3LGIA

Structure of the protease domain of degs (degs-deltapdz) at 1.65 a
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
220
structure length
220
Chain Sequence
FDSTDETPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allostery is an intrinsic property of the protease domain of DegS: implications for enzyme function and evolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Protease degS
total genus 56
structure length 220
sequence length 220
chains with identical sequence B, C
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2010-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3lgiA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3lgiA02
1UTPA 2G8TA 1W12U 3HKIB 1EJAA 1YLCA 1J17T 1CT2E 1XKBC 1QBOA 4D7FA 4UFEH 3GYMA 1PYTD 1W7XH 3ELAH 3EA8A 1MKWH 1TGBA 1TBZH 3TH4H 1RJXB 4ZKRU 1S0QA 2D8WA 2J9NA 1C5YB 2QY0B 1V2KT 1VGCB 3RDZA 4I8GA 3C27B 2FXRA 2A7JA 1Y5AT 1UK2A 5FBEA 2FWWA 1AU8A 1KLIH 2GX4A 3E0NB 1N1LA 2ANMH 1GHZA 2LPRA 3PLBA 1THRH 5DKMA 1C5UA 1C5NH 1FY4A 3B23B 5CHAB 3GY4A 3TU7H 3TLOA 2PTCE 3M5NA 2WPLS 1QL8A 2D1JA 2EC9H 3ZVEA 3SJOA 1UVOA 3MO6A 4UE7H 1A5GH 3P8GA 1DWCH 5JB9S 1SGEE 2ZDKA 1G2LA 4NSVA 1INCA 2Y80A 1E36B 2FOMB 2QYIA 4TY6A 2XTTB 2XBYA 4ZMAH 2P3FH 1DXWA 2Q6FA 2Z3DA 3A7XA 1ESBA 4NWLA 1Y3YA 1MQ6A 8GCHF 1LVOA 1T7CA 3GISB 1WQVH 1RIWC 3Q76A 1C9TA 3STIA 1EJNA 4TPIZ 1GHXH 3RXOA 2YOLA 8KME2 5JBBS 3VPKA 4CHAC 3A8BA 3PROA 4Y7BA 1UMAH 1DY8A 1Z6JH 5DP3A 3K6YA 3O8RA 3RC5A 3TK6A 4ABJA 1QQUA 2BD4A 3KQBA 3RXGA 3RUOA 3KF2A 1ZJDA 2AYWA 3Q3XA 5DP4A 1O3DA 1SGRE 3STJA 4O97A 1QA0A 1AVGH 2BD2A 5K7RA 1G3DA 2VIDA 1PQAA 2BY8X 1MD8A 1BRCE 1GL0E 1F5RA 3CS0A 2QV1A 1GCTC 2ASUB 2OCVB 4JCNA 1BHXF 3URCA 4BNRA 3DFLA 3ZZ3A 3T25A 4XE4A 1CO7E 1S6HA 3M61U 1MTVA 3RXDA 2RA3A 2BX3A 2J94A 3BTGE 4AORA 1YPMH 1O33A 1YPHC 1ZGIA 2BD9A 1ZRBA 1C1UH 2QCYA 1C2JA 1MAYA 1C4U2 1UTKA 2HVXA 3FVFB 2BDBA 1NFXA 1A4WH 2QXGA 2ZHEH 2QC2A 5IDKA 3ZZAA 1IQEA 4FUCA 3S7HB 3RXSA 5J4SA 1GI9B 1ELTA 4BTTB 1F0UA 2Y7ZA 1UJ1A 2ZGJA 2ZGHA 3A8DA 2ALPA 1Q3XA 3KIDU 1O3MA 2ZPRA 1O2UA 1ZPZA 1HNEE 1UTQA 1GBLA 1LKAA 3RC6A 2ANKH 2VINA 4INLA 4CHAB 2UUJB 4BAKB 3SUEA 1LDTT 2BQ6B 1D9IA 3VB5A 5I25A 2HNTF 4NFFA 3BTME 4OS4A 2H6MA 3RXCA 3BIVH 5BRRE 3U8OH 2SNVA 2ULLA 1UCYH 4ISNA 1MUEB 1UTLM 3QO6A 1SI5H 3MU1A 4IN1A 2VH6A 5HM2A 3Q00A 2OC0A 1THPB 3RXKA 4ZHLU 2ZQ1A 4X8VH 2Q6DA 1Q31A 2SGQE 3VB4A 1FPHH 2ZHQH 4WJG2 4NG9H 1P2QA 2WPHS 1SB1H 1W14U 2RG3A 3IITA 2UUKB 5GCHG 1C2DA 1GBFA 4ISLA 4WY3A 1GBDA 2HWLB 1P04A 4NWKA 5I46H 1EOLA 3FFGA 2HPQH 1P03A 1MZDA 1LCYA 3M35A 4O9VA 1TIOA 5LPFA 4GLYA 1HAPH 1LHEH 2FZZA 3TJNA 4K1EA 3UOUA 1F2SE 4CRFA 2W3IA 4F4OC 5C1YA 4OS7A 3NKKA 2EI8A 1AO5A 2O8LA 4MPUA 1VITH 1MQ5A 1GGDB 2BY7X 1M9UA 1IOEA 2ZFSA 3KHVA 1GBBA 1KIGH 4X1RU 5F6MA 1V2VT 3TK9A 3AAUA 1QB1A 3KCGH 2WPJS 2H5CA 1FDPA 3BG8A 4K60A 1ETTH 3ZZ9A 1BT7A 1AE8H 4Y0ZE 2BOHB 1GHWH 1XM1A 1GBKA 4NZQA 2G5NA 5T6DA 1SHYA 1NFWA 5F03A 1XMNB 2G52A 2GCTB 2QA9E 1HIAB 2XCNA 4XBBA 3BSQA 3EE0B 1C2LA 1T31A 4JZIA 5JBTA 2C8WB 3RMNH 1O2HA 2ZDVH 1O3PB 1XUJA 1S85A 3MOCA 5CMXH 1PQ8A 4Q80A 1O2KA 4DVAU 1YCPM 1SFQB 2FP7B 2BLWA 2ZU5A 1O2RA 2G81E 4GVUA 2HNTC 1NRSH 1BOQA 2DE9A 4B76A 5DP6A 1LQEA 2D26C 7GCHG 2B7DH 1ESAA 1P2NA 3HK3B 1BUIA 1HB0B 3GOVB 2FOHA 4X1PU 4CRBA 3QGNB 1GDQA 1B5GH 3IWMA 2BY6X 1XUKA 1BTHH 2HGTH 2WPKS 2FOFA 3PYHA 1WCZA 3BTTE 1P01A 1MU8B 5DJ7A 1A0HB 1AIXH 4GHQA 4VGCC 2Z3CA 3P92A 1TNGA 1A61H 3GDVA 3S9CA 5H4IB 3V12A 1SPJA 2Z9IA 1SG8B 3A87A 3Q3KA 4ABHA 1O5GH 1MTNB 1KXEA 5ESTE 3V3MA 3SU3A 1QB9A 3RXHA 3SQHE 1OYQA 2SGDE 1K1NA 4Y8ZA 3V7TA 1O2SA 1C2KA 2V0BA 3KNXA 3MH4A 2ALVA 5C67A 1NROH 2XWAA 3OTJE 4WMEA 1EXFA 1F5KU 1TAWA 4MDSA 4MPWA 5A8XA 3F9EA 3W94A 3T28A 3SHCH 2GD4B 1TGCA 3LPRA 4K8BA 2G4UA 4R8TB 1QNJA 4KTSA 1SGCA 4KP0A 3ZVGA 1EASA 3DD2H 2Y5GA 1FI8A 1YPKH 1IQMA 3T5FH 2BX4A 3NCLA 1V6DA 5GDSH 3RXAA 2Y5HA 1GHBG 1Z71A 4NIYA 1ZJKA 3TGJE 4ISOA 1A5IA 3U1JB 1XUIA 4PROA 3QK1A 2ZDMA 3IG6B 4AG2A 1ELVA 1S0RA 4YOJA 3ENSB 2P95A 5G4BA 1DPOA 1GCDA 1UK4A 4B75A 3JZ1B 1J16A 1EZXC 2GZ9A 1NN6A 3UTUH 2OC1A 1SLXB 4CBOA 1ZMNA 5EXMA 1WAYB 1PYTC 1A2CH 1EJMA 4ABFA 5FPSA 3LU9B 1T32A 3ATWA 2OLGA 3UREA 1ELFA 2A7HA 2Z9LA 4CH8B 1FNIA 1EB2A 4AFZA 1BIOA 3P6ZB 1BCUH 2VVUA 3EAJA 1FONA 3KEEA 3WY8A 2A4RA 1Q2WA 4U30A 1GBEA 4H42U 2BDCA 2JH0D 1HAOH 2BVSH 2FTLE 3P95A 2PKAB 4ABIA 1OWEA 1IHSH 5DP9A 1ELEE 1J9CH 3S9BA 1HIAA 1O3NA 1CE5A 2BD3A 4SGAE 1CU1A 1TA6A 2QXJA 1T8NA 1SL3A 5C5OA 1DVAH 4LK4A 1O38A 4NZLA 5GIBA 1IQNA 1QURH 1DLEA 5T6GA 1EZQA 1GMDF 2VVVA 1QBNA 1S83A 2FOGA 4U01A 1KXAA 1EAIA 4ZXYH 3SNCA 1VCQA 2QF0A 3RMMH 1HV7A 2FTMA 1DFPA 1C2MA 4AG1A 1OXGA 3H7OA 1O3CA 1O5EH 1Y3UA 3H7TA 1YP9A 1KSNA 2FX4A 5EXLA 2TRMA 1QRWA 3I78A 1TOMH 3TGIE 1TNLA 3P70B 1GI0A 2H9HA 1YCPH 3E8LA 3SOSA 1OYTH 1TA2A 3MNCA 5A0CA 4Q7YA 1ZLRA 3FZZA 5J4QA 3ZYEA 1G3CA 1JIRA 1MU6B 1GMHF 3GCHB 2PSYA 2ZO3H 1YC0A 2FS8A 1C1RA 3SI3H 1WYKA 1D4PB 3E0PB 2FI3E 1LPGB 1FJSA 4HTCH 1KXDA 1TPPA 4Q7XA 1EATA 1NZQH 3MNXA 1NRNH 2CGAA 1EP5A 2ZGXH 3EQ0H 7ESTE 4AYVB 3RXJA 1O5AB 2YNAA 1ZYOA 3MO3A 4FUEA 3MNSA 2ZTXA 1ZR0A 3ZV9A 1Y3WA 1BTPA 3SJ8A 1V2RT 1P05A 5DO4H 3ATKA 2AH4X 4QT8C 1SQOA 3ZV8A 2C90B 1IQHA 2AGGX 1CA0B 4K8YA 4WMDA 3DT0H 4FUIA 3ZVDA 4DJZB 3ESTA 1GJAB 1O36A 3QUMP 1LHGH 3P8NA 2F9NA 3UWJH 1O2OA 1GVLA 5E8EH 1P0SH 2H9EH 2OC7A 4TYDA 1O3AA 1Y5UT 1N8OB 2G00A 2BY9X 1UHBA 1JMOH 2W26A 4WH6A 4X2XA 1DLKB 3M7UA 4O3UA 2WYJA 4GPGA 1ELDE 3K65B 3TH2H 1GBAA 1BTXA 1TGTA 1TPOA 3UIRA 2GGVB 4KELA 2ZF0H 1GHBF 3D62A 4ZKOU 2XNIA 3L3TA 1CHOF 4E7RG 2O8WA 1ZTLA 1ELBA 3F9GA 1AQ7A 1XUHA 3W95A 4I31A 1XX9A 1O30A 3A7YA 4ABDA 2BLQA 3SUFA 2ZHDA 1O3EA 4MNWA 4X8TH 4ABEA 1AHTH 3QN7A 2ZA5A 3LH1A 2NWNA 2NU3E 2AMDA 2OINA 1UCYE 3A7TA 1EB1H 1HAGE 3T2NA 2AFQB 1O2XA 2P3TB 3MU5A 1TNKA 1L1GA 2FDAA 1UVSH 2RA0A 4FUBA 1G9IE 3PTNA 4UFDH 1O2YA 5EQSA 1XUFA 1G3BA 1ZHRA 2OQUA 1ELCA 4DY7B 1C5ZB 1OWKA 4JZEH 1PQ5A 1K1PA 1EOJA 5DK1A 2ZI2H 1Z8JB 3M3VA 4RSPA 6GCHF 1WQSA 1S5SA 1PFXC 2ZC9H 4TWYA 1DANH 5LH8A 1C2FA 3M36A 3ODDA 3GY8A 2F9OA 1PJPA 4K1SA 2VWOA 3AAVA 2VNTA 4D9QA 2W3KA 3QZQA 1K1MA 4OS6A 3LDXH 4YOGA 1FAXA 1MTSA 2BHGA 2GP9B 1V2OT 1A0JA 1ZPBA 2ZZUH 1VITF 4YLUA 5ETXA 1UTOA 2ODPA 1O2JA 4WMFA 5GPIB 4Y8YA 1F0SA 3DFJA 1BJVA 3ZVCA 1HXFH 1O34A 1Z8IB 1DUAA 1OWJA 2GT7A 3M5OA 2JETB 1T4VH 2C8YB 1B0FA 4AN7A 2PTNA 1DWDH 1C5XB 1P02A 3N7OA 1CGIE 1GWAA 2J38A 5JBAS 2OBQA 4I8HA 1S81A 1W11U 2QN5T 1NRQH 3A8AA 4X8UH 3SV7A 2Z6BD 3TJUA 3UWIA 1GBIA 1F0TA 2A1DB 4MQAA 3A85A 1C5MD 2PKAA 2C8ZB 3UPEA 4NIXA 1AFQB 2A7CA 1MBMA 1C4Y2 1C2GA 3MNBA 3ITIA 2ANYA 1FQ3A 1Z1JA 5F8ZA 2ZDNA 1B7XB 1HJAB 5EW2H 4X1SU 1OOKB 3QWCH 4NIWA 1W10U 3LJJA 1ANDA 2BYAX 5EU8A 2FM2A 5HMAA 2QXIA 1V2MT 5EPYA 2BQWB 1H9HE 2TPIZ 2OQ5A 3BF6H 1SGFG 3MFJA 4YOIA 2CF8H 5DPAA 2JH6D 4LZ1H 1ETRH 2ZFRH 3LGTA 2BOKA 5A2MH 1X7AC 1PPGE 2CF9H 2Y81A 1C4V2 2OXSA 1NS3A 1YPHE 3LGIA 2B5TB 1FUJA 1L1NA 3L33A 4LXBH 1QFKH 5FX6A 1C5SA 3ZZDA 3U98H 3ATIA 4Y76A 3TH3H 1GBMA 1NTPA 5E0GA 2QXHA 1KDQA 3OX7U 1UTNA 4YLQH 3A81A 1Y3VA 4UD9H 1FN8A 2O8MA 4KKDA 1K9OE 2WPMS 3BG4B 5A0AE 5K0HA 2VVCA 1DSUA 3ZZ7A 1MCTA 1H8DH 1F5LA 3LGWA 1GJ9B 1PPCE 1TPAE 3FAOA 3HPTB 2FMJA 2VB0A 1C5TA 1DT2A 1CBWB 4UDWH 1TRMA 4X2VA 3SV9A 1D6WA 1C1PA 2ZECA 2ZHFH 1LQDB 3SU6A 4UFGH 1C1TA 2CJIA 2WUBA 1CSOE 1SOTA 3NZIA 4K5ZA 1ZPCA 3SNAA 1L2EA 2BY5X 3ZZBA 2GCHG 2GZ7A 4E06H 4I7YH 2YNBA 1V2JT 3F1SB 1ANCA 3PLKA 4RN6A 3TITA 4JMYA 3RXQA 1O3KA 1ZGVA 3RM0H 4MPXA 1W8BH 3HGPA 1TQ0B 3AVZA 3ZYDA 1WU1A 2G5VA 1SOZA 1Z8RA 2J34A 1TOCB 3I29A 1GI8B 2NU2E 4TPYA 1J15A 1DDJA 4HI3A 4KGAA 1NRRH 4CH2B 1RTLA 1GL1A 1BRBE 1CHOG 5FCKA 4I33A 3DA9B 5GCHF 3RXFA 1P10A 4AB9A 3SO3A 1AVXA 2GV7A 2IOTA 3K9XB 3O8CA 1C1MA 2FODA 2PSXA 3BN9A 1GMCG 2NU4E 3SNDA 1MAXA 3QLPH 4A5TS 1MKXK 4NGAH 3TK5A 4JYVH 3QZRA 3PMBB 3Q77A 2XYAA 4FVBA 4AZ2B 1EZUC 3SN8A 1C2EA 2OD3B 1ZHPA 1SLVB 1V2NT 3B8JA 4JZFH 1PPBH 1D3PB 1K1IA 1CGJE 1GVKB 1NESE 3PM3A 3KN2A 3VEQB 1GHYH 3OY5U 2C93B 5HGGA 3SBKA 5CHAC 1RTKA 4ZUHA 8GCHG 1OP8A 3KL6A 1QGFA 1ABIH 1EKBB 3A80A 3KQDA 2GCHF 2AMPA 4BAOB 5BPEA 1GI2A 2FS9A 3M3TA 2FEQH 4OS2A 1C5PA 2EA3A 1MTUA 1NRPH 4I8KA 1SLUB 1Y5BT 3T62A 3SORA 1O2VA 2ZFQH 3D23A 4AYYB 3VB6A 1LHDH 4GCHF 1QRZA 2I6QA 2A5KA 1FMGA 3CENA 1YBWA 2I6SA 1LVYA 1C1SA 1C5VA 1H8IH 2AIQA 3C1KA 3MMGA 1N6XA 1EQ9A 2XC4A 4HFPB 2STBE 4IS5A 1GBTA 1HRTH 1ZSKA 5FPYA 2VU8E 2ZPQA 3MWIU 4E7NA 1TE0A 1YF4A 3DUXH 4BOHA 1P9SA 3OU0A 4U32A 2GCTC 5CE1A 1YLDA 1MKWK 1O2TA 1CT0E 1O5BB 2O8UA 2ZIQH 3RXPA 3UNRA 1EAXA 1DITH 4ISHH 2M5TA 3H5CB 3RMLH 1GI5A 1VCPA 1ZOMA 5FPTA 4ASHA 5HYOA 1SBWA 3P8FA 1V2QT 1GI6A 3L6PA 1FN6A 1C1OA 4X6PA 2ZU2A 4NCYA 3ZZ5A 4DG4A 4ZXXH 1HCGA 1L0ZA 2J95A 3SV6A 3QTOH 1W2KH 1GG6C 2ODYB 1F92A 4A1TA 1LPZB 1O2IA 1O5FH 1O39A 3LH3A 4X2YA 5JBCS 1ESTA 2W5EA 3RC4A 1Y3XA 3A86A 3SHAH 2HLCA 1SGNE 1O2MA 4Y6DA 2XC0A 2RDLA 1TWXB 2P16A 3SU0A 1P3EA 3F9HA 1BRAA 3U69H 1HAIH 1P12E 1TGNA 1HBTH 4OGYA 3SJ9A 1CVWH 3E3TA 1RS0A 3FP8E 2H5DA 1ZSJA 1K21H 1HAZB 1TX8A 1IQLA 3T29A 4ZROA 3M3SA 4BAMB 2ZHWH 1TNJA 3EDXB 4BAQB 1C1WH 1DXPA 2OC8A 4MPVA 4GSOA 1WTGH 2NU0E 3GY6A 2C8XB 4DGJA 2AS9A 4HZHA 3BTKE 2H1UA 1RTFB 1SLWB 3BTDE 2BTCE 1KLJH 1MCVA 3VGCB 4IMZA 3GCTG 3UY9A 2AGIX 4Z0KA 1DWEH 1DY9A 3EA9A 4D76A 1PPEE 4D9RA 2V35A 1C5QA 2ZU1A 1GJ6A 1W3CA 6ESTA 1P2JA 2ZKSA 3SV2H 1KDQB 1KTSB 3BTWE 4MVNA 5FCRA 1EPTB 1ZHMA 2R2MB 1HYLA 4X6NA 4XSKU 5FBIA 2ZQ2A 4MLFB 2WV4A 5E2OA 1MKXH 2F9VA 3HKJB 1IHTH 1C2IA 1TX6A 2TBSA 1BBRK 2SNWA 1TMBH 2BB4A 1O2NA 2BVRH 2CN0H 1OWDA 1QCPA 1PPZA 4D7GA 1H9IE 4ZHAA 1BMNH 2EI7A 2XC5A 1MZAA 3V0XA 9ESTA 1GJ5H 4A1VA 5C2ZA 3SGAE 5JPMH 2B9LA 1UTJA 2Z3EA 4IBLH 1OKXA 2W7SA 3CP7A 9LPRA 2QGRA 1TLDA 5DP5A 3PO1B 3CS7A 1SGDE 1ORFA 4BTIB 3LOXA 4CREA 2ZCHP 4X1QU 1DX5M 1PPFE 1SVPA 2BXTH 2O8TA 3A88A 2FI5E 3ZVFA 5GWZA 3SU4A 4H4FA 1IQKA 1P9UA 3BEFB 1DM4B 3BEIB 5A0BA 1DS2E 3TIUA 1BRUP 1T4UH 1GJ7B 4I8LA 2O9QA 1WTHD 5FHTA 4ABBA 2ZEBA 1K2I1 1YPGH 4J2YB 3BIUH 2ZG0H 1TB6H 2AGEX 1C5WB 2FOAA 3RU4D 1AUTC 1O35A 2BXUH 1HJ9A 1RIWB 1ZMLA 1YPEH 3GDSA 3M37A 3MH6A 3SGBE 1HPGA 2RCEA 2BD5A 1NC6A 1K1JA 3D49H 3RXTA 4AFUA 3SQEE 1LPKB 2FLBH 4A7IB 3SU2A 1TMTH 2PW8H 1E35B 3QTVH 1TMUH 1BZXE 4AFSA 1A1RA 1QL9A 6GCHG 4CRCA 1IAUA 5HM9A 1ACBE 2QIQA 2Y6TA 4TY7A 1Z1IA 2ZU4A 1GJBB 4ZH8A 2V6NA 1IQIA 1HJAC 1BTYA 4YT7H 1ARCA 2BDYA 3FANA 1F7ZA 2PHBA 4BTUB 3JZ2B 1BB0B 3MU4A 2CHAC 1QTFA 2W7UA 1TX7A 1NO9H 3SUGA 1Z7KA 2NU1E 1SGTA 1MD7A 1GI1A 4YESB 4FUDA 2ZWLH 5EXNA 1EAUA 2Z9JA 3NWUA 2A4OA 5F8XA 2F91A 1UHBB 3E90B 4BANB 2J92A 2P8OB 2SFAA 5C5NA 1GMDG 3TVJB 1IQGA 1AFEH 5E2PA 2HRVA 3KQEA 1AZ8A 2WINI 3SJIA 3I77A 5L2ZH 3AW1A 1TBRH 1Y59T 2IJOB 1E37B 1C5RA 1YM0A 2F9BH 2A5AA 2VIQA 1V2PT 3MU8A 3B9FH 1BQYA 3GCOA 4XFQA 8ESTE 4I32A 1IQJA 3A7WA 2A4GA 1VR1H 1NM6A 2UWOA 1WBGB 3U1IB 2ANWA 2ZFFH 2XCFA 1GBCA 1L4ZA 1LMWB 1DSTA 4NSYA 2TIOA 1TBQH 1AWHB 1BMMH 2GKVE 4IN2A 3NK8A 4NA7A 1C1NA 3UOPA 1FAKH 1K1LA 5AF9H 3UR6A 2G51A 1RGQA 1XXFA 4YM9A 1V3XA 1HAVB 5ESBA 2QAAA 3E91A 2VIPA 2J2UA 1A3EH 2ZGBH 2B0FA 3A7ZA 3SW2B 3BTFE 1EUFA 4XOJA 1FPCH 1CQQA 5C3NA 1YKTA 1LTOA 1V2UT 2QF3A 3BTEE 1O2LA 2PWXA 1GI3A 4K1TA 1G3EA 1HAXB 1TNHA 3U9AH 4A1XA 1ID5H 4WH8A 1EP6A 2UWPA 4B71A 4CBNA 2TGPZ 1BBRE 4FUFA 1SQTA 7GCHF 2XXLA 4AOQA 3RXRA 4DOQA 2HOBA 3PMHB 3RM2H 3QGJA 4BAHB 3OSYA 1P2KA 1GBHA 3VB7A 1OWIA 4B2AA 1G36A 4B74A 4CRDA 3MH5A 3MI4A 3S69A 1GI7B 1PQ7A 1GVZA 1WV7H 3HATH 3PLPA 2PGQB 2GT8A 2VGCB 2ZCLP 2OUAA 1VGCC 3UQOA 1CGHA 3RU4T 1ANEA 2R0LA 3RXVA 1FLEE 3A82A 5EODA 1TRNA 4X6MA 4X2WA 1YYY1 3AW0A 5EGMA 4VGCB 1HFDA 1JOUB 1J8AA 1QR3E 2PV9B 1GJ8B 1TQ7B 2XWBI 1TGSZ 1GCTB 4O3TA 3RXMA 1O37A 1C1QA 2VWNA 5T3HA 5T6FA 4FXGH 2SGAA 1TFXA 1W0ZU 2VWMA 1QY6A 2ZU3A 4LOYH 5EQQA 1XKAC 1O3IA 1YPLH 1FZZA 1ZMJA 1QBVH 1L4DA 1P09A 5A8ZA 1J14A 1N6YA 3BV9B 1KLTA 4ZKNU 1F0RA 1MMJN 4INKA 3S0NA 5PTPA 2ILNA 4XDEA 2ZGCA 3LGYA 1BMLA 4THNH 3UUZA 1K1OA 2PUXB 3UNQA 5GXPA 4GCHG 1AE5A 1FXYA 1BITA 1NPMA 3VGCC 4WF8A 2FIRH 2SGPE 1T8MA 1XXDA 4BXWA 1LHCH 2CMYA 1D3TB 3TPIZ 2XRCA 1KXFA 1UO6A 1HDTH 3RMOH 2CHAB 3ZZ4A 1SHHB 4WXIA 3ZZ8A 2FYQA 1KTTB 3NXPA 3PTBA 1DOJA 4XBDA 1AB9B 4X0WU 4H6SB 4AGKA 1DWBH 1RXPA 2HNTE 2K1QA 1SGPE 2R3UA 3GYLB 2WPIS 3EYDA 2VH0A 2AEIH 1D3DB 1TPSA 5DP8A 2KAIA 2GV6A 4E05H 2WUCA 1AGJA 4DURA 2ZCKP 2ODQA 3UFAA 7LPRA 4FUGA 1K22H 4K3JA 5F8TA 4OGXA 1JBUH 2FOCA 1QJ6B 3LC5A 3KGPA 4JZ1A 2VIOA 3RXBA 1HAVA 1RRKA 3VB3A 4CRGA 5L6NH 1AB9C 1JXPA 4FUHA 1GJDB 4RKJB 4K69A 1P06A 1LVMA 2BZ6H 1FIZA 4GHTA 1ELGA 3PWCA 4AGJA 1BBRH 3MH7A 2C3SA 2CXVA 4FU8A 2A2QH 4TWWA 1V2TT 4ISIH 2DUCA 5E0JA 1AZZA 1LKBA 2HPPH 4CRAA 4NA9H 1AKSA 3A83A 4M7GA 1BDAA 1OWHA 2XW9A 1DUEA 4BXSA 2A4QA 3M5MA 3PB1E 3P17H 1WUNH 6LPRA 5B6OA 1ZZZA 2F3CE 1N8OC 5HXFA 4B2CA 2AIPA 1AWFH 4JK6A 3PMAB 2GMTC 2FESH 2DE8A 2PKSB 3AASA 2FI4E 3U8TH 1QHRB 1C1VH 2SGEE 2THFB 3KQCA 5FX5A 3EA7A 1Z8GA 2BDIA 1OSSA 2TGAA 1BHXB 5AFYH 1TNIA 4HGCA 1GMHG 2ZTYA 3LGUA 1BJUA 2Z94A 4FU7A 4INHA 1LVBA 2EEKA 2BM2A 2BDAA 1UCYK 4Y8XA 4UEHH 1O3GA 4MG3A 2A31A 2PUQH 1MTNC 2JH5D 2BZAA 5AHGH 1BTZA 1ZTJA 1EPTC 2UWLA 4YZUA 4FUJA 1O0DH 5EQRA 4XBCA 2JKHA 2VGCC 4JK5A 4DW2U 5C1XA 1FY8E 1UVUH 4WWYA 3O8BA 1ELAA 1UK3A 5FAHA 3M7QA 1WSSH 1SMFE 1TONA 2WYGA 1MH0A 3SU1A 3GY2A 2FYRA 2ZFTA 8LPRA 4A92A 4WXVA 5IYTA 1AY6H 1P11E 1TYNA 3TGKE 3LC3A 2GTBA 4MNYA 5AFZH 2R3YA 3K6ZA 3PMJA 3ZVBA 4Y7AA 3ZZ6A 3ODFA 1MTWA 2HALA 3A84A 3GICB 5EW1H 2FOBA 5EPNA 5GJ4B 1HAYB 1D6RA 2OP9A 3K2UA 4B73A 3SNBA 1O2ZA 1FV9A 2IN2A 2GDEH 3MYWA 3MTYA 1O2QA 1G37A 4AFQA 1A7SA 1NU9A 1O31A 2EI6A 2Y82A 2R0KA 3QDZB 3TJOA 1SSXA 1AKSB 4YTAA 1YGCH 2SGFE 3NPSA 4YO9A 1A5HA 1GHAF 1BMAA 2XBWA 2LNCA 1UVTH 2BD8A 3U8RH 3G01A 1KY9A 1OP2A 1UTMA 5C1UA 1O5DH 4IMQA 3E1XB 1W13U 2FPZA 4NIVA 3RXIA 5E0HA 4MNXA 2ZFPH 2OTVA 1OP0A 1OX1A 2AMQA 3UQVA 2ZPSA 1GBJA 5LPEA 3F9FA 4U2WA 5JB8S 3A89A 3LONA 1EZSC 3BG4C 2PFEA 5EG4A 2G4TA 4DIIH 4YT6H 4AB8A 2GMTB 2GDDA 1S82A 3TNSA 1C5LH 1SFIA 1GJCB 4B2BA 3SI4H 7KMEH 1VITG 5LGOA 3S9AA 4UFFH 1VCWA 3P8OA 1TRYA 2Y5FA 4Y79A 4Z6AH 3UNSA 3MU0A 3OY6U 1GGDC 2D2DA 1GJ4H 3V13A 1CA8B 1THSH 2R9PA 1Z6EA 3HGNA 2P8OC 1QIXB 1U6QA 3SGQE 2Y7XA 5L30H 4IC6A 1GMCF 1XVOA 1O2GH 2BDHA 3BEUA 2GVFA 1CHGA 1BTWA 1AI8H 1NFUA 4KTCA 2P93A 1DICA 1ZSLA 4Y71A 5EOKA 1T8LA 3F6UH 2FLRH 2J4IA 1QB6A 1EAWA 2VIVA 2A5IA 3BTHE 2KAIB 3R0FA 4A6LA 1GHVH 2G55A 1HGTH 1V2WT 1G2MA 1P57B 3S7KB 1Y8TA 3SNEA 1LO6A 1ANBA 2BLVA 1YPJH 3HK6B 2ESTE 3GY7A 2PLXA 2Z7FE 3O8DA 3SZNA 2Z9GA 1AFQC 2R2WU 1B0EA 1O5CB 3FP7E 4OS5A 1QJ1B 4IGDA 3OYPA 1AD8H 1RFNA 2B8OH 1WOFA 2BD7A 2ZTZA 4X1NU 3D65E 4Y0YE 2ZP0H 1QJ7B 3SU5A 3LT3A 1GDUA 2ZDLA 1O3FA 1AN1E 2VJ1A 3A7VA 3SUDA 5FXLA 1P2IA 3NUMA 6CHAB 2AERH 2P59A 3FZDA 3F68H 5JDUB 1ETSH 1H1BA 2A45B 2P94A 1O3OA 4I8JA 5ABWA 1S84A 2JETC 1BA8B 3RLWH 1H4WA 1SGFA 1A3BH 4ZKSU 3A8CA 1ABJH 3E6PH 5DG6A 1E34B 3BTQE 4ZAEA 4JYUH 3M7TA 2XBXA 4R0IA 1GHAG 1OPHB 1P2MA 1JRSA 4B1TA 2XBVA 2FX6A 1KXCA 1UVPA 4NA8A 4NFEA 1ZTKA 3PO1C 2F9PA 1QL7A 1CT4E 5L2YH 3MHWU 4FU9A 4Q7ZA 1HJ8A 2VIWA 1GI4A 1O3HA 2C4FH 1BTUA 3RXLA 2FOEA 1O3JA 1G32B 4MTBA 1AMHA 1G30B 3LJOA 3ZZCA 2F83A 2V3HH 1FIWA 2Q6GA 2STAE 3EGKH 4F49A 1MBQA 3GCHC 3GCTF 1E38B 4UONA 3LGVA 1T8OA 5JYIA 1C2HA 1VJAU 2ZNKH 4J1YA 3RU4E 3ATLA 5TCAA 1HLTH 5TJXA 4AX9H 5LPRA 1JRTA 1A0LA 4Q2KA 1XUGA 3Q3YA 4H6TA 2V3OH 3E16B 3VXFH 1O3LA 1V2LT 4X8SH 3R3GB 1ARBA 2TGTA 1KYNA 1QRXA 4FVDA 4JYTA 3ZVAA 4CR9A 1NY22 1K28D 1O3BA 1CBWC 3RLYH 1YCPK 6CHAC 2TGDA 1GDNA 1P2OA 1ZRKA 1HAHH 2BVXH 4KTUA 1JIMA 4D8NA 1W7GH 1QQ4A 4LZ4B 4ESTE 5AVDA 3URDA 4DIHH 1PPHE 4X6OA 3GY5A 3VFEA 1SGYE 4IW4E 3LKWA 2VWLA 1TABE 5DGJA 1SR5C 4DCDA 4OS1A 2CV3A 4K2YA 1DE7H 2BMGB 2GZ8A 1HUTH 3TJVA 2H9TH 1FY5A 5A8YA 1JWTA 1EPTA 4O03A 3GY3A 2Q1JA 3QX5H 1HXEH 4ABGA 4SGBE 4Y10E 1VJ9U 3SJKA 3VXEH 5C20A 5TCCA 2UUYA 1L1JA 4GAWA 3DHKH 1SGIB 1O2PA 2A0QB 3UR9A 2H2ZA 3RXEA 2IPHA 3GCNA 2FO9A 1NFYA 5DP7A 4ZHMU 2BLOA 1LHFH 2F9UA 1QA7A 3SV8A 1CA0C 1EX3A 4RKOB 3M5LA 1VZQH 2PGBB 4ABAA 2P3UB 2WV5A 4JZDH 3T26A 3TNTA 4CR5A 1W0YH 1C5OH 2PR3A 4IC5A 1GG6B 1XVMA 2PKSC 1O2WA 1OS8A 2ZDAH 1KXBA 2UUFB 4Y11E 5A09A 1P3CA 1D3QB 1RD3B 2A32A 3GDUA 1NT1A 3RXUA 1SC8U 1FY1A 1P8VC 3PWBA 1SGQE 2OBOA 1E0FD 1SQAA 1FY3A 4WVPE 1AVWA 3FP6E 1A46H 1GPZA 2A2XH 3LIWA 1V2ST 2Z9KA 1C9PA 1IQFA 4GUXA 1TALA 3PV4A 1O32A 5SGAE 1AUJA 3T27A 4DT7B 1H9LB 2BQ7B 1S6FA 2BDGA 4MNVA 3MO9A 1NU7B 3RP2A 3ATMA
chains in the Genus database with same CATH superfamily
1UTPA 2G8TA 1W12U 3HKIB 1EJAA 1YLCA 1J17T 1CT2E 1XKBC 1QBOA 4D7FA 4UFEH 3GYMA 3OTPA 1PYTD 1W7XH 3ELAH 3EA8A 1MKWH 1TGBA 1TBZH 3TH4H 1RJXB 4ZKRU 1S0QA 2D8WA 2J9NA 1C5YB 2QY0B 1V2KT 1VGCB 3RDZA 2RFKC 4I8GA 3C27B 2FXRA 2A7JA 1Y5AT 1UK2A 5FBEA 2FWWA 1AU8A 1KLIH 2GX4A 3E0NB 1N1LA 2ANMH 1GHZA 2LPRA 3PLBA 1THRH 5DKMA 1C5UA 1C5NH 1FY4A 3B23B 5CHAB 3GY4A 3TU7H 3TLOA 2PTCE 3M5NA 2WPLS 1QL8A 2D1JA 2EC9H 3ZVEA 3SJOA 1UVOA 3MO6A 4UE7H 1A5GH 3P8GA 5HKKD 1DWCH 5JB9S 1SGEE 2ZDKA 1G2LA 4NSVA 1INCA 2Y80A 1E36B 2FOMB 2QYIA 4TY6A 2XTTB 2XBYA 4ZMAH 2P3FH 2RDEA 1DXWA 2Q6FA 2Z3DA 3A7XA 1ESBA 4NWLA 1Y3YA 2AHME 3OEHD 1MQ6A 8GCHF 1LVOA 1T7CA 3GISB 1WQVH 1RIWC 3Q76A 1C9TA 3STIA 1EJNA 4TPIZ 1GHXH 3RXOA 2YOLA 8KME2 5JBBS 3VPKA 4CHAC 3A8BA 3PROA 4Y7BA 1UMAH 1DY8A 1Z6JH 5DP3A 3K6YA 3O8RA 3RC5A 3TK6A 2KCOA 4ABJA 1QQUA 2BD4A 3KQBA 3RXGA 3RUOA 3KF2A 1ZJDA 2AYWA 3Q3XA 5DP4A 1O3DA 1SGRE 3STJA 4O97A 1QA0A 1AVGH 2BD2A 5K7RA 1G3DA 2VIDA 1PQAA 2BY8X 1MD8A 1BRCE 4RI0A 1GL0E 1F5RA 3CS0A 2QV1A 1GCTC 2ASUB 2OCVB 4JCNA 1BHXF 3URCA 4BNRA 3DFLA 3ZZ3A 4RT0A 3T25A 4XE4A 1CO7E 1S6HA 3M61U 1MTVA 3RXDA 2RA3A 2BX3A 2J94A 3BTGE 4AORA 1YPMH 1O33A 3EE7A 1YPHC 1ZGIA 2BD9A 1ZRBA 1C1UH 3SZEA 2QCYA 1C2JA 1MAYA 1C4U2 1UTKA 2HVXA 3FVFB 2BDBA 1NFXA 1A4WH 2QXGA 2ZHEH 2QC2A 5IDKA 3ZZAA 1IQEA 4FUCA 3S7HB 3RXSA 5J4SA 1GI9B 1ELTA 4BTTB 1F0UA 2Y7ZA 1UJ1A 2ZGJA 2ZGHA 3A8DA 2ALPA 1Q3XA 3KIDU 1O3MA 2WZQA 2ZPRA 1O2UA 1ZPZA 1HNEE 1UTQA 1GBLA 1LKAA 3RC6A 2ANKH 2VINA 4INLA 4CHAB 2UUJB 4BAKB 3OE7D 3SUEA 1LDTT 2BQ6B 1D9IA 3VB5A 5I25A 2HNTF 4NFFA 3BTME 4OS4A 2H6MA 3RXCA 3BIVH 5BRRE 3U8OH 2SNVA 2ULLA 1UCYH 4ISNA 1MUEB 1UTLM 3QO6A 1SI5H 3MU1A 4IN1A 2VH6A 5HM2A 3Q00A 2OC0A 1THPB 3RXKA 4ZHLU 2ZQ1A 4X8VH 2Q6DA 1Q31A 2SGQE 3VB4A 1FPHH 2ZHQH 4WJG2 4NG9H 1P2QA 2WPHS 1SB1H 1W14U 2RG3A 3IITA 2UUKB 5GCHG 1C2DA 1GBFA 4ISLA 4WY3A 1GBDA 2HWLB 1P04A 4NWKA 5I46H 2F4LA 1EOLA 3FFGA 2HPQH 1P03A 1MZDA 1LCYA 3M35A 4O9VA 1TIOA 5LPFA 4GLYA 1HAPH 1LHEH 2FZZA 3TJNA 4K1EA 3UOUA 1F2SE 4CRFA 2W3IA 4F4OC 5C1YA 4OS7A 3NKKA 2EI8A 1AO5A 2O8LA 3F0PA 4MPUA 1VITH 1MQ5A 1GGDB 2BY7X 1M9UA 2PP6A 1IOEA 2ZFSA 4ACBA 3KHVA 1GBBA 1KIGH 4X1RU 5F6MA 2J5UA 1V2VT 3TK9A 3AAUA 1QB1A 3KCGH 2WPJS 1YLNA 2KR7A 2H5CA 1FDPA 3BG8A 4K60A 1ETTH 5EJZA 3ZZ9A 1AE8H 1BT7A 4Y0ZE 2BOHB 1GHWH 1XM1A 1GBKA 4NZQA 2G5NA 5T6DA 1SHYA 1NFWA 5F03A 1XMNB 3H09A 2G52A 2GCTB 2QA9E 1HIAB 2XCNA 4XBBA 3BSQA 3EE0B 1C2LA 2F43B 1T31A 4JZIA 5JBTA 2C8WB 3RMNH 1O2HA 2ZDVH 1O3PB 1XUJA 1S85A 3MOCA 5CMXH 1PQ8A 4Q80A 1O2KA 4DVAU 1YCPM 1SFQB 2FP7B 2BLWA 2ZU5A 1O2RA 2G81E 4GVUA 5C0TA 2HNTC 1NRSH 1BOQA 2DE9A 4B76A 5DP6A 1LQEA 2D26C 7GCHG 2B7DH 1ESAA 1P2NA 3HK3B 1BUIA 1HB0B 1OHHD 3GOVB 2FOHA 2LP6A 4X1PU 4CRBA 3QGNB 1GDQA 1B5GH 3IWMA 2BY6X 1XUKA 1BTHH 2HGTH 2WPKS 2FOFA 3PYHA 1WCZA 3BTTE 1P01A 1MU8B 5DJ7A 4YXWD 1A0HB 1AIXH 4GHQA 4VGCC 2Z3CA 3P92A 1TNGA 1A61H 3GDVA 3S9CA 5H4IB 3V12A 1SPJA 2Z9IA 1SG8B 3A87A 3Q3KA 4ABHA 1O5GH 1MTNB 1KXEA 5ESTE 3V3MA 3SU3A 1QB9A 3RXHA 3SQHE 2J98B 1FX0B 1OYQA 2SGDE 1K1NA 4Y8ZA 3V7TA 1O2SA 1C2KA 2V0BA 3KYGA 3KNXA 3N7EA 3MH4A 2ALVA 5C67A 1NROH 2XWAA 3OTJE 4WMEA 3GS9A 2HLDD 1EXFA 1F5KU 1TAWA 4MDSA 4MPWA 5A8XA 3F9EA 3W94A 3T28A 3SHCH 2GD4B 1TGCA 3LPRA 4K8BA 2G4UA 4R8TB 1QNJA 4KTSA 1SGCA 4KP0A 3ZVGA 1EASA 5KECA 3DD2H 1FI8A 2Y5GA 1YPKH 1IQMA 3T5FH 2BX4A 3NCLA 1V6DA 5GDSH 3RXAA 2Y5HA 1GHBG 1Z71A 4NIYA 1ZJKA 3TGJE 4ISOA 1A5IA 3U1JB 1XUIA 4PROA 3QK1A 2ZDMA 3IG6B 4AG2A 1ELVA 1S0RA 4YOJA 3ENSB 5KEDA 2P95A 5G4BA 2WV9A 1DPOA 1GCDA 1UK4A 4B75A 3JZ1B 1J16A 1EZXC 2GZ9A 1NN6A 3UTUH 2OC1A 1SLXB 4CBOA 1ZMNA 5EXMA 1WAYB 1PYTC 1A2CH 1EJMA 4ABFA 5FPSA 3LU9B 1T32A 3ATWA 2OLGA 3UREA 1ELFA 2A7HA 2Z9LA 4CH8B 1FNIA 1EB2A 4AFZA 1BIOA 3P6ZB 2QF4A 1BCUH 2VVUA 3EAJA 1FONA 3KEEA 3WY8A 2A4RA 2HVYB 1Q2WA 4U30A 1GBEA 4H42U 2BDCA 2JH0D 1HAOH 2BVSH 3OFND 2FTLE 3P95A 2PKAB 4ABIA 1OWEA 1IHSH 5DP9A 1ELEE 1J9CH 3S9BA 1HIAA 1O3NA 1CE5A 2BD3A 4SGAE 1CU1A 1TA6A 2QXJA 1T8NA 1SL3A 5C5OA 1DVAH 1VKYA 4LK4A 1O38A 4NZLA 5GIBA 1IQNA 1QURH 1DLEA 5T6GA 1EZQA 1GMDF 2VVVA 1QBNA 1S83A 2FOGA 4U01A 1KXAA 1EAIA 4ZXYH 3SNCA 1VCQA 2QF0A 3RMMH 1HV7A 2FTMA 2L74A 1DFPA 1C2MA 4AG1A 1OXGA 3H7OA 1H8ED 1O3CA 1O5EH 1Y3UA 3H7TA 1YP9A 1KSNA 2FX4A 5EXLA 2TRMA 1QRWA 4Q4LA 3I78A 1TOMH 3TGIE 1TNLA 3P70B 4AC9A 3W1EA 1GI0A 2H9HA 1YCPH 3E8LA 3SOSA 1OYTH 1TA2A 3MNCA 5A0CA 4Q7YA 4B6EA 1ZLRA 3FZZA 5J4QA 3ZYEA 1G3CA 1JIRA 1MU6B 1GMHF 3GCHB 2PSYA 2K8IA 2ZO3H 1YC0A 2FS8A 1C1RA 3SI3H 1WYKA 1D4PB 3E0PB 2FI3E 1LPGB 1FJSA 4HTCH 1KXDA 5EJ1A 1TPPA 4Q7XA 1EATA 1NZQH 3MNXA 1NRNH 2CGAA 1EP5A 2ZGXH 3EQ0H 7ESTE 4AYVB 3RXJA 1O5AB 2YNAA 1ZYOA 3MO3A 4FUEA 3MNSA 2ZTXA 1ZR0A 3ZV9A 1Y3WA 1BTPA 3SJ8A 1V2RT 1P05A 5DO4H 5EJLA 3ATKA 2AH4X 4QT8C 1SQOA 3ZV8A 2C90B 1IQHA 2AGGX 1CA0B 4K8YA 4WMDA 3DT0H 4FUIA 3ZVDA 4DJZB 3ESTA 1GJAB 1O36A 3QUMP 1LHGH 3P8NA 2F9NA 3UWJH 1O2OA 1GVLA 5E8EH 1P0SH 2H9EH 2OC7A 4TYDA 1O3AA 1Y5UT 1N8OB 2G00A 2BY9X 1UHBA 1JMOH 2W26A 4WH6A 4X2XA 1DLKB 3M7UA 4O3UA 2WYJA 4GPGA 4XD7D 1ELDE 3K65B 3TH2H 1GBAA 1BTXA 1TGTA 1TPOA 3UIRA 2GGVB 4KELA 2ZF0H 1GHBF 3D62A 4F48B 4ZKOU 5B6LA 2XNIA 3L3TA 1CHOF 4E7RG 2O8WA 1ZTLA 1ELBA 3F9GA 1AQ7A 1XUHA 3W95A 4I31A 1XX9A 1O30A 3A7YA 4ABDA 2BLQA 3SUFA 2ZHDA 1O3EA 4MNWA 3FOAA 4X8TH 4ABEA 1AHTH 3QN7A 2ZA5A 3LH1A 2NWNA 2NU3E 2AMDA 2OINA 1UCYE 3A7TA 1EB1H 1HAGE 4RT1A 3T2NA 2AFQB 1O2XA 2P3TB 3MU5A 1TNKA 1L1GA 2FDAA 1UVSH 2RA0A 4FUBA 1G9IE 3PTNA 4UFDH 1EFRD 1O2YA 5EQSA 1XUFA 2VBCA 1G3BA 1ZHRA 2OQUA 1ELCA 4DY7B 1C5ZB 1S6LA 1OWKA 3WWFA 4JZEH 1PQ5A 1K1PA 1EOJA 5DK1A 2ZI2H 1Z8JB 3M3VA 4RSPA 6GCHF 1WQSA 1S5SA 1BMFD 1PFXC 2ZC9H 4TWYA 1DANH 5LH8A 1C2FA 3M36A 3ODDA 3GY8A 2F9OA 1PJPA 4K1SA 2VWOA 3AAVA 2VNTA 4D9QA 2W3KA 3QZQA 1K1MA 4OS6A 3LDXH 4YOGA 1FAXA 1MTSA 2BHGA 2GP9B 1V2OT 1A0JA 1ZPBA 5C17A 2ZZUH 1VITF 4YLUA 5ETXA 1UTOA 2ODPA 1O2JA 4WMFA 5GPIB 4Y8YA 4FOUC 1F0SA 3DFJA 1BJVA 3ZVCA 1HXFH 1O34A 1Z8IB 3OEED 1DUAA 1OWJA 2GT7A 3M5OA 2JETB 1T4VH 2C8YB 1WDIA 1B0FA 3F2FA 4AN7A 2PTNA 1DWDH 1C5XB 1P02A 3N7OA 1CGIE 1GWAA 2J38A 5JBAS 2OBQA 4I8HA 1S81A 1W11U 2QN5T 5CHBA 1NRQH 3A8AA 4X8UH 3SV7A 2Z6BD 3TJUA 3UWIA 1GBIA 3DSPA 3PV5A 1F0TA 2A1DB 4MQAA 3A85A 1C5MD 2PKAA 2C8ZB 3UPEA 4NIXA 3PV2A 1AFQB 2A7CA 1MBMA 1C4Y2 4Q63A 1C2GA 3MNBA 3ITIA 2ANYA 1FQ3A 1Z1JA 5F8ZA 2ZDNA 1B7XB 1HJAB 2KM0A 5EW2H 4X1SU 1OOKB 3QWCH 4NIWA 1W10U 3LJJA 1ANDA 2JIZD 2BYAX 5EU8A 2FM2A 5HMAA 2QXIA 1V2MT 2XNDD 2BQWB 5EPYA 1H9HE 2TPIZ 2OQ5A 1QZ8A 3BF6H 1SGFG 3MFJA 4YOIA 2CF8H 5DPAA 3F3BA 2JH6D 4LZ1H 1ETRH 2ZFRH 3LGTA 2BOKA 5A2MH 1X7AC 1PPGE 2CF9H 2Y81A 1C4V2 2OXSA 1NS3A 1YPHE 2WSSD 3U28C 3LGIA 2B5TB 1FUJA 1L1NA 3L33A 4LXBH 1QFKH 5FX6A 1C5SA 5KGOA 3ZZDA 3U98H 3ATIA 4Y76A 3TH3H 1GBMA 1NTPA 5E0GA 2QXHA 1KDQA 3OX7U 1UTNA 4YLQH 3A81A 1Y3VA 4UD9H 1WXRA 1FN8A 2O8MA 4KKDA 1K9OE 2WPMS 3BG4B 5A0AE 5K0HA 2VVCA 4TSFD 1DSUA 3ZZ7A 1MCTA 1H8DH 1F5LA 3LGWA 1GJ9B 1PPCE 1TPAE 3FAOA 3HPTB 2FMJA 1C5TA 1DT2A 1CBWB 2VB0A 4OM9A 4UDWH 1TRMA 4X2VA 3SV9A 1D6WA 1C1PA 2ZECA 2ZHFH 1LQDB 3SU6A 4UFGH 1C1TA 2CJIA 2WUBA 1CSOE 1SOTA 3NZIA 4K5ZA 1ZPCA 3SNAA 1L2EA 2BY5X 3ZZBA 2GCHG 2GZ7A 4E06H 4I7YH 2YNBA 1V2JT 3F1SB 1ANCA 3PLKA 4RN6A 3TITA 4JMYA 3RXQA 1O3KA 1ZGVA 3RM0H 4MPXA 1W8BH 3HGPA 1TQ0B 2WHXA 3AVZA 3ZYDA 1WU1A 2G5VA 1SOZA 1Z8RA 2J34A 1TOCB 3I29A 1GI8B 4P02A 2NU2E 4TPYA 1J15A 1DDJA 4HI3A 4KGAA 1NRRH 4CH2B 1RTLA 1GL1A 1BRBE 1CHOG 5FCKA 4I33A 3DA9B 5GCHF 3RXFA 1P10A 4AB9A 3SO3A 1AVXA 2GV7A 2IOTA 3K9XB 3O8CA 1C1MA 2FODA 2PSXA 3FKSD 3BN9A 1GMCG 5FL7D 2NU4E 3SNDA 1MAXA 3QLPH 4A5TS 1MKXK 4NGAH 3TK5A 4JYVH 3QZRA 3PMBB 1COWD 3Q77A 2XYAA 4FVBA 4AZ2B 1EZUC 3SN8A 1C2EA 2KCAA 1ZHPA 2OD3B 1SLVB 1V2NT 3B8JA 4JZFH 1PPBH 1D3PB 1K1IA 1CGJE 1GVKB 1NESE 3PM3A 3KN2A 3VEQB 1GHYH 1E1RD 3OY5U 2C93B 5CDFE 5HGGA 3SBKA 5CHAC 1RTKA 4ZUHA 8GCHG 1OP8A 3KL6A 2GJGA 1QGFA 1ABIH 1EKBB 3A80A 3KQDA 2GCHF 2AMPA 4BAOB 5BPEA 5DSFA 1GI2A 2FS9A 4B6FA 3M3TA 2FEQH 4OS2A 1C5PA 2EA3A 1MTUA 5T1VA 1NRPH 2J98A 4I8KA 1SLUB 1Y5BT 3T62A 2JJ2D 3SORA 1O2VA 2ZFQH 3D23A 4AYYB 3VB6A 1LHDH 1H8HD 4GCHF 1QRZA 5HIZA 2I6QA 2A5KA 1FMGA 3CENA 1YBWA 2I6SA 1LVYA 1C1SA 1C5VA 1H8IH 2AIQA 3C1KA 3MMGA 1N6XA 1EQ9A 2XC4A 4HFPB 2STBE 4IS5A 1GBTA 1K0HA 1HRTH 1ZSKA 5FPYA 2VU8E 2ZPQA 3MWIU 4E7NA 1TE0A 1YF4A 3DUXH 2QF5A 4BOHA 1P9SA 3OU0A 4U32A 2GCTC 5CE1A 1YLDA 1MKWK 1O2TA 1CT0E 1O5BB 2O8UA 2ZIQH 3RXPA 3UNRA 1EAXA 1DITH 4ISHH 2M5TA 3H5CB 3RMLH 1GI5A 1VCPA 1ZOMA 5FPTA 4ASHA 2J97A 5HYOA 1SBWA 4Z1MD 1E79D 3P8FA 1V2QT 1GI6A 3L6PA 1FN6A 1C1OA 4X6PA 2ZU2A 4NCYA 3ZZ5A 4DG4A 4ZXXH 1E1QD 1HCGA 1L0ZA 2J95A 3SV6A 3QTOH 1W2KH 1GG6C 2ODYB 2V7QD 1F92A 4A1TA 1LPZB 1O2IA 1O5FH 1O39A 3LH3A 4X2YA 5JBCS 1ESTA 2W5EA 3RC4A 1Y3XA 3A86A 3SHAH 2HLCA 1SGNE 1O2MA 4Y6DA 2XC0A 2RDLA 1TWXB 2P16A 3SU0A 1P3EA 3F9HA 1BRAA 3U69H 1HAIH 1P12E 1TGNA 1HBTH 4OGYA 3SJ9A 1CVWH 3E3TA 1RS0A 3FP8E 2H5DA 1ZSJA 1K21H 1HAZB 1TX8A 1IQLA 3T29A 4ZROA 3M3SA 4BAMB 2ZHWH 1TNJA 3EDXB 4BAQB 1C1WH 1DXPA 2OC8A 4MPVA 4GSOA 1WTGH 2NU0E 3GY6A 2C8XB 4DGJA 2AS9A 4HZHA 3BTKE 2H1UA 1RTFB 1SLWB 3BTDE 2BTCE 1KLJH 1MCVA 3VGCB 4IMZA 3GCTG 3UY9A 2YMSD 2AGIX 4Z0KA 1DWEH 1DY9A 3EA9A 2IJD1 4D76A 1PPEE 4D9RA 2V35A 5C94A 1C5QA 2ZU1A 1GJ6A 1W3CA 6ESTA 1P2JA 2ZKSA 3SV2H 1KDQB 1KTSB 3BTWE 4MVNA 5FCRA 1EPTB 1ZHMA 2R2MB 1HYLA 4X6NA 4XSKU 5FBIA 2ZQ2A 2L6OA 4MLFB 2WV4A 5E2OA 1MKXH 2F9VA 3HKJB 1IHTH 1C2IA 1TX6A 2TBSA 1BBRK 2SNWA 1TMBH 2BB4A 1O2NA 2BVRH 2CN0H 1OWDA 1QCPA 1PPZA 4D7GA 1H9IE 4ZHAA 1BMNH 2EI7A 2XC5A 1MZAA 3V0XA 9ESTA 1GJ5H 4A1VA 5C2ZA 3SGAE 5JPMH 2B9LA 1UTJA 2Z3EA 4IBLH 1OKXA 2W7SA 3CP7A 9LPRA 2QGRA 1TLDA 5DP5A 3PO1B 3CS7A 1SGDE 1ORFA 4BTIB 3LOXA 4CREA 2ZCHP 4X1QU 1DX5M 1PPFE 1SVPA 2BXTH 2O8TA 3A88A 2FI5E 3ZVFA 5GWZA 3SU4A 4H4FA 1IQKA 1P9UA 3BEFB 1DM4B 3BEIB 5A0BA 4F55A 1DS2E 3TIUA 4ASUD 1BRUP 1T4UH 1GJ7B 4I8LA 2O9QA 1WTHD 5FHTA 4ABBA 2ZEBA 1K2I1 1YPGH 4J2YB 3BIUH 2ZG0H 1TB6H 4I86A 2AGEX 1C5WB 2FOAA 3RU4D 1AUTC 1O35A 2BXUH 1HJ9A 1RIWB 1ZMLA 1YPEH 3GDSA 3M37A 3MH6A 3SGBE 1HPGA 2RCEA 2BD5A 1NC6A 1K1JA 3D49H 3RXTA 4AFUA 3SQEE 1LPKB 2FLBH 4A7IB 3SU2A 1TMTH 2PW8H 1E35B 3QTVH 1SQRA 1TMUH 1BZXE 4AFSA 1A1RA 1QL9A 1YWUA 6GCHG 4CRCA 1IAUA 5HM9A 1ACBE 2QIQA 2Y6TA 4TY7A 1Z1IA 2ZU4A 1GJBB 3KYFA 4ZH8A 2V6NA 1IQIA 1HJAC 1BTYA 2W6ID 4YT7H 1ARCA 2BDYA 3FANA 1F7ZA 2PHBA 4BTUB 3JZ2B 1BB0B 3MU4A 2CHAC 1QTFA 1KMHB 1TX7A 1NO9H 2W7UA 3SUGA 1Z7KA 2NU1E 1SGTA 1MD7A 1GI1A 4YESB 4FUDA 2ZWLH 5EXNA 1EAUA 2Z9JA 3NWUA 2A4OA 5F8XA 2F91A 1UHBB 3E90B 4BANB 2J92A 2P8OB 2SFAA 5C5NA 1GMDG 3TVJB 1IQGA 1AFEH 5E2PA 2HRVA 3KQEA 1AZ8A 2WINI 3SJIA 3I77A 5L2ZH 3AW1A 1MABB 1TBRH 1Y59T 2IJOB 1E37B 1C5RA 1YM0A 2F9BH 2A5AA 2VIQA 1V2PT 3MU8A 3B9FH 1BQYA 2KX4A 3GCOA 3N99A 4XFQA 4I32A 8ESTE 1IQJA 3A7WA 4XRNA 2A4GA 3FN8A 4P00A 1VR1H 1NM6A 2UWOA 1WBGB 5DN6D 2IPQX 3U1IB 2ANWA 2ZFFH 2XCFA 1GBCA 1L4ZA 1LMWB 1DSTA 4NSYA 2TIOA 2JDID 1TBQH 1AWHB 3KQ5A 1BMMH 2GKVE 4IN2A 3NK8A 4NA7A 1C1NA 3UOPA 1FAKH 1K1LA 5AF9H 3SYJA 3UR6A 2G51A 1RGQA 1XXFA 4YM9A 3MQKC 1V3XA 1HAVB 5ESBA 2QAAA 3E91A 2VIPA 2J2UA 1A3EH 2ZGBH 2B0FA 3A7ZA 3SW2B 3BTFE 3N7DA 1EUFA 4XOJA 1FPCH 1CQQA 5C3NA 1YKTA 2KCYA 1LTOA 1V2UT 2QF3A 3BTEE 1O2LA 2PWXA 1GI3A 4K1TA 1G3EA 1HAXB 1TNHA 3U9AH 4A1XA 1ID5H 2V3MA 4WH8A 1EP6A 2UWPA 4B71A 4CBNA 2TGPZ 1BBRE 4FUFA 1SQTA 7GCHF 2XXLA 4AOQA 3RXRA 4DOQA 2HOBA 3PMHB 3RM2H 3QGJA 4BAHB 3OSYA 1P2KA 1GBHA 3VB7A 1OWIA 4B2AA 1G36A 4B74A 4CRDA 3MH5A 3MI4A 1NBMD 3S69A 1GI7B 1PQ7A 1GVZA 1W0JD 1WV7H 3HATH 3PLPA 2PGQB 3PRDA 2GT8A 2VGCB 2ZCLP 2OUAA 1VGCC 3UQOA 1CGHA 3RU4T 1ANEA 2R0LA 3RXVA 1FLEE 3A82A 5EODA 1TRNA 4X6MA 4X2WA 1YYY1 3F0OA 3AW0A 5EGMA 4VGCB 1HFDA 1JOUB 1J8AA 4ACAA 1QR3E 2PV9B 1GJ8B 1TQ7B 2XWBI 5EIYA 1TGSZ 1GCTB 4O3TA 3RXMA 1O37A 1C1QA 2VWNA 5T3HA 5T6FA 4FXGH 2SGAA 1TFXA 1W0ZU 2VWMA 1QY6A 2ZU3A 4LOYH 5EQQA 1XKAC 1O3IA 1YPLH 1FZZA 1ZMJA 1QBVH 1L4DA 1P09A 5A8ZA 1J14A 1N6YA 3BV9B 1KLTA 4ZKNU 1F0RA 1MMJN 4INKA 3S0NA 5PTPA 2ILNA 4XDEA 2ZGCA 3LGYA 1BMLA 4THNH 3UUZA 1K1OA 2PUXB 3UNQA 5GXPA 4GCHG 1AE5A 1FXYA 1BITA 1NPMA 3VGCC 4WF8A 2FIRH 2SGPE 1T8MA 1XXDA 4BXWA 1LHCH 2CMYA 1D3TB 3TPIZ 2XRCA 1KXFA 1UO6A 1HDTH 3RMOH 2EQNA 2CHAB 3ZZ4A 1SHHB 2JJ1D 4WXIA 3ZZ8A 2FYQA 1KTTB 3NXPA 3PTBA 1DOJA 4XBDA 1AB9B 4X0WU 4H6SB 4AGKA 1DWBH 1RXPA 2HNTE 5C0UA 2K1QA 1SGPE 2R3UA 3GYLB 2WPIS 3EYDA 2VH0A 2AEIH 1D3DB 2K0QA 1TPSA 5DP8A 2KAIA 2GV6A 4E05H 2WUCA 1AGJA 4DURA 2ZCKP 2ODQA 3CNRA 3UFAA 7LPRA 4FUGA 1K22H 4K3JA 5F8TA 4OGXA 1JBUH 2FOCA 1QJ6B 3LC5A 3KGPA 4JZ1A 2VIOA 3RXBA 1HAVA 1RRKA 3VB3A 4CRGA 5L6NH 1AB9C 1JXPA 4FUHA 1GJDB 3PRBA 4RKJB 4K69A 1P06A 1LVMA 2BZ6H 1FIZA 4GHTA 1ELGA 3PWCA 4AGJA 1BBRH 3MH7A 2C3SA 2CXVA 4TT3D 4FU8A 2A2QH 4TWWA 1V2TT 4ISIH 2DUCA 3UAIC 5E0JA 1AZZA 1LKBA 2HPPH 4CRAA 4NA9H 1AKSA 3A83A 4M7GA 1BDAA 1OWHA 2XW9A 1DUEA 4BXSA 2A4QA 3M5MA 3PB1E 3P17H 1WUNH 6LPRA 5B6OA 1ZZZA 2F3CE 1N8OC 5HXFA 4B2CA 2AIPA 1AWFH 4JK6A 3PMAB 2GMTC 2FESH 2DE8A 2PKSB 3AASA 2FI4E 3U8TH 1QHRB 1C1VH 2SGEE 2THFB 3KQCA 5FX5A 3EA7A 1Z8GA 2BDIA 1OSSA 2TGAA 1BHXB 5AFYH 1TNIA 4HGCA 1GMHG 2ZTYA 3LGUA 1BJUA 2Z94A 4FU7A 4INHA 1LVBA 2EEKA 4DT4A 2BM2A 2BDAA 1UCYK 4Y8XA 4UEHH 1O3GA 4MG3A 2A31A 2PUQH 1MTNC 2JH5D 2BZAA 5AHGH 1BTZA 1ZTJA 1EPTC 2UWLA 4YZUA 4FUJA 1O0DH 5EQRA 4XBCA 5F53A 2JKHA 2VGCC 4JK5A 4DW2U 5C1XA 1FY8E 1UVUH 4WWYA 3O8BA 1ELAA 1UK3A 5FAHA 3M7QA 1WSSH 1SMFE 1TONA 2WYGA 1MH0A 3SU1A 3GY2A 2FYRA 2ZFTA 8LPRA 4A92A 4WXVA 5IYTA 1AY6H 1P11E 1TYNA 3TGKE 3LC3A 2GTBA 4MNYA 5AFZH 2R3YA 3K6ZA 3PMJA 3ZVBA 4Y7AA 3ZZ6A 3ODFA 1MTWA 2HALA 3A84A 3GICB 5EW1H 2FOBA 5EPNA 5GJ4B 1HAYB 1D6RA 2OP9A 3K2UA 4B73A 3SNBA 1O2ZA 1FV9A 2IN2A 2GDEH 3UB0A 3MYWA 3MTYA 1O2QA 1G37A 4AFQA 1A7SA 1NU9A 1O31A 2EI6A 2Y82A 2OK5A 2R0KA 3QDZB 3TJOA 1SSXA 1AKSB 4YTAA 1YGCH 2SGFE 3NPSA 4YO9A 1A5HA 1NBME 1GHAF 1BMAA 2XBWA 2LNCA 1UVTH 2EY4C 2BD8A 5GNDA 3U8RH 3G01A 1KY9A 1OP2A 1UTMA 3AK5A 5C1UA 1O5DH 4IMQA 3DCLA 1W13U 3E1XB 3F2GA 2FPZA 4NIVA 3RXIA 5E0HA 4MNXA 2ZFPH 2OTVA 1OP0A 1OX1A 2AMQA 3UQVA 2ZPSA 1GBJA 5LPEA 3F9FA 4U2WA 5JB8S 3A89A 3LONA 5IK2D 1EZSC 3BG4C 2PFEA 5EG4A 2G4TA 4DIIH 4YT6H 4AB8A 2CK3D 2GMTB 2GDDA 1S82A 3TNSA 1C5LH 1SFIA 1GJCB 4B2BA 3SI4H 7KMEH 1VITG 5LGOA 3S9AA 4UFFH 1VCWA 3P8OA 1TRYA 2Y5FA 4Y79A 4Z6AH 3UNSA 3MU0A 3OY6U 1GGDC 3DSOA 2D2DA 1GJ4H 3V13A 1CA8B 1THSH 2R9PA 1Z6EA 3HGNA 2P8OC 1QIXB 2YMSB 1U6QA 3SGQE 2Y7XA 5L30H 4IC6A 1GMCF 2WPDD 1XVOA 1W0KD 1O2GH 2BDHA 3BEUA 2GVFA 1CHGA 1BTWA 1AI8H 3ZIAD 1NFUA 4KTCA 2P93A 1DICA 1ZSLA 4Y71A 5EOKA 4HG6A 1T8LA 3F6UH 2FLRH 2J4IA 1QB6A 1EAWA 2VIVA 2A5IA 3BTHE 2KAIB 3R0FA 4A6LA 1GHVH 2G55A 1HGTH 1V2WT 1G2MA 1P57B 3S7KB 1Y8TA 3SNEA 1LO6A 1ANBA 2BLVA 1YPJH 3HK6B 2ESTE 3GY7A 2PLXA 2Z7FE 3O8DA 3SZNA 2Z9GA 1AFQC 2R2WU 1B0EA 1O5CB 3FP7E 4OS5A 1QJ1B 4IGDA 3OYPA 1AD8H 1RFNA 2B8OH 1WOFA 2BD7A 2ZTZA 4X1NU 3D65E 4Y0YE 2ZP0H 1QJ7B 3SU5A 3LT3A 1GDUA 2ZDLA 1O3FA 1AN1E 2VJ1A 3A7VA 3SUDA 5FXLA 1P2IA 3NUMA 6CHAB 2AERH 5HIYA 2P59A 3FZDA 3F68H 5JDUB 1ETSH 1H1BA 2A45B 2P94A 1O3OA 4I8JA 5ABWA 1S84A 2JETC 1BA8B 3RLWH 1H4WA 1SGFA 1A3BH 4ZKSU 3A8CA 1ABJH 3E6PH 5DG6A 1E34B 3BTQE 4ZAEA 4JYUH 3M7TA 2XBXA 4R0IA 2M2AA 2KZ4A 1GHAG 1OPHB 1P2MA 1SKYE 1JRSA 4B1TA 2XBVA 2FX6A 1KXCA 1UVPA 4NA8A 4NFEA 1ZTKA 3NRLA 3PO1C 2KFWA 2F9PA 1QL7A 1CT4E 5L2YH 3MHWU 4FU9A 4Q7ZA 2KCPA 1HJ8A 2VIWA 1GI4A 1O3HA 2C4FH 1BTUA 3RXLA 2FOEA 1O3JA 1G32B 4MTBA 1AMHA 1G30B 3LJOA 3ZZCA 2F83A 2V3HH 1FIWA 2Q6GA 2STAE 3EGKH 4F49A 1MBQA 3GCHC 3GCTF 1E38B 4UONA 3LGVA 1T8OA 5JYIA 1C2HA 1VJAU 2ZNKH 4J1YA 3RU4E 3ATLA 5TCAA 1HLTH 5TJXA 4AX9H 5LPRA 1JRTA 1A0LA 4Q2KA 1XUGA 3Q3YA 4H6TA 2V3OH 3E16B 3VXFH 1O3LA 1V2LT 4X8SH 3R3GB 3VG8A 1ARBA 2TGTA 1KYNA 1QRXA 4FVDA 4JYTA 3WW7A 3ZVAA 4CR9A 1NY22 1K28D 1O3BA 1CBWC 3RLYH 1YCPK 6CHAC 2TGDA 1GDNA 1P2OA 1ZRKA 1HAHH 2W6JD 2LELA 4FETA 2BVXH 4KTUA 1JIMA 4D8NA 1W7GH 1QQ4A 4LZ4B 4ESTE 5AVDA 3URDA 4DIHH 1PPHE 4X6OA 3DSGA 3GY5A 3VFEA 1SGYE 4IW4E 3LKWA 2VWLA 1TABE 5DGJA 1SR5C 4DCDA 4OS1A 2CV3A 4K2YA 1DE7H 2BMGB 2GZ8A 1HUTH 3TJVA 2H9TH 1FY5A 4ZCNA 5A8YA 1JWTA 1EPTA 4O03A 3GY3A 2Q1JA 3QX5H 1HXEH 4ABGA 4SGBE 4Y10E 1VJ9U 3SJKA 3VXEH 2QE7D 5C20A 5TCCA 2UUYA 1L1JA 4GAWA 3WWBA 3DHKH 1SGIB 1O2PA 2A0QB 3UR9A 2H2ZA 3RXEA 2IPHA 3GCNA 1UW7A 2FO9A 1NFYA 5DP7A 4ZHMU 2BLOA 1LHFH 2F9UA 1QA7A 3SV8A 1CA0C 1EX3A 4RKOB 3M5LA 1VZQH 4M9FA 2PGBB 4ABAA 2P3UB 2WV5A 4JZDH 3T26A 3TNTA 4CR5A 1W0YH 1C5OH 2PR3A 4IC5A 1GG6B 1XVMA 2PKSC 1O2WA 1OS8A 2ZDAH 1KXBA 2UUFB 4Y11E 5A09A 1P3CA 1D3QB 1RD3B 2A32A 3GDUA 1NT1A 3RXUA 1SC8U 1FY1A 1P8VC 3PWBA 1SGQE 2OBOA 1E0FD 1SQAA 1FY3A 4WVPE 1AVWA 3FP6E 1A46H 1GPZA 3FO8D 2A2XH 3LIWA 1V2ST 2Z9KA 1C9PA 1IQFA 2XOKD 3F2HA 4GUXA 1TALA 3PV4A 1O32A 1YY3A 5SGAE 1AUJA 3OAAD 3T27A 1H9LB 2BQ7B 4DT7B 2YMSC 1S6FA 2BDGA 4MNVA 3MO9A 1NU7B 3RP2A 3ATMA
chains in the Genus database with same CATH topology
1UTPA 2G8TA 1W12U 3HKIB 1EJAA 1YLCA 1J17T 1CT2E 1XKBC 1QBOA 4D7FA 4UFEH 3GYMA 1PYTD 1W7XH 3ELAH 3EA8A 1MKWH 1TGBA 1TBZH 3TH4H 1RJXB 4ZKRU 1S0QA 2D8WA 2J9NA 1C5YB 2QY0B 1V2KT 1VGCB 3RDZA 4I8GA 3C27B 2FXRA 2A7JA 1Y5AT 1UK2A 5FBEA 2FWWA 1AU8A 1KLIH 2GX4A 3E0NB 1N1LA 2ANMH 1GHZA 2LPRA 3PLBA 1THRH 5DKMA 1C5UA 1C5NH 1FY4A 3B23B 5CHAB 3GY4A 3TU7H 3TLOA 2PTCE 3M5NA 2WPLS 1QL8A 2D1JA 2EC9H 3ZVEA 3SJOA 1UVOA 3MO6A 4UE7H 1A5GH 3P8GA 1DWCH 5JB9S 1SGEE 2ZDKA 1G2LA 4NSVA 1INCA 2Y80A 1E36B 2FOMB 2QYIA 4TY6A 2XTTB 2XBYA 4ZMAH 2P3FH 1DXWA 2Q6FA 2Z3DA 3A7XA 1ESBA 4NWLA 1Y3YA 1MQ6A 8GCHF 1LVOA 1T7CA 3GISB 1WQVH 1RIWC 3Q76A 1C9TA 3STIA 1EJNA 4TPIZ 1GHXH 3RXOA 2YOLA 8KME2 5JBBS 3VPKA 4CHAC 3A8BA 3PROA 4Y7BA 1UMAH 1DY8A 1Z6JH 5DP3A 3K6YA 3O8RA 3RC5A 3TK6A 4ABJA 1QQUA 2BD4A 3KQBA 3RXGA 3RUOA 3KF2A 1ZJDA 2AYWA 3Q3XA 5DP4A 1O3DA 1SGRE 3STJA 4O97A 1QA0A 1AVGH 2BD2A 5K7RA 1G3DA 2VIDA 1PQAA 2BY8X 1MD8A 1BRCE 1GL0E 1F5RA 3CS0A 2QV1A 1GCTC 2ASUB 2OCVB 4JCNA 1BHXF 3URCA 4BNRA 3DFLA 3ZZ3A 3T25A 4XE4A 1CO7E 1S6HA 3M61U 1MTVA 3RXDA 2RA3A 2BX3A 2J94A 3BTGE 4AORA 1YPMH 1O33A 1YPHC 1ZGIA 2BD9A 1ZRBA 1C1UH 2QCYA 1C2JA 1MAYA 1C4U2 1UTKA 2HVXA 3FVFB 2BDBA 1NFXA 1A4WH 2QXGA 2ZHEH 2QC2A 5IDKA 3ZZAA 1IQEA 4FUCA 3S7HB 3RXSA 5J4SA 1GI9B 1ELTA 4BTTB 1F0UA 2Y7ZA 1UJ1A 2ZGJA 2ZGHA 3A8DA 2ALPA 1Q3XA 3KIDU 1O3MA 2ZPRA 1O2UA 1ZPZA 1HNEE 1UTQA 1GBLA 1LKAA 3RC6A 2ANKH 2VINA 4INLA 4CHAB 2UUJB 4BAKB 3SUEA 1LDTT 2BQ6B 1D9IA 3VB5A 5I25A 2HNTF 4NFFA 3BTME 4OS4A 2H6MA 3RXCA 3BIVH 5BRRE 3U8OH 2SNVA 2ULLA 1UCYH 4ISNA 1MUEB 1UTLM 3QO6A 1SI5H 3MU1A 4IN1A 2VH6A 5HM2A 3Q00A 2OC0A 1THPB 3RXKA 4ZHLU 2ZQ1A 4X8VH 2Q6DA 1Q31A 2SGQE 3VB4A 1FPHH 2ZHQH 4WJG2 4NG9H 1P2QA 2WPHS 1SB1H 1W14U 2RG3A 3IITA 2UUKB 5GCHG 1C2DA 1GBFA 4ISLA 4WY3A 1GBDA 2HWLB 1P04A 4NWKA 5I46H 1EOLA 3FFGA 2HPQH 1P03A 1MZDA 1LCYA 3M35A 4O9VA 1TIOA 5LPFA 4GLYA 1HAPH 1LHEH 2FZZA 3TJNA 4K1EA 3UOUA 1F2SE 4CRFA 2W3IA 4F4OC 5C1YA 4OS7A 3NKKA 2EI8A 1AO5A 2O8LA 4MPUA 1VITH 1MQ5A 1GGDB 2BY7X 1M9UA 1IOEA 2ZFSA 3KHVA 1GBBA 1KIGH 4X1RU 5F6MA 1V2VT 3TK9A 3AAUA 1QB1A 3KCGH 2WPJS 2H5CA 1FDPA 3BG8A 4K60A 1ETTH 3ZZ9A 1BT7A 1AE8H 4Y0ZE 2BOHB 1GHWH 1XM1A 1GBKA 4NZQA 2G5NA 5T6DA 1SHYA 1NFWA 5F03A 1XMNB 2G52A 2GCTB 2QA9E 1HIAB 2XCNA 4XBBA 3BSQA 3EE0B 1C2LA 1T31A 4JZIA 5JBTA 2C8WB 3RMNH 1O2HA 2ZDVH 1O3PB 1XUJA 1S85A 3MOCA 5CMXH 1PQ8A 4Q80A 1O2KA 4DVAU 1YCPM 1SFQB 2FP7B 2BLWA 2ZU5A 1O2RA 2G81E 4GVUA 2HNTC 1NRSH 1BOQA 2DE9A 4B76A 5DP6A 1LQEA 2D26C 7GCHG 2B7DH 1ESAA 1P2NA 3HK3B 1BUIA 1HB0B 3GOVB 2FOHA 4X1PU 4CRBA 3QGNB 1GDQA 1B5GH 3IWMA 2BY6X 1XUKA 1BTHH 2HGTH 2WPKS 2FOFA 3PYHA 1WCZA 3BTTE 1P01A 1MU8B 5DJ7A 1A0HB 1AIXH 4GHQA 4VGCC 2Z3CA 3P92A 1TNGA 1A61H 3GDVA 3S9CA 5H4IB 3V12A 1SPJA 2Z9IA 1SG8B 3A87A 3Q3KA 4ABHA 1O5GH 1MTNB 1KXEA 5ESTE 3V3MA 3SU3A 1QB9A 3RXHA 3SQHE 1OYQA 2SGDE 1K1NA 4Y8ZA 3V7TA 1O2SA 1C2KA 2V0BA 3KNXA 3MH4A 2ALVA 5C67A 1NROH 2XWAA 3OTJE 4WMEA 1EXFA 1F5KU 1TAWA 4MDSA 4MPWA 5A8XA 3F9EA 3W94A 3T28A 3SHCH 2GD4B 1TGCA 3LPRA 4K8BA 2G4UA 4R8TB 1QNJA 4KTSA 1SGCA 4KP0A 3ZVGA 1EASA 3DD2H 2Y5GA 1FI8A 1YPKH 1IQMA 3T5FH 2BX4A 3NCLA 1V6DA 5GDSH 3RXAA 2Y5HA 1GHBG 1Z71A 4NIYA 1ZJKA 3TGJE 4ISOA 1A5IA 3U1JB 1XUIA 4PROA 3QK1A 2ZDMA 3IG6B 4AG2A 1ELVA 1S0RA 4YOJA 3ENSB 2P95A 5G4BA 1DPOA 1GCDA 1UK4A 4B75A 3JZ1B 1J16A 1EZXC 2GZ9A 1NN6A 3UTUH 2OC1A 1SLXB 4CBOA 1ZMNA 5EXMA 1WAYB 1PYTC 1A2CH 1EJMA 4ABFA 5FPSA 3LU9B 1T32A 3ATWA 2OLGA 3UREA 1ELFA 2A7HA 2Z9LA 4CH8B 1FNIA 1EB2A 4AFZA 1BIOA 3P6ZB 1BCUH 2VVUA 3EAJA 1FONA 3KEEA 3WY8A 2A4RA 1Q2WA 4U30A 1GBEA 4H42U 2BDCA 2JH0D 1HAOH 2BVSH 2FTLE 3P95A 2PKAB 4ABIA 1OWEA 1IHSH 5DP9A 1ELEE 1J9CH 3S9BA 1HIAA 1O3NA 1CE5A 2BD3A 4SGAE 1CU1A 1TA6A 2QXJA 1T8NA 1SL3A 5C5OA 1DVAH 4LK4A 1O38A 4NZLA 5GIBA 1IQNA 1QURH 1DLEA 5T6GA 1EZQA 1GMDF 2VVVA 1QBNA 1S83A 2FOGA 4U01A 1KXAA 1EAIA 4ZXYH 3SNCA 1VCQA 2QF0A 3RMMH 1HV7A 2FTMA 1DFPA 1C2MA 4AG1A 1OXGA 3H7OA 1O3CA 1O5EH 1Y3UA 3H7TA 1YP9A 1KSNA 2FX4A 5EXLA 2TRMA 1QRWA 3I78A 1TOMH 3TGIE 1TNLA 3P70B 1GI0A 2H9HA 1YCPH 3E8LA 3SOSA 1OYTH 1TA2A 3MNCA 5A0CA 4Q7YA 1ZLRA 3FZZA 5J4QA 3ZYEA 1G3CA 1JIRA 1MU6B 1GMHF 3GCHB 2PSYA 2ZO3H 1YC0A 2FS8A 1C1RA 3SI3H 1WYKA 1D4PB 3E0PB 2FI3E 1LPGB 1FJSA 4HTCH 1KXDA 1TPPA 4Q7XA 1EATA 1NZQH 3MNXA 1NRNH 2CGAA 1EP5A 2ZGXH 3EQ0H 7ESTE 4AYVB 3RXJA 1O5AB 2YNAA 1ZYOA 3MO3A 4FUEA 3MNSA 2ZTXA 1ZR0A 3ZV9A 1Y3WA 1BTPA 3SJ8A 1V2RT 1P05A 5DO4H 3ATKA 2AH4X 4QT8C 1SQOA 3ZV8A 2C90B 1IQHA 2AGGX 1CA0B 4K8YA 4WMDA 3DT0H 4FUIA 3ZVDA 4DJZB 3ESTA 1GJAB 1O36A 3QUMP 1LHGH 3P8NA 2F9NA 3UWJH 1O2OA 1GVLA 5E8EH 1P0SH 2H9EH 2OC7A 4TYDA 1O3AA 1Y5UT 1N8OB 2G00A 2BY9X 1UHBA 1JMOH 2W26A 4WH6A 4X2XA 1DLKB 3M7UA 4O3UA 2WYJA 4GPGA 1ELDE 3K65B 3TH2H 1GBAA 1BTXA 1TGTA 1TPOA 3UIRA 2GGVB 4KELA 2ZF0H 1GHBF 3D62A 4ZKOU 2XNIA 3L3TA 1CHOF 4E7RG 2O8WA 1ZTLA 1ELBA 3F9GA 1AQ7A 1XUHA 3W95A 4I31A 1XX9A 1O30A 3A7YA 4ABDA 2BLQA 3SUFA 2ZHDA 1O3EA 4MNWA 4X8TH 4ABEA 1AHTH 3QN7A 2ZA5A 3LH1A 2NWNA 2NU3E 2AMDA 2OINA 1UCYE 3A7TA 1EB1H 1HAGE 3T2NA 2AFQB 1O2XA 2P3TB 3MU5A 1TNKA 1L1GA 2FDAA 1UVSH 2RA0A 4FUBA 1G9IE 3PTNA 4UFDH 1O2YA 5EQSA 1XUFA 1G3BA 1ZHRA 2OQUA 1ELCA 4DY7B 1C5ZB 1OWKA 4JZEH 1PQ5A 1K1PA 1EOJA 5DK1A 2ZI2H 1Z8JB 3M3VA 4RSPA 6GCHF 1WQSA 1S5SA 1PFXC 2ZC9H 4TWYA 1DANH 5LH8A 1C2FA 3M36A 3ODDA 3GY8A 2F9OA 1PJPA 4K1SA 2VWOA 3AAVA 2VNTA 4D9QA 2W3KA 3QZQA 1K1MA 4OS6A 3LDXH 4YOGA 1FAXA 1MTSA 2BHGA 2GP9B 1V2OT 1A0JA 1ZPBA 2ZZUH 1VITF 4YLUA 5ETXA 1UTOA 2ODPA 1O2JA 4WMFA 5GPIB 4Y8YA 1F0SA 3DFJA 1BJVA 3ZVCA 1HXFH 1O34A 1Z8IB 1DUAA 1OWJA 2GT7A 3M5OA 2JETB 1T4VH 2C8YB 1B0FA 4AN7A 2PTNA 1DWDH 1C5XB 1P02A 3N7OA 1CGIE 1GWAA 2J38A 5JBAS 2OBQA 4I8HA 1S81A 1W11U 2QN5T 1NRQH 3A8AA 4X8UH 3SV7A 2Z6BD 3TJUA 3UWIA 1GBIA 1F0TA 2A1DB 4MQAA 3A85A 1C5MD 2PKAA 2C8ZB 3UPEA 4NIXA 1AFQB 2A7CA 1MBMA 1C4Y2 1C2GA 3MNBA 3ITIA 2ANYA 1FQ3A 1Z1JA 5F8ZA 2ZDNA 1B7XB 1HJAB 5EW2H 4X1SU 1OOKB 3QWCH 4NIWA 1W10U 3LJJA 1ANDA 2BYAX 5EU8A 2FM2A 5HMAA 2QXIA 1V2MT 5EPYA 2BQWB 1H9HE 2TPIZ 2OQ5A 3BF6H 1SGFG 3MFJA 4YOIA 2CF8H 5DPAA 2JH6D 4LZ1H 1ETRH 2ZFRH 3LGTA 2BOKA 5A2MH 1X7AC 1PPGE 2CF9H 2Y81A 1C4V2 2OXSA 1NS3A 1YPHE 3LGIA 2B5TB 1FUJA 1L1NA 3L33A 4LXBH 1QFKH 5FX6A 1C5SA 3ZZDA 3U98H 3ATIA 4Y76A 3TH3H 1GBMA 1NTPA 5E0GA 2QXHA 1KDQA 3OX7U 1UTNA 4YLQH 3A81A 1Y3VA 4UD9H 1FN8A 2O8MA 4KKDA 1K9OE 2WPMS 3BG4B 5A0AE 5K0HA 2VVCA 1DSUA 3ZZ7A 1MCTA 1H8DH 1F5LA 3LGWA 1GJ9B 1PPCE 1TPAE 3FAOA 3HPTB 2FMJA 2VB0A 1C5TA 1DT2A 1CBWB 4UDWH 1TRMA 4X2VA 3SV9A 1D6WA 1C1PA 2ZECA 2ZHFH 1LQDB 3SU6A 4UFGH 1C1TA 2CJIA 2WUBA 1CSOE 1SOTA 3NZIA 4K5ZA 1ZPCA 3SNAA 1L2EA 2BY5X 3ZZBA 2GCHG 2GZ7A 4E06H 4I7YH 2YNBA 1V2JT 3F1SB 1ANCA 3PLKA 4RN6A 3TITA 4JMYA 3RXQA 1O3KA 1ZGVA 3RM0H 4MPXA 1W8BH 3HGPA 1TQ0B 3AVZA 3ZYDA 1WU1A 2G5VA 1SOZA 1Z8RA 2J34A 1TOCB 3I29A 1GI8B 2NU2E 4TPYA 1J15A 1DDJA 4HI3A 4KGAA 1NRRH 4CH2B 1RTLA 1GL1A 1BRBE 1CHOG 5FCKA 4I33A 3DA9B 5GCHF 3RXFA 1P10A 4AB9A 3SO3A 1AVXA 2GV7A 2IOTA 3K9XB 3O8CA 1C1MA 2FODA 2PSXA 3BN9A 1GMCG 2NU4E 3SNDA 1MAXA 3QLPH 4A5TS 1MKXK 4NGAH 3TK5A 4JYVH 3QZRA 3PMBB 3Q77A 2XYAA 4FVBA 4AZ2B 1EZUC 3SN8A 1C2EA 2OD3B 1ZHPA 1SLVB 1V2NT 3B8JA 4JZFH 1PPBH 1D3PB 1K1IA 1CGJE 1GVKB 1NESE 3PM3A 3KN2A 3VEQB 1GHYH 3OY5U 2C93B 5HGGA 3SBKA 5CHAC 1RTKA 4ZUHA 8GCHG 1OP8A 3KL6A 1QGFA 1ABIH 1EKBB 3A80A 3KQDA 2GCHF 2AMPA 4BAOB 5BPEA 1GI2A 2FS9A 3M3TA 2FEQH 4OS2A 1C5PA 2EA3A 1MTUA 1NRPH 4I8KA 1SLUB 1Y5BT 3T62A 3SORA 1O2VA 2ZFQH 3D23A 4AYYB 3VB6A 1LHDH 4GCHF 1QRZA 2I6QA 2A5KA 1FMGA 3CENA 1YBWA 2I6SA 1LVYA 1C1SA 1C5VA 1H8IH 2AIQA 3C1KA 3MMGA 1N6XA 1EQ9A 2XC4A 4HFPB 2STBE 4IS5A 1GBTA 1HRTH 1ZSKA 5FPYA 2VU8E 2ZPQA 3MWIU 4E7NA 1TE0A 1YF4A 3DUXH 4BOHA 1P9SA 3OU0A 4U32A 2GCTC 5CE1A 1YLDA 1MKWK 1O2TA 1CT0E 1O5BB 2O8UA 2ZIQH 3RXPA 3UNRA 1EAXA 1DITH 4ISHH 2M5TA 3H5CB 3RMLH 1GI5A 1VCPA 1ZOMA 5FPTA 4ASHA 5HYOA 1SBWA 3P8FA 1V2QT 1GI6A 3L6PA 1FN6A 1C1OA 4X6PA 2ZU2A 4NCYA 3ZZ5A 4DG4A 4ZXXH 1HCGA 1L0ZA 2J95A