3LGIA

Structure of the protease domain of degs (degs-deltapdz) at 1.65 a
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
220
structure length
220
Chain Sequence
FDSTDETPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allostery is an intrinsic property of the protease domain of DegS: implications for enzyme function and evolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Protease degS
total genus 56
structure length 220
sequence length 220
chains with identical sequence B, C
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2010-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3lgiA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3lgiA02
4WMFA 2QXGA 2V3OH 3S9CA 1BZXE 3SW2B 1S0RA 2H5DA 4H42U 1NFYA 1HYLA 2RG3A 3BN9A 3UNQA 3MHWU 3TJOA 5HM2A 3PTNA 4AGKA 1ZHPA 1VR1H 1HAYB 2BD8A 2FZZA 1C2KA 1TA6A 3L33A 5J4SA 4BAHB 4Q7ZA 1YC0A 3OTJE 2Y81A 5ABWA 1QA7A 3QLPH 4OS6A 4AOQA 1ZOMA 5L30H 1FY8E 5ESTE 4A92A 2ULLA 2UWPA 2F9OA 3KHVA 4FUJA 1EAWA 3MH5A 2PUXB 1BOQA 1ANBA 1LHCH 2ODQA 1QTFA 2OXSA 4FUCA 2FLRH 2ZCKP 1XUFA 1PQ8A 3GCTG 2KAIA 2JH5D 5DGJA 3IITA 1AN1E 1UTPA 3GY5A 4MPWA 4XBCA 3ZV8A 3ZZ7A 2P8OB 3DFLA 1QA0A 1QGFA 1OP0A 1ZMLA 2XC5A 3FVFB 5E2OA 4MQAA 1LQEA 2OBQA 4K3JA 3TU7H 5LPEA 4YTAA 3NXPA 3Q77A 5HXFA 1DWDH 2GTBA 3K6ZA 4WF8A 1GJ5H 3B23B 2FS8A 5L2YH 5EG4A 1DOJA 3DUXH 2C8XB 2OP9A 4WMEA 1O5GH 1SFIA 5A09A 1O3FA 1DANH 2IJOB 2FTMA 1A0JA 2BQWB 1IOEA 1C1NA 2JH6D 2OBOA 8GCHG 3SNCA 1NROH 3LGIA 1P57B 2ZKSA 1TAWA 1AE8H 4YT7H 1MKWH 3ATWA 3RXDA 4XFQA 2FM2A 3MO3A 4NA8A 2QXJA 1TNGA 1OWDA 1HAGE 2CGAA 1FV9A 1H1BA 4ABEA 1BCUH 1K1NA 5DP4A 4I8HA 2ZHFH 2PSXA 1BITA 1QQUA 1NESE 4RKOB 2ZO3H 4Y8XA 1OWEA 3SORA 1O5CB 2OUAA 1ARCA 4BXWA 2Q6GA 5E0GA 1TX8A 1YLDA 2PSYA 3LT3A 1DUEA 1UVOA 3ZVAA 5I25A 4FU7A 1IQLA 4XSKU 2ZPQA 3RXBA 1ABJH 2BDIA 1CGHA 1L1JA 1O2ZA 5JBAS 2VIDA 4VGCB 1AE5A 3SJOA 4ZAEA 1O2JA 3I77A 1GL1A 1BMMH 4ZKNU 4Y71A 1P3EA 3M36A 2FOCA 4Z0KA 2FOGA 1TQ0B 2WPKS 3GY8A 4FU8A 1AHTH 1L0ZA 2EI8A 4OGXA 5GPIB 7GCHG 1ESTA 1QQ4A 2GZ7A 2ZPRA 2C8WB 3B9FH 2IPHA 4NZQA 2AERH 3FFGA 1E38B 5A8YA 1PPZA 1EB1H 1W13U 1GI3A 2BDHA 4INLA 2Q6FA 5EQQA 2BZ6H 1WYKA 3TK5A 1SR5C 2SNWA 1ZPCA 2ZHQH 4FVDA 1TGNA 1V2VT 1PPEE 5C1XA 4B2BA 3TGKE 2QN5T 2QXIA 1P0SH 1DDJA 2XBYA 3OSYA 5GXPA 3U8RH 4OGYA 1BTZA 4D7GA 9ESTA 1C1RA 2YNAA 1JXPA 1DWBH 1ELGA 3UPEA 1GCDA 3P8OA 3E1XB 4GPGA 3UTUH 1FPCH 1HXEH 1GBIA 2ZNKH 3RDZA 1UTKA 3AAVA 1T7CA 1A46H 1F7ZA 3ITIA 4AB8A 4BOHA 1ELVA 3URCA 3A84A 1TX7A 4PROA 1XVOA 3LGYA 1G2MA 4Q7XA 3FAOA 2FX4A 3QO6A 1F0SA 5FXLA 1BHXF 3MOCA 3F9HA 4I33A 5JBCS 1SQTA 4E06H 1O0DH 1KXBA 2SFAA 4H6TA 3K65B 5GJ4B 1VITF 1CHOF 3PWCA 4XDEA 1WQVH 3KNXA 4E7RG 1FXYA 4ZMAH 1KXEA 1HAIH 2VIPA 1K28D 3M3VA 4NSYA 1AUTC 1S5SA 4ABIA 3GYLB 3ZZCA 1GBEA 2PKAB 1TPPA 1TRMA 3H7OA 4NIWA 5EW1H 4I8GA 1C5TA 2QF3A 2Z3CA 3KIDU 4D7FA 2J4IA 1GI8B 1WOFA 3MNSA 2JKHA 5PTPA 2HPQH 3U8OH 2EEKA 3EA8A 3MI4A 1AFEH 3E91A 1PPHE 1MAXA 1OX1A 4UEHH 1RD3B 4M7GA 1O31A 2EC9H 2FOHA 2BVRH 2A5IA 3QUMP 5EQSA 1C2DA 3LGUA 1AVWA 3F9GA 4ISOA 2UWOA 3T25A 2TGAA 4AFZA 1OPHB 1C5QA 2VVCA 1J17T 2AEIH 4OS2A 2FYQA 1C5YB 1HPGA 4QT8C 2RCEA 3P17H 4IN2A 4X1QU 1QURH 4F49A 3RXPA 1V2QT 3V7TA 5EODA 3RXEA 3S7HB 2PGBB 1L1GA 4X2XA 1K1JA 1H4WA 2ALVA 3BG8A 1MH0A 1GBBA 1NPMA 4UFEH 1UHBA 3UUZA 2SGDE 3ZZ8A 4XOJA 2YNBA 2A1DB 4NZLA 2SGAA 1V2KT 1SG8B 4WMDA 3W94A 1UJ1A 2Z94A 1RS0A 4CRAA 2ALPA 1BTPA 1RIWB 1S0QA 3ODDA 1KSNA 1DM4B 2AGGX 2C93B 2TGPZ 1MUEB 1K1OA 2VGCB 3TPIZ 2HNTE 1UTJA 1O2WA 2HNTF 2C90B 2ZEBA 4TPYA 2FODA 1L1NA 1NRSH 3Q3KA 2HRVA 1LHDH 3LC3A 2NU4E 3BTEE 1BTWA 5GCHG 1W3CA 1LHEH 1TFXA 3GISB 2CHAB 1C2LA 1GMDF 4MNYA 1F5KU 2W3KA 1BRAA 1DWCH 2G55A 3P95A 1RFNA 3RXTA 4Y6DA 1C1PA 1GGDC 3HKJB 1QNJA 3SJIA 2WPIS 4FUEA 1EAUA 1S6HA 1UTLM 3LIWA 1AB9C 3GY7A 4K8BA 1Z1JA 1O36A 5K0HA 1YM0A 2CV3A 2ZGBH 2ZHDA 3RXCA 2XRCA 1GVZA 4B74A 1K2I1 3CS0A 4UDWH 4ABJA 5G4BA 2ZHEH 4ISHH 2OC8A 1GJ4H 1ZMNA 2VJ1A 1C1SA 4JK6A 1CHOG 2AIQA 3M3TA 4UONA 3KN2A 1NFWA 3QGJA 2O8WA 1AIXH 1MTNB 1UK3A 2V6NA 2GZ8A 2A7JA 3A85A 3BTTE 2VWMA 4B73A 3O8BA 1BRUP 2Y80A 1HIAA 1LQDB 2Z9JA 2ZFSA 4JYTA 1GHAG 2Z6BD 1HDTH 2UUKB 1BMLA 5JBBS 4A5TS 2ZTZA 1MAYA 3PYHA 4YM9A 5TCAA 4O3TA 1GDNA 1O2MA 2FO9A 1TX6A 2Z9KA 4IW4E 2B8OH 1ZLRA 4O03A 2D8WA 4XE4A 4IGDA 6CHAC 5FCKA 3TGIE 1GI4A 1GHVH 4JZIA 1HJ8A 5FBIA 1PQ5A 3SGAE 1HNEE 1NN6A 2P3UB 4AYYB 4X1SU 3V3MA 2YOLA 1H9LB 1O2NA 2Z7FE 1QJ7B 4ISIH 1P12E 2ZDMA 3BG4C 4X1NU 3RXRA 3GCOA 1DVAH 1TQ7B 3VB7A 3T27A 1EAXA 3T62A 1O3JA 3GCTF 1Z7KA 2ANWA 2TIOA 3BTFE 1OSSA 1DFPA 2Y7ZA 2O8MA 3VB5A 1O5EH 3MU4A 3D49H 4BTIB 2OD3B 3RXAA 2A31A 1EATA 1O3CA 1EPTA 2ZDNA 1G32B 3RXKA 5IYTA 2OCVB 1MZAA 1C5SA 1EOJA 1Y3VA 1XUIA 1C5RA 4IN1A 2G00A 2WYGA 4LZ1H 4WWYA 2J2UA 2VIOA 4K69A 4OS5A 2BOHB 4A1XA 2GT8A 2NU3E 3MYWA 2F83A 1UTMA 1XUGA 4I32A 1A5IA 2XBWA 2A2QH 2XBVA 2BY6X 1VITH 1Y3UA 1BQYA 3PLKA 2C8ZB 1ZPZA 1O3BA 4ZHLU 2H5CA 1SOTA 3K2UA 4K60A 1V2PT 1ZPBA 2BY5X 1W7GH 3TJUA 1UVPA 3RXIA 2V35A 4IMQA 3NWUA 3LKWA 3PO1C 3SQEE 4Y8ZA 4YOGA 3SUGA 3TK9A 1HCGA 4NCYA 3RM0H 1TMBH 1TA2A 1X7AC 1V3XA 4KELA 1C1UH 1CSOE 3H7TA 1SGFG 4HGCA 4MLFB 1QR3E 3RU4E 1VJ9U 1JIRA 3AAUA 2GX4A 4AYVB 3BEIB 2BLOA 1D6WA 2ZHWH 1EZXC 5F03A 2EA3A 4TY6A 1GCTB 3A81A 1HAVA 1BIOA 1V2OT 3FP7E 3ZYDA 3FP8E 3VB3A 2ZDLA 1W0ZU 2PR3A 1A5GH 2WPHS 2KAIB 3RXJA 3E16B 4X8UH 8GCHF 2C8YB 4O97A 5FPSA 4NG9H 2QAAA 3PROA 1AU8A 4WXVA 3SV6A 2BX4A 7ESTE 1ANDA 4H6SB 4AG1A 1ANCA 1P2JA 2AMDA 2BD2A 3SI3H 4MNXA 2XWAA 3ZZ6A 1SLVB 1LMWB 3Q76A 1GDQA 5AF9H 3MTYA 2OTVA 2PTCE 5AVDA 4Y10E 1CBWB 2A32A 3T28A 2W7SA 1SGPE 4IC5A 1YBWA 4NFEA 1BDAA 3CENA 4AGJA 1FQ3A 3E8LA 1P2NA 1GGDB 3BTQE 5BPEA 1GBJA 1LTOA 2G4UA 1ETSH 1AGJA 4ZXYH 6LPRA 5HYOA 1CVWH 1AVXA 3P8NA 2CMYA 1LKAA 3PMAB 3SO3A 2B5TB 5JB8S 2Y5FA 4DCDA 4MVNA 1XUKA 1W0YH 1OS8A 4HTCH 3SQHE 3MWIU 3C27B 5F8ZA 5E2PA 2FP7B 2A45B 4A1TA 2SGPE 2H9HA 1A3BH 1F0RA 4BTUB 1D3PB 2O8TA 2GMTC 3F6UH 5T6FA 1Z1IA 1UMAH 3VGCB 1UTOA 1ZHRA 1MQ5A 1JMOH 1QRZA 1P04A 4DURA 4IS5A 1C5WB 1ORFA 2F3CE 1HAVB 4JYVH 4CHAB 2BD7A 2FI3E 2JH0D 3UOUA 2RA0A 4Q80A 1O39A 4FUDA 1O2HA 4TWYA 2XCFA 3EDXB 2PFEA 3M5MA 2GKVE 2XNIA 4X6OA 3RUOA 2PHBA 1U6QA 1A2CH 1TBQH 1ELEE 1CA0C 3BTGE 3U8TH 1C5MD 1YGCH 2VWLA 2JETB 1UVSH 3GDVA 4ESTE 1J8AA 2H2ZA 1MMJN 1EJMA 1ESAA 3SJ9A 3SNDA 1ZZZA 1LPKB 5A2MH 4MPUA 1BHXB 1ETRH 3EYDA 1IQJA 1SFQB 2W7UA 1Y5AT 4YO9A 5DP6A 1N8OC 1SGRE 1D6RA 1F5LA 1H9HE 1GMDG 1ABIH 3UQVA 4GHQA 1BB0B 1C5PA 1BT7A 2G81E 1EB2A 1B0FA 1TGTA 3RMMH 2OC1A 6GCHF 1OYQA 2Z3DA 3F1SB 3TH4H 4A7IB 1N1LA 1GBKA 1YPGH 1BJVA 1MKWK 3UR6A 2J9NA 4AFSA 1OKXA 3R3GB 2R0LA 1IQEA 3QX5H 2P3FH 3M35A 1RRKA 3RMLH 3M7QA 1ELCA 3LJJA 3GY3A 1ETTH 2R2MB 4ABFA 1ZGIA 1W7XH 2BD3A 4K1TA 2PWXA 5H4IB 3SU3A 1VGCB 4AX9H 1EAIA 1P2MA 2BHGA 1V2NT 4ZH8A 1BMNH 4MNVA 3MU8A 3TJNA 2AIPA 1C5XB 3RLWH 1SLUB 3TK6A 5DG6A 1TOCB 1KXAA 1BTHH 2BB4A 2H6MA 1JRTA 1TABE 2G8TA 5C5NA 3KL6A 3UR9A 2ZQ2A 2J92A 4DG4A 4HZHA 5GDSH 4J2YB 1C2IA 1PPGE 1UTQA 1ANEA 1V2JT 5HGGA 2ZC9H 1NY22 1BBRK 1AI8H 4TWWA 3NK8A 1C1WH 4B2CA 1SSXA 3W95A 1IQFA 2GV7A 1HIAB 3MH4A 2A7CA 2GT7A 1J9CH 1ELAA 1O3LA 1RTLA 3UY9A 3S0NA 3ZZDA 1DT2A 1GBAA 1O3EA 3RXGA 3ZZBA 1XUHA 1TNJA 3ZYEA 5DP5A 3SU4A 1FIZA 1C2GA 4ISNA 4Y7BA 5DJ7A 1G36A 2ZFFH 3ZZ3A 1UCYE 2ZDVH 2LNCA 1T8LA 1O2QA 1XXFA 3RXSA 3EGKH 2BD4A 2SGEE 7LPRA 3HATH 1F92A 1XKAC 2VWOA 1GHWH 2O9QA 1P8VC 3VB4A 1KYNA 3EQ0H 3L6PA 1XMNB 2NU1E 4K1SA 2CF9H 3FZDA 4Y79A 1IQGA 3URDA 1VITG 1OWHA 1C4V2 1O2OA 1HLTH 2BLVA 2ZFQH 2VH0A 4CRBA 5T6GA 2OINA 2QC2A 4HI3A 3PMHB 2P95A 2GCHF 1PYTD 2HLCA 1SL3A 3BTKE 1S81A 1T31A 1ELTA 4JZEH 1LPGB 4ZROA 1WCZA 1HJ9A 3LDXH 1ZTKA 1XVMA 3I78A 2WPJS 4B76A 3DA9B 1GI6A 2SNVA 4YZUA 1INCA 1MU6B 2ZFRH 1YPHE 1SMFE 1GWAA 1KIGH 1OXGA 3RXUA 4GAWA 3TIUA 3ZVCA 1HUTH 5EOKA 3A83A 8KME2 5TCCA 2PKSC 4BAOB 3SGBE 4B75A 3QTOH 1F2SE 2ZG0H 4YLUA 1ZGVA 3GCHC 3RU4T 2A2XH 3BTHE 4TYDA 1O3MA 1EP5A 1P3CA 3ATLA 3AVZA 1EZQA 2GCTC 1BJUA 2R3YA 4SGAE 1FY4A 3GDUA 2ASUB 4Z6AH 4KGAA 1DWEH 2ZWLH 2DE9A 2FIRH 3T2NA 3LOXA 5SGAE 3MH6A 1ZJKA 2C4FH 1SLWB 5T6DA 1SGQE 1EUFA 4MPXA 1K21H 1UK2A 1LO6A 4BAKB 5JPMH 4Q2KA 5LPFA 3MFJA 1BTUA 2PGQB 1D4PB 3E90B 1M9UA 3HKIB 2Q1JA 5B6OA 3PM3A 2Y82A 1EZSC 3BTME 1V2WT 4AORA 1TE0A 1GBLA 1O2UA 1C2EA 2BX3A 2BLQA 1NRNH 1GJ8B 4LOYH 2FOEA 1RXPA 1SC8U 1G37A 1T8NA 2IOTA 2W26A 1YPJH 1G2LA 2HWLB 1EKBB 3BV9B 1FN6A 1UVTH 4NIYA 4UFGH 1P2QA 3ATKA 1TNLA 3IG6B 5GCHF 1O3HA 2FMJA 4OS7A 1H8DH 2UWLA 2ZA5A 1Z8IB 5DPAA 2B7DH 1ARBA 5AFYH 2B9LA 3C1KA 1AUJA 3M7UA 1ZMJA 1QJ1B 2BVXH 1FPHH 1AFQB 5FHTA 5DP3A 1KXDA 3A86A 1EPTC 3VPKA 2BXTH 1HB0B 2UUFB 2FI4E 4K8YA 1BRBE 2ZECA 1L2EA 4ABHA 1HAOH 3SNAA 1IQIA 3D65E 3SNEA 3E6PH 3BG4B 2I6SA 1RGQA 4GLYA 1D3DB 2LPRA 3BTDE 3KGPA 3FP6E 3G01A 3OY5U 4KP0A 1TMTH 3ESTA 1IQHA 1UCYH 2Y5HA 1W8BH 1G3EA 3E3TA 5FX6A 1O2SA 3P8GA 4ZKOU 3S9BA 1SLXB 3MO9A 4CRFA 3LC5A 4DIHH 4DY7B 1MD7A 1ZRKA 1A5HA 3QWCH 2GDDA 4OS4A 1TIOA 4LXBH 1C2FA 1DY8A 3OY6U 3SN8A 4X8VH 3SJKA 3RXLA 2AGIX 1ZYOA 1A61H 4JMYA 1MTUA 4U01A 4YOJA 3SJ8A 5LH8A 3TLOA 1O34A 2VNTA 2A5AA 2GVFA 4DVAU 2H1UA 1UHBB 1RJXB 1MCVA 5DKMA 3U98H 3E0PB 3NZIA 3ZVDA 2QGRA 2BDGA 1DPOA 2F9NA 2GMTB 4WXIA 5JB9S 1WBGB 3RM2H 1S6FA 2FESH 4ASHA 1CA8B 3IWMA 4IC6A 5LGOA 4X6MA 2BXUH 1SVPA 1NRPH 2FI5E 1TYNA 2F9BH 2FLBH 1HFDA 1O2YA 1TRYA 2Y5GA 1IAUA 3A82A 5A0BA 2A5KA 1LVBA 3LGTA 3BIVH 1G9IE 3UREA 1GHAF 3F68H 1P10A 3EAJA 3SV2H 1AO5A 2ZGXH 3A7VA 2F9VA 2ZFTA 1YPEH 3QZQA 2ANYA 2K1QA 1VCPA 2XC0A 1NRQH 1TNIA 3SU1A 1GCTC 1W12U 4I8JA 3P8FA 1MBQA 1FNIA 3SBKA 1THRH 1O2VA 2GP9B 1GJ7B 1FLEE 2TRMA 1O2TA 1YF4A 4Y11E 1YPMH 1MZDA 1O3DA 4A1VA 2WPLS 2WUCA 2QYIA 2PKAA 1C5OH 1C1OA 1VZQH 2FOMB 4AZ2B 2OQ5A 1OP2A 4CREA 4NFFA 3GY2A 1JIMA 3PWBA 1QHRB 1GBTA 1NU7B 4FUGA 1GJBB 1HRTH 3K6YA 4ZKSU 4O3UA 1HJAC 1NTPA 1FMGA 4UE7H 1EASA 3A7TA 5J4QA 1O3AA 1GJCB 5CHAC 1NZQH 3HGPA 4Y7AA 3UNSA 3LJOA 2QY0B 1HGTH 2HALA 3MH7A 5L6NH 1EP6A 3PV4A 1KXFA 1FY5A 4X6NA 2BLWA 1DXWA 2CJIA 3D23A 1E36B 1TGBA 1BTXA 4X8SH 5C20A 2AYWA 3MO6A 1O3NA 2XCNA 1V2TT 2C3SA 4KKDA 1JOUB 3A7XA 3MNBA 4WJG2 2R2WU 1TONA 3RU4D 1Y3WA 1C1QA 4VGCC 1FY1A 2DE8A 1ZR0A 1SGFA 1MTWA 1G30B 1O2KA 1D3TB 2GZ9A 2ZU5A 1TMUH 4X0WU 3A7ZA 1PQAA 5A0AE 5A8ZA 1GVKB 5IDKA 1TNHA 1C4Y2 1HBTH 1PPCE 4KTUA 3M5LA 3ZVFA 1FIWA 1GI5A 4K1EA 3EE0B 1UVUH 4NWKA 2WV5A 3TITA 1GBFA 1UK4A 1GG6B 1CQQA 1SGIB 1VCQA 3GYMA 4R8TB 4J1YA 1KLIH 1VCWA 3MU5A 1QB9A 2ZDKA 1C2JA 1O5DH 3L3TA 3GICB 3SZNA 1OOKB 2D2DA 3WY8A 3O8CA 1QB6A 1Z6EA 1V2ST 2AMQA 5I46H 1A0HB 2TBSA 1TLDA 1DLKB 1O2PA 1SGTA 4E05H 2BZAA 1K9OE 4JZDH 1NFXA 3SU0A 3MMGA 1DUAA 3A88A 2BDAA 2QCYA 3KEEA 1WV7H 2ZGCA 1G3CA 2D26C 8LPRA 3U1IB 1UO6A 2Z9LA 1QIXB 3KF2A 1MD8A 4YESB 1ZTLA 3SOSA 3QN7A 5GIBA 1J14A 5DP7A 3PO1B 2VIWA 2SGFE 1OYTH 3MNCA 4BTTB 1FI8A 1NRRH 5DP9A 1IQMA 1QBOA 1CU1A 1H9IE 2I6QA 3M5NA 5HMAA 5FX5A 1OWKA 3GOVB 3RP2A 1CGJE 5A0CA 2OLGA 2FS9A 2FTLE 4HFPB 2J34A 1JWTA 3FANA 4BNRA 3ZVBA 1EOLA 1SGEE 1GMCG 1BBRE 2XXLA 3Q3XA 1SGNE 2FWWA 4GCHF 3UIRA 1AY6H 3BEFB 2FDAA 1V2RT 6CHAB 2ZP0H 5L2ZH 3TGJE 2O8UA 4NGAH 1QRWA 1DICA 5C67A 5FAHA 3OU0A 4WH8A 2FXRA 2SGQE 1A1RA 1IQNA 2FYRA 1ELFA 1MQ6A 2GCTB 3A8CA 1O5FH 2AH4X 2BMGB 1XKBC 1RTFB 5F6MA 1BBRH 3ATMA 4FVBA 1A0LA 2QV1A 1WAYB 1RIWC 1AD8H 2FPZA 1FN8A 3STJA 1E37B 1QCPA 1AWFH 2A7HA 1FAKH 4NSVA 1GPZA 1EXFA 3R0FA 1PPFE 4YT6H 1O3OA 3A7YA 1Z71A 3K9XB 4CH2B 1AZZA 5CE1A 2Z3EA 3P70B 1KTTB 1C5VA 1C1TA 1IHTH 3GY4A 4AFUA 1O3KA 1WUNH 1V2LT 3A7WA 3SV7A 4I8LA 2B0FA 4FUHA 1ELBA 5F8TA 1N6XA 3TNSA 3TVJB 1NC6A 2R3UA 1C5NH 3EA9A 3BTWE 3UNRA 2ZQ1A 5C1UA 2BY8X 2P8OC 1Z8GA 1DSUA 1DS2E 5EPYA 3A8AA 3U69H 2VVVA 3V0XA 2VU8E 1O2GH 3TH2H 3KQDA 1ID5H 1LVOA 1N6YA 3Q00A 4INHA 1P9UA 4IMZA 4WY3A 1WU1A 4ZHMU 6ESTA 3DT0H 2AFQB 3ZV9A 1GI2A 4E7NA 2PKSB 2TGDA 2G5NA 2G51A 3VXFH 4D8NA 1QY6A 4MTBA 3DD2H 3HGNA 2A4RA 3ODFA 1LHGH 2HPPH 1SOZA 1T8OA 2ZU4A 4ZUHA 1WTGH 1LCYA 4H4FA 2Y6TA 1TBZH 1V2UT 1QRXA 1GBMA 2VIQA 4X8TH 1G3DA 3STIA 2VINA 1O38A 3GCNA 4GCHG 4Y0ZE 3QZRA 4FXGH 4F4OC 3QTVH 1SPJA 5E0HA 3KQBA 4X1RU 1HAPH 3SNBA 4ISLA 1KXCA 1QB1A 1XXDA 3JZ2B 1Y5BT 1J16A 1XX9A 1P2KA 1NFUA 1Y3XA 3M37A 1O32A 2CF8H 1NU9A 1OP8A 4GHTA 3N7OA 4FUIA 3MU1A 2J38A 1C5ZB 3A8BA 1FAXA 1O37A 2GV6A 1JRSA 1LVMA 1GBDA 1MTSA 3ELAH 3RLYH 1GJ9B 1MTVA 3JZ1B 1TGCA 1PFXC 2FOBA 4CRDA 2F9PA 1VGCC 1YCPH 1Q31A 2BYAX 4KTSA 2P94A 1GMHF 4AFQA 2W3IA 4WH6A 1ZSLA 3QK1A 1BUIA 4D9QA 5K7RA 2F91A 1S82A 3Q3YA 2PV9B 1S85A 1Q3XA 1VJAU 3VGCC 1P2OA 4ZXXH 4NIXA 2VH6A 4GVUA 1GHBF 3P6ZB 1ZHMA 3UFAA 1GI1A 4ABDA 4ABAA 5TJXA 3ATIA 1MKXK 2BDBA 1J15A 5JBTA 1Z8RA 2BY9X 4IBLH 1UTNA 3T5FH 3ZZ5A 3ZZ9A 1GDUA 5AHGH 5EXNA 4CR5A 1EPTB 4UFDH 1P06A 1WTHD 5CMXH 1LHFH 4DJZB 4FU9A 1C2MA 1DLEA 4NIVA 5C1YA 2M5TA 3SV8A 2WUBA 1C9PA 5EXMA 2VGCC 2P16A 1TWXB 1CE5A 4BAMB 1W10U 4SGBE 1S83A 1NM6A 1V2MT 2UUYA 4UFFH 1W14U 4B2AA 3RXOA 5HM9A 4ZKRU 3ZVGA 2THFB 1AVGH 3SU5A 2DUCA 2BD5A 1F0TA 3SGQE 4MNWA 5FPTA 1O5AB 5F8XA 2FOFA 2XW9A 4YOIA 2A4OA 3RC5A 3UWIA 1YCPK 4CH8B 3PB1E 2BTCE 1EQ9A 1GHBG 2CN0H 3SHCH 1YYY1 1KY9A 3T29A 1AB9B 4Y8YA 1HAHH 3M61U 1HAZB 1RTKA 9LPRA 1KDQB 2ODYB 2QA9E 5ETXA 1L4DA 3LH3A 1GBHA 1T4VH 4X2VA 4CR9A 4X2WA 3OX7U 2ZCLP 4DIIH 1DY9A 1MKXH 1O3IA 2OQUA 1YPHC 3BSQA 2CXVA 5GWZA 1G3BA 1K1IA 2Z9GA 1CGIE 1P2IA 1EX3A 3RMOH 1W11U 2XTTB 2A4QA 3RXVA 2IN2A 1O5BB 3GDSA 2XBXA 2XWBI 1OWIA 3TJVA 2HOBA 1EZUC 1QJ6B 3HK3B 2EI6A 3UOPA 1T32A 3FZZA 1AQ7A 4FUFA 1GMHG 1FJSA 4R0IA 1MBMA 5EPNA 1PYTC 2PLXA 3SHAH 1CT0E 1K1LA 1GJAB 1GG6C 3SUEA 2NU0E 5C2ZA 1AKSA 3PMJA 2ZI2H 1XM1A 1O3PB 3QDZB 3CP7A 3A89A 3SI4H 2WV4A 3M5OA 2GDEH 4THNH 2ZDAH 1DX5M 3ZZAA 2TPIZ 2JETC 3M3SA 3ENSB 1ZJDA 3AASA 1KDQA 1SB1H 1IHSH 3PLPA 4BAQB 5T3HA 1PQ7A 4ABGA 1TRNA 1C2HA 1YP9A 2BQ6B 1CHGA 2FOAA 4MDSA 2ILNA 4U32A 1HJAB 3PTBA 3O8RA 2D1JA 1O2XA 3NKKA 1CT2E 4INKA 3V13A 1HAXB 4D76A 5FPYA 5CHAB 5DP8A 2ZZUH 1ZTJA 4X2YA 4CBNA 3BEUA 2ZU2A 4XBDA 1HXFH 5EQRA 4CHAC 1CO7E 1EJNA 1Z8JB 2GD4B 1SI5H 5BRRE 2WPMS 2Q6DA 4YLQH 1GHXH 4A6LA 4X6PA 3LGVA 5C3NA 1Y3YA 2RDLA 1GJDB 3M7TA 5EW2H 2AGEX 1GI0A 4DGJA 4JZFH 1TB6H 5ESBA 3RXMA 1P01A 2ZTYA 1SHYA 1H8IH 1DXPA 1HV7A 1D9IA 1NT1A 2EI7A 4JYUH 2UUJB 4K5ZA 3LONA 1DE7H 1LPZB 2ZF0H 1WQSA 1TPOA 1O33A 2CHAC 1AMHA 1QBNA 3H5CB 4DW2U 4U2WA 5EU8A 3S7KB 1K1PA 2OC7A 5DK1A 1N8OB 1QL7A 1YKTA 4D9RA 2ESTE 5E0JA 4LK4A 2V0BA 1ELDE 2A4GA 1TOMH 1ZSKA 4JK5A 1C5UA 1DSTA 2GGVB 1W2KH 4NA7A 2AMPA 3NCLA 1MU8B 2Z9IA 1BRCE 2PW8H 4I31A 1KLJH 1OWJA 1V6DA 3ZVEA 1IQKA 1C1VH 4RKJB 1GHYH 1K22H 4X1PU 1AKSB 4BANB 3KQEA 4JCNA 1P02A 2F9UA 4ABBA 1YPLH 1SGCA 4MG3A 3SUFA 1MCTA 1A3EH 5AFZH 1JBUH 1A4WH 1KLTA 3AW1A 3HK6B 4RSPA 1DITH 1GHZA 4DT7B 4GUXA 3BF6H 1SBWA 3NUMA 2BDCA 5JDUB 1C9TA 1O2IA 3CS7A 1Z6JH 1CT4E 1TNKA 1O35A 3PMBB 4B71A 3ZZ4A 4CBOA 1SHHB 1YPKH 1LDTT 4Y0YE 5LPRA 3AW0A 2NWNA 1FONA 6GCHG 5FCRA 2Y7XA 3T26A 2P93A 1BA8B 1TALA 1GMCF 3SU6A 4O9VA 1FUJA 4GSOA 1ZRBA 1F5RA 4I8KA 4Y76A 3TNTA 4BXSA 1AFQC 1LKBA 2BOKA 2HGTH 2P59A 3QGNB 3I29A 1Q2WA 3RC4A 2BM2A 2BVSH 1S84A 2R0KA 5FBEA 1T8MA 4TY7A 1P05A 2G5VA 1BTYA 2BD9A 3OYPA 4NA9H 1ZSJA 3U9AH 3VB6A 4DOQA 4KTCA 2AS9A 4TPIZ 2HNTC 1B5GH 4CRGA 2J95A 7KMEH 1UCYK 4I7YH 1SGYE 1THPB 1C1MA 1YLCA 3MU0A 4Q7YA 2G4TA 1GVLA 5E8EH 3A87A 4AB9A 4LZ4B 1P09A 1WSSH 2R9PA 3S69A 3SV9A 1C4U2 5JYIA 1SGDE 3DFJA 2OC0A 3P92A 5A8XA 3NPSA 1O3GA 1FZZA 2QF0A 2BQ7B 3D62A 2GCHG 2VVUA 3KQCA 2ZPSA 3GY6A 2ODPA 3RXFA 4AN7A 2ZU3A 3B8JA 1NS3A 1GBCA 1SQAA 1TPSA 3UWJH 4RN6A 1FY3A 2ZGHA 1LVYA 3TH3H 2FEQH 3O8DA 1K1MA 2WINI 3A8DA 1FDPA 2ZTXA 1TPAE 2VB0A 3DHKH 3LGWA 1QL9A 1EJAA 1P11E 3EA7A 1D3QB 2A0QB 1GJ6A 2QIQA 2ZIQH 3LU9B 1QBVH 3E0NB 1C5LH 1BMAA 2XC4A 3RXHA 3BIUH 1YCPM 3LPRA 1MTNC 2ANKH 2ZGJA 4K2YA 3GCHB 2G52A 4FUBA 1THSH 1E35B 4B1TA 2ANMH 1NO9H 1Y8TA 3LH1A 2V3HH 3HPTB 1E0FD 2QXHA 1T4UH 1L4ZA 1Y5UT 2J94A 5C5OA 3SU2A 2STBE 4XBBA 1B0EA 1GL0E 2BY7X 1QFKH 2XYAA 1AWHB 3MNXA 5DO4H 2FX6A 2PTNA 5EGMA 1GI9B 3VFEA 3V12A 2ZCHP 3S9AA 2HVXA 3SUDA 8ESTE 3F9EA 2ZU1A 4WVPE 1SQOA 3PLBA 4CRCA 1CBWC 1TBRH 2VIVA 1GI7B 2STAE 3RXQA 1O2RA 1Y59T 4JZ1A 1ESBA 2P3TB 2H9TH 4U30A 4UD9H 2O8LA 3UQOA 1KTSB 3F9FA 3A80A 3RC6A 1E34B 1CA0B 2H9EH 1O30A 2W5EA 1A7SA 2TGTA 4AG2A 3KCGH 1O2LA 2WYJA 4MPVA 4ZHAA 2BDYA 1QL8A 1TGSZ 3VEQB 1F0UA 1XUJA 1ACBE 1P03A 7GCHF 4OS1A 2VWNA 1PJPA 2PUQH 3RMNH 1P9SA 1AZ8A 2ZFPH 5EXLA 3VXEH 4NWLA 2NU2E 3U1JB 2RA3A 1B7XB 1PPBH
chains in the Genus database with same CATH superfamily
4WMFA 2QXGA 2V3OH 3S9CA 1BZXE 3SW2B 1S0RA 2H5DA 4P00A 4H42U 1NFYA 1HYLA 2RG3A 3BN9A 3UNQA 3MHWU 3TJOA 5HM2A 3PTNA 4AGKA 1ZHPA 4RT1A 1VR1H 1HAYB 2BD8A 2FZZA 1C2KA 1TA6A 3L33A 5J4SA 4BAHB 4Q7ZA 1YC0A 5FL7D 3OTJE 2Y81A 5ABWA 1QA7A 3QLPH 4OS6A 4AOQA 1ZOMA 5L30H 1FY8E 5ESTE 1EFRD 4A92A 2ULLA 2UWPA 2F9OA 3KHVA 4FUJA 1EAWA 3MH5A 2PUXB 1BOQA 1YY3A 1ANBA 1LHCH 2ODQA 1QTFA 2OXSA 4FUCA 2FLRH 2ZCKP 1XUFA 1PQ8A 3GCTG 2KAIA 2JH5D 5DGJA 3IITA 1AN1E 1UTPA 3GY5A 4MPWA 3DSGA 4XBCA 3ZV8A 3ZZ7A 4FOUC 2P8OB 3DFLA 1QA0A 1QGFA 1OP0A 1ZMLA 2XC5A 3FVFB 5E2OA 4MQAA 1LQEA 2OBQA 4K3JA 3TU7H 5LPEA 1QZ8A 2KM0A 4YTAA 3NXPA 3Q77A 5HXFA 1DWDH 2GTBA 3K6ZA 4WF8A 1GJ5H 3B23B 2FS8A 5L2YH 5EG4A 1DOJA 3DUXH 2C8XB 2OP9A 4WMEA 1O5GH 1SFIA 5A09A 1O3FA 1DANH 2IJOB 2FTMA 5EJLA 1A0JA 2BQWB 1IOEA 1C1NA 2JH6D 2OBOA 8GCHG 3SNCA 1NROH 3LGIA 1P57B 2ZKSA 1TAWA 1AE8H 4YT7H 1MKWH 3ATWA 3RXDA 4XFQA 2FM2A 3MO3A 4NA8A 2QXJA 1TNGA 1OWDA 1HAGE 2CGAA 1FV9A 1H1BA 4ABEA 1BCUH 1K1NA 5DP4A 4I8HA 2ZHFH 2PSXA 1BITA 2KCAA 1QQUA 1NESE 4RKOB 2ZO3H 4Y8XA 1OWEA 3SORA 1O5CB 2OUAA 1ARCA 4BXWA 2WZQA 2Q6GA 5E0GA 1TX8A 1YLDA 2PSYA 3LT3A 1DUEA 1UVOA 3ZVAA 5I25A 4FU7A 1IQLA 4XSKU 2ZPQA 3RXBA 1ABJH 2BDIA 1CGHA 1L1JA 1O2ZA 5JBAS 4XRNA 2VIDA 4VGCB 1AE5A 3SJOA 4ZAEA 1O2JA 3I77A 1GL1A 1BMMH 4ZKNU 4Y71A 1P3EA 3M36A 1OHHD 2FOCA 4Z0KA 2FOGA 1TQ0B 2WPKS 3GY8A 4FU8A 1AHTH 1L0ZA 2EI8A 4OGXA 5GPIB 7GCHG 1ESTA 1QQ4A 2GZ7A 2ZPRA 2C8WB 3B9FH 4P02A 2IPHA 1BMFD 4NZQA 2AERH 3FFGA 1E38B 5A8YA 1PPZA 1E1RD 1K0HA 1EB1H 1W13U 1GI3A 2BDHA 4INLA 2Q6FA 5EQQA 2BZ6H 1WYKA 3TK5A 1SR5C 2SNWA 1ZPCA 2ZHQH 4FVDA 5DN6D 1TGNA 1V2VT 1PPEE 5C1XA 4B2BA 3TGKE 2QN5T 2QXIA 1P0SH 1DDJA 5KECA 2XBYA 3OSYA 5GXPA 3U8RH 4OGYA 1BTZA 4D7GA 9ESTA 1C1RA 2YNAA 1JXPA 1DWBH 1ELGA 3UPEA 1GCDA 3FN8A 3P8OA 3E1XB 4GPGA 3UTUH 1FPCH 1HXEH 1GBIA 2ZNKH 3RDZA 1UTKA 3AAVA 1T7CA 1A46H 1F7ZA 3ITIA 4AB8A 4BOHA 1ELVA 3URCA 3A84A 1TX7A 4PROA 1XVOA 3LGYA 1G2MA 4Q7XA 3FAOA 2FX4A 3QO6A 1F0SA 5FXLA 1BHXF 3MOCA 3F9HA 4I33A 5JBCS 1SQTA 4E06H 1O0DH 1KXBA 2SFAA 4H6TA 3K65B 5GJ4B 1VITF 1CHOF 3PWCA 4XDEA 1WQVH 3KNXA 4E7RG 1FXYA 4ZMAH 1KXEA 1HAIH 4F55A 2VIPA 1K28D 3M3VA 4NSYA 1AUTC 1S5SA 4ABIA 4YXWD 3GYLB 5EJ1A 3OEHD 3ZZCA 1GBEA 2PKAB 1TPPA 1TRMA 3H7OA 4NIWA 5EW1H 4I8GA 1C5TA 2QF3A 2Z3CA 3KIDU 4D7FA 2J4IA 1GI8B 1WOFA 3MNSA 2JKHA 5PTPA 2HPQH 3U8OH 2EEKA 3EA8A 3MI4A 1AFEH 3E91A 1PPHE 1MAXA 5GNDA 1OX1A 4UEHH 1RD3B 4M7GA 1O31A 2EC9H 2FOHA 2BVRH 2A5IA 3QUMP 5EQSA 1C2DA 3LGUA 1AVWA 3F9GA 4ISOA 1SQRA 2UWOA 3T25A 2TGAA 4AFZA 1OPHB 1C5QA 2VVCA 1J17T 2AEIH 3OTPA 4OS2A 2FYQA 1C5YB 1HPGA 3VG8A 4QT8C 2RCEA 3P17H 4IN2A 4X1QU 1QURH 4F49A 3RXPA 1V2QT 3V7TA 5EODA 3RXEA 3S7HB 2PGBB 1L1GA 4X2XA 2JIZD 1K1JA 1H4WA 2ALVA 3BG8A 1MH0A 1GBBA 1NPMA 4UFEH 1UHBA 3UUZA 2SGDE 3ZZ8A 4XOJA 2YNBA 2A1DB 2K8IA 4NZLA 2SGAA 1V2KT 1SG8B 4WMDA 3W94A 1UJ1A 2Z94A 1RS0A 2PP6A 4CRAA 2ALPA 1BTPA 1RIWB 1S0QA 3ODDA 2LELA 1KSNA 1DM4B 2AGGX 2C93B 2TGPZ 1MUEB 1K1OA 2VGCB 3TPIZ 2HNTE 1UTJA 1O2WA 2HNTF 2C90B 2WSSD 2ZEBA 4TPYA 2FODA 1L1NA 1NRSH 3Q3KA 2HRVA 1LHDH 3LC3A 2NU4E 3BTEE 1BTWA 5GCHG 3N7DA 1W3CA 1LHEH 1KMHB 1YWUA 1TFXA 3GISB 2CHAB 1C2LA 1GMDF 4MNYA 1F5KU 2W3KA 1BRAA 1DWCH 2G55A 3P95A 1RFNA 3RXTA 4Y6DA 1C1PA 1GGDC 3HKJB 1QNJA 3SJIA 2WPIS 4FUEA 1EAUA 1S6HA 1UTLM 3LIWA 1AB9C 3GY7A 4K8BA 1Z1JA 1O36A 5K0HA 1YM0A 2CV3A 2ZGBH 2ZHDA 3RXCA 2XRCA 1GVZA 4B74A 1K2I1 3CS0A 4UDWH 4ABJA 5G4BA 2ZHEH 1NBME 4ISHH 2OC8A 1GJ4H 1ZMNA 1C1SA 2VJ1A 4JK6A 1CHOG 2AIQA 3M3TA 4Q4LA 4UONA 3KN2A 1NFWA 3QGJA 2L6OA 2O8WA 1AIXH 1MTNB 1UK3A 2V6NA 2GZ8A 2A7JA 3A85A 3BTTE 2VWMA 4B73A 3O8BA 1BRUP 2Y80A 1HIAA 1LQDB 2Z9JA 2ZFSA 4JYTA 1GHAG 2Z6BD 1HDTH 2UUKB 1BMLA 5JBBS 4A5TS 2ZTZA 1MAYA 3PYHA 5HIZA 4YM9A 5TCAA 4O3TA 1GDNA 1O2MA 2FO9A 1TX6A 2Z9KA 5HIYA 4IW4E 2B8OH 1ZLRA 4O03A 2D8WA 4XE4A 4IGDA 6CHAC 5FCKA 3TGIE 1GI4A 2YMSB 1GHVH 4JZIA 1HJ8A 5FBIA 1PQ5A 3SGAE 1HNEE 1NN6A 2P3UB 4AYYB 4X1SU 3V3MA 2YOLA 1H9LB 1O2NA 2Z7FE 1QJ7B 4ISIH 1P12E 2ZDMA 3BG4C 4X1NU 3RXRA 3GCOA 4B6EA 1DVAH 1TQ7B 3VB7A 3T27A 1EAXA 2W6ID 3T62A 1O3JA 3GCTF 1Z7KA 2ANWA 2TIOA 3BTFE 1OSSA 1DFPA 2Y7ZA 2O8MA 3VB5A 1O5EH 3MU4A 2RFKC 3D49H 4M9FA 4BTIB 2OD3B 3RXAA 2A31A 1EATA 1O3CA 2GJGA 1EPTA 2J98B 2ZDNA 1G32B 3RXKA 5IYTA 2OCVB 1MZAA 1C5SA 3PV2A 1EOJA 1Y3VA 1XUIA 1C5RA 4IN1A 2G00A 2WYGA 4LZ1H 2VBCA 4WWYA 2J2UA 2VIOA 4K69A 4OS5A 2BOHB 4A1XA 2GT8A 2NU3E 3MYWA 2F83A 1UTMA 1XUGA 4I32A 1A5IA 2XBWA 2A2QH 2XBVA 2BY6X 1VITH 1Y3UA 1BQYA 3PLKA 3KQ5A 2C8ZB 1ZPZA 1O3BA 4ZHLU 2H5CA 1SOTA 3K2UA 4K60A 1V2PT 1ZPBA 1NBMD 2BY5X 1W7GH 3TJUA 1UVPA 3RXIA 2V35A 4XD7D 4IMQA 3NWUA 3LKWA 3PO1C 3SQEE 4Y8ZA 4YOGA 3SUGA 3TK9A 1HCGA 4NCYA 3RM0H 2YMSC 1TMBH 1TA2A 1X7AC 1V3XA 4KELA 1C1UH 1CSOE 3H7TA 1SGFG 4HGCA 4MLFB 1QR3E 3RU4E 1VJ9U 1JIRA 3AAUA 2GX4A 4AYVB 3BEIB 2BLOA 1D6WA 2ZHWH 1EZXC 5F03A 4TT3D 2EA3A 4TY6A 1GCTB 3A81A 1HAVA 1BIOA 1V2OT 3FP7E 3ZYDA 3FP8E 3VB3A 2ZDLA 1W0ZU 2PR3A 1A5GH 2WPHS 2KAIB 3RXJA 5C17A 3E16B 4X8UH 8GCHF 2C8YB 4O97A 5FPSA 4NG9H 2QAAA 3PROA 1AU8A 4WXVA 3SV6A 2BX4A 7ESTE 1ANDA 4H6SB 4AG1A 1ANCA 1P2JA 2AMDA 2BD2A 3SI3H 4MNXA 2XWAA 3ZZ6A 1SLVB 1LMWB 3Q76A 1GDQA 5AF9H 3MTYA 2OTVA 2PTCE 5AVDA 4Y10E 1CBWB 2A32A 3T28A 2W7SA 2KCYA 1SGPE 4IC5A 1YBWA 4NFEA 1BDAA 3CENA 4AGJA 1FQ3A 3E8LA 3F2FA 1P2NA 1GGDB 3BTQE 2KCPA 5BPEA 1GBJA 1LTOA 2G4UA 1ETSH 1AGJA 4ZXYH 6LPRA 5HYOA 1CVWH 1AVXA 3P8NA 2CMYA 1LKAA 3PMAB 3SO3A 2B5TB 5JB8S 2J5UA 2Y5FA 4DCDA 4MVNA 1XUKA 1W0YH 1OS8A 4HTCH 3SQHE 3MWIU 3C27B 5F8ZA 5E2PA 2FP7B 2A45B 2HLDD 4A1TA 2SGPE 2H9HA 1A3BH 1F0RA 3UAIC 4BTUB 5DSFA 1D3PB 2O8TA 2GMTC 3F6UH 2J97A 5T6FA 1Z1IA 1UMAH 3VGCB 1UTOA 1ZHRA 1MQ5A 1JMOH 1QRZA 1P04A 4DURA 4IS5A 1C5WB 1ORFA 2F3CE 1HAVB 4JYVH 2KZ4A 4CHAB 2BD7A 2JH0D 2FI3E 3UOUA 2RA0A 4Q80A 1O39A 4FUDA 1O2HA 4TWYA 3DSPA 2XCFA 3EDXB 2PFEA 3M5MA 2GKVE 2XNIA 4X6OA 3RUOA 2PHBA 1U6QA 1A2CH 1TBQH 1ELEE 1CA0C 3BTGE 3U8TH 1C5MD 1YGCH 2VWLA 2JETB 1UVSH 3GDVA 5EJZA 4ESTE 1J8AA 2H2ZA 1MMJN 1EJMA 1ESAA 3SJ9A 3SNDA 1ZZZA 1LPKB 5A2MH 4MPUA 5T1VA 1BHXB 3N7EA 1ETRH 3EYDA 1IQJA 1SFQB 2W7UA 1Y5AT 4YO9A 5DP6A 1N8OC 1SGRE 1D6RA 1F5LA 1H9HE 1GMDG 1ABIH 3UQVA 3KYGA 4GHQA 1BB0B 1C5PA 1BT7A 2G81E 1EB2A 1B0FA 1TGTA 3RMMH 2OC1A 6GCHF 1OYQA 2Z3DA 3F1SB 3TH4H 4A7IB 1N1LA 1GBKA 1YPGH 1BJVA 1MKWK 3F0OA 3UR6A 2J9NA 2WPDD 1OKXA 3R3GB 2R0LA 4AFSA 1IQEA 3QX5H 2P3FH 3M35A 1RRKA 3RMLH 3M7QA 1ELCA 3LJJA 3GY3A 1ETTH 3DSOA 2KR7A 2R2MB 4ABFA 1ZGIA 1W7XH 1W0JD 2BD3A 4K1TA 2PWXA 4I86A 5H4IB 3SU3A 1VGCB 4AX9H 1EAIA 2K0QA 1P2MA 2BHGA 1V2NT 4ZH8A 1BMNH 4MNVA 3MU8A 3TJNA 2AIPA 1C5XB 3RLWH 4OM9A 1SLUB 3TK6A 5DG6A 1TOCB 1KXAA 1BTHH 2BB4A 2H6MA 1JRTA 1TABE 2G8TA 5C5NA 3WW7A 3KL6A 3UR9A 2ZQ2A 2J92A 4DG4A 4HZHA 5GDSH 4J2YB 1C2IA 1PPGE 1UTQA 1ANEA 1V2JT 5HGGA 2ZC9H 1NY22 1BBRK 1AI8H 4TWWA 3NK8A 1C1WH 4B2CA 1SSXA 3W95A 1IQFA 2GV7A 1HIAB 3MH4A 2A7CA 2GT7A 1J9CH 1ELAA 1O3LA 1RTLA 3UY9A 3S0NA 3ZZDA 1DT2A 1GBAA 1O3EA 3RXGA 3ZZBA 1XUHA 1TNJA 3ZYEA 5DP5A 3SU4A 1FIZA 1C2GA 4ISNA 3PRBA 4Y7BA 5DJ7A 1G36A 2ZFFH 3ZZ3A 1UCYE 2ZDVH 2LNCA 1T8LA 1O2QA 1XXFA 3RXSA 3EGKH 2BD4A 2SGEE 7LPRA 3HATH 1F92A 1XKAC 2VWOA 3SZEA 1GHWH 2O9QA 1P8VC 3VB4A 1KYNA 3EQ0H 3L6PA 1XMNB 2NU1E 4K1SA 3SYJA 2CF9H 3FZDA 4Y79A 1IQGA 3URDA 1VITG 1OWHA 1C4V2 1O2OA 1HLTH 1WXRA 2BLVA 2ZFQH 2VH0A 4CRBA 5T6GA 1H8ED 2OINA 2QC2A 4HI3A 3PMHB 2P95A 2GCHF 1PYTD 2HLCA 1SL3A 3BTKE 5KGOA 1S81A 1T31A 1ELTA 4JZEH 1LPGB 4ZROA 1WCZA 1HJ9A 3LDXH 1ZTKA 1XVMA 3I78A 2WPJS 4B76A 3DA9B 1GI6A 2SNVA 4YZUA 1INCA 1MU6B 2ZFRH 1YPHE 1SMFE 1GWAA 1KIGH 1OXGA 3RXUA 4GAWA 3TIUA 3ZVCA 1HUTH 3OFND 5EOKA 3A83A 8KME2 5TCCA 2PKSC 4BAOB 3SGBE 5F53A 4B75A 3QTOH 1F2SE 2ZG0H 4YLUA 1ZGVA 2F4LA 3GCHC 3RU4T 2A2XH 3BTHE 4TYDA 1O3MA 1EP5A 1P3CA 3ATLA 3AVZA 1EZQA 2GCTC 1BJUA 2R3YA 4SGAE 2HVYB 1FY4A 3GDUA 2WV9A 5KEDA 2ASUB 4Z6AH 4KGAA 1DWEH 1E1QD 3N99A 1E79D 2ZWLH 2DE9A 2FIRH 3T2NA 3LOXA 5SGAE 3MH6A 1ZJKA 2C4FH 1SLWB 5T6DA 1SGQE 1EUFA 4MPXA 1K21H 1UK2A 1LO6A 4BAKB 5JPMH 4Q2KA 5LPFA 3MFJA 1BTUA 2PGQB 1D4PB 3E90B 1M9UA 3HKIB 2Q1JA 5B6OA 3PM3A 2Y82A 1EZSC 3BTME 1V2WT 1SKYE 4AORA 1TE0A 1GBLA 1O2UA 1C2EA 2BX3A 2QE7D 2BLQA 1NRNH 1GJ8B 4LOYH 2FOEA 1RXPA 1SC8U 1G37A 1T8NA 2IOTA 2W26A 1YPJH 1G2LA 2HWLB 1EKBB 3BV9B 1FN6A 1UVTH 4NIYA 4UFGH 1P2QA 3ATKA 1TNLA 3IG6B 5GCHF 3U28C 1O3HA 2FMJA 4OS7A 1H8DH 2UWLA 2ZA5A 1Z8IB 5DPAA 4B6FA 2B7DH 1ARBA 5AFYH 3F3BA 4ACAA 2B9LA 3C1KA 1AUJA 3M7UA 1ZMJA 1QJ1B 2BVXH 1FPHH 1AFQB 5FHTA 5DP3A 1KXDA 3A86A 1EPTC 3VPKA 2BXTH 1HB0B 2UUFB 2FI4E 4K8YA 1BRBE 1H8HD 2ZECA 1L2EA 4ABHA 1HAOH 3SNAA 1IQIA 3D65E 3SNEA 3E6PH 3BG4B 2I6SA 1RGQA 2XOKD 5C0TA 4GLYA 1D3DB 2LP6A 2LPRA 3BTDE 3KGPA 3FP6E 3G01A 3OY5U 4KP0A 1TMTH 3ESTA 1IQHA 1UCYH 2Y5HA 1W8BH 1G3EA 3E3TA 5FX6A 1O2SA 3P8GA 4ZKOU 3S9BA 1SLXB 3MO9A 4CRFA 3LC5A 4DIHH 4DY7B 1MD7A 1ZRKA 1A5HA 3QWCH 2GDDA 3FO8D 4OS4A 1TIOA 4LXBH 1C2FA 1DY8A 3OY6U 3SN8A 4X8VH 3SJKA 3RXLA 2AGIX 1ZYOA 1A61H 4JMYA 1MTUA 4U01A 4YOJA 3SJ8A 5LH8A 3TLOA 1O34A 2VNTA 2A5AA 2GVFA 4DVAU 2H1UA 1UHBB 1RJXB 1MCVA 5DKMA 3U98H 3E0PB 3NZIA 3ZVDA 2QGRA 2BDGA 2EQNA 1DPOA 2F9NA 2GMTB 4WXIA 5JB9S 1WBGB 3RM2H 3MQKC 1S6FA 2FESH 4ASHA 1CA8B 3IWMA 4IC6A 5LGOA 4X6MA 2BXUH 1SVPA 1NRPH 2FI5E 1TYNA 2F9BH 2FLBH 1HFDA 1O2YA 1TRYA 2Y5GA 1IAUA 3A82A 5A0BA 2A5KA 1LVBA 3LGTA 3BIVH 1G9IE 3UREA 1GHAF 3CNRA 3F68H 1P10A 3EAJA 3SV2H 1AO5A 2ZGXH 3A7VA 2F9VA 2ZFTA 1YPEH 3QZQA 2ANYA 2K1QA 1VCPA 2XC0A 1NRQH 1TNIA 3SU1A 1GCTC 1W12U 4I8JA 3P8FA 1MBQA 1FNIA 3SBKA 1THRH 1O2VA 2GP9B 1GJ7B 1FLEE 2CK3D 2TRMA 1O2TA 1YF4A 4Y11E 1YPMH 1MZDA 1O3DA 4A1VA 2WPLS 2WUCA 2QYIA 2PKAA 5C0UA 3DCLA 1C5OH 1C1OA 1VZQH 2FOMB 3GS9A 2OQ5A 4AZ2B 2W6JD 4FETA 2F43B 1OP2A 4CREA 4NFFA 2RDEA 3GY2A 1JIMA 3PWBA 1QHRB 1GBTA 1NU7B 4FUGA 1GJBB 1HRTH 3K6YA 4ZKSU 4O3UA 1HJAC 1NTPA 1FMGA 4UE7H 1EASA 3A7TA 5J4QA 1O3AA 1GJCB 5CHAC 4HG6A 1NZQH 3HGPA 4Y7AA 3UNSA 3LJOA 2QY0B 1HGTH 2HALA 3MH7A 5L6NH 1EP6A 3PV4A 1KXFA 1FY5A 4X6NA 2BLWA 1UW7A 1DXWA 2CJIA 3D23A 1E36B 1TGBA 1BTXA 4X8SH 5C20A 2AYWA 3MO6A 1O3NA 2XCNA 1V2TT 2C3SA 4KKDA 1JOUB 3A7XA 3MNBA 4WJG2 2R2WU 1TONA 3RU4D 1Y3WA 1C1QA 4VGCC 1FY1A 2DE8A 1ZR0A 1SGFA 1MTWA 1G30B 1O2KA 5B6LA 1D3TB 4DT4A 2GZ9A 2ZU5A 1TMUH 4X0WU 3A7ZA 1PQAA 5A0AE 5A8ZA 1GVKB 5IDKA 1TNHA 1C4Y2 1HBTH 1PPCE 4KTUA 3M5LA 3ZVFA 4F48B 2YMSD 1FIWA 1GI5A 4K1EA 3EE0B 1UVUH 4NWKA 2WV5A 4Q63A 3TITA 1GBFA 1UK4A 1GG6B 1CQQA 1SGIB 1VCQA 3GYMA 4R8TB 3FKSD 4J1YA 1KLIH 1VCWA 3MU5A 1QB9A 2ZDKA 1C2JA 1O5DH 3L3TA 3GICB 3SZNA 1OOKB 2D2DA 3WY8A 3O8CA 1QB6A 1Z6EA 1V2ST 2AMQA 5I46H 1A0HB 2TBSA 2V3MA 1TLDA 1DLKB 1O2PA 1SGTA 4E05H 2BZAA 1K9OE 4JZDH 1NFXA 3SU0A 3MMGA 1DUAA 3A88A 2BDAA 2QCYA 3KEEA 1WV7H 2ZGCA 1G3CA 2D26C 8LPRA 3U1IB 1UO6A 2Z9LA 1QIXB 3KF2A 1MD8A 4YESB 1ZTLA 3SOSA 3QN7A 5GIBA 1J14A 5DP7A 3PO1B 2VIWA 2SGFE 1OYTH 3MNCA 4BTTB 1FI8A 1NRRH 5DP9A 1IQMA 1QBOA 1CU1A 1H9IE 2I6QA 3M5NA 5HMAA 5FX5A 1OWKA 3GOVB 3RP2A 1CGJE 5A0CA 2OLGA 2FS9A 2FTLE 4HFPB 2J34A 1JWTA 3FANA 4BNRA 3ZVBA 1EOLA 1SGEE 1GMCG 1BBRE 2XXLA 3Q3XA 4RT0A 1SGNE 2FWWA 4GCHF 3UIRA 1AY6H 3BEFB 2FDAA 1V2RT 6CHAB 3F2GA 2ZP0H 2V7QD 5L2ZH 3TGJE 2O8UA 4NGAH 1QRWA 1DICA 5C67A 5FAHA 3OU0A 4WH8A 2FXRA 2SGQE 1A1RA 1IQNA 2FYRA 1ELFA 1MQ6A 2GCTB 1FX0B 3A8CA 1O5FH 2AH4X 1W0KD 2BMGB 1XKBC 1RTFB 5F6MA 1BBRH 3ATMA 4FVBA 1A0LA 2QV1A 1WAYB 1RIWC 1AD8H 1COWD 2FPZA 1FN8A 3STJA 3ZIAD 1E37B 1QCPA 1AWFH 2A7HA 1FAKH 4NSVA 1GPZA 1EXFA 3OE7D 4RI0A 3R0FA 1PPFE 4YT6H 1O3OA 3A7YA 1Z71A 3K9XB 4CH2B 1AZZA 5CE1A 2Z3EA 3P70B 1KTTB 1C5VA 1C1TA 1IHTH 3GY4A 4AFUA 1O3KA 1WUNH 1V2LT 3A7WA 3SV7A 4I8LA 2B0FA 4FUHA 1ELBA 5F8TA 1N6XA 3TNSA 3PV5A 3TVJB 1NC6A 2R3UA 5C94A 1C5NH 2OK5A 3EA9A 5CDFE 3BTWE 3UNRA 2ZQ1A 5C1UA 2BY8X 2P8OC 1Z8GA 1DSUA 1DS2E 5EPYA 3A8AA 3U69H 2VVVA 3V0XA 2VU8E 1O2GH 3TH2H 3KQDA 1ID5H 1LVOA 3PRDA 3UB0A 1N6YA 3Q00A 4INHA 1P9UA 4IMZA 4WY3A 1WU1A 4ZHMU 6ESTA 3DT0H 2AFQB 3ZV9A 1GI2A 4E7NA 2PKSB 2TGDA 2G5NA 2G51A 3VXFH 4D8NA 1QY6A 4MTBA 3DD2H 3HGNA 2A4RA 3ODFA 1LHGH 2HPPH 1SOZA 1T8OA 2ZU4A 4ZUHA 1WTGH 1LCYA 4H4FA 2Y6TA 1TBZH 1V2UT 1QRXA 1GBMA 2VIQA 4X8TH 1G3DA 3STIA 2VINA 1O38A 3GCNA 4GCHG 4Y0ZE 3QZRA 4FXGH 4F4OC 3QTVH 1SPJA 5E0HA 3KQBA 4X1RU 1HAPH 3SNBA 4ISLA 1KXCA 1QB1A 1XXDA 4ZCNA 3JZ2B 1Y5BT 1J16A 1XX9A 3EE7A 1P2KA 1NFUA 1Y3XA 3M37A 1O32A 2CF8H 1NU9A 1OP8A 4GHTA 3N7OA 4FUIA 3MU1A 2J38A 1C5ZB 2KFWA 3A8BA 1FAXA 3NRLA 1O37A 2GV6A 1JRSA 1LVMA 1GBDA 1MTSA 3ELAH 3RLYH 1GJ9B 1MTVA 2XNDD 3JZ1B 1TGCA 1PFXC 2FOBA 4CRDA 2F9PA 1VGCC 1YCPH 1Q31A 2BYAX 4KTSA 2P94A 1MABB 1GMHF 4AFQA 2W3IA 4WH6A 1ZSLA 3QK1A 1BUIA 4D9QA 5K7RA 2F91A 1S82A 3Q3YA 2PV9B 1S85A 1Q3XA 1VJAU 3VGCC 1P2OA 4ZXXH 4NIXA 2VH6A 4GVUA 1GHBF 3P6ZB 1VKYA 1ZHMA 3UFAA 1GI1A 4ABDA 4ABAA 5TJXA 3ATIA 1MKXK 2BDBA 1J15A 5JBTA 1Z8RA 2BY9X 4IBLH 1UTNA 3T5FH 3ZZ5A 3OAAD 1GDUA 3ZZ9A 5AHGH 5EXNA 4CR5A 1EPTB 2J98A 4UFDH 1P06A 1WTHD 5CMXH 1LHFH 4DJZB 4FU9A 1C2MA 1DLEA 4NIVA 5C1YA 2M5TA 3SV8A 2WUBA 1C9PA 5EXMA 2JDID 2VGCC 3WWFA 2P16A 1TWXB 1CE5A 4BAMB 1W10U 4SGBE 2IJD1 1S83A 1NM6A 1V2MT 2UUYA 4UFFH 1W14U 4B2AA 3RXOA 5HM9A 4ZKRU 3ZVGA 2THFB 1AVGH 3SU5A 2DUCA 2BD5A 1F0TA 3SGQE 4MNWA 5FPTA 1O5AB 5F8XA 2FOFA 2XW9A 1WDIA 4YOIA 2A4OA 3RC5A 5EIYA 3UWIA 1YCPK 4CH8B 3PB1E 2BTCE 1EQ9A 1GHBG 2CN0H 3SHCH 1YYY1 1KY9A 3T29A 1AB9B 4Y8YA 1HAHH 3M61U 1HAZB 1RTKA 9LPRA 1KDQB 2ODYB 2QA9E 5ETXA 1L4DA 3LH3A 1GBHA 1T4VH 4X2VA 4CR9A 4X2WA 3OX7U 2ZCLP 4DIIH 1DY9A 1MKXH 1O3IA 2OQUA 1YPHC 3BSQA 2CXVA 5GWZA 1G3BA 1K1IA 2Z9GA 1CGIE 1P2IA 1EX3A 3RMOH 1W11U 2XTTB 2A4QA 3RXVA 2IN2A 1O5BB 3GDSA 2XBXA 2XWBI 1OWIA 3TJVA 2HOBA 1EZUC 1QJ6B 3HK3B 2EI6A 3UOPA 1T32A 3FZZA 1AQ7A 4FUFA 1GMHG 1FJSA 4R0IA 3F2HA 1MBMA 5EPNA 1PYTC 2PLXA 3SHAH 1CT0E 1K1LA 1GJAB 1GG6C 3SUEA 2NU0E 5C2ZA 1AKSA 2KCOA 3PMJA 2ZI2H 1XM1A 1O3PB 3QDZB 3CP7A 3A89A 3SI4H 2WV4A 3M5OA 2GDEH 4THNH 2ZDAH 1DX5M 3ZZAA 2TPIZ 2JETC 1YLNA 3ENSB 1ZJDA 3AASA 3M3SA 1KDQA 1SB1H 5CHBA 1IHSH 3PLPA 4ASUD 4BAQB 5T3HA 1PQ7A 4ABGA 1TRNA 1C2HA 1YP9A 2BQ6B 1CHGA 2FOAA 4MDSA 2ILNA 4U32A 1HJAB 3PTBA 3O8RA 2D1JA 1O2XA 3NKKA 1CT2E 4INKA 3V13A 1HAXB 4D76A 5FPYA 5CHAB 5DP8A 2ZZUH 1ZTJA 4X2YA 4CBNA 3BEUA 2ZU2A 4XBDA 1HXFH 5EQRA 4CHAC 1CO7E 1EJNA 1Z8JB 2GD4B 1SI5H 5BRRE 2WPMS 2Q6DA 4YLQH 1S6LA 1GHXH 4A6LA 4X6PA 3LGVA 5C3NA 1Y3YA 2RDLA 1GJDB 3F0PA 3M7TA 5EW2H 2AGEX 1GI0A 4DGJA 4JZFH 1TB6H 5ESBA 3RXMA 1P01A 2ZTYA 1SHYA 1H8IH 1DXPA 1HV7A 1D9IA 1NT1A 2EI7A 4JYUH 2UUJB 4K5ZA 4ACBA 3LONA 1DE7H 1LPZB 2ZF0H 1WQSA 1TPOA 1O33A 2CHAC 1AMHA 1QBNA 3H5CB 4DW2U 4U2WA 3W1EA 5EU8A 3S7KB 5HKKD 1K1PA 2OC7A 5DK1A 1N8OB 1QL7A 1YKTA 4D9RA 2ESTE 5E0JA 4LK4A 2V0BA 1ELDE 2A4GA 1TOMH 1ZSKA 4JK5A 1C5UA 1DSTA 2GGVB 1W2KH 4NA7A 2AMPA 3NCLA 1MU8B 2Z9IA 1BRCE 2PW8H 4I31A 1KLJH 1OWJA 1V6DA 3ZVEA 1IQKA 1C1VH 4RKJB 1GHYH 1K22H 4X1PU 1AKSB 4BANB 3KQEA 4JCNA 1P02A 2F9UA 4ABBA 1YPLH 1SGCA 4MG3A 3AK5A 2EY4C 3SUFA 1MCTA 1A3EH 5AFZH 1JBUH 1A4WH 1KLTA 3AW1A 3HK6B 4RSPA 1DITH 1GHZA 4DT7B 4GUXA 3BF6H 1SBWA 3KYFA 3NUMA 2BDCA 5JDUB 1C9TA 1O2IA 3CS7A 1Z6JH 1CT4E 1TNKA 1O35A 3PMBB 2M2AA 4B71A 3ZZ4A 4CBOA 1SHHB 1YPKH 1LDTT 3WWBA 4Y0YE 5LPRA 3AW0A 3FOAA 2NWNA 1FONA 6GCHG 5FCRA 2Y7XA 3T26A 2WHXA 2P93A 1BA8B 1TALA 1GMCF 3SU6A 4O9VA 1FUJA 4GSOA 4TSFD 1ZRBA 1F5RA 4I8KA 4Y76A 3TNTA 4BXSA 1AFQC 1LKBA 2BOKA 2HGTH 2P59A 3QGNB 2AHME 1Q2WA 3I29A 2BM2A 3RC4A 2BVSH 1S84A 2R0KA 5FBEA 1T8MA 4TY7A 1P05A 2G5VA 1BTYA 2BD9A 3OYPA 4NA9H 1ZSJA 3U9AH 3VB6A 4DOQA 4KTCA 2AS9A 2QF5A 4TPIZ 2HNTC 1B5GH 4CRGA 2J95A 7KMEH 1UCYK 2IPQX 4Z1MD 4I7YH 1SGYE 1THPB 1C1MA 1YLCA 3MU0A 4Q7YA 2G4TA 1GVLA 5E8EH 3A87A 2JJ2D 4AB9A 4LZ4B 1P09A 1WSSH 2R9PA 3S69A 3SV9A 1C4U2 5JYIA 1SGDE 3DFJA 2OC0A 3P92A 5A8XA 3NPSA 1O3GA 1FZZA 2QF0A 2BQ7B 3D62A 2GCHG 2VVUA 3KQCA 2ZPSA 3GY6A 2ODPA 3RXFA 4AN7A 2ZU3A 3B8JA 1NS3A 1GBCA 1SQAA 1TPSA 3UWJH 4RN6A 1FY3A 2ZGHA 1LVYA 3TH3H 3H09A 2FEQH 3O8DA 1K1MA 2WINI 3A8DA 1FDPA 2ZTXA 1TPAE 2L74A 2VB0A 3DHKH 3LGWA 1QL9A 1EJAA 1P11E 3EA7A 1D3QB 2A0QB 1GJ6A 2QIQA 2ZIQH 3LU9B 1QBVH 3E0NB 1C5LH 1BMAA 2XC4A 3RXHA 3BIUH 1YCPM 3LPRA 4AC9A 1MTNC 2ANKH 2ZGJA 4K2YA 3GCHB 2G52A 4FUBA 1THSH 1E35B 4B1TA 2ANMH 1NO9H 1Y8TA 3LH1A 2V3HH 3HPTB 1E0FD 2QXHA 1T4UH 1L4ZA 1Y5UT 2J94A 5C5OA 3SU2A 2STBE 4XBBA 1B0EA 1GL0E 2BY7X 1QFKH 2XYAA 1AWHB 3MNXA 5DO4H 2FX6A 2PTNA 5EGMA 1GI9B 3VFEA 3V12A 2ZCHP 3S9AA 2HVXA 3SUDA 5IK2D 2QF4A 3OEED 8ESTE 2KX4A 3F9EA 2ZU1A 4WVPE 1SQOA 3PLBA 4CRCA 1CBWC 1TBRH 2VIVA 1GI7B 2STAE 3RXQA 1O2RA 1Y59T 4JZ1A 1ESBA 2P3TB 2H9TH 4U30A 4UD9H 2O8LA 3UQOA 1KTSB 3F9FA 3A80A 3RC6A 1E34B 1CA0B 2H9EH 1O30A 2W5EA 2JJ1D 2TGTA 1A7SA 4AG2A 3KCGH 1O2LA 2WYJA 4MPVA 4ZHAA 2BDYA 1QL8A 1TGSZ 3VEQB 1F0UA 1XUJA 1ACBE 1P03A 7GCHF 4OS1A 2VWNA 1PJPA 2PUQH 3RMNH 1P9SA 1AZ8A 2ZFPH 5EXLA 3VXEH 4NWLA 2NU2E 3U1JB 2RA3A 1B7XB 1PPBH
chains in the Genus database with same CATH topology
4WMFA 2QXGA 2V3OH 3S9CA 1BZXE 3SW2B 1S0RA 2H5DA 4H42U 1NFYA 1HYLA 2RG3A 3BN9A 3UNQA 3MHWU 3TJOA 5HM2A 3PTNA 4AGKA 1ZHPA 1VR1H 1HAYB 2BD8A 2FZZA 1C2KA 1TA6A 3L33A 5J4SA 4BAHB 4Q7ZA 1YC0A 3OTJE 2Y81A 5ABWA 1QA7A 3QLPH 4OS6A 4AOQA 1ZOMA 5L30H 1FY8E 5ESTE 4A92A 2ULLA 2UWPA 2F9OA 3KHVA 4FUJA 1EAWA 3MH5A 2PUXB 1BOQA 1ANBA 1LHCH 2ODQA 1QTFA 2OXSA 4FUCA 2FLRH 2ZCKP 1XUFA 1PQ8A 3GCTG 2KAIA 2JH5D 5DGJA 3IITA 1AN1E 1UTPA 3GY5A 4MPWA 4XBCA 3ZV8A 3ZZ7A 2P8OB 3DFLA 1QA0A 1QGFA 1OP0A 1ZMLA 2XC5A 3FVFB 5E2OA 4MQAA 1LQEA 2OBQA 4K3JA 3TU7H 5LPEA 4YTAA 3NXPA 3Q77A 5HXFA 1DWDH 2GTBA 3K6ZA 4WF8A 1GJ5H 3B23B 2FS8A 5L2YH 5EG4A 1DOJA 3DUXH 2C8XB 2OP9A 4WMEA 1O5GH 1SFIA 5A09A 1O3FA 1DANH 2IJOB 2FTMA 1A0JA 2BQWB 1IOEA 1C1NA 2JH6D 2OBOA 8GCHG 3SNCA 1NROH 3LGIA 1P57B 2ZKSA 1TAWA 1AE8H 4YT7H 1MKWH 3ATWA 3RXDA 4XFQA 2FM2A 3MO3A 4NA8A 2QXJA 1TNGA 1OWDA 1HAGE 2CGAA 1FV9A 1H1BA 4ABEA 1BCUH 1K1NA 5DP4A 4I8HA 2ZHFH 2PSXA 1BITA 1QQUA 1NESE 4RKOB 2ZO3H 4Y8XA 1OWEA 3SORA 1O5CB 2OUAA 1ARCA 4BXWA 2Q6GA 5E0GA 1TX8A 1YLDA 2PSYA 3LT3A 1DUEA 1UVOA 3ZVAA 5I25A 4FU7A 1IQLA 4XSKU 2ZPQA 3RXBA 1ABJH 2BDIA 1CGHA 1L1JA 1O2ZA 5JBAS 2VIDA 4VGCB 1AE5A 3SJOA 4ZAEA 1O2JA 3I77A 1GL1A 1BMMH 4ZKNU 4Y71A 1P3EA 3M36A 2FOCA 4Z0KA 2FOGA 1TQ0B 2WPKS 3GY8A 4FU8A 1AHTH 1L0ZA 2EI8A 4OGXA 5GPIB 7GCHG 1ESTA 1QQ4A 2GZ7A 2ZPRA 2C8WB 3B9FH 2IPHA 4NZQA 2AERH 3FFGA 1E38B 5A8YA 1PPZA 1EB1H 1W13U 1GI3A 2BDHA 4INLA 2Q6FA 5EQQA 2BZ6H 1WYKA 3TK5A 1SR5C 2SNWA 1ZPCA 2ZHQH 4FVDA 1TGNA 1V2VT 1PPEE 5C1XA 4B2BA 3TGKE 2QN5T 2QXIA 1P0SH 1DDJA 2XBYA 3OSYA 5GXPA 3U8RH 4OGYA 1BTZA 4D7GA 9ESTA 1C1RA 2YNAA 1JXPA 1DWBH 1ELGA 3UPEA 1GCDA 3P8OA 3E1XB 4GPGA 3UTUH 1FPCH 1HXEH 1GBIA 2ZNKH 3RDZA 1UTKA 3AAVA 1T7CA 1A46H 1F7ZA 3ITIA 4AB8A 4BOHA 1ELVA 3URCA 3A84A 1TX7A 4PROA 1XVOA 3LGYA 1G2MA 4Q7XA 3FAOA 2FX4A 3QO6A 1F0SA 5FXLA 1BHXF 3MOCA 3F9HA 4I33A 5JBCS 1SQTA 4E06H 1O0DH 1KXBA 2SFAA 4H6TA 3K65B 5GJ4B 1VITF 1CHOF 3PWCA 4XDEA 1WQVH 3KNXA 4E7RG 1FXYA 4ZMAH 1KXEA 1HAIH 2VIPA 1K28D 3M3VA 4NSYA 1AUTC 1S5SA 4ABIA 3GYLB 3ZZCA 1GBEA 2PKAB 1TPPA 1TRMA 3H7OA 4NIWA 5EW1H 4I8GA 1C5TA 2QF3A 2Z3CA 3KIDU 4D7FA 2J4IA 1GI8B 1WOFA 3MNSA 2JKHA 5PTPA 2HPQH 3U8OH 2EEKA 3EA8A 3MI4A 1AFEH 3E91A 1PPHE 1MAXA 1OX1A 4UEHH 1RD3B 4M7GA 1O31A 2EC9H 2FOHA 2BVRH 2A5IA 3QUMP 5EQSA 1C2DA 3LGUA 1AVWA 3F9GA 4ISOA 2UWOA 3T25A 2TGAA 4AFZA 1OPHB 1C5QA 2VVCA 1J17T 2AEIH 4OS2A 2FYQA 1C5YB 1HPGA 4QT8C 2RCEA 3P17H 4IN2A 4X1QU 1QURH 4F49A 3RXPA 1V2QT 3V7TA 5EODA 3RXEA 3S7HB 2PGBB 1L1GA 4X2XA 1K1JA 1H4WA 2ALVA 3BG8A 1MH0A 1GBBA 1NPMA 4UFEH 1UHBA 3UUZA 2SGDE 3ZZ8A 4XOJA 2YNBA 2A1DB 4NZLA 2SGAA 1V2KT 1SG8B 4WMDA 3W94A 1UJ1A 2Z94A 1RS0A 4CRAA 2ALPA 1BTPA 1RIWB 1S0QA 3ODDA 1KSNA 1DM4B 2AGGX 2C93B 2TGPZ 1MUEB 1K1OA 2VGCB 3TPIZ 2HNTE 1UTJA 1O2WA 2HNTF 2C90B 2ZEBA 4TPYA 2FODA 1L1NA 1NRSH 3Q3KA 2HRVA 1LHDH 3LC3A 2NU4E 3BTEE 1BTWA 5GCHG 1W3CA 1LHEH 1TFXA 3GISB 2CHAB 1C2LA 1GMDF 4MNYA 1F5KU 2W3KA 1BRAA 1DWCH 2G55A 3P95A 1RFNA 3RXTA 4Y6DA 1C1PA 1GGDC 3HKJB 1QNJA 3SJIA 2WPIS 4FUEA 1EAUA 1S6HA 1UTLM 3LIWA 1AB9C 3GY7A 4K8BA 1Z1JA 1O36A 5K0HA 1YM0A 2CV3A 2ZGBH 2ZHDA 3RXCA 2XRCA 1GVZA 4B74A 1K2I1 3CS0A 4UDWH 4ABJA 5G4BA 2ZHEH 4ISHH 2OC8A 1GJ4H 1ZMNA 2VJ1A 1C1SA 4JK6A 1CHOG 2AIQA 3M3TA 4UONA 3KN2A 1NFWA 3QGJA 2O8WA 1AIXH 1MTNB 1UK3A 2V6NA 2GZ8A 2A7JA 3A85A 3BTTE 2VWMA 4B73A 3O8BA 1BRUP 2Y80A 1HIAA 1LQDB 2Z9JA 2ZFSA 4JYTA 1GHAG 2Z6BD 1HDTH 2UUKB 1BMLA 5JBBS 4A5TS 2ZTZA 1MAYA 3PYHA 4YM9A 5TCAA 4O3TA 1GDNA 1O2MA 2FO9A 1TX6A 2Z9KA 4IW4E 2B8OH 1ZLRA 4O03A 2D8WA 4XE4A 4IGDA 6CHAC 5FCKA 3TGIE 1GI4A 1GHVH 4JZIA 1HJ8A 5FBIA 1PQ5A 3SGAE 1HNEE 1NN6A 2P3UB 4AYYB 4X1SU 3V3MA 2YOLA 1H9LB 1O2NA 2Z7FE 1QJ7B 4ISIH 1P12E 2ZDMA 3BG4C 4X1NU 3RXRA 3GCOA 1DVAH 1TQ7B 3VB7A 3T27A 1EAXA 3T62A 1O3JA 3GCTF 1Z7KA 2ANWA 2TIOA 3BTFE 1OSSA 1DFPA 2Y7ZA 2O8MA 3VB5A 1O5EH 3MU4A 3D49H 4BTIB 2OD3B 3RXAA 2A31A 1EATA 1O3CA 1EPTA 2ZDNA 1G32B 3RXKA 5IYTA 2OCVB 1MZAA 1C5SA 1EOJA 1Y3VA 1XUIA 1C5RA 4IN1A 2G00A 2WYGA 4LZ1H 4WWYA 2J2UA 2VIOA 4K69A 4OS5A 2BOHB 4A1XA 2GT8A 2NU3E 3MYWA 2F83A 1UTMA 1XUGA 4I32A 1A5IA 2XBWA 2A2QH 2XBVA 2BY6X 1VITH 1Y3UA 1BQYA 3PLKA 2C8ZB 1ZPZA 1O3BA 4ZHLU 2H5CA 1SOTA 3K2UA 4K60A 1V2PT 1ZPBA 2BY5X 1W7GH 3TJUA 1UVPA 3RXIA 2V35A 4IMQA 3NWUA 3LKWA 3PO1C 3SQEE 4Y8ZA 4YOGA 3SUGA 3TK9A 1HCGA 4NCYA 3RM0H 1TMBH 1TA2A 1X7AC 1V3XA 4KELA 1C1UH 1CSOE 3H7TA 1SGFG 4HGCA 4MLFB 1QR3E 3RU4E 1VJ9U 1JIRA 3AAUA 2GX4A 4AYVB 3BEIB 2BLOA 1D6WA 2ZHWH 1EZXC 5F03A 2EA3A 4TY6A 1GCTB 3A81A 1HAVA 1BIOA 1V2OT 3FP7E 3ZYDA 3FP8E 3VB3A 2ZDLA 1W0ZU 2PR3A 1A5GH 2WPHS 2KAIB 3RXJA 3E16B 4X8UH 8GCHF 2C8YB 4O97A 5FPSA 4NG9H 2QAAA 3PROA 1AU8A 4WXVA 3SV6A 2BX4A 7ESTE 1ANDA 4H6SB 4AG1A 1ANCA 1P2JA 2AMDA 2BD2A 3SI3H 4MNXA 2XWAA 3ZZ6A 1SLVB 1LMWB 3Q76A 1GDQA 5AF9H 3MTYA 2OTVA 2PTCE 5AVDA 4Y10E 1CBWB 2A32A 3T28A 2W7SA 1SGPE 4IC5A 1YBWA 4NFEA 1BDAA 3CENA 4AGJA 1FQ3A 3E8LA 1P2NA 1GGDB 3BTQE 5BPEA 1GBJA 1LTOA 2G4UA 1ETSH 1AGJA 4ZXYH 6LPRA 5HYOA 1CVWH 1AVXA 3P8NA 2CMYA 1LKAA 3PMAB 3SO3A 2B5TB 5JB8S 2Y5FA 4DCDA 4MVNA 1XUKA 1W0YH 1OS8A 4HTCH 3SQHE 3MWIU 3C27B 5F8ZA 5E2PA 2FP7B 2A45B 4A1TA 2SGPE 2H9HA 1A3BH 1F0RA 4BTUB 1D3PB 2O8TA 2GMTC 3F6UH 5T6FA 1Z1IA 1UMAH 3VGCB 1UTOA 1ZHRA 1MQ5A 1JMOH 1QRZA 1P04A 4DURA 4IS5A 1C5WB 1ORFA 2F3CE 1HAVB 4JYVH 4CHAB 2BD7A 2FI3E 2JH0D 3UOUA 2RA0A 4Q80A 1O39A 4FUDA 1O2HA 4TWYA 2XCFA 3EDXB 2PFEA 3M5MA 2GKVE 2XNIA 4X6OA 3RUOA 2PHBA 1U6QA 1A2CH 1TBQH 1ELEE 1CA0C 3BTGE 3U8TH 1C5MD 1YGCH 2VWLA 2JETB 1UVSH 3GDVA 4ESTE 1J8AA 2H2ZA 1MMJN 1EJMA 1ESAA 3SJ9A 3SNDA 1ZZZA 1LPKB 5A2MH 4MPUA 1BHXB 1ETRH 3EYDA 1IQJA 1SFQB 2W7UA 1Y5AT 4YO9A 5DP6A 1N8OC 1SGRE 1D6RA 1F5LA 1H9HE 1GMDG 1ABIH 3UQVA 4GHQA 1BB0B 1C5PA 1BT7A 2G81E 1EB2A 1B0FA 1TGTA 3RMMH 2OC1A 6GCHF 1OYQA 2Z3DA 3F1SB 3TH4H 4A7IB 1N1LA 1GBKA 1YPGH 1BJVA 1MKWK 3UR6A 2J9NA 4AFSA 1OKXA 3R3GB 2R0LA 1IQEA 3QX5H 2P3FH 3M35A 1RRKA 3RMLH 3M7QA 1ELCA 3LJJA 3GY3A 1ETTH 2R2MB 4ABFA 1ZGIA 1W7XH 2BD3A 4K1TA 2PWXA 5H4IB 3SU3A 1VGCB 4AX9H 1EAIA 1P2MA 2BHGA 1V2NT 4ZH8A 1BMNH 4MNVA 3MU8A 3TJNA 2AIPA 1C5XB 3RLWH 1SLUB 3TK6A 5DG6A 1TOCB 1KXAA 1BTHH 2BB4A 2H6MA 1JRTA 1TABE 2G8TA 5C5NA 3KL6A 3UR9A 2ZQ2A 2J92A 4DG4A 4HZHA 5GDSH 4J2YB 1C2IA 1PPGE 1UTQA 1ANEA 1V2JT 5HGGA 2ZC9H 1NY22 1BBRK 1AI8H 4TWWA 3NK8A 1C1WH 4B2CA 1SSXA 3W95A 1IQFA 2GV7A 1HIAB 3MH4A 2A7CA 2GT7A 1J9CH 1ELAA 1O3LA 1RTLA 3UY9A 3S0NA 3ZZDA 1DT2A 1GBAA 1O3EA 3RXGA 3ZZBA 1XUHA 1TNJA 3ZYEA 5DP5A 3SU4A 1FIZA 1C2GA 4ISNA 4Y7BA 5DJ7A 1G36A 2ZFFH 3ZZ3A 1UCYE 2ZDVH 2LNCA 1T8LA 1O2QA 1XXFA 3RXSA 3EGKH 2BD4A 2SGEE 7LPRA 3HATH 1F92A 1XKAC 2VWOA 1GHWH 2O9QA 1P8VC 3VB4A 1KYNA 3EQ0H 3L6PA 1XMNB 2NU1E 4K1SA 2CF9H 3FZDA 4Y79A 1IQGA 3URDA 1VITG 1OWHA 1C4V2 1O2OA 1HLTH 2BLVA 2ZFQH 2VH0A 4CRBA 5T6GA 2OINA 2QC2A 4HI3A 3PMHB 2P95A 2GCHF 1PYTD 2HLCA 1SL3A 3BTKE 1S81A 1T31A 1ELTA 4JZEH 1LPGB 4ZROA 1WCZA 1HJ9A 3LDXH 1ZTKA 1XVMA 3I78A 2WPJS 4B76A 3DA9B 1GI6A 2SNVA 4YZUA 1INCA 1MU6B 2ZFRH 1YPHE 1SMFE 1GWAA 1KIGH 1OXGA 3RXUA 4GAWA 3TIUA 3ZVCA 1HUTH 5EOKA 3A83A 8KME2 5TCCA 2PKSC 4BAOB 3SGBE 4B75A 3QTOH 1F2SE 2ZG0H 4YLUA 1ZGVA 3GCHC 3RU4T 2A2XH 3BTHE 4TYDA 1O3MA 1EP5A 1P3CA 3ATLA 3AVZA 1EZQA 2GCTC 1BJUA 2R3YA 4SGAE 1FY4A 3GDUA 2ASUB 4Z6AH 4KGAA 1DWEH 2ZWLH 2DE9A 2FIRH 3T2NA 3LOXA 5SGAE 3MH6A 1ZJKA 2C4FH 1SLWB 5T6DA 1SGQE 1EUFA 4MPXA 1K21H 1UK2A 1LO6A 4BAKB 5JPMH 4Q2KA 5LPFA 3MFJA 1BTUA 2PGQB 1D4PB 3E90B 1M9UA 3HKIB 2Q1JA 5B6OA 3PM3A 2Y82A 1EZSC 3BTME 1V2WT 4AORA 1TE0A 1GBLA 1O2UA 1C2EA 2BX3A 2BLQA 1NRNH 1GJ8B 4LOYH 2FOEA 1RXPA 1SC8U 1G37A 1T8NA 2IOTA 2W26A 1YPJH 1G2LA 2HWLB 1EKBB 3BV9B 1FN6A 1UVTH 4NIYA 4UFGH 1P2QA 3ATKA 1TNLA 3IG6B 5GCHF 1O3HA 2FMJA 4OS7A 1H8DH 2UWLA 2ZA5A 1Z8IB 5DPAA 2B7DH 1ARBA 5AFYH 2B9LA 3C1KA 1AUJA 3M7UA 1ZMJA 1QJ1B 2BVXH 1FPHH 1AFQB 5FHTA 5DP3A 1KXDA 3A86A 1EPTC 3VPKA 2BXTH 1HB0B 2UUFB 2FI4E 4K8YA 1BRBE 2ZECA 1L2EA 4ABHA 1HAOH 3SNAA 1IQIA 3D65E 3SNEA