3LGIA

Structure of the protease domain of degs (degs-deltapdz) at 1.65 a
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
220
structure length
220
Chain Sequence
FDSTDETPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease degS
publication title Allostery is an intrinsic property of the protease domain of DegS: implications for enzyme function and evolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 56
structure length 220
sequence length 220
chains with identical sequence B, C
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2010-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3lgiA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3lgiA02
3GCOA 1GI9B 3A84A 1GG6C 1TBRH 3RXSA 1C2FA 3LIWA 5FPSA 3D62A 1T32A 3T2NA 3GY3A 3RC6A 2Y7ZA 4XFQA 1UMAH 1DUEA 4FUHA 1AE8H 1O5BB 1ZTJA 4GLYA 4Y76A 1LVMA 3UNRA 1C9PA 2PW8H 1W11U 1C5LH 4OS2A 4THNH 4FUEA 4Y6DA 1GDNA 3BG8A 1C5XB 2SGPE 4SGAE 4JZFH 2O8WA 2NU2E 4BOHA 4MVNA 3TU7H 2AH4X 4NIVA 2ZO3H 1YPHE 5AFZH 3HGNA 1K1IA 3M35A 3DFLA 1TMTH 1VITH 1AMHA 2ZHDA 1C1VH 2QAAA 3IG6B 3A7WA 1O5DH 3V13A 1HLTH 1W7XH 3PB1E 1YCPM 1O37A 3MMGA 1Y3YA 1W8BH 1TX8A 5E8EH 4IN2A 1EZSC 4OGXA 1DSUA 2GDDA 1C4V2 2W7UA 2QC2A 2R9PA 2VH6A 2SNWA 3SU6A 1XKBC 3SGAE 2D8WA 2A5IA 2BLVA 3QO6A 1UCYK 4UONA 1OSSA 1O36A 1DANH 4INHA 1HAVA 3U69H 1LKAA 1GCTC 1OWDA 2XW9A 5DP5A 1XUGA 1TQ7B 2ZGHA 2Z9JA 2B9LA 1LHCH 3SW2B 1TE0A 2BD8A 4H42U 4CR5A 1S0RA 1GVLA 1L4DA 3A83A 1C5VA 1ESBA 3F9FA 2VVCA 3ZVDA 1E37B 1EZXC 4AG1A 1O2QA 5L30H 3ZZ7A 3B23B 5HM2A 4ABHA 5FBEA 1C1TA 1GI3A 4VGCC 5F8XA 4YT6H 1EPTC 4Q7ZA 4LXBH 1J17T 2VIVA 2Y5GA 4KTUA 3D65E 1O2IA 1V2OT 1LPZB 1NN6A 2EI6A 1FQ3A 3PTNA 1TRMA 5FAHA 1O2OA 1IQIA 1AFEH 5CHAC 3G01A 3V12A 1GVZA 5SGAE 1KIGH 5JBTA 2IPHA 1O3MA 1AWFH 2WPIS 2IOTA 2FOBA 1ZGIA 3ZZ3A 1T7CA 2F9OA 4ABFA 2A32A 2Z3EA 2V3OH 1F0UA 2F9BH 3RXOA 2ZC9H 2ZU4A 3NUMA 4ZXYH 3SI4H 4CRCA 9LPRA 1C1PA 3LT3A 3KN2A 3RDZA 4DG4A 3O8CA 3LC3A 1EX3A 4O3UA 1RIWC 2BDBA 1P12E 1YPEH 2G81E 1QRXA 2GMTC 1PFXC 1HAGE 1D4PB 3MU0A 1M9UA 2TRMA 3OX7U 1HIAB 3O8RA 2TGTA 1PYTD 3NPSA 3PLKA 3QZQA 2B5TB 1GBTA 2D1JA 3GCNA 4I8LA 4ZKRU 1THSH 4K5ZA 1AD8H 3A7YA 1YPHC 1YBWA 4NA8A 1AY6H 1ELTA 2BVSH 3FANA 2G5NA 2XBVA 2CV3A 2WPMS 3UREA 3LPRA 2SNVA 3QGNB 3MTYA 1W3CA 1RTLA 2C90B 4OS1A 1DWBH 1GI2A 2XBWA 3TH3H 3JZ1B 1D3TB 1ZPCA 4JYVH 4UFEH 1ELVA 2W3KA 1HNEE 5A8YA 1K21H 3MH4A 1SGIB 5DP7A 1XX9A 4WF8A 1C2MA 1O3BA 1PJPA 1SQAA 3ZZ8A 1C1SA 4K1EA 4MNVA 5AVDA 3T29A 3NZIA 1RTKA 6GCHG 1LVOA 4BTTB 1FNIA 2WPKS 1L1NA 1MTNB 1BJVA 3MO9A 3P70B 3RM0H 1TFXA 3MU8A 4HI3A 2BY6X 1K9OE 4GHTA 1C2HA 3ZZBA 3GY5A 1AZ8A 2BDAA 4FUIA 5TCAA 1TX7A 3T5FH 3SHAH 2BTCE 3BTDE 1VZQH 2Z9GA 2HPQH 1GBIA 1MZAA 3F9EA 5EQRA 2PKAB 3CENA 5FX6A 3E16B 4BAOB 3Q77A 1GBLA 1ACBE 1P3EA 1QGFA 2CF8H 1QBOA 1O0DH 3N7OA 1EAUA 2ZPSA 3H7OA 3STJA 1GVKB 4YOGA 5CE1A 3LH1A 1TQ0B 2F9UA 3A8BA 4GPGA 1EQ9A 4Y10E 3URCA 3ZV9A 4K3JA 1O2LA 3M5OA 1MBMA 4I32A 1CA0C 1QL8A 1F0TA 3RXBA 2GCTB 1FIWA 4BAMB 5GCHF 2BLWA 1LTOA 2BXTH 3KCGH 3TITA 1MTSA 1DFPA 3OY5U 2KAIB 1QURH 2P3FH 3TGIE 1HIAA 1L4ZA 3KF2A 4ESTE 1G30B 4B2CA 4YOJA 1YCPH 1ANCA 4MNYA 3P8FA 1UTOA 1S85A 4KP0A 3RC5A 2RA3A 3PO1C 1PPEE 2JKHA 1GBAA 1IAUA 3LGWA 3RC4A 1RGQA 4ISOA 1UTJA 1FXYA 3BTME 1GBCA 1XUIA 2YNBA 2ZGJA 1ETRH 1S0QA 2C8ZB 2GX4A 1ELDE 1ZJKA 4INLA 3TNSA 1O33A 1P09A 1EUFA 4XDEA 1YPLH 4X1NU 4MLFB 2HLCA 4K8BA 1GI1A 4O97A 1SGNE 1HAYB 1LQEA 1Y3XA 2FODA 2FS9A 3RMMH 1HB0B 1BB0B 1NRPH 1OOKB 1QIXB 3LONA 2TGAA 1BTXA 2EI8A 2GVFA 1P11E 1O2TA 3Q3KA 2FOAA 2FYQA 1Q2WA 1GG6B 3MH5A 4ISLA 4CBOA 3DUXH 1QCPA 1O3HA 3TPIZ 3GCTG 1C2DA 2PKAA 3ATIA 3QK1A 4TWWA 2Q6DA 3BN9A 4K69A 4E06H 1H8IH 8ESTE 4IS5A 1LHEH 3PROA 4I7YH 1CSOE 1O5FH 1DS2E 1SHHB 1EAIA 3A88A 1P9UA 2ZFRH 3RXHA 2ZU1A 1F5LA 1VJAU 8LPRA 1YP9A 1BRBE 2ILNA 1O2MA 1AUTC 1GJ4H 4KELA 1FV9A 3VXEH 4Q80A 2ZA5A 1GJ5H 3A8CA 1C9TA 2WPJS 3SV7A 1BCUH 1GMDF 1H9IE 2HOBA 2AMQA 3PMHB 3KHVA 1AO5A 2F9PA 2SFAA 4ISNA 2KAIA 4AB8A 1XUFA 2FS8A 4JZ1A 1RD3B 1UCYH 3SZNA 4WVPE 3RXJA 1C1MA 1GBMA 4FUCA 3TNTA 1PYTC 4XE4A 1CGHA 2Y5FA 3KL6A 1MQ5A 1SGDE 1UVOA 1BHXB 3AASA 5F8ZA 1O3DA 3T27A 3SU0A 1MKWH 1DX5M 3K65B 1UJ1A 2ODQA 1SI5H 1O2VA 1P2NA 2Z7FE 1GJ8B 1GCTB 3RXDA 2NU3E 2FO9A 4Y8ZA 5C5NA 1CA8B 1P57B 2J95A 2HVXA 2FESH 3DFJA 1AU8A 3ATLA 4Y7AA 2YNAA 2ZTYA 3TK9A 1KXFA 2JH6D 2XC0A 3DT0H 1EATA 1DXWA 5A8ZA 1IQEA 1OPHB 1O3JA 5FCKA 1O5CB 3FP8E 3SQHE 4K2YA 4X8SH 4CRDA 2NU4E 2FEQH 5GWZA 2BOHB 1MKXK 4VGCB 5JYIA 1XUJA 1EPTB 1TMBH 3GY2A 2V6NA 1BHXF 1IQFA 1LPKB 2ZTZA 1TONA 2VINA 4PROA 2CMYA 1VCQA 1VCPA 3M7UA 4WXVA 5A0AE 2VVVA 3UUZA 1OWJA 3EQ0H 1K1JA 1BUIA 1QL9A 1S84A 3FVFB 5H4IB 4RN6A 3MU5A 5DP4A 5CHAB 4CREA 1O2PA 1PQ7A 1SOTA 1GHXH 2FWWA 1A4WH 3KNXA 8GCHG 2B7DH 2WYJA 3CP7A 1EAWA 1C2KA 1NFYA 5DGJA 5EGMA 5T6DA 4F4OC 3Q3YA 5J4QA 4YZUA 4YOIA 2G00A 4AFUA 1O2XA 1P2IA 1NZQH 1RIWB 1GHBG 4D8NA 1GI7B 3M3TA 2GMTB 1GJ6A 2J92A 4X2VA 2H6MA 1KYNA 3GISB 5I46H 2OBOA 4JZDH 4AYVB 3SHCH 4X0WU 1AQ7A 4AFSA 1W2KH 1O5EH 3K6YA 3SU3A 2K1QA 1Q31A 5F03A 3TK5A 5LGOA 3TK6A 1O2WA 1DPOA 2BDCA 1FY8E 1GWAA 1P02A 2ZU5A 4MTBA 3MOCA 5FPYA 3S7KB 1N8OC 4X2WA 1TNJA 3GY4A 2ZHFH 3RU4T 1QQ4A 4NWKA 1O3FA 2LPRA 1SLWB 3OYPA 2OC8A 1GHWH 1YC0A 4CRAA 1O2JA 1Y5AT 3DA9B 1NFUA 1KTTB 2QXJA 4AFZA 1V2UT 2PKSC 1THRH 1AZZA 1GDUA 2FOCA 3U8TH 5HM9A 3MNBA 2GKVE 1J9CH 1SGFA 2OLGA 1E38B 1SG8B 1TRNA 4JMYA 4TPYA 2THFB 1LDTT 2ZQ2A 4FUJA 4YT7H 1NRQH 7GCHF 5E2OA 1G3BA 4FU8A 1H9HE 2CHAC 1RXPA 1O39A 1BTWA 4ZMAH 3EAJA 5GJ4B 1SC8U 4NGAH 1EPTA 5TCCA 1C5WB 1TGCA 3M37A 1KXDA 3LU9B 3RU4D 3URDA 4K8YA 3TH2H 3RLWH 2EC9H 4AORA 4NZLA 3T26A 2ODYB 1ZLRA 3B9FH 3E91A 1W13U 4KGAA 1YGCH 3BIVH 1WU1A 1ETSH 1O3GA 4NA7A 2FI5E 5L2ZH 1TYNA 4MPVA 4B1TA 2ZDAH 5IDKA 1JBUH 3OSYA 3SGQE 1T8MA 4I33A 1O5AB 1O38A 2A7HA 2BM2A 5C20A 1HAOH 3B8JA 1C5YB 4D7GA 1AVWA 5HXFA 2A7JA 4DVAU 4AYYB 4NSYA 1TAWA 1CA0B 2H9HA 2A4GA 1QJ6B 1MAYA 3KQDA 2J2UA 4X1PU 1AHTH 4GUXA 1LMWB 5G4BA 1UHBB 4JZEH 5DP9A 4IMQA 3S9CA 3EGKH 1GCDA 1C5SA 2ZKSA 2CJIA 1OP2A 3MNSA 3PLBA 1TGTA 4UFDH 4Y8XA 1E0FD 4BAHB 3E0PB 2P8OC 2DUCA 1HAZB 1V2LT 4MG3A 8KME2 3C1KA 3HK3B 2ZFPH 5E0GA 1O3PB 3OU0A 3A7ZA 4QT8C 1GBEA 3GY8A 2PWXA 1G3DA 2QIQA 1UVSH 2A1DB 2STAE 4GHQA 4WY3A 4DOQA 4X8UH 4ZUHA 1G3CA 2VNTA 5DP8A 1UCYE 1IQHA 1C2EA 3RU4E 2ALVA 1OXGA 3PO1B 4U32A 1CGIE 3M3VA 5L6NH 4B74A 1AGJA 1DDJA 1YYY1 2AGIX 1P8VC 1GJ9B 4MPWA 2CXVA 3F68H 3UR9A 4BTUB 1BDAA 2BOKA 1ELGA 1ARCA 2VB0A 1LKBA 3RXIA 3M61U 1P2OA 4B2AA 3VB4A 2FP7B 1CQQA 1UTNA 1S82A 1EXFA 1ID5H 2OINA 3H7TA 3KIDU 3SV8A 4X1SU 1NU7B 5TJXA 1FN6A 4O9VA 1O2RA 2ZEBA 4ZKSU 1AIXH 1ESAA 4JYTA 1Z8JB 4OS7A 3ATKA 4Y0ZE 3LGVA 1C5PA 2ESTE 2ZIQH 4TYDA 4NG9H 4DJZB 4Y7BA 2GCHG 5EXMA 1Q3XA 5DPAA 1FAKH 3A8AA 3V0XA 4WMEA 1V2JT 1HJ8A 1N6XA 3M5MA 3ATMA 1SGEE 4ABGA 1UK4A 2QXIA 4RSPA 3TGJE 3UWIA 4MNWA 1MTVA 1QB6A 4ZAEA 1KXBA 1FONA 1SVPA 1TA2A 1YLDA 2ODPA 1QR3E 3U9AH 2Y82A 4ABDA 1D9IA 2Z3DA 4CRBA 1ELAA 3VXFH 4A6LA 1S5SA 1YPGH 3NK8A 2A2QH 1UHBA 3SNAA 1TX6A 1TALA 2NU0E 1A5IA 5GXPA 1J8AA 3A86A 1LCYA 3KQEA 1C2JA 3E8LA 1SHYA 2XYAA 3DD2H 1UTMA 2BD3A 2ZG0H 3MH6A 4U30A 1UTPA 1O2YA 3EA7A 1BIOA 4B71A 2ZGCA 1JWTA 4X6MA 4JK5A 4ZHLU 1C5OH 5JBCS 1GJ7B 5DJ7A 4I8HA 1ORFA 1CVWH 4Q7XA 2ZCKP 2FX6A 1SSXA 2XCFA 1D3QB 1NY22 3LGYA 4H6SB 4OS4A 3S69A 3Q3XA 1FIZA 2OC1A 1KLIH 1B0EA 3RXVA 1SBWA 1AUJA 1FZZA 1KXEA 1WUNH 2RDLA 3GCHC 1QHRB 2AGGX 4TPIZ 5DK1A 1GJBB 2DE9A 2ZPRA 1G3EA 5GIBA 3CS0A 1ANEA 1SGCA 1ZRKA 2J94A 3QZRA 3L6PA 4NIXA 1E35B 3PWBA 2HNTF 1WQVH 2BYAX 1N1LA 1H4WA 1ZSKA 1O2SA 1PPCE 3A80A 3BTFE 1OS8A 3SU1A 2FI4E 1JMOH 1JRSA 3UFAA 5LPEA 1ABJH 2GV6A 4ABIA 5C1XA 1GPZA 1K1PA 3NKKA 1Y8TA 4NIYA 3BTEE 1BTHH 3VB5A 1V2PT 1MQ6A 4NFEA 2G52A 4E05H 2Y5HA 4X1QU 4WMDA 2VIDA 2HRVA 3SU2A 4A1XA 1D6RA 3ODFA 2VWOA 4FUBA 4NIWA 5LH8A 1H9LB 2BY5X 2GGVB 3UY9A 1SLVB 1VITF 4LK4A 4K1TA 2P3TB 3PMAB 3ZYDA 3BSQA 2PUXB 2P94A 3SJIA 3O8DA 1W0ZU 4R8TB 3K9XB 3TGKE 2PV9B 3M5NA 4X8VH 4JK6A 3SORA 2VVUA 5DKMA 1SPJA 1XVMA 1FY1A 3PMBB 3QGJA 1ZSLA 4RKOB 4IGDA 4XBCA 2STBE 3FZDA 1IQLA 1SGRE 1SGFG 1Y59T 1QA0A 1MZDA 3ZZ9A 1UK3A 1TA6A 4Y8YA 1GMHF 1FJSA 2AMDA 2FTLE 3A7XA 2AIQA 5EODA 1SQTA 2WYGA 3P8NA 1UVTH 5AFYH 1ZRBA 1O32A 4ZROA 2XCNA 3E3TA 2F91A 1T31A 3PMJA 3E6PH 1O3OA 5EPYA 1QL7A 4ABBA 1N8OB 2FPZA 2TBSA 1HAIH 4BNRA 7LPRA 1FI8A 4GCHF 1A7SA 9ESTA 3SQEE 5JB9S 2W7SA 1ELEE 4XBBA 1ELCA 1AVXA 1NO9H 2PKSB 1BQYA 1F5RA 5A2MH 1PQ5A 2A31A 2ZNKH 2BB4A 3LH3A 1HAXB 1VGCC 5BRRE 1K1MA 3GOVB 1YKTA 2JETC 5JBBS 2CHAB 2RG3A 2BDGA 1GI5A 3DHKH 1IOEA 3HKIB 1TGBA 4X6NA 3MH7A 1NS3A 5EW2H 3KGPA 3TVJB 2YOLA 2BDHA 3TJNA 4GSOA 2FLRH 1DOJA 2J4IA 2P3UB 4NWLA 2ZTXA 4LZ1H 2BD5A 1KDQB 1WBGB 4ISIH 2QYIA 5A0CA 1S81A 1O3EA 2BVXH 1C4U2 4YM9A 1MTWA 1V2TT 2BDIA 4OS6A 1MBQA 1EOJA 1HV7A 1J16A 2I6QA 1TRYA 1C1RA 3MFJA 4ISHH 1CHOG 1C5MD 6CHAC 2PUQH 1TNKA 1VJ9U 1JIRA 1TGSZ 1CU1A 1H1BA 3LJJA 2QCYA 1F0RA 2ZGBH 1FUJA 1GBKA 4FUDA 3RXPA 4A7IB 2FDAA 1S6FA 2R2WU 1EOLA 2AIPA 1GBDA 5B6OA 1C1NA 2W3IA 1ETTH 2H5DA 2EEKA 3C27B 4OS5A 2ANKH 2J38A 2RCEA 2P8OB 5JB8S 2F3CE 1XUKA 3EA9A 3ESTA 7ESTE 1C5NH 3UTUH 2P93A 2WUCA 3VGCC 4XSKU 5A8XA 2XWAA 2GD4B 1Z6JH 1ZPZA 1SFQB 4RKJB 2HPPH 5FXLA 1HYLA 5T6GA 5T6FA 2WV4A 1UTQA 2C8XB 1SB1H 1T4UH 4Q2KA 4F49A 2ULLA 1DLKB 2GZ7A 4H6TA 1KXCA 2OBQA 3M5LA 1DY8A 2ZCLP 3TJUA 1TLDA 1GMCF 3BEIB 1OP0A 1O3IA 2FOMB 1O35A 2UWPA 1LHGH 2NWNA 1G37A 4GVUA 2ZU3A 3UNQA 4A5TS 4I31A 2ZECA 2ZHQH 1Z8IB 1SOZA 2VIWA 1HGTH 4X6PA 1FN8A 2ANMH 2ZHEH 2V35A 5EU8A 2VWMA 1GI6A 4HFPB 1PPFE 2AEIH 1C2IA 2OC7A 3KQCA 1JRTA 1CT2E 4JZIA 4UFFH 4YLQH 2TGDA 3KEEA 1KLTA 2C4FH 4O3TA 2GT7A 1O5GH 3F9GA 5HGGA 1O2HA 1SGTA 1AVGH 1CBWC 3FP6E 1O34A 2ALPA 5GDSH 3MYWA 4X6OA 3H5CB 2R0LA 1RTFB 4FXGH 3UIRA 2W5EA 1RJXB 5C1UA 5ESTE 1BZXE 2ASUB 2Z3CA 3GY7A 3VPKA 1ZPBA 1ZMLA 1V2MT 2VGCC 2JH0D 5LPFA 3ITIA 4BAQB 4B75A 1ZTKA 1OX1A 4ABAA 2VIPA 4NA9H 1G2LA 1O3CA 4UFGH 3FAOA 2V0BA 4Q7YA 2ZFFH 1D6WA 1V2QT 2J34A 1Y5UT 3SUFA 1L1GA 2QGRA 2XXLA 3ZZ6A 1GHVH 2GZ9A 2BQ7B 2O8LA 5EQQA 2TIOA 1IQGA 1C5TA 1NRNH 1SL3A 1Z1JA 1FDPA 1FPCH 4DIIH 1RFNA 1V2KT 4ASHA 2BX3A 1C2LA 3SOSA 1MU6B 2FXRA 1P3CA 2OUAA 1L0ZA 2OCVB 3ENSB 1HDTH 1F7ZA 2JH5D 3GDUA 3SBKA 3RXGA 1KTSB 3UR6A 3GCHB 1JXPA 1WV7H 3HATH 1MU8B 1ELFA 3SNEA 1DLEA 3RXEA 1FAXA 3V3MA 1BBRK 3MNXA 4YLUA 3TH4H 4INKA 4X2YA 3SUEA 2A5AA 1GHZA 1NTPA 1BRUP 4BTIB 1EZUC 1MUEB 2WPLS 3MO3A 3RXLA 1BTPA 1JOUB 2FX4A 1GBBA 1O3NA 4IMZA 2GZ8A 5DP3A 1HFDA 1GHYH 5FBIA 3RUOA 5DP6A 1GL0E 2Z6BD 5PTPA 1DM4B 3RXRA 3D49H 2XBXA 1FPHH 3WY8A 1O2ZA 1PQ8A 4IC6A 5BPEA 1TWXB 3MU4A 1W12U 4AZ2B 1G32B 2FMJA 2WUBA 3U1JB 1PQAA 3MI4A 1FY3A 3GDSA 1BT7A 1UK2A 2A4OA 1QB9A 1S83A 2Y80A 3UPEA 4CR9A 1Y3VA 1TB6H 2Q6GA 2PTCE 1HAVB 3EE0B 2R3UA 2VU8E 4E7NA 1T8LA 1MCTA 3HKJB 3ZVBA 3SI3H 1VITG 5A0BA 1YCPK 3PTBA 3O8BA 1C5ZB 4LZ4B 3SNBA 1O3LA 1TOMH 2FYRA 1Y5BT 3TLOA 1B5GH 2SGDE 2Z9LA 4H4FA 1HCGA 1TOCB 1ARBA 1BMLA 5AF9H 4DY7B 2BLQA 1GI0A 1GHAF 2PR3A 4UE7H 3QWCH 1EAXA 3GCTF 3LOXA 3K2UA 2G51A 3OY6U 3VB7A 1L1JA 4AB9A 1V2VT 3MO6A 1LHDH 1O30A 5C3NA 4I8JA 2PSYA 1QQUA 2J9NA 2O8UA 3M7TA 1GI4A 1AB9C 1P0SH 3BTGE 4YESB 3I78A 1DY9A 4AFQA 4ABEA 3GDVA 1MD8A 1GBJA 2DE8A 3LGIA 4FUGA 1V6DA 2XBYA 1OWEA 1FLEE 1OYQA 1QA7A 1TPSA 1VGCB 3S9AA 1O2NA 5GCHG 2ZDKA 1G36A 3VEQB 2JETB 5F6MA 3STIA 4GCHG 4AOQA 1NRRH 1W0YH 3JZ2B 2P95A 5EXNA 3SJ8A 1NESE 1YPKH 1EASA 3EYDA 4ZHMU 5C67A 2AGEX 5L2YH 4CRFA 4Z6AH 3QLPH 2BVRH 2GV7A 4B73A 1THPB 3BTKE 4CBNA 4WXIA 2AFQB 4IC5A 4BAKB 2EI7A 2R2MB 1LVYA 1K1OA 3RM2H 1Z71A 3P95A 3A8DA 2BMGB 1GJDB 2Y6TA 1MMJN 3LJOA 2G4TA 3R3GB 3AW1A 3MHWU 5C1YA 3RXMA 3PLPA 3E0NB 2IN2A 3U8OH 5J4SA 5A09A 4B76A 1DICA 3IITA 3U98H 2ZDNA 1K1NA 2BY8X 1AFQC 4TWYA 1IQMA 4A92A 4IBLH 1QY6A 1GGDC 4MDSA 4TY7A 3Q00A 3RLYH 6CHAB 4FVDA 1V2ST 5T3HA 2BHGA 3SNDA 4YTAA 4BXWA 1QJ1B 3ZZDA 1WAYB 2UWOA 1B7XB 3T25A 3MWIU 1CO7E 1F0SA 1NM6A 1MKWK 2PTNA 4WWYA 1EP6A 1HAPH 3F1SB 2WINI 1TNHA 2BD4A 2UUKB 2OTVA 2VIOA 1NPMA 4D7FA 5HYOA 3VGCB 4J2YB 3SV6A 4OGYA 3TJVA 3NCLA 4KTSA 3UOPA 1ANDA 1BMNH 3LC5A 1HAHH 1BITA 2ANYA 1XM1A 2FOGA 1TNLA 1GJCB 3I77A 1D3DB 1AN1E 1Z1IA 4HGCA 2FOHA 1O31A 2OD3B 1XUHA 1C1OA 1HXEH 5C5OA 1SGYE 1D3PB 1PPHE 8GCHF 2XC5A 4UEHH 1ZGVA 4HZHA 1C1QA 3LGTA 3PV4A 5FHTA 1GMDG 1NT1A 5GPIB 4TY6A 1EP5A 4X2XA 2QA9E 2ZDLA 3BTWE 2ZU2A 2NU1E 2Y81A 2BZ6H 1ZOMA 1QJ7B 3A82A 2PGQB 1EKBB 4AX9H 1DE7H 1DT2A 1GHBF 4X8TH 2BZAA 2Q6FA 1GMCG 2P59A 2Q1JA 4Y79A 4ABJA 2O8TA 1LPGB 2C8YB 3RMLH 2CF9H 1MKXH 4NFFA 1C5UA 2GTBA 4FU7A 2SGEE 3R0FA 4CHAC 1P9SA 1P2JA 1PPZA 1UVPA 2XTTB 1G2MA 1XXFA 3SGBE 4JCNA 1CBWB 1CHGA 4MPUA 5IYTA 1GDQA 2F9NA 2UUFB 3P8OA 5AHGH 2H2ZA 4SGBE 1ESTA 1W10U 3BF6H 4K1SA 1AI8H 1C1UH 3RXKA 4AGJA 2D26C 1KSNA 1TPOA 2AERH 1CE5A 1T8NA 1ZMJA 1BMMH 2VGCB 2A5KA 2H9EH 4XOJA 2ZI2H 3ZVAA 3CS7A 2QXHA 3BTHE 1BTUA 2Z9KA 1EB1H 3UNSA 5JPMH 3BEUA 4UD9H 1P2MA 2F9VA 2AS9A 4FUFA 2Z9IA 1A61H 2UUYA 2AMPA 2VWNA 2FOFA 2A0QB 3ZZCA 3SU4A 4WH6A 1UTKA 3T28A 4WH8A 2WPHS 3S9BA 3SUGA 3RXAA 2M5TA 1LO6A 2UWLA 2BY9X 3LKWA 1N6YA 2BDYA 2FZZA 1O3KA 2H5CA 2H9TH 5FPTA 2C93B 3QDZB 3RXFA 2V3HH 1YPJH 4ZHAA 1WOFA 5EPNA 5E0HA 1DSTA 3S7HB 1HJAC 3F9HA 3RMOH 3RMNH 3QX5H 1BBRH 3LDXH 2FOEA 2LNCA 3GICB 4FVBA 4U01A 2F83A 3ZVFA 1PPGE 2B8OH 1NRSH 3U1IB 1O2UA 3FZZA 5FX5A 1KY9A 1V2RT 1EJMA 3A87A 1QRZA 3RXTA 1QFKH 3GYLB 2HNTE 3D23A 3S0NA 1NFXA 2ZZUH 1P06A 3BG4C 2A4RA 2QY0B 4DCDA 1RS0A 1EZQA 3BTQE 1TBZH 2BLOA 4ZH8A 1WYKA 2A45B 4AGKA 3Q76A 3KQBA 5ETXA 4LOYH 1CGJE 1X7AC 2FM2A 3ZVCA 3AVZA 1Y3UA 3A7TA 4GAWA 2C8WB 3HK6B 2BXUH 2HWLB 3F6UH 1V2NT 2A2XH 3A89A 4XBDA 4WJG2 3U8RH 1MD7A 1SLXB 1QB1A 1FY4A 4BANB 5F8TA 3BV9B 1A5HA 1GI8B 2P16A 1NFWA 1W14U 1BJUA 1IQNA 1O2KA 3RXCA 3HPTB 4Z0KA 7GCHG 3L3TA 5EOKA 1A3EH 4IN1A 5E2PA 5LPRA 3ZV8A 1UVUH 3TIUA 2OC0A 2VJ1A 3VB6A 1P2QA 5JDUB 2XC4A 1SLUB 5DO4H 1MAXA 2SGFE 4AG2A 3PWCA 3SUDA 3SV2H 1GBHA 5C2ZA 3BIUH 2BD9A 2OQ5A 1U6QA 2QXGA 1C1WH 1QRWA 1ZMNA 1WCZA 4HTCH 1GL1A 1YLCA 4D9RA 4ZKOU 1J14A 1C4Y2 1FY5A 2ZFSA 2ZP0H 2VH0A 1K22H 1DVAH 1BTZA 1MTUA 4I8GA 2VWLA 3V7TA 2GCHF 1EJNA 4D76A 1IQJA 1TGNA 1TNGA 5CMXH 1P04A 1QBNA 4AN7A 2BD7A 3NWUA 2ZCHP 3SJ9A 1DWCH 3TJOA 2XWBI 1AB9B 2FIRH 1OWKA 3IWMA 2Z94A 1DWDH 1JIMA 5ESBA 1WTGH 4ZXXH 1GHAG 1Z6EA 1DWEH 3SJKA 2G5VA 2FTMA 1S6HA 2CGAA 2SGAA 3AAUA 3MNCA 1ZHRA 1OWHA 2BY7X 4WMFA 3ZYEA 2PSXA 2H1UA 1K28D 3W95A 4MQAA 1SGQE 4DW2U 7KMEH 2A7CA 2VIQA 2ANWA 1H8DH 1BRCE 3SO3A 4CH8B 1ZSJA 3AW0A 3UOUA 1HUTH 1ZTLA 1DXPA 1T8OA 4DGJA 1NU9A 1UO6A 1WQSA 5E0JA 1P01A 5EW1H 1C2GA 1FMGA 2OQUA 1TIOA 4U2WA 3OTJE 2I6SA 2CN0H 2PHBA 3P92A 1DITH 3HGPA 3AAVA 1XMNB 1V3XA 1WSSH 4JYUH 1GBFA 5K7RA 2OP9A 1F2SE 5K0HA 3UQOA 1MCVA 3P17H 1XVOA 2HNTC 6LPRA 3SNCA 5DG6A 1W7GH 4X1RU 1BA8B 4E7RG 4BXSA 1O3AA 2XNIA 4D9QA 1AFQB 2GT8A 1A1RA 1GGDB 1Z7KA 1K2I1 3FFGA 4I8KA 4NSVA 3P6ZB 3ZZ4A 3RP2A 3RXQA 3ATWA 4MPXA 1A0JA 1P2KA 1KDQA 1Z8GA 1BMAA 4R0IA 2ZHWH 2BX4A 4FU9A 1UTLM 1YF4A 1TNIA 2GP9B 3SV9A 1AWHB 1BRAA 5FCRA 3GY6A 1ABIH 3E90B 1F92A 2A4QA 4O03A 3ZZ5A 4DT7B 2O8MA 1AKSB 1B0FA 1PPBH 1EB2A 3QTOH 3L33A 1QBVH 2D2DA 2G8TA 5EG4A 1Y3WA 2R3YA 1T4VH 3GYMA 2RA0A 1E36B 1VR1H 5HMAA 1BTYA 3NXPA 3T62A 2ZDMA 2AYWA 6GCHF 1QNJA 1O2GH 1P10A 4Y11E 3ELAH 1L2EA 4A1TA 1ZZZA 1G9IE 1P03A 3I29A 1LHFH 3ODDA 1HXFH 3PYHA 2PGBB 4NZQA 2C3SA 4DURA 3PM3A 4B2BA 1KLJH 2SGQE 6ESTA 3UWJH 2QN5T 1TPAE 1HPGA 1ANBA 1SQOA 1MTNC 2IJOB 4MNXA 2BD2A 1BBRE 1XKAC 1SMFE 2O9QA 2GDEH 3E1XB 2ZF0H 2G4UA 2B0FA 3QUMP 1LVBA 1C5QA 1NROH 1YPMH 1ZYOA 3P8GA 4CHAB 2HGTH 3W94A 2ZDVH 2PLXA 1KXAA 2ZFQH 2W26A 1OKXA 5I25A 2QF0A 2PFEA 1OP8A 1ZHMA 2Y7XA 1A3BH 1SGPE 1V2WT 3MU1A 2FI3E 3M3SA 1P05A 4CH2B 5EXLA 1HRTH 2ZWLH 1RRKA 1TPPA 2R0KA 1TABE 4UDWH 3RXUA 5ABWA 1CT4E 2TGPZ 1ZHPA 1IHSH 2GCTC 4J1YA 1A2CH 3A85A 2XRCA 3M7QA 3ZVGA 1OWIA 1INCA 1J15A 3QN7A 4DIHH 1IQKA 1ZJDA 3QTVH 5EQSA 3ZZAA 1ELBA 4NCYA 2QF3A 1AKSA 1QTFA 3SJOA 1OYTH 4IW4E 1BOQA 4KKDA 1WTHD 2EA3A 3FP7E 1A46H 1HBTH 2OXSA 2QV1A 4M7GA 4YO9A 3UQVA 1HJ9A 5JBAS 1IHTH 4KTCA 2FLBH 3VB3A 3M36A 1K1LA 3BEFB 1F5KU 1TMUH 1DUAA 1A0HB 3SU5A 2G55A 3LGUA 3EA8A 2WV5A 3VFEA 1SR5C 1CT0E 1Z8RA 4Y0YE 1A0LA 1YM0A 1ZR0A 4Y71A 3ZVEA 1HJAB 1CHOF 1E34B 2ZFTA 1VCWA 1A5GH 1XXDA 3K6ZA 1AE5A 3A81A 1C5RA 3BTTE 2HALA 1MH0A 1GJAB 1SFIA 2ZGXH 2ZPQA 4K60A 4ZKNU 1EJAA 2TPIZ 1TBQH 2BQ6B 2ZQ1A 4A1VA 4CRGA 1GMHG 3BG4B 1LQDB 1NC6A 3SN8A 3A7VA 2BQWB 2UUJB 3EDXB
chains in the Genus database with same CATH superfamily
3GCOA 1GI9B 3A84A 1GG6C 1TBRH 3RXSA 1C2FA 3LIWA 5FPSA 3D62A 1T32A 3T2NA 3GY3A 3RC6A 2Y7ZA 4XFQA 1UMAH 1DUEA 4FUHA 1AE8H 1O5BB 1ZTJA 5C94A 4GLYA 4Y76A 1LVMA 3UNRA 1C9PA 2PW8H 5C17A 1W11U 1C5LH 4OS2A 4THNH 4FUEA 4Y6DA 1GDNA 3BG8A 1C5XB 2SGPE 4SGAE 4JZFH 2O8WA 2NU2E 4BOHA 2J98B 4MVNA 3TU7H 2AH4X 4NIVA 2ZO3H 1YPHE 5AFZH 3HGNA 1K1IA 3M35A 3DFLA 1TMTH 1VITH 2YMSC 1AMHA 2ZHDA 1C1VH 2QAAA 3IG6B 3A7WA 1O5DH 3V13A 1HLTH 1W7XH 3CNRA 3PB1E 1YCPM 1O37A 3MMGA 1Y3YA 1W8BH 1TX8A 5E8EH 4XD7D 4IN2A 1EZSC 4OGXA 1DSUA 2GDDA 1C4V2 2W7UA 2QC2A 2R9PA 2VH6A 2SNWA 3SU6A 1XKBC 3SGAE 2D8WA 2A5IA 2BLVA 3QO6A 1UCYK 4UONA 1OSSA 1O36A 1DANH 4INHA 1HAVA 3U69H 1LKAA 1GCTC 1OWDA 2XW9A 5DP5A 1XUGA 1TQ7B 2ZGHA 2Z9JA 2B9LA 1LHCH 3SW2B 1TE0A 2BD8A 4H42U 4CR5A 1S0RA 1GVLA 1L4DA 3A83A 1C5VA 1ESBA 3F9FA 2VVCA 3ZVDA 1E37B 1EZXC 4AG1A 1O2QA 5L30H 3ZZ7A 3B23B 5HM2A 4ABHA 5FBEA 1C1TA 1GI3A 4VGCC 4AC9A 2WSSD 5F8XA 4YT6H 1EPTC 3F3BA 4Q7ZA 4LXBH 1J17T 2VIVA 2QF4A 2Y5GA 4KTUA 3D65E 1O2IA 1V2OT 1LPZB 1NN6A 2EI6A 1FQ3A 3PTNA 1TRMA 5FAHA 4Q63A 1O2OA 1IQIA 4TSFD 1AFEH 2WPDD 5CHAC 3G01A 3V12A 1GVZA 5SGAE 1KIGH 5JBTA 2IPHA 1O3MA 1AWFH 2WPIS 2IOTA 2FOBA 1ZGIA 3ZZ3A 4ACAA 1T7CA 2F9OA 4ABFA 2A32A 2Z3EA 2V3OH 4DT4A 1F0UA 2F9BH 3RXOA 2ZC9H 2ZU4A 3NUMA 4ZXYH 3SI4H 4CRCA 2KM0A 9LPRA 1C1PA 3LT3A 3KN2A 3RDZA 4DG4A 3O8CA 3LC3A 1EX3A 4O3UA 1RIWC 2BDBA 1P12E 1YPEH 2G81E 1QRXA 2GMTC 1PFXC 1HAGE 1D4PB 3MU0A 1M9UA 2TRMA 3OX7U 1HIAB 3O8RA 2TGTA 1PYTD 3NPSA 3PLKA 3QZQA 2B5TB 1GBTA 2D1JA 3GCNA 4I8LA 4ZKRU 1THSH 4K5ZA 1AD8H 2J5UA 3A7YA 1YPHC 1YBWA 4NA8A 1AY6H 1ELTA 2BVSH 3FANA 2G5NA 2XBVA 2CV3A 2WPMS 3UREA 2HLDD 3LPRA 2SNVA 3QGNB 3MTYA 1W3CA 1RTLA 2C90B 4OS1A 1DWBH 1GI2A 2XBWA 3TH3H 3JZ1B 1D3TB 1W0KD 1ZPCA 4JYVH 4UFEH 1ELVA 2W3KA 1HNEE 5A8YA 1K21H 3MH4A 1SGIB 5DP7A 1XX9A 4WF8A 1C2MA 1O3BA 1PJPA 1SQAA 3ZZ8A 1C1SA 4K1EA 4MNVA 5AVDA 3T29A 3NZIA 1RTKA 6GCHG 1LVOA 4BTTB 1FNIA 2WPKS 1L1NA 1SKYE 1MTNB 1BJVA 3MO9A 3P70B 3RM0H 1TFXA 3MU8A 4HI3A 2BY6X 1K9OE 4GHTA 1C2HA 3ZZBA 3GY5A 1AZ8A 2BDAA 4FUIA 5TCAA 1TX7A 3T5FH 3SHAH 2BTCE 3BTDE 1VZQH 2Z9GA 2HPQH 1GBIA 1MZAA 3F9EA 5EQRA 2PKAB 3CENA 5FX6A 3E16B 2JJ2D 4BAOB 3Q77A 1GBLA 1ACBE 1P3EA 1QGFA 2CF8H 1QBOA 1O0DH 3N7OA 1EAUA 1VKYA 2ZPSA 3H7OA 3STJA 2WV9A 1GVKB 4YOGA 5CE1A 3LH1A 1TQ0B 2F9UA 3A8BA 4GPGA 1EQ9A 4Y10E 3URCA 3ZV9A 4K3JA 1O2LA 3M5OA 1MBMA 4I32A 1CA0C 1QL8A 1F0TA 3RXBA 2GCTB 1FIWA 4BAMB 5GCHF 2BLWA 1LTOA 2BXTH 3KCGH 3TITA 1MTSA 1DFPA 3OY5U 2KAIB 1QURH 2P3FH 1E1RD 3TGIE 1HIAA 1L4ZA 3KF2A 4ESTE 5DSFA 1G30B 4B2CA 4YOJA 1YCPH 1ANCA 4MNYA 3P8FA 1UTOA 3N7EA 3DSOA 1S85A 4KP0A 3RC5A 2RA3A 3PO1C 1PPEE 2JKHA 1GBAA 1IAUA 3LGWA 3RC4A 1RGQA 4ISOA 1UTJA 1FXYA 3BTME 1GBCA 1XUIA 3AK5A 2F4LA 2YNBA 2ZGJA 1ETRH 1S0QA 2C8ZB 2GX4A 1ELDE 1ZJKA 4INLA 3TNSA 1O33A 1P09A 3F0PA 1EUFA 4XDEA 1YPLH 4X1NU 4MLFB 2KFWA 2HLCA 4K8BA 1GI1A 2QF5A 3N99A 4O97A 1SGNE 1HAYB 1LQEA 1Y3XA 2FODA 2FS9A 3RMMH 1HB0B 1BB0B 1NRPH 1OOKB 1QIXB 3LONA 3FOAA 2TGAA 1BTXA 3PRBA 2EI8A 2GVFA 1P11E 1O2TA 3Q3KA 2FOAA 2FYQA 1Q2WA 1GG6B 3MH5A 4ISLA 4CBOA 3DUXH 1QCPA 1O3HA 3TPIZ 3GCTG 3OE7D 1C2DA 2PKAA 3ATIA 3QK1A 4TWWA 2Q6DA 3BN9A 4K69A 4E06H 1H8IH 8ESTE 4IS5A 1LHEH 3PROA 4ASUD 4I7YH 1CSOE 1O5FH 1DS2E 1SHHB 1EAIA 3A88A 1P9UA 5T1VA 2ZFRH 3RXHA 2ZU1A 1KMHB 1F5LA 1VJAU 8LPRA 1YP9A 1BRBE 2ILNA 1O2MA 1AUTC 1GJ4H 4KELA 1FV9A 3VXEH 2KCPA 4Q80A 2ZA5A 1GJ5H 3A8CA 1C9TA 2WPJS 3SV7A 1BCUH 1GMDF 2YMSB 1H9IE 2HOBA 2AMQA 3PMHB 3KHVA 1AO5A 1WDIA 2F9PA 2SFAA 4ISNA 2KAIA 4AB8A 1XUFA 2FS8A 4JZ1A 1RD3B 1UCYH 3SZNA 4WVPE 3RXJA 1C1MA 1GBMA 4FUCA 3TNTA 1PYTC 4P00A 4XE4A 1CGHA 2Y5FA 3KL6A 1MQ5A 1SGDE 1UVOA 1BHXB 3AASA 5F8ZA 1O3DA 3T27A 3SU0A 5B6LA 1MKWH 1DX5M 3K65B 1UJ1A 2ODQA 1SI5H 1O2VA 1P2NA 2Z7FE 1GJ8B 1GCTB 3RXDA 2NU3E 2FO9A 4Y8ZA 5C5NA 1CA8B 1P57B 2J95A 2HVXA 2FESH 3DFJA 1AU8A 3ATLA 4FOUC 2YNAA 4Y7AA 2ZTYA 3TK9A 1KXFA 2JH6D 2XC0A 3DT0H 5EJ1A 1EATA 1DXWA 3F2HA 5A8ZA 1IQEA 1OPHB 1O3JA 2CK3D 5FCKA 1O5CB 3FP8E 3SQHE 4K2YA 4X8SH 4CRDA 2NU4E 2FEQH 5GWZA 2BOHB 1MKXK 4VGCB 5JYIA 1XUJA 2IPQX 1EPTB 1TMBH 3GY2A 2V6NA 3F0OA 1BHXF 1IQFA 1LPKB 2ZTZA 4HG6A 1TONA 2VINA 4PROA 2CMYA 1VCQA 1VCPA 3M7UA 4WXVA 5A0AE 2VVVA 3UUZA 1OWJA 3EQ0H 1K1JA 1BUIA 2RDEA 1QL9A 1S84A 3FVFB 5H4IB 4RN6A 3MU5A 5DP4A 5CHAB 4CREA 1O2PA 1PQ7A 1SOTA 1GHXH 2FWWA 1A4WH 2VBCA 2KCOA 3KNXA 2B7DH 8GCHG 2WYJA 3CP7A 1EAWA 1C2KA 1WXRA 1NFYA 1BMFD 5DGJA 5EGMA 5T6DA 4F4OC 3Q3YA 5J4QA 4YZUA 4YOIA 2G00A 4AFUA 1O2XA 1P2IA 1NZQH 1RIWB 1GHBG 4D8NA 1GI7B 3M3TA 2F43B 2GMTB 1GJ6A 5KGOA 2J92A 4X2VA 2H6MA 1KYNA 3GISB 5I46H 2OBOA 4JZDH 4AYVB 3SHCH 4X0WU 1AQ7A 4AFSA 1W2KH 1O5EH 3K6YA 3SU3A 2K1QA 1Q31A 5F03A 5GNDA 3TK5A 5LGOA 3TK6A 1O2WA 1DPOA 2BDCA 1FY8E 1GWAA 1P02A 2ZU5A 4MTBA 3MOCA 5FPYA 3S7KB 1N8OC 4X2WA 1TNJA 3GY4A 2ZHFH 3PV5A 3RU4T 1QQ4A 4NWKA 1O3FA 2LPRA 1SLWB 3OYPA 2OC8A 1GHWH 1YC0A 4CRAA 1O2JA 1Y5AT 3DA9B 1NFUA 1KTTB 2QXJA 4AFZA 1V2UT 2PKSC 1THRH 1AZZA 1GDUA 2FOCA 1MABB 3U8TH 5HM9A 3MNBA 2GKVE 1J9CH 1SGFA 2OLGA 1E38B 1SG8B 1TRNA 4JMYA 4TPYA 2THFB 1LDTT 2ZQ2A 4FUJA 4YT7H 1NRQH 7GCHF 5E2OA 1G3BA 4FU8A 1H9HE 2CHAC 1RXPA 1O39A 1BTWA 4ZMAH 3EAJA 5GJ4B 1SC8U 4NGAH 1EPTA 5TCCA 1C5WB 1TGCA 3M37A 1KXDA 3LU9B 3RU4D 3URDA 4K8YA 3TH2H 3RLWH 2EC9H 4AORA 4NZLA 3T26A 2ODYB 2IJD1 1ZLRA 3B9FH 3E91A 1W13U 4KGAA 1YGCH 3BIVH 1WU1A 1ETSH 1O3GA 4NA7A 2FI5E 5L2ZH 1TYNA 4MPVA 4B1TA 4RT0A 2ZDAH 5IDKA 1JBUH 3OSYA 3SGQE 1T8MA 4I33A 1O5AB 3PV2A 1O38A 2KCYA 2A7HA 2BM2A 5C20A 1HAOH 3B8JA 1C5YB 4D7GA 1AVWA 5HXFA 2A7JA 4DVAU 4AYYB 4NSYA 1TAWA 1CA0B 2H9HA 2A4GA 1QJ6B 1MAYA 3KQDA 2J2UA 4X1PU 1AHTH 4GUXA 1LMWB 5G4BA 1UHBB 4JZEH 5DP9A 4IMQA 3S9CA 3EGKH 1GCDA 1C5SA 2ZKSA 2CJIA 1W0JD 1OP2A 3MNSA 3PLBA 1TGTA 4UFDH 4Y8XA 1E0FD 4BAHB 3E0PB 3WW7A 2P8OC 2DUCA 1HAZB 1V2LT 4MG3A 8KME2 3C1KA 3HK3B 2ZFPH 5E0GA 1O3PB 3OU0A 3A7ZA 4QT8C 1GBEA 3GY8A 2PWXA 1G3DA 2QIQA 1UVSH 2A1DB 2STAE 4GHQA 4WY3A 4DOQA 4X8UH 4ZUHA 1G3CA 2VNTA 3SYJA 5DP8A 1UCYE 1IQHA 1C2EA 3RU4E 2ALVA 1OXGA 3PO1B 4U32A 1CGIE 3M3VA 5L6NH 4B74A 1AGJA 1DDJA 1YYY1 2AGIX 1P8VC 1GJ9B 4MPWA 2CXVA 3F68H 3UR9A 4BTUB 1BDAA 2BOKA 1ELGA 3EE7A 3WWBA 1ARCA 2VB0A 1LKBA 3RXIA 3M61U 1P2OA 4B2AA 3VB4A 2FP7B 2JDID 3U28C 1CQQA 1UTNA 1S82A 1EXFA 1ID5H 2OINA 3H7TA 3KIDU 3SV8A 4X1SU 1NU7B 5TJXA 1FN6A 4O9VA 1O2RA 2ZEBA 4ZKSU 1AIXH 1ESAA 4JYTA 1Z8JB 4OS7A 3ATKA 4Y0ZE 3LGVA 1C5PA 2ESTE 2ZIQH 4TYDA 4NG9H 4DJZB 4Y7BA 2GCHG 5EXMA 2XOKD 1Q3XA 5DPAA 1FAKH 3A8AA 3V0XA 4WMEA 1V2JT 1HJ8A 1N6XA 3M5MA 3ATMA 1SGEE 4ABGA 1UK4A 2QXIA 4RSPA 3TGJE 3UWIA 4MNWA 3OTPA 1MTVA 1QB6A 4ZAEA 1KXBA 1FONA 1SVPA 1TA2A 1YLDA 2ODPA 1QR3E 3U9AH 2Y82A 4ABDA 1D9IA 2Z3DA 4CRBA 1ELAA 3VXFH 4A6LA 1S5SA 1YPGH 3NK8A 2A2QH 1UHBA 3SNAA 1TX6A 1TALA 2NU0E 1A5IA 5GXPA 1J8AA 3A86A 1LCYA 3KQEA 1C2JA 3E8LA 1SHYA 2J98A 2XYAA 3DD2H 1UTMA 2BD3A 2ZG0H 3MH6A 4U30A 2PP6A 1UTPA 1O2YA 3EA7A 2K8IA 4XRNA 3UB0A 1BIOA 4B71A 2ZGCA 1JWTA 4X6MA 4JK5A 4ZHLU 5C0UA 1C5OH 5JBCS 1GJ7B 5DJ7A 4I8HA 1ORFA 1CVWH 2AHME 4Q7XA 2ZCKP 2FX6A 1SSXA 2XCFA 1D3QB 1NY22 3LGYA 4H6SB 4OS4A 3S69A 3Q3XA 1FIZA 2OC1A 1KLIH 1B0EA 3RXVA 1SBWA 1AUJA 1FZZA 1KXEA 1WUNH 2RDLA 3GCHC 1QHRB 2AGGX 4TPIZ 5DK1A 1GJBB 2DE9A 2ZPRA 1G3EA 5GIBA 3CS0A 1ANEA 1SGCA 1ZRKA 2J94A 3QZRA 3L6PA 4NIXA 1E35B 3PWBA 2HNTF 2LP6A 1WQVH 2BYAX 1N1LA 1H4WA 1ZSKA 1O2SA 1PPCE 3A80A 3BTFE 1OS8A 3SU1A 2FI4E 1JMOH 1JRSA 3UFAA 5LPEA 1ABJH 2GV6A 4ABIA 5C1XA 1GPZA 2V7QD 1K1PA 3NKKA 1Y8TA 4NIYA 3BTEE 1BTHH 3VB5A 1V2PT 1MQ6A 4NFEA 2G52A 4E05H 2Y5HA 4X1QU 4WMDA 2VIDA 2HRVA 3SU2A 4A1XA 1D6RA 3ODFA 2VWOA 4FUBA 4NIWA 5LH8A 1H9LB 2BY5X 2GGVB 3UY9A 1SLVB 1VITF 4LK4A 4K1TA 2P3TB 3PMAB 3ZYDA 3BSQA 2PUXB 2P94A 3SJIA 3O8DA 1W0ZU 4R8TB 3OFND 3K9XB 3TGKE 2PV9B 3M5NA 4X8VH 4JK6A 3SORA 2VVUA 4ZCNA 5DKMA 1SPJA 1XVMA 1FY1A 3PMBB 3DCLA 3QGJA 1ZSLA 4RKOB 4IGDA 4XBCA 2STBE 3FZDA 1IQLA 1SGRE 1SGFG 1Y59T 1QA0A 1MZDA 3ZZ9A 1UK3A 1TA6A 4Y8YA 1GMHF 1FJSA 2AMDA 2FTLE 3A7XA 2AIQA 5EODA 4B6FA 1SQTA 5CDFE 2WYGA 3P8NA 1UVTH 5AFYH 1ZRBA 1O32A 4ZROA 2XCNA 3E3TA 2F91A 1T31A 3PMJA 3E6PH 1O3OA 5EPYA 1QL7A 4ABBA 5IK2D 1E79D 1N8OB 2FPZA 1HAIH 2TBSA 4BNRA 7LPRA 1FI8A 4GCHF 1A7SA 9ESTA 3SQEE 5JB9S 2W7SA 1ELEE 4XBBA 1ELCA 1AVXA 1NO9H 2PKSB 1BQYA 1F5RA 5A2MH 1PQ5A 2A31A 2ZNKH 2BB4A 3LH3A 1HAXB 1VGCC 5BRRE 1K1MA 3GOVB 1YKTA 2JETC 5JBBS 2HVYB 2CHAB 2RG3A 2BDGA 1GI5A 3DHKH 1IOEA 3HKIB 1TGBA 4X6NA 3MH7A 1NS3A 5EW2H 3KGPA 3TVJB 2YOLA 2BDHA 3TJNA 4GSOA 2FLRH 1DOJA 2J4IA 2P3UB 4NWLA 2ZTXA 4LZ1H 2BD5A 1KDQB 1WBGB 4ISIH 2QYIA 2KZ4A 5KECA 5A0CA 1S81A 1O3EA 3W1EA 2BVXH 1C4U2 4YM9A 1MTWA 1V2TT 2BDIA 4OS6A 1MBQA 1EOJA 1HV7A 1J16A 2I6QA 1TRYA 1C1RA 3MFJA 4ISHH 1CHOG 1C5MD 6CHAC 2PUQH 1TNKA 1VJ9U 1JIRA 1TGSZ 1CU1A 1H1BA 3LJJA 2QCYA 1F0RA 2ZGBH 1FUJA 1GBKA 4FUDA 3RXPA 4A7IB 2FDAA 1S6FA 2R2WU 1EOLA 2AIPA 1GBDA 5B6OA 1C1NA 2W3IA 1ETTH 2H5DA 3SZEA 2EEKA 2QE7D 3C27B 4OS5A 2ANKH 2J38A 2RCEA 2P8OB 5JB8S 2F3CE 1XUKA 3EA9A 3ESTA 1QZ8A 7ESTE 1C5NH 3UTUH 2P93A 2WUCA 3VGCC 4XSKU 5A8XA 2XWAA 2GD4B 1Z6JH 1ZPZA 1SFQB 4RKJB 2L74A 2HPPH 5FXLA 1HYLA 5T6GA 5T6FA 2WV4A 1UTQA 2C8XB 1SB1H 1T4UH 4Q2KA 4F49A 2ULLA 1DLKB 2GZ7A 5HIZA 4H6TA 1KXCA 2OBQA 3M5LA 1DY8A 2ZCLP 3TJUA 1COWD 3FKSD 1TLDA 1GMCF 3BEIB 1OP0A 1O3IA 2FOMB 1O35A 2UWPA 1LHGH 2NWNA 1G37A 4GVUA 2ZU3A 3UNQA 4A5TS 4I31A 2ZECA 2ZHQH 1Z8IB 1SOZA 2VIWA 1HGTH 4X6PA 1FN8A 2ANMH 2ZHEH 2V35A 2GJGA 5EU8A 2VWMA 1GI6A 4HFPB 1PPFE 2AEIH 1C2IA 2OC7A 3KQCA 1JRTA 1CT2E 4JZIA 4UFFH 4YLQH 2TGDA 3KEEA 1KLTA 2C4FH 4O3TA 2GT7A 1O5GH 3F9GA 5HGGA 1O2HA 1SGTA 1AVGH 1CBWC 3FP6E 1O34A 2ALPA 5GDSH 3KQ5A 3MYWA 4X6OA 3H5CB 2R0LA 1RTFB 4FXGH 3UIRA 2W5EA 1RJXB 5C1UA 5ESTE 1BZXE 2ASUB 2Z3CA 3GY7A 3VPKA 1ZPBA 1ZMLA 1V2MT 2VGCC 2JH0D 5LPFA 3ITIA 4BAQB 4B75A 1ZTKA 1OX1A 4ABAA 2VIPA 4NA9H 1G2LA 1O3CA 4UFGH 3FAOA 2V0BA 4Q7YA 2ZFFH 1D6WA 1V2QT 5EJZA 2J34A 1Y5UT 3SUFA 1L1GA 2QGRA 2XXLA 3ZZ6A 2KX4A 1GHVH 2GZ9A 2BQ7B 2O8LA 5EQQA 2TIOA 1IQGA 1C5TA 1NRNH 1SL3A 1Z1JA 1FDPA 1FPCH 4DIIH 4Z1MD 1RFNA 1V2KT 4ASHA 2BX3A 1C2LA 3SOSA 1MU6B 2FXRA 1P3CA 2OUAA 1L0ZA 2OCVB 3ENSB 1HDTH 1YWUA 1F7ZA 2EY4C 2JH5D 3GDUA 3SBKA 3RXGA 1KTSB 3UR6A 3GCHB 1JXPA 1WV7H 3HATH 1MU8B 1ELFA 3SNEA 1DLEA 3RXEA 1FAXA 3V3MA 1BBRK 3MNXA 4YLUA 3TH4H 4INKA 4X2YA 3SUEA 2A5AA 1GHZA 1NTPA 1BRUP 4BTIB 1EZUC 1MUEB 2WPLS 3MO3A 4YXWD 3RXLA 1BTPA 1JOUB 4RT1A 3H09A 2FX4A 1GBBA 1O3NA 4IMZA 2GZ8A 5DP3A 1HFDA 1GHYH 5FBIA 3RUOA 5DP6A 1GL0E 2Z6BD 5PTPA 1DM4B 3RXRA 3D49H 2XBXA 1FPHH 3WY8A 1O2ZA 1PQ8A 4IC6A 5BPEA 4F48B 1TWXB 3MU4A 1W12U 4AZ2B 1G32B 3WWFA 2FMJA 2WUBA 3U1JB 1PQAA 3MI4A 1FY3A 3GDSA 1BT7A 1UK2A 2A4OA 1QB9A 1S83A 2Y80A 3UPEA 4CR9A 1Y3VA 1TB6H 2Q6GA 2PTCE 1HAVB 3EE0B 2R3UA 2VU8E 4E7NA 3OEED 1T8LA 1MCTA 3HKJB 3ZVBA 3SI3H 1VITG 5A0BA 1YCPK 3PTBA 3O8BA 1C5ZB 4LZ4B 3SNBA 1O3LA 1TOMH 2FYRA 1Y5BT 3TLOA 1B5GH 2SGDE 2Z9LA 4H4FA 1HCGA 1TOCB 1FX0B 3PRDA 1ARBA 1BMLA 5DN6D 5AF9H 4DY7B 2BLQA 1GI0A 1GHAF 2PR3A 4UE7H 3QWCH 1EAXA 3GCTF 3LOXA 3K2UA 2G51A 3OY6U 3VB7A 1L1JA 4AB9A 1V2VT 3MO6A 1LHDH 1O30A 5C3NA 4I8JA 2PSYA 1QQUA 2J9NA 2O8UA 3M7TA 1OHHD 1GI4A 1AB9C 1P0SH 3BTGE 4YESB 3I78A 1DY9A 4AFQA 4ABEA 3GDVA 1MD8A 1GBJA 2DE8A 3LGIA 4FUGA 1V6DA 2XBYA 1OWEA 1FLEE 1OYQA 1QA7A 1TPSA 1VGCB 3S9AA 1O2NA 5GCHG 2ZDKA 1G36A 3VEQB 2JETB 5F6MA 2JIZD 3STIA 4GCHG 4AOQA 1NRRH 1UW7A 1W0YH 3JZ2B 2P95A 5EXNA 3SJ8A 1NESE 1YPKH 5HKKD 1EASA 3EYDA 4ZHMU 5C67A 5FL7D 2AGEX 5L2YH 4CRFA 4Z6AH 3QLPH 2BVRH 2GV7A 4B73A 1THPB 3BTKE 4CBNA 4WXIA 2AFQB 4IC5A 4BAKB 2EI7A 2R2MB 1LVYA 1K1OA 3RM2H 1Z71A 3P95A 3A8DA 2BMGB 1GJDB 2Y6TA 1MMJN 3LJOA 3DSGA 2G4TA 3R3GB 3AW1A 3MHWU 5C1YA 3RXMA 3PLPA 3E0NB 2IN2A 3U8OH 5J4SA 5A09A 4B76A 1DICA 3IITA 3U98H 2ZDNA 1K1NA 2BY8X 1AFQC 4TWYA 1IQMA 4A92A 4IBLH 1QY6A 1GGDC 4MDSA 4TY7A 2OK5A 3Q00A 3RLYH 6CHAB 4FVDA 1V2ST 5T3HA 2BHGA 3SNDA 4YTAA 4BXWA 1QJ1B 3ZZDA 1WAYB 2UWOA 1B7XB 2W6ID 3T25A 3MWIU 1CO7E 1F0SA 1NM6A 1MKWK 2PTNA 4WWYA 1EP6A 1HAPH 2WZQA 3F1SB 2WINI 4P02A 1TNHA 2BD4A 2UUKB 2OTVA 2VIOA 1NPMA 4D7FA 5HYOA 3VGCB 4J2YB 3SV6A 4OGYA 3TJVA 3NCLA 4KTSA 3UOPA 1ANDA 1BMNH 3LC5A 1HAHH 1BITA 2ANYA 1XM1A 2FOGA 1TNLA 1GJCB 3I77A 1D3DB 1AN1E 1Z1IA 4HGCA 2FOHA 1O31A 1XUHA 2OD3B 1C1OA 1HXEH 5C5OA 1SGYE 1D3PB 1SQRA 1PPHE 8GCHF 2XC5A 4UEHH 1ZGVA 4HZHA 1C1QA 3LGTA 3PV4A 5FHTA 1GMDG 1NT1A 5GPIB 4TY6A 1EP5A 4X2XA 2QA9E 2ZDLA 3BTWE 2ZU2A 4OM9A 4M9FA 2NU1E 2Y81A 2BZ6H 1ZOMA 1QJ7B 3A82A 2PGQB 1EKBB 4AX9H 1DE7H 3NRLA 1DT2A 1GHBF 4X8TH 2BZAA 2Q6FA 1GMCG 2P59A 2Q1JA 4Y79A 4ABJA 2O8TA 1LPGB 2C8YB 3RMLH 2CF9H 1MKXH 4NFFA 1C5UA 2GTBA 4FU7A 2SGEE 3R0FA 2XNDD 4CHAC 1P9SA 1P2JA 1PPZA 1UVPA 2XTTB 1G2MA 1XXFA 3SGBE 4JCNA 1CBWB 1CHGA 4MPUA 4ACBA 3KYGA 5IYTA 1GDQA 2F9NA 2UUFB 3P8OA 5AHGH 2H2ZA 4SGBE 1ESTA 1W10U 3BF6H 4K1SA 1AI8H 1C1UH 3RXKA 4AGJA 2D26C 1KSNA 1TPOA 2AERH 1CE5A 1T8NA 1ZMJA 1BMMH 2VGCB 2A5KA 2H9EH 4XOJA 2ZI2H 3MQKC 3ZVAA 3CS7A 2QXHA 3BTHE 1BTUA 2Z9KA 1EB1H 3UNSA 5JPMH 3BEUA 4UD9H 1P2MA 2F9VA 2AS9A 4FUFA 2Z9IA 1A61H 2UUYA 2AMPA 2VWNA 2FOFA 2A0QB 3ZZCA 3SU4A 4WH6A 1UTKA 3T28A 3OEHD 4WH8A 2WPHS 3S9BA 3SUGA 3RXAA 2M5TA 1LO6A 2UWLA 2BY9X 3LKWA 1N6YA 2BDYA 2FZZA 1O3KA 2H5CA 2H9TH 2KR7A 2C93B 5FPTA 3OAAD 3QDZB 3RXFA 2V3HH 1YPJH 4ZHAA 1WOFA 5EPNA 5E0HA 1DSTA 3FN8A 3S7HB 4FETA 1HJAC 3F9HA 3RMOH 3RMNH 2RFKC 3QX5H 1BBRH 3LDXH 2FOEA 2LNCA 3GICB 4FVBA 4I86A 4U01A 2F83A 2L6OA 1PPGE 2B8OH 2W6JD 1NRSH 3ZVFA 5C0TA 3U1IB 1O2UA 4F55A 3FZZA 5FX5A 1KY9A 1V2RT 1EJMA 3A87A 1QRZA 3RXTA 1QFKH 3GYLB 2HNTE 3D23A 3S0NA 1E1QD 1NFXA 2ZZUH 1P06A 3BG4C 5EIYA 2A4RA 2QY0B 4DCDA 1RS0A 1EZQA 3BTQE 1TBZH 2BLOA 4ZH8A 1WYKA 2A45B 4AGKA 3Q76A 3KQBA 5ETXA 4LOYH 1CGJE 1X7AC 2FM2A 3ZVCA 3AVZA 1Y3UA 3A7TA 4GAWA 2C8WB 3HK6B 2BXUH 2HWLB 3F6UH 1V2NT 2A2XH 3A89A 4XBDA 4WJG2 3U8RH 1MD7A 1SLXB 1QB1A 1FY4A 4BANB 3VG8A 5F8TA 3BV9B 1A5HA 1GI8B 2P16A 1NFWA 1W14U 1BJUA 1IQNA 5EJLA 1O2KA 3RXCA 3HPTB 4Z0KA 7GCHG 3L3TA 5EOKA 1A3EH 4IN1A 3DSPA 5E2PA 5LPRA 3ZV8A 1UVUH 3TIUA 2OC0A 2VJ1A 3VB6A 1P2QA 5JDUB 5KEDA 2M2AA 2XC4A 1SLUB 1NBMD 5DO4H 2K0QA 1MAXA 2SGFE 4AG2A 3PWCA 3SUDA 3SV2H 1GBHA 5C2ZA 3BIUH 2BD9A 2OQ5A 1U6QA 2QXGA 1C1WH 1H8HD 1QRWA 1ZMNA 1WCZA 4HTCH 1GL1A 1YLCA 4D9RA 4ZKOU 1J14A 1C4Y2 1FY5A 2ZFSA 2ZP0H 2VH0A 1K22H 1DVAH 1BTZA 1MTUA 4I8GA 2VWLA 3V7TA 2GCHF 2J97A 1EJNA 4D76A 1IQJA 1TGNA 1TNGA 5CMXH 1P04A 1QBNA 4AN7A 2BD7A 3NWUA 3F2GA 2ZCHP 3SJ9A 2EQNA 1DWCH 3TJOA 2XWBI 1AB9B 2FIRH 1OWKA 3IWMA 2Z94A 1DWDH 1JIMA 5ESBA 1WTGH 4ZXXH 1GHAG 1Z6EA 1DWEH 3SJKA 2G5VA 2FTMA 1S6HA 2CGAA 2SGAA 3AAUA 3MNCA 1ZHRA 1OWHA 2BY7X 4WMFA 3ZYEA 2PSXA 2H1UA 1K28D 4Q4LA 3W95A 4MQAA 1SGQE 3ZIAD 4DW2U 7KMEH 2A7CA 2VIQA 2ANWA 4TT3D 1H8DH 1BRCE 3SO3A 4CH8B 1ZSJA 3AW0A 3UOUA 1HUTH 1ZTLA 1DXPA 1T8OA 4DGJA 1NU9A 1UO6A 1WQSA 5E0JA 1P01A 5EW1H 1C2GA 1FMGA 2OQUA 1TIOA 4U2WA 3OTJE 2I6SA 2CN0H 2PHBA 3P92A 1DITH 3HGPA 3AAVA 1XMNB 1V3XA 1NBME 1WSSH 3N7DA 4JYUH 1GBFA 5K7RA 2OP9A 1F2SE 5K0HA 3UQOA 1MCVA 3GS9A 3P17H 1XVOA 2HNTC 6LPRA 3SNCA 5DG6A 1W7GH 4X1RU 1BA8B 4E7RG 4BXSA 1O3AA 2XNIA 4D9QA 1AFQB 2GT8A 1A1RA 1GGDB 1Z7KA 1K2I1 3FFGA 4I8KA 4NSVA 3P6ZB 3ZZ4A 3RP2A 3RXQA 3ATWA 4MPXA 1A0JA 1P2KA 1KDQA 2YMSD 1Z8GA 2WHXA 1BMAA 4R0IA 2ZHWH 2BX4A 4FU9A 1UTLM 4RI0A 1YF4A 1TNIA 2GP9B 3SV9A 1AWHB 1BRAA 5FCRA 3GY6A 1ABIH 3E90B 1F92A 2A4QA 4O03A 3ZZ5A 4DT7B 2O8MA 1AKSB 1B0FA 1PPBH 1EB2A 3QTOH 3L33A 1QBVH 2D2DA 2G8TA 5EG4A 1Y3WA 2R3YA 1T4VH 3GYMA 2RA0A 1E36B 1VR1H 5HMAA 1BTYA 3NXPA 3T62A 1YY3A 2ZDMA 2AYWA 6GCHF 1QNJA 1O2GH 1P10A 4Y11E 3ELAH 3FO8D 1L2EA 4A1TA 1ZZZA 1G9IE 1P03A 3I29A 1LHFH 3F2FA 3ODDA 1HXFH 3PYHA 2PGBB 4NZQA 2C3SA 4DURA 3PM3A 4B2BA 1KLJH 2SGQE 6ESTA 3UWJH 2QN5T 1EFRD 1TPAE 1HPGA 1ANBA 1SQOA 1MTNC 2IJOB 4MNXA 2BD2A 5CHBA 1BBRE 1XKAC 1SMFE 2O9QA 2GDEH 3E1XB 2ZF0H 2G4UA 2B0FA 3QUMP 1LVBA 1C5QA 1NROH 1YPMH 1ZYOA 3P8GA 4CHAB 2HGTH 3W94A 2ZDVH 2LELA 2PLXA 5HIYA 1KXAA 2ZFQH 2W26A 1OKXA 5I25A 2QF0A 2PFEA 1YLNA 1OP8A 1ZHMA 2Y7XA 1A3BH 1SGPE 1V2WT 3MU1A 2FI3E 3M3SA 1P05A 4CH2B 3KYFA 5EXLA 1HRTH 2ZWLH 1RRKA 1TPPA 2R0KA 1TABE 4UDWH 3RXUA 5ABWA 1CT4E 2TGPZ 1ZHPA 1IHSH 2GCTC 4J1YA 3UAIC 1A2CH 3A85A 2XRCA 3M7QA 3ZVGA 1OWIA 1INCA 1J15A 3QN7A 4DIHH 1IQKA 1ZJDA 3QTVH 5EQSA 3ZZAA 1ELBA 4NCYA 2QF3A 1AKSA 1QTFA 3SJOA 1OYTH 4IW4E 1BOQA 4KKDA 1WTHD 2EA3A 3FP7E 1A46H 1HBTH 2OXSA 2QV1A 4M7GA 4YO9A 5F53A 3UQVA 1HJ9A 5JBAS 1IHTH 4KTCA 2FLBH 3VB3A 3M36A 1K1LA 3BEFB 1F5KU 1TMUH 1K0HA 1DUAA 1A0HB 3SU5A 2G55A 2JJ1D 3LGUA 3EA8A 2WV5A 3VFEA 1SR5C 2KCAA 4B6EA 1CT0E 1Z8RA 4Y0YE 1A0LA 1YM0A 1ZR0A 4Y71A 1S6LA 3ZVEA 1HJAB 2V3MA 1CHOF 1E34B 2ZFTA 1VCWA 1A5GH 1XXDA 3K6ZA 1AE5A 3A81A 1C5RA 3BTTE 2HALA 1MH0A 1GJAB 1SFIA 2ZGXH 2ZPQA 4K60A 4ZKNU 1EJAA 2TPIZ 1TBQH 2BQ6B 2ZQ1A 1H8ED 4A1VA 4CRGA 1GMHG 3BG4B 1LQDB 1NC6A 3SN8A 3A7VA 2BQWB 2UUJB 3EDXB
chains in the Genus database with same CATH topology
3GCOA 1GI9B 3A84A 1GG6C 1TBRH 3RXSA 1C2FA 3LIWA 5FPSA 3D62A 1T32A 3T2NA 3GY3A 3RC6A 2Y7ZA 4XFQA 1UMAH 1DUEA 4FUHA 1AE8H 1O5BB 1ZTJA 4GLYA 4Y76A 1LVMA 3UNRA 1C9PA 2PW8H 1W11U 1C5LH 4OS2A 4THNH 4FUEA 4Y6DA 1GDNA 3BG8A 1C5XB 2SGPE 4SGAE 4JZFH 2O8WA 2NU2E 4BOHA 4MVNA 3TU7H 2AH4X 4NIVA 2ZO3H 1YPHE 5AFZH 3HGNA 1K1IA 3M35A 3DFLA 1TMTH 1VITH 1AMHA 2ZHDA 1C1VH 2QAAA 3IG6B 3A7WA 1O5DH 3V13A 1HLTH 1W7XH 3PB1E 1YCPM 1O37A 3MMGA 1Y3YA 1W8BH 1TX8A 5E8EH 4IN2A 1EZSC 4OGXA 1DSUA 2GDDA 1C4V2 2W7UA 2QC2A 2R9PA 2VH6A 2SNWA 3SU6A 1XKBC 3SGAE 2D8WA 2A5IA 2BLVA 3QO6A 1UCYK 4UONA 1OSSA 1O36A 1DANH 4INHA 1HAVA 3U69H 1LKAA 1GCTC 1OWDA 2XW9A 5DP5A 1XUGA 1TQ7B 2ZGHA 2Z9JA 2B9LA 1LHCH 3SW2B 1TE0A 2BD8A 4H42U 4CR5A 1S0RA 1GVLA 1L4DA 3A83A 1C5VA 1ESBA 3F9FA 2VVCA 3ZVDA 1E37B 1EZXC 4AG1A 1O2QA 5L30H 3ZZ7A 3B23B 5HM2A 4ABHA 5FBEA 1C1TA 1GI3A 4VGCC 5F8XA 4YT6H 1EPTC 4Q7ZA 4LXBH 1J17T 2VIVA 2Y5GA 4KTUA 3D65E 1O2IA 1V2OT 1LPZB 1NN6A 2EI6A 1FQ3A 3PTNA 1TRMA 5FAHA 1O2OA 1IQIA 1AFEH 5CHAC 3G01A 3V12A 1GVZA 5SGAE 1KIGH 5JBTA 2IPHA 1O3MA 1AWFH 2WPIS 2IOTA 2FOBA 1ZGIA 3ZZ3A 1T7CA 2F9OA 4ABFA 2A32A 2Z3EA 2V3OH 1F0UA 2F9BH 3RXOA 2ZC9H 2ZU4A 3NUMA 4ZXYH 3SI4H 4CRCA 9LPRA 1C1PA 3LT3A 3KN2A 3RDZA 4DG4A 3O8CA 3LC3A 1EX3A 4O3UA 1RIWC 2BDBA 1P12E 1YPEH 2G81E 1QRXA 2GMTC 1PFXC 1HAGE 1D4PB 3MU0A 1M9UA 2TRMA 3OX7U 1HIAB 3O8RA 2TGTA 1PYTD 3NPSA 3PLKA 3QZQA 2B5TB 1GBTA 2D1JA 3GCNA 4I8LA 4ZKRU 1THSH 4K5ZA 1AD8H 3A7YA 1YPHC 1YBWA 4NA8A 1AY6H 1ELTA 2BVSH 3FANA 2G5NA 2XBVA 2CV3A 2WPMS 3UREA 3LPRA 2SNVA 3QGNB 3MTYA 1W3CA 1RTLA 2C90B 4OS1A 1DWBH 1GI2A 2XBWA 3TH3H 3JZ1B 1D3TB 1ZPCA 4JYVH 4UFEH 1ELVA 2W3KA 1HNEE 5A8YA 1K21H 3MH4A 1SGIB 5DP7A 1XX9A 4WF8A 1C2MA 1O3BA 1PJPA 1SQAA 3ZZ8A 1C1SA 4K1EA 4MNVA 5AVDA 3T29A 3NZIA 1RTKA 6GCHG 1LVOA 4BTTB 1FNIA 2WPKS 1L1NA 1MTNB 1BJVA 3MO9A 3P70B 3RM0H 1TFXA 3MU8A 4HI3A 2BY6X 1K9OE 4GHTA 1C2HA 3ZZBA 3GY5A 1AZ8A 2BDAA 4FUIA 5TCAA 1TX7A 3T5FH 3SHAH 2BTCE 3BTDE 1VZQH 2Z9GA 2HPQH 1GBIA 1MZAA 3F9EA 5EQRA 2PKAB 3CENA 5FX6A 3E16B 4BAOB 3Q77A 1GBLA 1ACBE 1P3EA 1QGFA 2CF8H 1QBOA 1O0DH 3N7OA 1EAUA 2ZPSA 3H7OA 3STJA 1GVKB 4YOGA 5CE1A 3LH1A 1TQ0B 2F9UA 3A8BA 4GPGA 1EQ9A 4Y10E 3URCA 3ZV9A 4K3JA 1O2LA 3M5OA 1MBMA 4I32A 1CA0C 1QL8A 1F0TA 3RXBA 2GCTB 1FIWA 4BAMB 5GCHF 2BLWA 1LTOA 2BXTH 3KCGH 3TITA 1MTSA 1DFPA 3OY5U 2KAIB 1QURH 2P3FH 3TGIE 1HIAA 1L4ZA 3KF2A 4ESTE 1G30B 4B2CA 4YOJA 1YCPH 1ANCA 4MNYA 3P8FA 1UTOA 1S85A 4KP0A 3RC5A 2RA3A 3PO1C 1PPEE 2JKHA 1GBAA 1IAUA 3LGWA 3RC4A 1RGQA 4ISOA 1UTJA 1FXYA 3BTME 1GBCA 1XUIA 2YNBA 2ZGJA 1ETRH 1S0QA 2C8ZB 2GX4A 1ELDE 1ZJKA 4INLA 3TNSA 1O33A 1P09A 1EUFA 4XDEA 1YPLH 4X1NU 4MLFB 2HLCA 4K8BA 1GI1A 4O97A 1SGNE 1HAYB 1LQEA 1Y3XA 2FODA 2FS9A 3RMMH 1HB0B 1BB0B 1NRPH 1OOKB 1QIXB 3LONA 2TGAA 1BTXA 2EI8A 2GVFA 1P11E 1O2TA 3Q3KA 2FOAA 2FYQA 1Q2WA 1GG6B 3MH5A 4ISLA 4CBOA 3DUXH 1QCPA 1O3HA 3TPIZ 3GCTG 1C2DA 2PKAA 3ATIA 3QK1A 4TWWA 2Q6DA 3BN9A 4K69A 4E06H 1H8IH 8ESTE 4IS5A 1LHEH 3PROA 4I7YH 1CSOE 1O5FH 1DS2E 1SHHB 1EAIA 3A88A 1P9UA 2ZFRH 3RXHA 2ZU1A 1F5LA 1VJAU 8LPRA 1YP9A 1BRBE 2ILNA 1O2MA 1AUTC 1GJ4H 4KELA 1FV9A 3VXEH 4Q80A 2ZA5A 1GJ5H 3A8CA 1C9TA 2WPJS 3SV7A 1BCUH 1GMDF 1H9IE 2HOBA 2AMQA 3PMHB 3KHVA 1AO5A 2F9PA 2SFAA 4ISNA 2KAIA 4AB8A 1XUFA 2FS8A 4JZ1A 1RD3B 1UCYH 3SZNA 4WVPE 3RXJA 1C1MA 1GBMA 4FUCA 3TNTA 1PYTC 4XE4A 1CGHA 2Y5FA 3KL6A 1MQ5A 1SGDE 1UVOA 1BHXB 3AASA 5F8ZA 1O3DA 3T27A 3SU0A 1MKWH 1DX5M 3K65B 1UJ1A 2ODQA 1SI5H 1O2VA 1P2NA 2Z7FE 1GJ8B 1GCTB 3RXDA 2NU3E 2FO9A 4Y8ZA 5C5NA 1CA8B 1P57B 2J95A 2HVXA 2FESH 3DFJA 1AU8A 3ATLA 4Y7AA 2YNAA 2ZTYA 3TK9A 1KXFA 2JH6D 2XC0A 3DT0H 1EATA 1DXWA 5A8ZA 1IQEA 1OPHB 1O3JA 5FCKA 1O5CB 3FP8E 3SQHE 4K2YA 4X8SH 4CRDA 2NU4E 2FEQH 5GWZA 2BOHB 1MKXK 4VGCB 5JYIA 1XUJA 1EPTB 1TMBH 3GY2A 2V6NA 1BHXF 1IQFA 1LPKB 2ZTZA 1TONA 2VINA 4PROA 2CMYA 1VCQA 1VCPA 3M7UA 4WXVA 5A0AE 2VVVA 3UUZA 1OWJA 3EQ0H 1K1JA 1BUIA 1QL9A 1S84A 3FVFB 5H4IB 4RN6A 3MU5A 5DP4A 5CHAB 4CREA 1O2PA 1PQ7A 1SOTA 1GHXH 2FWWA 1A4WH 3KNXA 8GCHG 2B7DH 2WYJA 3CP7A 1EAWA 1C2KA 1NFYA 5DGJA 5EGMA 5T6DA 4F4OC 3Q3YA 5J4QA 4YZUA 4YOIA 2G00A 4AFUA 1O2XA 1P2IA 1NZQH 1RIWB 1GHBG 4D8NA 1GI7B 3M3TA 2GMTB 1GJ6A 2J92A 4X2VA 2H6MA 1KYNA 3GISB 5I46H 2OBOA 4JZDH 4AYVB 3SHCH 4X0WU 1AQ7A 4AFSA 1W2KH 1O5EH 3K6YA 3SU3A 2K1QA 1Q31A 5F03A 3TK5A 5LGOA 3TK6A 1O2WA 1DPOA 2BDCA 1FY8E 1GWAA 1P02A 2ZU5A 4MTBA 3MOCA 5FPYA 3S7KB 1N8OC 4X2WA 1TNJA 3GY4A 2ZHFH 3RU4T 1QQ4A 4NWKA 1O3FA 2LPRA 1SLWB 3OYPA 2OC8A 1GHWH 1YC0A 4CRAA 1O2JA 1Y5AT 3DA9B 1NFUA 1KTTB 2QXJA 4AFZA 1V2UT 2PKSC 1THRH 1AZZA 1GDUA 2FOCA 3U8TH 5HM9A 3MNBA 2GKVE 1J9CH 1SGFA 2OLGA 1E38B 1SG8B 1TRNA 4JMYA 4TPYA 2THFB 1LDTT 2ZQ2A 4FUJA 4YT7H 1NRQH 7GCHF 5E2OA 1G3BA 4FU8A 1H9HE 2CHAC 1RXPA 1O39A 1BTWA 4ZMAH 3EAJA 5GJ4B 1SC8U 4NGAH 1EPTA 5TCCA 1C5WB 1TGCA 3M37A 1KXDA 3LU9B 3RU4D 3URDA 4K8YA 3TH2H 3RLWH 2EC9H 4AORA 4NZLA 3T26A 2ODYB 1ZLRA 3B9FH 3E91A 1W13U 4KGAA 1YGCH 3BIVH 1WU1A 1ETSH 1O3GA 4NA7A 2FI5E 5L2ZH 1TYNA 4MPVA 4B1TA 2ZDAH 5IDKA 1JBUH 3OSYA 3SGQE 1T8MA 4I33A 1O5AB 1O38A 2A7HA 2BM2A 5C20A 1HAOH 3B8JA 1C5YB 4D7GA 1AVWA 5HXFA 2A7JA 4DVAU 4AYYB 4NSYA 1TAWA 1CA0B 2H9HA 2A4GA 1QJ6B 1MAYA 3KQDA 2J2UA 4X1PU 1AHTH 4GUXA 1LMWB 5G4BA 1UHBB 4JZEH 5DP9A 4IMQA 3S9CA 3EGKH 1GCDA 1C5SA 2ZKSA 2CJIA 1OP2A 3MNSA 3PLBA 1TGTA 4UFDH 4Y8XA 1E0FD 4BAHB 3E0PB 2P8OC 2DUCA 1HAZB 1V2LT 4MG3A 8KME2 3C1KA 3HK3B 2ZFPH 5E0GA 1O3PB 3OU0A 3A7ZA 4QT8C 1GBEA 3GY8A 2PWXA 1G3DA 2QIQA 1UVSH 2A1DB 2STAE 4GHQA 4WY3A 4DOQA 4X8UH 4ZUHA 1G3CA 2VNTA 5DP8A 1UCYE 1IQHA 1C2EA 3RU4E 2ALVA 1OXGA 3PO1B 4U32A 1CGIE 3M3VA 5L6NH 4B74A 1AGJA 1DDJA 1YYY1 2AGIX 1P8VC 1GJ9B 4MPWA 2CXVA 3F68H 3UR9A 4BTUB 1BDAA 2BOKA 1ELGA 1ARCA 2VB0A 1LKBA 3RXIA 3M61U 1P2OA 4B2AA 3VB4A 2FP7B 1CQQA 1UTNA 1S82A 1EXFA 1ID5H 2OINA 3H7TA 3KIDU 3SV8A 4X1SU 1NU7B 5TJXA 1FN6A 4O9VA 1O2RA 2ZEBA 4ZKSU 1AIXH 1ESAA 4JYTA 1Z8JB 4OS7A 3ATKA 4Y0ZE 3LGVA 1C5PA 2ESTE 2ZIQH 4TYDA 4NG9H 4DJZB 4Y7BA 2GCHG 5EXMA 1Q3XA 5DPAA 1FAKH 3A8AA 3V0XA 4WMEA 1V2JT 1HJ8A 1N6XA 3M5MA 3ATMA 1SGEE 4ABGA 1UK4A 2QXIA 4RSPA 3TGJE 3UWIA 4MNWA 1MTVA 1QB6A 4ZAEA 1KXBA 1FONA 1SVPA 1TA2A 1YLDA 2ODPA 1QR3E 3U9AH 2Y82A 4ABDA 1D9IA 2Z3DA 4CRBA 1ELAA 3VXFH 4A6LA 1S5SA 1YPGH 3NK8A 2A2QH 1UHBA 3SNAA 1TX6A 1TALA 2NU0E 1A5IA 5GXPA 1J8AA 3A86A 1LCYA 3KQEA 1C2JA 3E8LA 1SHYA 2XYAA 3DD2H 1UTMA 2BD3A 2ZG0H 3MH6A 4U30A 1UTPA 1O2YA 3EA7A 1BIOA 4B71A 2ZGCA 1JWTA 4X6MA 4JK5A 4ZHLU 1C5OH 5JBCS 1GJ7B 5DJ7A 4I8HA 1ORFA 1CVWH 4Q7XA 2ZCKP 2FX6A 1SSXA 2XCFA 1D3QB 1NY22 3LGYA 4H6SB 4OS4A 3S69A 3Q3XA 1FIZA 2OC1A 1KLIH 1B0EA 3RXVA 1SBWA 1AUJA 1FZZA 1KXEA 1WUNH 2RDLA 3GCHC 1QHRB 2AGGX 4TPIZ 5DK1A 1GJBB 2DE9A 2ZPRA 1G3EA 5GIBA 3CS0A 1ANEA 1SGCA 1ZRKA 2J94A 3QZRA 3L6PA 4NIXA 1E35B 3PWBA 2HNTF 1WQVH 2BYAX 1N1LA 1H4WA 1ZSKA 1O2SA 1PPCE 3A80A 3BTFE 1OS8A 3SU1A 2FI4E 1JMOH 1JRSA 3UFAA 5LPEA 1ABJH 2GV6A 4ABIA 5C1XA 1GPZA 1K1PA 3NKKA 1Y8TA 4NIYA 3BTEE 1BTHH 3VB5A 1V2PT 1MQ6A 4NFEA 2G52A 4E05H 2Y5HA 4X1QU 4WMDA 2VIDA 2HRVA 3SU2A 4A1XA 1D6RA 3ODFA 2VWOA 4FUBA 4NIWA 5LH8A 1H9LB 2BY5X 2GGVB 3UY9A 1SLVB 1VITF 4LK4A 4K1TA 2P3TB 3PMAB 3ZYDA 3BSQA 2PUXB 2P94A 3SJIA 3O8DA 1W0ZU 4R8TB 3K9XB 3TGKE 2PV9B 3M5NA 4X8VH 4JK6A 3SORA 2VVUA 5DKMA 1SPJA 1XVMA 1FY1A 3PMBB 3QGJA 1ZSLA 4RKOB 4IGDA 4XBCA 2STBE 3FZDA 1IQLA 1SGRE 1SGFG 1Y59T 1QA0A 1MZDA 3ZZ9A 1UK3A 1TA6A 4Y8YA 1GMHF 1FJSA 2AMDA 2FTLE 3A7XA 2AIQA 5EODA 1SQTA 2WYGA 3P8NA 1UVTH 5AFYH 1ZRBA 1O32A 4ZROA 2XCNA 3E3TA 2F91A 1T31A 3PMJA 3E6PH 1O3OA 5EPYA 1QL7A 4ABBA 1N8OB 2FPZA 2TBSA 1HAIH 4BNRA 7LPRA 1FI8A 4GCHF 1A7SA 9ESTA 3SQEE 5JB9S 2W7SA 1ELEE 4XBBA 1ELCA 1AVXA 1NO9H 2PKSB 1BQYA 1F5RA 5A2MH 1PQ5A 2A31A 2ZNKH 2BB4A 3LH3A 1HAXB 1VGCC 5BRRE 1K1MA 3GOVB 1YKTA 2JETC 5JBBS 2CHAB 2RG3A 2BDGA 1GI5A 3DHKH 1IOEA 3HKIB 1TGBA 4X6NA 3MH7A 1NS3A 5EW2H 3KGPA 3TVJB 2YOLA 2BDHA 3TJNA 4GSOA 2FLRH 1DOJA 2J4IA 2P3UB 4NWLA 2ZTXA 4LZ1H 2BD5A 1KDQB 1WBGB 4ISI