMHA 3BTQE 2STBE 4MTBA 1J8AA 1JRTA 2G8TA 1OP2A 2R0KA 2V3HH 2GX4A 4UFDH 2P3UB 5PTPA 1JOUB 2A4GA 1RD3B 3C1KA 1K1LA 1XKAC 3MYWA 1G2MA 1UMAH 3QLPH 2P3FH 1TAWA 1PQ5A 4DCDA 4NG9H 2SNVA 1O35A 1GBFA 1KXCA 3VPKA 1C4V2 1HAXB 3CS0A 4BAMB 3V12A 2ANKH 3DT0H 2AH4X 2WPKS 2QIQA 1TOCB 3MHWU 4O3UA 4Q2KA 1T8OA 5FCKA 2Q1JA 3U8TH 2BD5A 2BD4A 5GWZA 3A82A 2BDGA 4INHA 5C20A 4HI3A 3SGQE 2W3KA 1DDJA 1G30B 3SOSA 4H6TA 1UTOA 4DT7B 2NU0E 5A0CA 1NRPH 5HM9A 2F3CE 3H7OA 1E36B 1P11E 3BF6H 2VWLA 1ESBA 4XFQA 2ZTYA 4MQAA 1FY5A 1EZQA 3S9AA 2UWPA 1S83A 2GGVB 3NUMA 3MOCA 4K8YA 4DG4A 1MTVA 1TPOA 1WCZA 3SJ9A 2ZIQH 1F5KU 4B74A 1GPZA 3SW2B 1V2WT 2ZDLA 4O97A 2PV9B 2PUQH 1BZXE 1Y3XA 2ZHQH 3AW0A 3TK5A 3RXJA 3SUDA 2PWXA 4MLFB 4AB9A 2GCHF 2Y5FA 2Y6TA 3TJOA 4PROA 1SGCA 3M3VA 1C5UA 4JK6A 3UTUH 3RXGA 1H9LB 1D3TB 3MI4A 3QZQA 1FAXA 1BHXF 3DA9B 3QWCH 3Q3KA 1GI2A 1TX6A 1HUTH 3RMOH 4AOQA 1FV9A 1GBJA 2HOBA 1DANH 2BOHB 1YP9A 2R3UA 4YO9A 3PB1E 1C5OH 3C27B 1UTPA 1YCPH 2JH5D 1LDTT 1PQ7A 2BX3A 4CRAA 2BVSH 1C5PA 1C5SA 3UR6A 3ZZ3A 3GY6A 1O5AB 1XUIA 2XCNA 1K22H 3ZYEA 1C1VH 3NK8A 2VWNA 2CV3A 1LPKB 5CHAB 1GCTB 1SSXA 1P8VC 2GZ7A 2PFEA 2UWLA 4BAQB 1YLDA 5JBCS 2ZGJA 1TNHA 1PJPA 3GCHB 2P3TB 4DY7B 4TPIZ 2FESH 5A8XA 5GDSH 4ZXYH 1SQOA 3PLKA 1O2SA 4WJG2 4D7FA 2J95A 2BOKA 3EA9A 1FIZA 2GV7A 3R3GB 1NM6A 2Z3EA 1Q2WA 1UK2A 3S7KB 2HWLB 3F9EA 2ZCKP 3RXRA 4DOQA 1TONA 5GPIB 1LCYA 4KKDA 3RXAA 1GHBG 1O30A 1LPZB 4AFSA 3UQOA 1V2QT 3RXVA 2QY0B 2FOBA 4KGAA 4INLA 2J94A 2VIPA 1OXGA 3QUMP 2GTBA 3LJJA 2WPJS 1D6RA 3ITIA 5DP8A 2Y80A 2OC1A 4IBLH 5JDUB 2CJIA 2H9EH 1UK3A 4MPVA 1B0FA 1EP6A 2SFAA 1GBEA 3OYPA 1G3BA 1V2ST 3BG4B 1SB1H 5FPSA 2PSYA 1MBQA 2M5TA 4WMEA 1QBNA 4AGJA 1FJSA 2Y81A 1OWDA 2B9LA 2PKAB 2FMJA 1PPHE 3E1XB 3TNSA 3LONA 3S69A 1K1IA 3A8AA 2FDAA 5AFYH 1VZQH 1F0SA 1SL3A 1TBRH 3BTDE 1NFYA 4F4OC 1MU8B 3SJOA 3ZVFA 4WVPE 4CRCA 1SVPA 1GJAB 2GMTB 2XNIA 5I46H 2ZU4A 1THPB 4AZ2B 2QA9E 2VINA 2WPIS 4DW2U 2ZECA 2ODYB 4HTCH 2HNTC 1C2EA 3RLYH 3SJ8A 2XBYA 1BHXB 1TIOA 1YF4A 2V0BA 1CE5A 4UFGH 1W13U 4RSPA 2FOAA 3VB6A 4NWKA 3M5OA 1C2DA 2BDCA 3O8CA 4R0IA 1A0LA 3GDSA 1V2JT 1QB6A 3SGAE 1G3EA 1TPAE 1XXFA 4R8TB 2ZU3A 1GI6A 3GISB 2WPLS 3RXKA 3MTYA 5E0JA 1A5HA 4Y71A 5AF9H 1VGCB 2ILNA 5DJ7A 1AFQB 2Z7FE 3DUXH 2ZG0H 3JZ1B 4X2XA 3A87A 2YNAA 3UREA 1CGHA 1IQNA 3B8JA 5GCHG 5E8EH 2ZCLP 1OKXA 1P10A 4CRDA 1ABJH 1TGCA 1P2MA 3PMBB 2GCHG 3M36A 5F8XA 3UOUA 1W12U 1CT4E 1D3DB 4NIYA 3MNSA 1UVOA 2O8UA 4O9VA 3VB7A 4ABEA 1J16A 3BTWE 1TLDA 3P92A 8GCHG 1YCPK 2A1DB 4NSVA 1ZTKA 1GWAA 2JH0D 1TABE 1O5GH 1MU6B 1LPGB 1TOMH 5IYTA 1AZZA 4ABJA 1HJ9A 2FI5E 4BNRA 2IPHA 4Y79A 4Y7BA 1GDQA 2FXRA 5DP4A 2OQUA 2XRCA 5E2PA 3PO1C 4A6LA 1D4PB 1RTKA 4FU7A 3SNBA 1VCQA 1DM4B 2QXIA 5E0HA 1SHHB 2G5NA 3M35A 4E05H 1NFWA 5K0HA 1TNLA 2QXJA 1SQTA 3HKJB 1P2IA 1O3FA 3UIRA 2HNTE 2ZPSA 3RC4A 1ELEE 1YBWA 1EP5A 4YZUA 4ZHMU 2BQ6B 2QF0A 1PFXC 4B76A 1W14U 1C4Y2 2VWMA 1N1LA 1EATA 1CT2E 2SGAA 3KCGH 1NESE 3A88A 5C5NA 1ANBA
chains in the Genus database with same CATH superfamily
3ZZ6A 4AORA 3QTVH 3UWIA 3RXQA 3ZVBA 1FPCH 5HIYA 1PQ8A 3TGJE 1ANEA 2QXHA 3OFND 1ZJDA 2GDEH 1TGNA 2HVXA 3ESTA 2ZFTA 1N8OC 1SGQE 1CHOF 4FETA 4XSKU 1VJAU 1E34B 1C1WH 2EY4C 1P05A 2BY5X 5GIBA 5AFZH 4IMQA 3LJOA 4NGAH 1C5YB 2WV5A 1P12E 1DWBH 3A89A 4OS6A 1QJ6B 1BTHH 1S5SA 3RLWH 1C1UH 1FY3A 1QGFA 3PRBA 1ELTA 3OTJE 1PPZA 1V6DA 3MU5A 4BXSA 1OWHA 2BLWA 1AB9C 2KX4A 5B6LA 1NRNH 2JETB 4ASUD 2ALVA 2YMSB 3ODFA 3RXCA 2ZDMA 5J4QA 1A7SA 5EW2H 3D23A 2Z9JA 3T28A 1RIWB 1V2PT 2L74A 3L33A 3N99A 1KLTA 4WMFA 1P9SA 1K21H 4ISIH 1SOTA 3TK6A 3MMGA 4YLQH 4Z1MD 3P8NA 5DKMA 1QIXB 2OC8A 1NPMA 1EB1H 1BTZA 2AGGX 2FODA 3D62A 1JBUH 1V2MT 5CE1A 2HLCA 1BTXA 3BN9A 4RI0A 1VITG 1RS0A 1QJ7B 5BPEA 2CMYA 1LHEH 3N7OA 4YOJA 2P93A 2VB0A 5J4SA 3GY2A 3MU4A 3CENA 2AFQB 1CA0C 3E90B 3VXFH 4ZROA 3ENSB 2GT7A 3CP7A 4U32A 3W94A 1HAZB 1CGIE 1TQ7B 4TWYA 3FOAA 1GI8B 1IQIA 1IQLA 2OC7A 1DXWA 1A5IA 1P04A 1KTSB 1TBQH 1EUFA 3TU7H 1E1RD 1IQEA 2ZTZA 3GY4A 1QFKH 1GHWH 3MO9A 2ZHWH 4I31A 1DWEH 1Q3XA 4Y10E 5L30H 1OX1A 2V3OH 1A46H 2FX6A 3Q77A 1C2JA 1NC6A 1QBVH 2SGEE 4ZUHA 2FPZA 1XMNB 2VH0A 1GJDB 3F2FA 4K69A 3TJNA 3ZZ9A 1HYLA 4BAKB 3EDXB 5SGAE 1AN1E 4ZKNU 2KM0A 1HJ8A 1WUNH 2A4QA 2A2QH 1NRQH 1SGEE 1VCPA 1OWIA 2G51A 3M61U 1P01A 1P9UA 1FDPA 5DG6A 3RC6A 3TH4H 2PKSC 4BTTB 2FYRA 3RM2H 1O3HA 1BRAA 1XUKA 3HPTB 4KP0A 1GVLA 1UCYH 5E0GA 3SNAA 1NY22 4OGYA 1S0QA 3VFEA 4DJZB 2JH6D 1LVMA 1C1QA 1S82A 2AERH 2NU1E 2OCVB 1BBRK 1Y5BT 1WU1A 1A0JA 2W7SA 1A4WH 4F55A 1CSOE 1AHTH 3GYLB 4JZEH 3M7UA 5EU8A 1QY6A 1W10U 4E7NA 5HKKD 3KEEA 2QN5T 2ASUB 4D9RA 2G4UA 1BTPA 4BAOB 4HGCA 4B2CA 1JIRA 2AYWA 1HAVA 2EI7A 3LC3A 1IAUA 4GLYA 4AG2A 3BTKE 1V2KT 1AB9B 1IQHA 4WH8A 1CHOG 3HK3B 1SGNE 3A7XA 2GCTB 5F8ZA 2AGEX 4ABIA 3SO3A 7LPRA 1NTPA 1O3PB 1DY9A 2BVRH 1RTFB 7GCHG 3TGKE 2F9PA 4A1TA 3GCHC 2GDDA 1YC0A 4NSYA 1DPOA 4X6MA 1V2NT 3OSYA 1BMMH 1O5CB 1SLXB 2C8ZB 2HNTF 2KR7A 5HXFA 1WAYB 4YESB 1SFIA 1EOLA 2B5TB 1V2LT 4OS1A 3KQDA 3U1JB 5C1UA 1G36A 1SHYA 1BBRH 3GY5A 4GPGA 1QCPA 3BTFE 1O5DH 3PMAB 1YCPM 1AI8H 1DOJA 1WOFA 2A7JA 4WH6A 3SUGA 3TIUA 4I8HA 3Q76A 3KIDU 2ZTXA 1K28D 3PMHB 4OGXA 2TIOA 3LGTA 3SU3A 1QBOA 2VIWA 2VIOA 5FX6A 2AIPA 1T4UH 3HGPA 1G32B 2P8OC 5JPMH 2BQ7B 1TRYA 3FVFB 3M5NA 3A84A 3RMLH 2BY7X 5T6DA 4UD9H 2FTLE 1XUHA 2O8WA 1A3EH 1XUGA 1FI8A 1HXEH 1FMGA 1TNJA 4K1TA 3SV6A 1ZJKA 4H6SB 3KQBA 3HKIB 1YGCH 1Y8TA 1TWXB 1TPPA 1YWUA 1SR5C 2YOLA 4K60A 3H7TA 1GBTA 1YPLH 2AHME 1HGTH 1AVGH 2GZ9A 3MWIU 1CO7E 3A8DA 1DS2E 1GBAA 1GDNA 1TFXA 2ZDVH 3LOXA 1RIWC 1TMUH 1ZMLA 3LH1A 1BA8B 1ETSH 2KAIA 5GCHF 3ATLA 1T8MA 2BHGA 2FOMB 4CH2B 1OPHB 3RXIA 1AIXH 2FLRH 1XX9A 4KTUA 4B1TA 2YNBA 4F49A 3ZVCA 2XWBI 1O2GH 2G52A 1C1OA 5AHGH 1NU7B 1EX3A 3EYDA 5LH8A 2SGFE 5L6NH 5L2YH 3F9HA 4AFQA 1Y3VA 3RDZA 4YT7H 1Y3WA 1DSTA 3PV2A 2ZDNA 1CT0E 2I6QA 2A31A 3A7YA 2PLXA 2FO9A 1JWTA 1XVMA 4B2BA 4I33A 1S0RA 2A45B 5DP5A 2PKAA 3N7EA 4Q80A 2FOFA 1DFPA 1K1PA 1YYY1 1V3XA 2F43B 4INKA 4TYDA 3D49H 3T26A 1SKYE 2F9OA 1F92A 2ZFQH 4MPUA 1IQJA 1UJ1A 4GAWA 1TA2A 2FOCA 3VGCC 1AWFH 3GY7A 3LU9B 3ZZDA 6ESTA 3RMMH 1HBTH 1KDQB 1Y5UT 1C9PA 1O2TA 8ESTE 2TGAA 1P09A 4I8JA 3EGKH 1EPTA 1GGDB 3P8OA 1O32A 4F48B 2GCTC 1HPGA 1HV7A 2A7HA 3OEED 1GI4A 3ZZ7A 1JMOH 1KIGH 3NXPA 4CRFA 1BMNH 4FUIA 1C2MA 1HCGA 1BMFD 1W7GH 3M37A 1OOKB 1MMJN 4MPXA 3MNBA 2J4IA 3TH3H 3FKSD 3K6ZA 4K8BA 3UQVA 3FZDA 1EJNA 5K7RA 3M3SA 3OAAD 2BY8X 2OXSA 1P06A 1EAXA 2PP6A 4Y76A 3RP2A 3SU4A 3O8RA 1P2JA 1KSNA 3QTOH 3ZYDA 4A92A 1QR3E 1UK4A 1KTTB 2OLGA 1KLIH 5GJ4B 4WF8A 3RU4E 4IW4E 3KHVA 5A8ZA 3TITA 1MBMA 1NFUA 2WUBA 1KYNA 1O36A 2FZZA 2BLVA 1CA0B 3RC5A 1BJVA 4AYYB 1RFNA 2ANMH 1IQMA 4JZDH 2WUCA 1GMDF 2FOGA 2A32A 4WWYA 2TPIZ 1P02A 1ZOMA 1Z71A 1Z8RA 2KCYA 2KCOA 4ABBA 1O5BB 1FLEE 2WYJA 1BTYA 1LVBA 1W7XH 1O3MA 1QB9A 4Y0ZE 3SV8A 1S6LA 2EQNA 1UVPA 2AEIH 3MNCA 4Z6AH 1ELFA 1AE5A 1TNGA 2TGDA 3BG8A 1QL8A 2Y7XA 4MDSA 1C1MA 3RMNH 2PUXB 1C2KA 2O8MA 3SUFA 1WTHD 1C5RA 1C5WB 3FP7E 2BLOA 5C3NA 3BIUH 2P8OB 2A7CA 2GMTC 1AD8H 3OX7U 3I78A 1Y59T 1DE7H 1K1JA 5A09A 1V2OT 1GJBB 1AKSA 1N6XA 1GMCG 1O2YA 3R0FA 1G2LA 4J2YB 5EG4A 3SUEA 2BD3A 4X6OA 1SBWA 2BD2A 3GS9A 4AFZA 2IN2A 2H6MA 3A7VA 4FUBA 2K8IA 3QK1A 1P3EA 1D3QB 1GHAG 4LXBH 1GI5A 1OHHD 1DT2A 2H9HA 4DURA 4AX9H 1YLCA 5JB9S 1HAHH 2PKSB 3QZRA 2TGTA 5FBIA 1NZQH 1O5EH 2VIVA 1SLUB 5HIZA 1OS8A 2Z9LA 4X1QU 2FYQA 3SZEA 1RRKA 2SGPE 3OTPA 5EPYA 1GBLA 1AO5A 1O2JA 2ZGXH 4U01A 1FONA 4LZ1H 3E6PH 2WV9A 3A85A 3SJKA 3LDXH 2VVCA 2XC0A 1NS3A 4FU9A 1P2NA 2CGAA 1WSSH 1O2OA 1SLWB 3GCTG 4K3JA 1SOZA 1GHBF 3H5CB 1Z6JH 1C1SA 3O8DA 4Q7YA 1FY1A 3NRLA 6GCHF 5DN6D 8GCHF 2ZGHA 1UTMA 2WPMS 1ID5H 3V7TA 4ZKOU 5LGOA 2UUFB 1GMHG 2FS9A 2UWOA 3IWMA 4Q63A 1A3BH 2FIRH 2R0LA 1TMTH 5LPEA 5IDKA 1WBGB 5FHTA 1FN6A 3BTEE 2GT8A 1C5VA 1Z7KA 1P03A 3A83A 3E3TA 3F1SB 3EE0B 4UEHH 2I6SA 4CBOA 1GJ8B 1QZ8A 1ZTJA 3LPRA 3UUZA 4U30A 2ZC9H 4OS5A 3PRDA 1P3CA 1AE8H 1GG6C 3P70B 3KF2A 1TGSZ 3SQEE 5CMXH 1EZXC 1EASA 4HFPB 3OU0A 1MTWA 3V0XA 2Z9IA 1S84A 4XDEA 3VXEH 2J2UA 2ANYA 2NU4E 1HXFH 4ISHH 2K0QA 1TPSA 1NU9A 4IGDA 4K1SA 4ZH8A 4D76A 1LKBA 3K2UA 1W8BH 2OD3B 1ETRH 3DSGA 1EAIA 1GBMA 2Z6BD 2BZAA 2QYIA 3SNDA 2HGTH 2A5AA 3RXLA 1GI0A 1PPEE 2PGQB 2VGCC 4HZHA 2FLBH 1C1NA 4Q7ZA 5T1VA 4TY6A 2CN0H 4H42U 1DXPA 1PPCE 1C5XB 3GY8A 2Q6DA 1O3DA 3EAJA 5EXMA 3RXPA 1KXFA 1NFXA 1CU1A 1T8NA 3GICB 4D8NA 1YPEH 2BYAX 4WMDA 2Q6GA 1UTLM 1UVTH 2CXVA 1K0HA 3VB5A 2KZ4A 2R3YA 2ZCHP 1O2PA 4IC5A 3EE7A 3Q3XA 1WXRA 2B8OH 1MH0A 1GJ7B 2J92A 2XBVA 1G37A 1OYTH 3LT3A 3PO1B 1W2KH 1ELGA 4QT8C 2ZFRH 3PROA 1A2CH 2JDID 3SBKA 3STJA 1ZSKA 1BMAA 2FX4A 3UAIC 3DD2H 3H09A 3E0NB 1F7ZA 2ODPA 2HRVA 9ESTA 1DICA 4NWLA 1OWJA 1LHFH 3ZV9A 2ZU1A 2AMPA 4IC6A 1DUAA 2BD8A 1IQFA 1TE0A 2TRMA 3B9FH 3OY6U 2BMGB 5HYOA 1LQDB 1EPTC 2Z9GA 3ZZ8A 2EC9H 1NRRH 3GCTF 1TA6A 1TQ0B 3M3TA 1TMBH 3M7TA 2H5DA 4D7GA 3QO6A 4OS4A 4MNWA 4UE7H 1GL1A 4M7GA 2W6ID 2BXTH 1ZGIA 1BDAA 1SFQB 3STIA 1F2SE 5AVDA 2XCFA 3ZVDA 2D26C 1YKTA 1QL9A 2F91A 3PYHA 1MZAA 3KN2A 1GBCA 1ARBA 3E0PB 2W7UA 5FCRA 1ACBE 3RUOA 1AVWA 2BQWB 3E16B 3RXSA 1NN6A 4ACBA 1EZSC 1KDQA 4B6EA 2F83A 1MTNB 4ABAA 3BEUA 3K65B 2C3SA 1ANDA 3AW1A 1Y5AT 1SC8U 1ZRBA 2V3MA 1BRCE 4KTSA 1GMDG 1LHGH 4DIHH 2HVYB 1SQAA 1ZSJA 1ZHMA 1ANCA 5DP7A 3O8BA 2OQ5A 2H2ZA 3GOVB 4X2YA 1LTOA 4I8LA 1E37B 5DK1A 3PWCA 1OYQA 1ZPZA 1TX8A 4ZXXH 3TNTA 4GVUA 1N8OB 3FAOA 2VU8E 2CK3D 5A8YA 3PV4A 2P59A 2QAAA 1SLVB 4JCNA 1EAWA 4I32A 1O2KA 3G01A 1DX5M 4B71A 2ZNKH 2ZA5A 2VNTA 2BD9A 1C2LA 2W5EA 5EJ1A 3U8RH 3RXHA 1PYTD 1C1RA 1H9IE 2VJ1A 3PLPA 3SU0A 1W0ZU 4OS7A 3SHAH 2JKHA 2ESTE 1J17T 2GKVE 1C5QA 1BT7A 1QTFA 4TPYA 1EFRD 1G9IE 1GL0E 4P02A 1UO6A 1FN8A 3EA7A 1AFQC 3U98H 4P00A 2FTMA 4XOJA 1W3CA 1F5LA 1SGFA 1E0FD 1N6YA 4AYVB 4YTAA 1DWDH 3M7QA 2CF9H 4TWWA 2VBCA 3U69H 3F9FA 1B0EA 3SI3H 3ZZAA 1O39A 3BEIB 3GDUA 1IHSH 3AK5A 3A7ZA 4K1EA 1ABIH 2GD4B 4I7YH 3P8GA 3SI4H 4CREA 1K1NA 2G00A 4Y11E 3VEQB 1IHTH 5DO4H 3M5MA 1O0DH 3VB4A 2GP9B 2CF8H 1O3OA 2A5IA 1GHAF 4NIWA 1F0UA 4FVDA 1MTSA 1AQ7A 3QGNB 4WY3A 6GCHG 6LPRA 1BTWA 3F9GA 3LC5A 4NA7A 3WWBA 1H1BA 1O3IA 2ZKSA 1K1OA 1MCTA 1F0TA 2D2DA 3A8CA 4AB8A 1CBWB 1ZLRA 1O2WA 4Y0YE 4I86A 2YMSC 3LGUA 5C17A 3W95A 2C8WB 3BTGE 1K1MA 2PR3A 1DVAH 3SU2A 1JXPA 5A0AE 1FY8E 1ZGVA 3SHCH 3SNCA 1G3CA 1WQSA 1Y3YA 2B0FA 4WXIA 1DY8A 3BTHE 2XWAA 4X1NU 2YMSD 4CH8B 3T29A 5EPNA 1O2XA 1SMFE 1XXDA 3S9CA 1ESAA 3DSOA 5IK2D 5F53A 2XYAA 2ZDAH 2VVUA 3PTBA 2FI3E 3SU6A 2TBSA 1NBME 1J14A 1MD7A 1MUEB 2RDLA 5FX5A 1YPGH 1L1JA 4X0WU 1A1RA 4MVNA 1TBZH 3PTNA 4FUGA 3U9AH 2NU2E 1COWD 3I77A 2DE9A 3LKWA 4X8VH 2CHAC 4X1SU 3PM3A 4YOGA 3RU4T 2Y82A 2WPDD 1E38B 3UNRA 1HB0B 2BDHA 3UNSA 1T4VH 1UVSH 3TPIZ 1K9OE 4BXWA 2G5VA 4B6FA 4CR9A 4BTIB 3A81A 1YM0A 1X7AC 2OTVA 2XC5A 1EJAA 4LZ4B 5C1YA 4AG1A 2RA0A 1P2OA 3MU0A 1HAGE 3A7TA 5F03A 1O3JA 2ALPA 2Z94A 2FEQH 1XUFA 4YXWD 1ELVA 3KQ5A 1IQKA 2ZPQA 3P17H 2RG3A 3NZIA 2F9VA 4TSFD 2P16A 4SGBE 2J38A 1HDTH 1W0KD 1RGQA 4ACAA 1ORFA 3IG6B 2NWNA 2VIDA 5EQSA 1TYNA 2PGBB 4CRBA 2FM2A 1MKXK 4FVBA 2EEKA 1O2UA 4DIIH 3ZVAA 1CVWH 1GMHF 1ZTLA 1ARCA 1HAOH 1M9UA 1TX7A 3QDZB 1KXDA 1B5GH 1EKBB 2ANWA 1GJ4H 2Q6FA 1SGRE 4H4FA 2P94A 1HRTH 2BLQA 1O2ZA 1OP0A 1UTKA 4GHTA 2C93B 3SU5A 1HAIH 1PQAA 2HPQH 1FY4A 3D65E 1Z6EA 5C5OA 2PW8H 3P8FA 3KQCA 1FXYA 1O2HA 3MFJA 5EOKA 3GDVA 2C8YB 3PLBA 5HM2A 1ZPCA 2HLDD 3BIVH 4MNXA 1SGPE 2QF5A 1F5RA 1ZSLA 1GCTC 2SNWA 4CR5A 1C1PA 2PTNA 4E7RG 3WY8A 1CGJE 2BY9X 2WZQA 5EIYA 4JK5A 1HIAB 1SGYE 1MZDA 2QF4A 2EI6A 5DP9A 2ZHFH 4XBDA 2WINI 1S6HA 1V2TT 4A1XA 3QN7A 3MU1A 4VGCC 3UOPA 4ZHLU 1ZMJA 1IQGA 2J9NA 1C5ZB 2BTCE 3BTTE 1HAYB 2BDBA 1UCYE 3PV5A 4FUJA 1K2I1 3NPSA 1L1NA 1LQEA 2O8TA 5EJZA 1KXAA 5C2ZA 2A0QB 5T6GA 1U6QA 5T3HA 4X8TH 3GY3A 4ISOA 4O03A 4GHQA 2BY6X 1LO6A 2WV4A 2Z3CA 3V13A 1NROH 1VITH 1O2RA 4NFEA 3MO3A 1QJ1B 2FOHA 1GJ6A 1DUEA 4JYTA 1EXFA 4AGKA 1HNEE 2QCYA 2CHAB 4E06H 1AKSB 2XTTB 3S9BA 1EQ9A 4A7IB 4MNVA 4K2YA 1T8LA 5FAHA 3U1IB 2QE7D 1P2KA 3UWJH 5DGJA 1AUJA 3MO6A 5C1XA 1EAUA 1WQVH 4NFFA 1W11U 1UHBB 5EGMA 3P95A 4FUEA 4NIVA 3MH4A 1O2MA 1GDUA 2GV6A 3T5FH 2BXUH 2IJOB 4GUXA 1BBRE 3MH7A 1A0HB 3OE7D 5G4BA 1BRUP 3ZZ5A 5EJLA 1PPFE 4FXGH 1C5TA 1GBKA 3MH6A 2ZP0H 1GI1A 2UUYA 5KECA 1KXEA 4NIXA 4ZMAH 1J15A 1O3AA 4UFEH 3KL6A 2F9NA 3BG4C 3I29A 7KMEH 2VH6A 3EA8A 1OSSA 3F3BA 2BZ6H 1ZHRA 5F6MA 4IN2A 4JMYA 1ZR0A 4X6NA 1BUIA 4RKJB 1C2IA 1E79D 4BTUB 5L2ZH 4NA8A 4Y8ZA 3SV2H 2D8WA 1L4ZA 2Z3DA 1YPJH 4JZIA 5A0BA 3SGBE 1P57B 1UTQA 3TJVA 2KAIB 2A4RA 1Z8JB 4IMZA 4X2WA 3A80A 4JYUH 3T2NA 2L6OA 3K9XB 1LHCH 2AMQA 3UFAA 2D1JA 1G3DA 3DHKH 4NA9H 5JYIA 4Y6DA 4B75A 5HGGA 5DPAA 2A5KA 2QXGA 2GVFA 1Z8GA 5C67A 4LK4A 7GCHF 4IN1A 3S0NA 2HPPH 1MKWH 1UHBA 1O3BA 3Q00A 1J9CH 2OP9A 3KNXA 2BB4A 3FFGA 2ULLA 1EB2A 2RA3A 1QQ4A 1DWCH 1GBIA 1HFDA 1S85A 3FO8D 4KELA 4Q4LA 1CQQA 3BV9B 1BCUH 2ZO3H 5I25A 1KMHB 3HATH 1QURH 5EXLA 4RT1A 3V3MA 1QA7A 4FU8A 1ELCA 1RXPA 1GGDC 3AASA 3NCLA 1O3KA 1UCYK 1VGCC 3RXEA 5TJXA 1ELDE 2G55A 1H4WA 5FXLA 5BRRE 1GI3A 3TVJB 5E2OA 2Y5GA 3GCOA 3A7WA 4XBCA 2Y5HA 2ZU2A 3LGVA 1O2NA 3DCLA 2LP6A 4OM9A 1TRNA 2LELA 1Z1JA 3PMJA 1AVXA 4GCHG 4NZQA 1V2RT 3A8BA 2SGDE 3OEHD 5ABWA 4J1YA 2FS8A 7ESTE 4MG3A 1O3NA 1ELBA 1XUJA 1A5GH 2HALA 2BM2A 4B73A 2Y7ZA 2ZFPH 4Y8XA 4JZ1A 5JBBS 2FP7B 3UR9A 4ZAEA 2OINA 4LOYH 3AVZA 4B2AA 4FOUC 1DLEA 1GVKB 1L4DA 2C4FH 3GYMA 1E35B 3FP8E 1D9IA 2ZQ1A 4NZLA 2JETC 2F9BH 4FUHA 4OS2A 5HMAA 1A61H 1XM1A 1LVOA 3FP6E 3Q3YA 1UW7A 3ATIA 4VGCB 2DUCA 1TALA 1O3GA 4ABDA 1VCWA 1V2UT 1WTGH 2IOTA 1O3CA 4ABFA 4DT4A 1CA8B 3DSPA 3T25A 1KLJH 1VITF 3E8LA 4ISNA 1HIAA 2VGCB 5C0UA 4TY7A 1EOJA 2V6NA 4YM9A 3F6UH 1LVYA 2ZHDA 1BIOA 3MNXA 1HJAC 1QHRB 5JBTA 5F8TA 4YLUA 4KTCA 2RDEA 3ODDA 4BAHB 2B7DH 1LHDH 2BX4A 5JB8S 4ASHA 3ZVGA 2RCEA 1SI5H 2AIQA 3SV7A 1GI9B 3ATKA 1MD8A 5DSFA 2LNCA 4I8KA 1RJXB 1TGBA 1INCA 3SQHE 3TLOA 1AU8A 1D3PB 3SZNA 5TCAA 3B23B 2QV1A 2OBQA 1TNKA 1ELAA 3RXFA 2WPHS 6CHAC 3E91A 1T7CA 1O38A 5A2MH 2J98A 3KGPA 2ZEBA 3URCA 1XKBC 2IPQX 3HGNA 1JRSA 1C5NH 1AZ8A 1AGJA 2W26A 3T62A 3SNEA 1H8IH 5JBAS 4UONA 1C5LH 1GVZA 1V2VT 1UTJA 1QNJA 2V35A 3SV9A 4AN7A 2G4TA 3NKKA 1FAKH 4MPWA 1Z8IB 3FANA 4GCHF 3SJIA 2OBOA 3BEFB 4X8UH 2GJGA 4DGJA 1Y3UA 2ZU5A 1ETTH 1O2QA 4RKOB 4THNH 1GBBA 1AY6H 5EW1H 2R2WU 2FOEA 2ZGBH 3VB3A 3RXMA 2QF3A 4Y8YA 3ZIAD 1SGTA 1UVUH 1VJ9U 1PPBH 4CHAB 1MKWK 4X1RU 2XW9A 1LMWB 1BRBE 1L0ZA 2WHXA 3UNQA 3EQ0H 2ZQ2A 1GJ5H 2A4OA 1BB0B 1NT1A 1BOQA 1O3EA 1GMCF 4FUFA 2QC2A 2XBWA 1TRMA 3P6ZB 1QRWA 3RXOA 1T31A 5CHAC 1Z1IA 2ZHEH 4BANB 1SG8B 1BITA 2GZ8A 1YPHC 5T6FA 1MKXH 2EA3A 1BMLA 1FZZA 1O2LA 1AUTC 1QRZA 1F0RA 1HJAB 1GI7B 1C2GA 1WYKA 3LH3A 3UY9A 2WYGA 3TGIE 1OWKA 1C1TA 1PYTC 1ZRKA 3W1EA 4ZKSU 1TB6H 2J34A 3ZVEA 1SGFG 1SPJA 4UFFH 5EQRA 1BTUA 1O37A 4X2VA 1YPKH 3FZZA 5EODA 1ZMNA 1BQYA 3WWFA 4Y7AA 3MU8A 4MNYA 1ZHPA 3OY5U 3PWBA 1GBHA 3ZZ4A 5TCCA 1DITH 1YY3A 3IITA 2G81E 3RXBA 2C8XB 2VVVA 2W3IA 2C90B 1CBWC 2DE8A 1WV7H 1RTLA 1H9HE 2IJD1 1SGDE 4ESTE 3LGYA 5FPYA 1FUJA 4YOIA 1BJUA 3RU4D 2ZDKA 2ZFFH 3ATMA 5CDFE 1AWHB 4UDWH 1H8HD 1HAPH 3TJUA 2SGQE 2XBXA 5CHBA 3LIWA 2ZWLH 2F9UA 1KXBA 1H8ED 1QL7A 2BDAA 4D9QA 1KY9A 1D6WA 4I8GA 1NBMD 1LKAA 1QRXA 4ABHA 2O8LA 1IOEA 1S6FA 3F68H 4CRGA 9LPRA 3ZZCA 1OP8A 1S81A 5DP6A 1GHVH 2OUAA 4O3TA 3QGJA 4CBNA 1HLTH 3M5LA 1AFEH 1YPHE 1FPHH 4ABGA 4GSOA 4SGAE 2J97A 8LPRA 5ESBA 5H4IB 1MQ6A 2R9PA 2PHBA 4TT3D 2TGPZ 1HAVB 8KME2 3F0OA 3F0PA 4A1VA 2H1UA 5GNDA 2P95A 2ZI2H 3KQEA 3QX5H 3BSQA 1NRSH 2ODQA 2VWOA 1B7XB 1TNIA 3VG8A 1GHZA 1GBDA 2PTCE 1O5FH 1GG6B 4FUDA 3U8OH 1XVOA 4YT6H 1TGTA 3FN8A 2XC4A 3ZV8A 4XE4A 2KCAA 1O31A 1THSH 3VGCB 1YPMH 1O2IA 2QGRA 1DSUA 1GCDA 2FI4E 1MTUA 5B6OA 3JZ2B 1UTNA 2AGIX 2ZFSA 5GXPA 4K5ZA 2UUJB 3SN8A 2A2XH 2J5UA 4DVAU 1GJCB 1MCVA 2EI8A 3CS7A 1VR1H 1PPGE 4ZKRU 4CHAC 2JJ1D 2K1QA 1FQ3A 1EJMA 4IS5A 1OWEA 2ZGCA 3RXUA 4Q7XA 2AMDA 1O2VA 3SU1A 2BDIA 4XBBA 2BVXH 2UUKB 5EXNA 3MH5A 2R2MB 5FBEA 1GJ9B 3ELAH 1EPTB 1CHGA 1MAXA 3N7DA 3LGWA 2ZF0H 2ZPRA 1FIWA 1NO9H 1QA0A 1H8DH 3AAVA 4RN6A 4Z0KA 1THRH 2H9TH 3ATWA 4X6PA 2PSXA 3URDA 5LPFA 5EQQA 3T27A 1C5MD 4X1PU 1C4U2 1ESTA 2AS9A 1MTNC 1C2FA 6CHAB 1ZZZA 1O34A 2OC0A 1O3LA 3BTME 3TH2H 4U2WA 3DFLA 3RM0H 1C9TA 2XXLA 2BDYA 1GHYH 4A5TS 2STAE 3A86A 4NCYA 3SYJA 1C2HA 1W0JD 5DP3A 4X8SH 3S7HB 2H5CA 3NWUA 4ISLA 4JYVH 4ZHAA 1P0SH 3GCNA 2BD7A 3RXDA 1W0YH 1MABB 2NU3E 1P2QA 3LGIA 3AAUA 3RXTA 1SGIB 3K6YA 1GHXH 1QQUA 3L3TA 3ZZBA 4JZFH 2VIQA 5ESTE 5LPRA 2FWWA 2O9QA 1ZYOA 3UPEA 1EZUC 1DLKB 1FNIA 1T32A 2ZZUH 4HG6A 1MAYA 3L6PA 2LPRA 1ZPBA 3WW7A 1Q31A 4WXVA 2W6JD 1QB1A 1L2EA 1O33A 3SORA 4BOHA 2KCPA 4AFUA 1L1GA 3DFJA 4FUCA 2THFB 1MQ5A 5FPTA 3HK6B 2Z9KA 5ETXA 1JIMA 3TK9A 3UB0A 1AMHA 3F2HA 3BTQE 2STBE 4MTBA 1J8AA 2OK5A 1JRTA 2G8TA 1OP2A 2R0KA 2V3HH 2GX4A 4UFDH 2P3UB 5PTPA 1JOUB 2A4GA 1RD3B 3C1KA 1K1LA 1XKAC 3MYWA 1G2MA 1UMAH 3QLPH 2P3FH 1TAWA 4XD7D 1PQ5A 2KFWA 4DCDA 4NG9H 2SNVA 1O35A 1GBFA 1KXCA 3VPKA 1C4V2 1HAXB 3CS0A 4BAMB 3V12A 2ANKH 3DT0H 2AH4X 2WPKS 2QIQA 1TOCB 2JJ2D 3MHWU 4O3UA 4Q2KA 1T8OA 1VKYA 5FCKA 2Q1JA 3U8TH 2BD5A 2BD4A 5C94A 3A82A 5GWZA 2BDGA 4INHA 5C20A 4HI3A 3SGQE 2W3KA 1DDJA 1G30B 3SOSA 4H6TA 1UTOA 4DT7B 2NU0E 5A0CA 1NRPH 5HM9A 2F3CE 3H7OA 1E36B 1P11E 3BF6H 2VWLA 1ESBA 4XFQA 2ZTYA 4MQAA 1FY5A 1EZQA 3S9AA 2UWPA 1S83A 2GGVB 4AC9A 3NUMA 3MOCA 4K8YA 4DG4A 1MTVA 1TPOA 5KGOA 1WCZA 1E1QD 3SJ9A 2ZIQH 3F2GA 1F5KU 4B74A 1GPZA 3SW2B 1V2WT 2ZDLA 4O97A 2PV9B 2PUQH 1BZXE 1Y3XA 3U28C 2ZHQH 3AW0A 3TK5A 3RXJA 3SUDA 2PWXA 4MLFB 2WSSD 4XRNA 4AB9A 2GCHF 2Y5FA 2Y6TA 3TJOA 4PROA 1SGCA 3M3VA 1C5UA 4JK6A 3UTUH 3RXGA 1H9LB 1D3TB 3MI4A 3QZQA 1FAXA 1BHXF 3DA9B 3QWCH 3Q3KA 1GI2A 1TX6A 1HUTH 3RMOH 4AOQA 1FV9A 1GBJA 2HOBA 1DANH 2BOHB 1YP9A 2R3UA 4M9FA 4YO9A 3PB1E 1C5OH 3C27B 1UTPA 1YCPH 2M2AA 2JH5D 1LDTT 1PQ7A 2BX3A 4CRAA 2BVSH 1C5PA 1C5SA 3UR6A 3ZZ3A 3GY6A 1O5AB 1XUIA 2XCNA 1K22H 3ZYEA 1C1VH 3NK8A 2VWNA 2CV3A 5FL7D 1LPKB 5CHAB 1GCTB 1SSXA 1P8VC 2GZ7A 2PFEA 2UWLA 4BAQB 1YLDA 2XOKD 5JBCS 2ZGJA 1TNHA 1PJPA 2XNDD 2P3TB 3GCHB 4RT0A 4DY7B 4TPIZ 2FESH 5A8XA 5GDSH 4ZXYH 1SQOA 3PLKA 1O2SA 4WJG2 4D7FA 2J95A 2BOKA 3EA9A 1FIZA 2GV7A 3R3GB 1NM6A 2Z3EA 1Q2WA 1UK2A 3S7KB 2HWLB 3F9EA 2ZCKP 3RXRA 4DOQA 1TONA 5GPIB 1LCYA 4KKDA 3RXAA 5C0TA 1GHBG 1O30A 1LPZB 1WDIA 4AFSA 3UQOA 1V2QT 3RXVA 2QY0B 2FOBA 4KGAA 4INLA 2J94A 2VIPA 1OXGA 3QUMP 2GTBA 3LJJA 2WPJS 1D6RA 3ITIA 5DP8A 2Y80A 2OC1A 4IBLH 5JDUB 2CJIA 2H9EH 5KEDA 1UK3A 4MPVA 1B0FA 1EP6A 2SFAA 1GBEA 3OYPA 1G3BA 1V2ST 3BG4B 1SB1H 5FPSA 2PSYA 1MBQA 2M5TA 4WMEA 1QBNA 4AGJA 1FJSA 2Y81A 1OWDA 2B9LA 2PKAB 2FMJA 1PPHE 3E1XB 3TNSA 3LONA 3S69A 1K1IA 3A8AA 2FDAA 5AFYH 1VZQH 1F0SA 1SL3A 1TBRH 3BTDE 1NFYA 4F4OC 1MU8B 3SJOA 3ZVFA 4WVPE 4CRCA 1SVPA 1GJAB 2GMTB 2XNIA 5I46H 1SQRA 2ZU4A 1THPB 4AZ2B 2QA9E 2VINA 2WPIS 4DW2U 2ZECA 2ODYB 4HTCH 2HNTC 1C2EA 3RLYH 3SJ8A 2XBYA 1BHXB 1TIOA 1YF4A 2V0BA 1CE5A 4UFGH 1W13U 2F4LA 4RSPA 2FOAA 3VB6A 4NWKA 3M5OA 1C2DA 3KYFA 2BDCA 3O8CA 4R0IA 1A0LA 3GDSA 1V2JT 1YLNA 1QB6A 3SGAE 2V7QD 1G3EA 1TPAE 1XXFA 4R8TB 2ZU3A 1GI6A 3GISB 2WPLS 3RXKA 3MTYA 5E0JA 1A5HA 4Y71A 5AF9H 1VGCB 2ILNA 5DJ7A 1AFQB 1FX0B 2Z7FE 3DUXH 2ZG0H 3JZ1B 4X2XA 2JIZD 3A87A 2YNAA 3UREA 1CGHA 1IQNA 3B8JA 5GCHG 5E8EH 2ZCLP 1OKXA 1P10A 4CRDA 1ABJH 1TGCA 1P2MA 3PMBB 2GCHG 3M36A 5F8XA 3UOUA 1W12U 1CT4E 1D3DB 4NIYA 3MNSA 1UVOA 2O8UA 4O9VA 3VB7A 4ABEA 1J16A 3BTWE 1TLDA 3P92A 8GCHG 1YCPK 2A1DB 4NSVA 1ZTKA 1GWAA 2JH0D 1TABE 1O5GH 1MU6B 1LPGB 1TOMH 5IYTA 1AZZA 4ABJA 1HJ9A 2FI5E 4BNRA 2IPHA 4ZCNA 4Y79A 3KYGA 4Y7BA 1GDQA 2FXRA 3MQKC 5DP4A 2OQUA 2XRCA 5E2PA 3PO1C 4A6LA 1D4PB 1RTKA 3CNRA 4FU7A 3SNBA 1VCQA 1DM4B 2QXIA 5E0HA 1SHHB 2G5NA 3M35A 4E05H 1NFWA 5K0HA 1TNLA 2QXJA 1SQTA 3HKJB 1P2IA 1O3FA 3UIRA 2HNTE 2ZPSA 3RC4A 1ELEE 1YBWA 1EP5A 4YZUA 4ZHMU 2BQ6B 2QF0A 1PFXC 2J98B 4B76A 2RFKC 1W14U 1C4Y2 1N1LA 1EATA 1CT2E 2SGAA 2VWMA 3KCGH 1NESE 3A88A 5C5NA 1ANBA
chains in the Genus database with same CATH topology
3ZZ6A 4AORA 3QTVH 3UWIA 3RXQA 3ZVBA 1FPCH 1PQ8A 3TGJE 1ANEA 2QXHA 1ZJDA 2GDEH 1TGNA 2HVXA 3ESTA 2ZFTA 1N8OC 1SGQE 1CHOF 4XSKU 1VJAU 1E34B 1C1WH 1P05A 2BY5X 5GIBA 5AFZH 4IMQA 3LJOA 4NGAH 1C5YB 2WV5A 1P12E 1DWBH 3A89A 4OS6A 1QJ6B 1BTHH 1S5SA 3RLWH 1C1UH 1FY3A 1QGFA 1ELTA 3OTJE 1PPZA 1V6DA 3MU5A 4BXSA 1OWHA 2BLWA 1AB9C 1NRNH 2JETB 2ALVA 3ODFA 3RXCA 5J4QA 2ZDMA 1A7SA 5EW2H 3D23A 2Z9JA 3T28A 1RIWB 1V2PT 3L33A 4WMFA 1KLTA 1P9SA 1K21H 4ISIH 1SOTA 3TK6A 3MMGA 4YLQH 3P8NA 5DKMA 1QIXB 2OC8A 1NPMA 1EB1H 1BTZA 2AGGX 2FODA 3D62A 1JBUH 1V2MT 5CE1A 2HLCA 1BTXA 3BN9A 1VITG 1RS0A 1QJ7B 5BPEA 2CMYA 1LHEH 3N7OA 4YOJA 2P93A 2VB0A 5J4SA 3GY2A 3MU4A 3CENA 2AFQB 1CA0C 3E90B 3VXFH 4ZROA 3ENSB 2GT7A 3CP7A 4U32A 3W94A 1HAZB 1CGIE 1TQ7B 4TWYA 1GI8B 1IQIA 1IQLA 2OC7A 1DXWA 1A5IA 1P04A 1KTSB 1TBQH 1EUFA 3TU7H 1IQEA 2ZTZA 3GY4A 1QFKH 1GHWH 3MO9A 2ZHWH 4I31A 1DWEH 1Q3XA 4Y10E 5L30H 1OX1A 2V3OH 1A46H 2FX6A 3Q77A 1C2JA 1NC6A 1QBVH 2SGEE 4ZUHA 2FPZA 1XMNB 2VH0A 1GJDB 4K69A 3TJNA 3ZZ9A 1HYLA 4BAKB 3EDXB 5SGAE 1AN1E 4ZKNU 1HJ8A 1WUNH 2A4QA 2A2QH 1NRQH 1SGEE 1VCPA 1OWIA 2G51A 3M61U 1P01A 1P9UA 1FDPA 5DG6A 3RC6A 3TH4H 2PKSC 4BTTB 2FYRA 3RM2H 1O3HA 1BRAA 1XUKA 3HPTB 4KP0A 1GVLA 1UCYH 5E0GA 3SNAA 1NY22 4OGYA 1S0QA 3VFEA 4DJZB 2JH6D 1LVMA 1C1QA 1S82A 2AERH 2NU1E 2OCVB 1BBRK 1Y5BT 1WU1A 1A0JA 2W7SA 1A4WH 1CSOE 1AHTH 3GYLB 4JZEH 3M7UA 5EU8A 1QY6A 1W10U 4E7NA 3KEEA 2QN5T 2ASUB 4D9RA 2G4UA 1BTPA 4BAOB 4HGCA 4B2CA 1JIRA 2AYWA 1HAVA 2EI7A 3LC3A 1IAUA 4GLYA 4AG2A 3BTKE 1V2KT 1AB9B 1IQHA 4WH8A 1CHOG 3HK3B 1SGNE 3A7XA 2GCTB 5F8ZA 2AGEX 4ABIA 3SO3A 7LPRA 1NTPA 1O3PB 1DY9A 2BVRH 1RTFB 7GCHG 3TGKE 2F9PA 4A1TA 3GCHC 2GDDA 1YC0A 4NSYA 1DPOA 4X6MA 1V2NT 3OSYA 1BMMH 1O5CB 1SLXB 2C8ZB 2HNTF 5HXFA 1WAYB 4YESB 1SFIA 1EOLA 2B5TB 1V2LT 4OS1A 3KQDA 3U1JB 5C1UA 1G36A 1SHYA 1BBRH 3GY5A 4GPGA 1QCPA 3BTFE 1O5DH 3PMAB 1YCPM 1AI8H 1DOJA 1WOFA 2A7JA 4WH6A 3SUGA 3TIUA 4I8HA 3Q76A 3KIDU 2ZTXA 1K28D 3PMHB 4OGXA 2TIOA 3LGTA 3SU3A 1QBOA 2VIWA 2VIOA 5FX6A 2AIPA 1T4UH 3HGPA 1G32B 2P8OC 5JPMH 2BQ7B 1TRYA 3FVFB 3M5NA 3A84A 3RMLH 2BY7X 5T6DA 4UD9H 2FTLE 1XUHA 2O8WA 1A3EH 1XUGA 1FI8A 1HXEH 1FMGA 1TNJA 4K1TA 3SV6A 1ZJKA 4H6SB 3KQBA 3HKIB 1YGCH 1Y8TA 1TWXB 1TPPA 1SR5C 2YOLA 4K60A 3H7TA 1GBTA 1YPLH 1HGTH 1AVGH 2GZ9A 3MWIU 1CO7E 3A8DA 1DS2E 1GBAA 1GDNA 1TFXA 2ZDVH 3LOXA 1RIWC 1TMUH 1ZMLA 3LH1A 1BA8B 1ETSH 2KAIA 5GCHF 3ATLA 1T8MA 2BHGA 2FOMB 4CH2B 1OPHB 3RXIA 1AIXH 2FLRH 1XX9A 4KTUA 4B1TA 2YNBA 4F49A 3ZVCA 2XWBI 1O2GH 2G52A 1C1OA 5AHGH 1NU7B 1EX3A 3EYDA 5LH8A 2SGFE 5L6NH 5L2YH 3F9HA 4AFQA 1Y3VA 3RDZA 4YT7H 1Y3WA 1DSTA 2ZDNA 1CT0E 2I6QA 2A31A 3A7YA 2PLXA 2FO9A 1JWTA 1XVMA 4B2BA 4I33A 1S0RA 2A45B 5DP5A 2PKAA 4Q80A 2FOFA 1DFPA 1K1PA 1YYY1 1V3XA 4INKA 4TYDA 3D49H 3T26A 2F9OA 1F92A 2ZFQH 4MPUA 1IQJA 1UJ1A 4GAWA 1TA2A 2FOCA 3VGCC 1AWFH 3GY7A 3LU9B 3ZZDA 6ESTA 3RMMH 1HBTH 1KDQB 1Y5UT 1C9PA 1O2TA 8ESTE 2TGAA 1P09A 4I8JA 3EGKH 1EPTA 1GGDB 3P8OA 1O32A 2GCTC 1HPGA 1HV7A 2A7HA 1GI4A 3ZZ7A 1JMOH 1KIGH 3NXPA 4CRFA 1BMNH 4FUIA 1C2MA 1HCGA 1W7GH 3M37A 1OOKB 1MMJN 4MPXA 3MNBA 2J4IA 3TH3H 3K6ZA 4K8BA 3UQVA 3FZDA 1EJNA 5K7RA 3M3SA 2BY8X 2OXSA 1P06A 1EAXA 4Y76A 3RP2A 3SU4A 3O8RA 1P2JA 1KSNA 3QTOH 3ZYDA 4A92A 1QR3E 1UK4A 1KTTB 2OLGA 1KLIH 5GJ4B 4WF8A 3RU4E 4IW4E 3KHVA 5A8ZA 3TITA 1MBMA 1NFUA 2WUBA 1KYNA 1O36A 2FZZA 2BLVA 1CA0B 3RC5A 1BJVA 4AYYB 1RFNA 2ANMH 1IQMA 4JZDH 2WUCA 1GMDF 2FOGA 2A32A 4WWYA 2TPIZ 1P02A 1ZOMA 1Z71A 1Z8RA 4ABBA 1O5BB 1FLEE 2WYJA 1BTYA 1LVBA 1W7XH 1O3MA 1QB9A 4Y0ZE 3SV8A 1UVPA 2AEIH 3MNCA 4Z6AH 1ELFA 1AE5A 1TNGA 2TGDA 3BG8A 1QL8A 2Y7XA 4MDSA 1C1MA 3RMNH 2PUXB 1C2KA 2O8MA 3SUFA 1WTHD 1C5RA 1C5WB 3FP7E 2BLOA 5C3NA 3BIUH 2P8OB 2A7CA 2GMTC 1AD8H 3OX7U 3I78A 1Y59T 1DE7H 1K1JA 5A09A 1V2OT 1GJBB 1AKSA 1N6XA 1GMCG 1O2YA 3R0FA 1G2LA 4J2YB 5EG4A 3SUEA 2BD3A 4X6OA 1SBWA 2BD2A 4AFZA 2IN2A 2H6MA 3A7VA 4FUBA 3QK1A 1P3EA 1D3QB 1GHAG 4LXBH 1GI5A 1DT2A 2H9HA 4DURA 4AX9H 1YLCA 5JB9S 1HAHH 2PKSB 3QZRA 2TGTA 5FBIA 1NZQH 1O5EH 2VIVA 1SLUB 1OS8A 2Z9LA 4X1QU 2FYQA 1RRKA 2SGPE 5EPYA 1GBLA 1AO5A 1O2JA 2ZGXH 4U01A 1FONA 4LZ1H 3E6PH 3A85A 3SJKA 3LDXH 2VVCA 2XC0A 1NS3A 4FU9A 1P2NA 2CGAA 1WSSH 1O2OA 1SLWB 3GCTG 4K3JA 1SOZA 1GHBF 3H5CB 1Z6JH 1C1SA 3O8DA 4Q7YA 1FY1A 6GCHF 8GCHF 2ZGHA 1UTMA 2WPMS 1ID5H 3V7TA 4ZKOU 5LGOA 2UUFB 1GMHG 2FS9A 2UWOA 3IWMA 1A3BH 2FIRH 2R0LA 1TMTH 5LPEA 5IDKA 1WBGB 5FHTA 1FN6A 3BTEE 2GT8A 1C5VA 1Z7KA 1P03A 3A83A 3E3TA 3F1SB 3EE0B 4UEHH 2I6SA 4CBOA 1GJ8B 1ZTJA 3LPRA 3UUZA 4U30A 2ZC9H 4OS5A 1P3CA 1AE8H 1GG6C 3P70B 3KF2A 1TGSZ 3SQEE 5CMXH 1EZXC 1EASA 4HFPB 3OU0A 1MTWA 3V0XA 2Z9IA 1S84A 4XDEA 3VXEH 2J2UA 2ANYA 2NU4E 1HXFH 4ISHH 1TPSA 1NU9A 4IGDA 4K1SA 4ZH8A 4D76A 1LKBA 3K2UA 1W8BH 2OD3B 1ETRH 1EAIA 1GBMA 2Z6BD 2BZAA 2QYIA 3SNDA 2HGTH 2A5AA 3RXLA 1GI0A 1PPEE 2PGQB 2VGCC 4HZHA 2FLBH 1C1NA 4Q7ZA 4TY6A 2CN0H 4H42U 1DXPA 1PPCE 1C5XB 3GY8A 2Q6DA 1O3DA 3EAJA 5EXMA 3RXPA 1KXFA 1NFXA 1CU1A 1T8NA 3GICB 4D8NA 1YPEH 2BYAX 4WMDA 2Q6GA 1UTLM 1UVTH 2CXVA 3VB5A 2R3YA 2ZCHP 1O2PA 4IC5A 3Q3XA 2B8OH 1MH0A 1GJ7B 2J92A 2XBVA 1G37A 1OYTH 3LT3A 3PO1B 1W2KH 1ELGA 4QT8C 2ZFRH 3PROA 1A2CH 3SBKA 3STJA 1ZSKA 1BMAA 2FX4A 3DD2H 3E0NB 1F7ZA 2ODPA 2HRVA 9ESTA 1DICA 4NWLA 1OWJA 1LHFH 3ZV9A 2ZU1A 2AMPA 4IC6A 1DUAA 2BD8A 1IQFA 1TE0A 2TRMA 3B9FH 3OY6U 2BMGB 5HYOA 1LQDB 1EPTC 2Z9GA 3ZZ8A 2EC9H 1NRRH 3GCTF 1TA6A 1TQ0B 3M3TA 1TMBH 3M7TA 2H5DA 4D7GA 3QO6A 4OS4A 4MNWA 4UE7H 1GL1A 4M7GA 2BXTH 1ZGIA 1BDAA 1SFQB 3STIA 1F2SE 5AVDA 2XCFA 3ZVDA 2D26C 1YKTA 1QL9A 2F91A 3PYHA 1MZAA 3KN2A 1GBCA 1ARBA 3E0PB 2W7UA 5FCRA 1ACBE 3RUOA 1AVWA 2BQWB 3E16B 3RXSA 1NN6A 1EZSC 1KDQA 2F83A 1MTNB 4ABAA 3BEUA 3K65B 2C3SA 1ANDA 3AW1A 1Y5AT 1SC8U 1ZRBA 1BRCE 4KTSA 1GMDG 1LHGH 4DIHH 1SQAA 1ZSJA 1ZHMA 1ANCA 5DP7A 3O8BA 2OQ5A 2H2ZA 3GOVB 4X2YA 1LTOA 4I8LA 1E37B 5DK1A 3PWCA 1OYQA 1ZPZA 1TX8A 4ZXXH 3TNTA 4GVUA 1N8OB 3FAOA 2VU8E 5A8YA 3PV4A 2P59A 2QAAA 1SLVB 4JCNA 1EAWA 4I32A 1O2KA 3G01A 1DX5M 4B71A 2ZNKH 2ZA5A 2VNTA 2BD9A 1C2LA 2W5EA 3U8RH 3RXHA 1PYTD 1C1RA 1H9IE 2VJ1A 3PLPA 3SU0A 1W0ZU 4OS7A 3SHAH 2JKHA 2ESTE 1J17T 2GKVE 1C5QA 1BT7A 1QTFA 4TPYA 1G9IE 1GL0E 1UO6A 1FN8A 3EA7A 1AFQC 3U98H 2FTMA 4XOJA 1W3CA 1F5LA 1SGFA 1E0FD 1N6YA 4AYVB 4YTAA 1DWDH 3M7QA 2CF9H 4TWWA 3U69H 3F9FA 1B0EA 3SI3H 3ZZAA 1O39A 3BEIB 3GDUA 1IHSH 3A7ZA 4K1EA 1ABIH 2GD4B 4I7YH 3P8GA 3SI4H 4CREA 1K1NA 2G00A 4Y11E 3VEQB 1IHTH 5DO4H 3M5MA 1O0DH 3VB4A 2GP9B 2CF8H 1O3OA 2A5IA 1GHAF 4NIWA 1F0UA 4FVDA 1MTSA 1AQ7A 3QGNB 4WY3A 6GCHG 6LPRA 1BTWA 3F9GA 3LC5A 4NA7A 1H1BA 1O3IA 2ZKSA 1K1OA 1MCTA 1F0TA 2D2DA 3A8CA 4AB8A 1CBWB 1ZLRA 1O2WA 4Y0YE 3LGUA 3W95A 2C8WB 3BTGE 1K1MA 2PR3A 1DVAH 3SU2A 1JXPA 5A0AE 1FY8E 1ZGVA 3SHCH 3SNCA 1G3CA 1WQSA 1Y3YA 2B0FA 4WXIA 1DY8A 3BTHE 2XWAA 4X1NU 4CH8B 3T29A 5EPNA 1O2XA 1SMFE 1XXDA 3S9CA 1ESAA 2XYAA 2ZDAH 2VVUA 3PTBA 2FI3E 3SU6A 2TBSA 1J14A 1MD7A 1MUEB 2RDLA 5FX5A 1YPGH 1L1JA 4X0WU 1A1RA 4MVNA 1TBZH 3PTNA 4FUGA 3U9AH 2NU2E 3I77A 3LKWA 2DE9A 4X8VH 2CHAC 4X1SU 3PM3A 4YOGA 3RU4T 2Y82A 1E38B 3UNRA 1HB0B 2BDHA 3UNSA 1T4VH 1UVSH 3TPIZ 1K9OE 4BXWA 2G5VA 4CR9A 4BTIB 3A81A 1YM0A 1X7AC 2OTVA 2XC5A 1EJAA 4LZ4B 5C1YA 4AG1A 2RA0A 1P2OA 3MU0A 1HAGE 3A7TA 5F03A 1O3JA 2ALPA 2Z94A 2FEQH 1XUFA 1ELVA 1IQKA 2ZPQA 3P17H 2RG3A 3NZIA 2F9VA 2P16A 4SGBE 2J38A 1HDTH 1RGQA 1ORFA 3IG6B 2NWNA 2VIDA 5EQSA 1TYNA 2PGBB 4CRBA 2FM2A 1MKXK 4FVBA 2EEKA 1O2UA 4DIIH 3ZVAA 1CVWH 1GMHF 1ZTLA 1ARCA 1HAOH 1M9UA 1TX7A 3QDZB 1KXDA 1B5GH 1EKBB 2ANWA 1GJ4H 2Q6FA 1SGRE 4H4FA 2P94A 1HRTH 2BLQA 1O2ZA 1OP0A 1UTKA 4GHTA 2C93B 3SU5A 1HAIH 1PQAA 2HPQH 1FY4A 3D65E 1Z6EA 5C5OA 2PW8H 3P8FA 3KQCA 1FXYA 1O2HA 3MFJA 5EOKA 3GDVA 2C8YB 3PLBA 5HM2A 1ZPCA 3BIVH 4MNXA 1SGPE 1F5RA 1ZSLA 1GCTC 2SNWA 4CR5A 1C1PA 2PTNA 4E7RG 3WY8A 1CGJE 2BY9X 4JK5A 1HIAB 1SGYE 1MZDA 2EI6A 5DP9A 2ZHFH 4XBDA 2WINI 1S6HA 1V2TT 4A1XA 3QN7A 3MU1A 4VGCC 3UOPA 4ZHLU 1ZMJA 1IQGA 2J9NA 1C5ZB 2BTCE 3BTTE 1HAYB 2BDBA