3LGIA

Structure of the protease domain of degs (degs-deltapdz) at 1.65 a
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
220
structure length
220
Chain Sequence
FDSTDETPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Protease degS
publication title Allostery is an intrinsic property of the protease domain of DegS: implications for enzyme function and evolution.
pubmed doi rcsb
source organism Escherichia coli
total genus 56
structure length 220
sequence length 220
chains with identical sequence B, C
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2010-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3lgiA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3lgiA02
3E3TA 1GHYH 1DY9A 2W7UA 4VGCC 3QK1A 2GV6A 3K6ZA 1D3PB 1INCA 1GI5A 3SQHE 1Q3XA 5DJ7A 2A4OA 2WPJS 2AIQA 4LZ1H 1NFWA 1FY5A 4UEHH 4X6NA 3A7VA 2Q6GA 2Y5GA 1GMHF 1EJAA 3M61U 6CHAB 4FUIA 4NA8A 3RXEA 2M5TA 3JZ2B 1SC8U 1AY6H 4FVDA 3TK9A 1PFXC 1GI0A 4OS5A 1DWBH 4YLUA 1ANDA 1BT7A 2GMTC 2D2DA 4KGAA 4DIIH 1T7CA 1Z7KA 2CHAB 2GP9B 1TQ7B 2P8OB 1IQNA 1AKSB 4GLYA 3LDXH 4A1TA 3B9FH 3DT0H 2ANYA 3TNSA 3V12A 3QN7A 4Q7ZA 3PMBB 2ZU3A 3SV6A 4AFUA 1C5LH 1IHTH 3ZYDA 2XWBI 5TCCA 4AB9A 3ZZ7A 1P11E 4U32A 3VPKA 1C1RA 2Z3DA 1A61H 3M5NA 5LGOA 2A0QB 2BD5A 1DM4B 1FJSA 1IQLA 2ZPRA 1AU8A 3A7XA 4Y8YA 1O3FA 2R9PA 4MDSA 5JB8S 2OXSA 2AGGX 1BBRH 1V2RT 1GMCG 4O9VA 1P10A 1TNIA 1TRYA 4MPUA 5E2OA 4DCDA 4ISHH 1B7XB 4Q80A 1K22H 1CA0B 2VIOA 2FESH 3AVZA 5C5NA 2Z9KA 2FWWA 3GY2A 1MKWK 1SQOA 4XBDA 3S69A 1QRXA 4Y8XA 1TPSA 2P94A 1JWTA 3P6ZB 3QWCH 2FS8A 1VZQH 1MTSA 2TGPZ 1LVYA 4Y11E 1DUEA 4AX9H 1SGPE 2WINI 2R0KA 1ELFA 3L6PA 1O2RA 4FXGH 3SNDA 5JPMH 1AE5A 3FANA 3O8DA 3TGKE 3T62A 1BIOA 2PSYA 3RC4A 3NCLA 1A4WH 1CGIE 2GCTC 4NWLA 2OP9A 5DPAA 1UVSH 1JXPA 1PPBH 1J16A 1BRUP 2V35A 3RXUA 2A1DB 3Q00A 1TOCB 2OTVA 1LPZB 1O2XA 5C2ZA 1W10U 3A7YA 5L2YH 3ZZ5A 4NSVA 1C2MA 1V2QT 2FI5E 4XOJA 5ESBA 1VGCC 2BDAA 1HAYB 3BTGE 1JIRA 1O36A 3K2UA 3TGJE 1MZAA 1NU7B 3TIUA 1XMNB 2R0LA 4NGAH 1K1MA 3LC5A 1BCUH 2RA0A 1O2VA 3HPTB 1KIGH 1GJ8B 1EAUA 1NROH 4K5ZA 1GJAB 5JBTA 3PYHA 1GCDA 4BOHA 4DIHH 1L1NA 3SJKA 2BTCE 2Q6DA 1K9OE 4F4OC 3TGIE 1KTSB 4RN6A 2BY5X 2J9NA 1UCYH 1MCTA 1Z6JH 1IAUA 1GVLA 2TGDA 2GGVB 4ISNA 4Y7BA 4YOIA 2ZWLH 3T26A 1YPKH 1MCVA 1GBIA 5A09A 2FEQH 1LDTT 1X7AC 2FM2A 1WBGB 4JK5A 2Z9GA 1CVWH 3MH7A 1BMNH 4BAHB 3ZZ9A 2FLRH 1ELCA 3RMLH 3BG4B 5DP3A 1B5GH 2ZDVH 1FIZA 4DOQA 5C5OA 4ZMAH 3S9BA 1AI8H 2I6QA 2ANWA 2Y6TA 2PHBA 3R0FA 2BY9X 3D49H 2ODYB 2ZC9H 2VH0A 1EZSC 4FUGA 3RMMH 2QN5T 4AYYB 5AFZH 1GMDG 1O5CB 2HNTF 2V0BA 4FU8A 3V3MA 1AO5A 2ODQA 4ASHA 1W2KH 2HLCA 5FCRA 2WPIS 2FOGA 1D3TB 3TPIZ 2C8ZB 1P3EA 3U69H 1KLTA 1Z8GA 1V2TT 1GBTA 2VWNA 1EATA 2STBE 4I33A 3PMAB 1CSOE 3A86A 4UFEH 1MTUA 5T6DA 1NRSH 2QXIA 2SNWA 1MQ6A 1WQSA 3RU4E 2JETC 5EODA 1KDQB 5FBEA 1WSSH 1ZHPA 2P3FH 1BTXA 3P8GA 1EAXA 1SGNE 3TJUA 1GG6B 1EASA 1JBUH 4FUHA 4X1QU 3MOCA 3LJJA 3PMHB 4AN7A 2SGDE 3U1IB 1BRCE 2BDIA 3RXMA 2C93B 1FZZA 1LHDH 1LHCH 1QRWA 4LZ4B 1ZHRA 3TJNA 3RMNH 1GMHG 1OSSA 4XFQA 3ELAH 3SUFA 2B8OH 4X8VH 2ZPSA 1O3PB 2Y7ZA 1SR5C 1F92A 5EG4A 2FOBA 3U9AH 1E0FD 3RP2A 1GDNA 2G81E 2ZG0H 3GY7A 2BB4A 4AG1A 3C27B 4TWYA 1SVPA 1UK3A 3A85A 2OC1A 1KY9A 2J4IA 3LGYA 1UVPA 1KXBA 1C5OH 2QXJA 2ZFSA 3MTYA 4ZKSU 1SGCA 1OWJA 1QJ6B 1BJUA 4BTUB 3QZRA 4X8SH 1GHWH 1PQ7A 2YNBA 4YT6H 4Y8ZA 4O3TA 1ESTA 1LPKB 1ABJH 1TGTA 3GY8A 5LPEA 1MU6B 2ZIQH 1Y3WA 4Y76A 1ZGIA 1MKXK 1S83A 1EUFA 1VR1H 2FIRH 1RIWC 3E1XB 2BMGB 1C2LA 3E0NB 1YF4A 3RXSA 1P0SH 1ZMJA 3ODFA 2G5VA 1PPGE 3SU0A 1TGNA 2ODPA 3QGNB 3I29A 1SGTA 1AQ7A 4OGYA 2RCEA 2FTMA 1SLVB 3NWUA 4I8GA 4H6TA 1TPAE 5CMXH 4DY7B 1A0LA 3GICB 1ANCA 1C5VA 1WOFA 5A8XA 1O2IA 1FLEE 1GVZA 4LOYH 1C4U2 4UFDH 4D9RA 1TE0A 1UVUH 1O5FH 5C1YA 1C5SA 3KIDU 2VIDA 3KQBA 1O2ZA 2ZHQH 1S84A 1O3KA 1O33A 2GT8A 1AVWA 3E91A 3BTQE 5CE1A 5DP8A 3B8JA 1CT2E 1YBWA 4Y0YE 2ZFRH 1BBRK 1NFXA 4IMQA 2V3HH 4DURA 1KXFA 2ZI2H 1QBVH 4JZIA 3S7HB 1LQEA 1BHXB 1TYNA 2HPQH 1ID5H 1W14U 5DG6A 1HAPH 2ZU2A 4AZ2B 3GOVB 2KAIA 4GSOA 1AGJA 1N6XA 1WTHD 1G3CA 1V2PT 3LT3A 4ZH8A 4CR5A 1FI8A 3E0PB 1GHZA 4WY3A 2OC0A 1BHXF 3M37A 1MKWH 3OYPA 2EEKA 4THNH 3SGBE 3FAOA 3UWIA 4YZUA 1GBHA 3RUOA 2ESTE 4HTCH 3LPRA 1NN6A 3T2NA 1CBWC 5C20A 5SGAE 4E7NA 1O3BA 1OWHA 1OP2A 2Y82A 2W26A 4XDEA 2FYRA 2HPPH 3P8FA 3HKJB 1QQ4A 5DP4A 2BX3A 2ZP0H 5EOKA 1AVXA 2HRVA 3BF6H 4ESTE 1ETTH 1QB1A 1W13U 1GMCF 2RG3A 1YPMH 1OS8A 4AFSA 2BD3A 2NU2E 1Y3YA 1O2JA 3AAUA 2VWLA 5J4SA 3M3SA 2PKSC 1XX9A 4YOJA 3VB4A 1DUAA 2SFAA 4DJZB 3E90B 1LVMA 3M7TA 4MTBA 1HFDA 4UD9H 3T29A 1PPZA 1GL1A 1H8IH 2F9NA 2OINA 2PKAB 2VINA 3RMOH 4A7IB 4K3JA 4A1VA 1GWAA 1D4PB 5TCAA 3F9HA 3A7TA 1ZSLA 1RTFB 3A8DA 1UTPA 2OC8A 2XBWA 4H6SB 5EU8A 1QJ7B 1YPEH 4NZQA 1TNKA 2ZU1A 3ZVDA 3BIUH 1DLEA 1MMJN 2TRMA 2O9QA 1AUTC 2GZ7A 1FPHH 2PTCE 4AYVB 1EB1H 1PPCE 1ZLRA 1E34B 1BDAA 4H42U 1C5UA 2W7SA 1TRMA 4HI3A 5G4BA 1GCTC 8LPRA 4FU9A 3TNTA 2WPKS 3V0XA 5HXFA 3QX5H 3DA9B 4DG4A 3M5LA 1YPGH 5EPYA 2QV1A 1O2MA 5AHGH 1VITF 2BZAA 3B23B 3OTJE 4NIVA 8GCHG 1WCZA 1GI2A 6ESTA 4K1SA 3RC5A 2D1JA 4JZDH 1TFXA 2EI7A 4D7FA 2H5CA 4B76A 4OS6A 2F9VA 3A81A 1VCQA 1VJAU 1U6QA 3HATH 2STAE 1TA2A 3VB6A 6LPRA 3BEUA 4IN1A 3HGPA 1FY3A 1SFQB 1HRTH 3A89A 3STJA 1GHAF 5GDSH 1NRPH 5AF9H 1ORFA 3MH5A 1CHOF 1Z71A 1AE8H 4OS7A 1ARCA 3EQ0H 1F5RA 1K21H 1GGDC 2W5EA 4B71A 1D6RA 5HGGA 1EJNA 2QF3A 2R2MB 3M7QA 3LGUA 1P3CA 3E6PH 3EAJA 1O3DA 1SHYA 3SNEA 1P2OA 2W3KA 2UWOA 1L0ZA 1Y3VA 1MBMA 1M9UA 2WV4A 5IYTA 1QFKH 3Q3KA 1KSNA 3M5MA 1O5DH 1XUFA 2FP7B 3RLWH 1YCPK 3LGWA 1ELVA 1RIWB 2ZQ2A 3SU4A 3ZVFA 3O8RA 2SNVA 1T4VH 3RXKA 3SNAA 3RXDA 1IQJA 3QTVH 2VGCC 4JYTA 1FY8E 4A6LA 1K1LA 3V13A 2Z9IA 3SUGA 1O2TA 6GCHG 1BB0B 2FMJA 5T6FA 3BN9A 4JYVH 1HPGA 3TLOA 3F1SB 1DWEH 2FOHA 1TA6A 1HIAA 2QCYA 3KEEA 3RXQA 1A0JA 1O39A 1C1VH 1TQ0B 1S85A 3RM2H 1GHBG 1ZPBA 2ZGXH 3A8CA 1UVOA 1PPHE 1TMUH 2FO9A 3RXIA 1EPTB 4A1XA 1MBQA 1ESBA 1TGCA 2QGRA 1P05A 1C2DA 1C2GA 2CF9H 1HAIH 3M5OA 3O8CA 5GCHG 1QJ1B 2GZ8A 1O2OA 1A1RA 4HFPB 1SGYE 1GJDB 3FP7E 2VIWA 3SV8A 1ELEE 1SPJA 4BNRA 3MFJA 1SG8B 1MKXH 3SHCH 1Z8IB 2G00A 2BLVA 4A92A 3ENSB 4FUCA 2HGTH 4YO9A 1ZTLA 5TJXA 1ZPZA 5GWZA 3GISB 3P95A 2A31A 3FZDA 2ANKH 1G3EA 1Q2WA 3T27A 3A7ZA 3TITA 3PTBA 4DVAU 1QQUA 4WMDA 1XVOA 3BEIB 1P9UA 2O8WA 1KXDA 4IBLH 4ZUHA 1TONA 1NRNH 2FX6A 3EA9A 3ZV9A 1BTZA 3G01A 2FS9A 1TNLA 1W8BH 2CF8H 1TABE 4YESB 1GJ7B 3IWMA 3ATLA 2ZGBH 4ABIA 4Z0KA 2C90B 2PW8H 1ACBE 1DX5M 3EYDA 2A32A 2SGPE 3RXRA 4ZHLU 2H9EH 4TY6A 1MU8B 2ZCHP 3A83A 1SGQE 2F9UA 5T3HA 4Q7XA 4BXWA 1QL8A 4WXVA 1AWHB 1O3IA 3PM3A 5DO4H 1V2LT 1BA8B 1EZXC 4MNYA 4KTSA 1TIOA 1QCPA 3UQOA 4CREA 2PKSB 2BDHA 1ARBA 4WVPE 4OGXA 2A5KA 3GY3A 3UOPA 2Y5HA 2XW9A 2QF0A 2Z3CA 4ABEA 3PO1B 1XXDA 4WH8A 1HAGE 2BX4A 3VXEH 4KTUA 1ZRBA 2WYGA 1THSH 1BTUA 1Y3XA 1O2HA 5LH8A 4AB8A 3KQDA 1Y5AT 3BG8A 4AOQA 3MMGA 2VIVA 2ZKSA 4D8NA 4TPYA 5CHAC 1AZZA 1C1SA 1K1NA 1DWDH 3RXVA 3SHAH 2BY8X 3TJOA 4WMEA 4ABHA 3ZVGA 1ZTJA 3M35A 2ZFPH 4TPIZ 1OKXA 4K69A 3SUDA 1A7SA 1SGIB 1UJ1A 1G3DA 2ALPA 2J34A 2ZFFH 1C5ZB 5DP9A 5H4IB 1EKBB 1F5KU 2P16A 4GHTA 4IGDA 4Y79A 1O3LA 1CO7E 2Z7FE 1KXEA 3UWJH 4GHQA 2PGBB 4NIWA 2AS9A 2GKVE 3VB5A 4X2VA 3FP8E 1VITG 1ANEA 3GY5A 3RXFA 1F7ZA 3V7TA 3Q76A 4FUJA 1C2FA 4CBOA 2F9BH 2VVVA 3QUMP 2K1QA 1H1BA 1LTOA 3SU2A 4FUFA 4GCHG 4I7YH 3RXTA 4MPXA 4CRFA 1CA8B 2CXVA 3U98H 4ABJA 2RDLA 2NWNA 5E0JA 1PJPA 2DUCA 2FZZA 4X2YA 5GJ4B 4AFQA 2ZTZA 1GHAG 1NRRH 1IQHA 2IOTA 4O03A 1CHOG 1OOKB 2PUXB 3NUMA 2ILNA 4CHAB 3MU8A 1YPHE 1CGJE 1Z1JA 4IW4E 1AN1E 1Y8TA 2BY6X 2EA3A 3BTWE 3GDUA 3RU4D 1GGDB 1UTLM 4YT7H 1QY6A 1C1OA 1TPOA 4CR9A 2EI8A 2ANMH 5DP5A 5FPTA 5ABWA 1VCWA 2GX4A 1FN8A 5F6MA 2BZ6H 2QAAA 1YLDA 3P70B 3OX7U 1EXFA 2CGAA 1L2EA 2ZTYA 7GCHF 1C5RA 3U1JB 4OS2A 3BSQA 4J2YB 3P8OA 3ATKA 5FAHA 2FODA 2VB0A 1FPCH 3CP7A 1C2JA 4ABDA 4I8JA 1SGEE 1ZPCA 1OX1A 2TIOA 3F9EA 3SJIA 1OWDA 2Z9JA 4X6MA 3W94A 3GCOA 1EQ9A 4DGJA 1LKBA 3GCHC 2IPHA 8ESTE 2G55A 1GBKA 3F9FA 1MTVA 3S0NA 5EXLA 2IN2A 3WY8A 2UWLA 4IC6A 3QDZB 3RC6A 1UHBA 3NZIA 4XSKU 2BD4A 3ZVCA 1O2YA 1YYY1 3RDZA 4VGCB 1GBBA 1K1IA 3DFJA 2F9OA 4B1TA 8GCHF 4BTTB 1AD8H 3H7OA 4K2YA 2A2QH 3TK6A 2AMDA 2ZF0H 4MPVA 3JZ1B 1SB1H 1AUJA 1C1NA 1V6DA 1MTWA 3LKWA 2YNAA 3RXLA 1QHRB 2AGEX 1DPOA 1Z1IA 3ZZ6A 4HGCA 1LPGB 1YCPH 2ZDKA 1P2KA 1XUIA 7ESTE 2CJIA 2J92A 2BD8A 1FY1A 2H9HA 4JZ1A 2ZTXA 3SORA 4AG2A 3NPSA 1O37A 1P09A 2XCFA 3P92A 1YP9A 4AORA 4RSPA 1DVAH 1MH0A 1N8OC 2GMTB 2OBQA 3RXCA 2BDGA 5F8TA 3S7KB 3ODDA 1GBFA 3SI4H 4INHA 1L4DA 2GD4B 3TVJB 1NTPA 1G2MA 3QGJA 3A8AA 2GDEH 3EA7A 1AMHA 1C5TA 1HLTH 5F03A 1A3BH 2P3TB 5EGMA 2GT7A 2Z6BD 4X8TH 1GI9B 3IG6B 1C1QA 4J1YA 1AWFH 1KLIH 3N7OA 1SGRE 1Z8JB 6GCHF 1O2NA 1TX6A 1P01A 5EPNA 1LQDB 1MD7A 1P02A 1TX7A 2FYQA 3TH3H 2A2XH 1K1PA 1YKTA 2C8WB 1V2UT 2BVXH 1IQMA 2BHGA 1C9TA 1GHBF 3H7TA 1T32A 5JBCS 1W7XH 3HKIB 3TK5A 2A4GA 1A46H 3ESTA 2ZHDA 2AYWA 1TNJA 2GCTB 1IQKA 3LGTA 5JBAS 2OBOA 5GCHF 1A0HB 3OSYA 1QA0A 1RS0A 3DHKH 5CHAB 1C2KA 4ABFA 3A88A 3BTDE 3UOUA 3UUZA 4X0WU 2ZECA 3ZV8A 3SZNA 1GHXH 2VIPA 1QBOA 5BRRE 3Q3YA 5F8XA 1O3JA 1DXWA 1K1OA 1P06A 1VGCB 4X2XA 1QL7A 2O8LA 4WJG2 1V2MT 1UTNA 3FP6E 1UK2A 1RXPA 1XUKA 2FOMB 1F0UA 2HOBA 3SJOA 1KLJH 1HDTH 4I32A 4B2BA 1WU1A 1G36A 3AW0A 4GUXA 4RKJB 1DSUA 1QURH 2HALA 1PYTC 1UTQA 1QA7A 3AASA 6CHAC 1GJ6A 1ZR0A 1O3MA 1HCGA 1WV7H 1QNJA 4X1SU 3MNXA 1SLUB 2BVRH 1V2OT 3PROA 2V6NA 2BQWB 3QZQA 4ISLA 1NFUA 4NZLA 2AMQA 3KN2A 2G5NA 4IMZA 5DP6A 3RXAA 2CHAC 4F49A 1Z6EA 1BQYA 1FAXA 4PROA 1NT1A 3UY9A 4B2AA 2UUJB 2KAIB 2P59A 5I25A 2Q1JA 4CH8B 4D7GA 5L2ZH 4ISOA 2OCVB 4I8LA 1AZ8A 4X6OA 1FMGA 1G3BA 1K2I1 2J94A 5JYIA 3KQEA 1BTPA 3MNSA 2H9TH 1MZDA 4I8KA 1AFQC 4XBCA 1BZXE 1HYLA 1YPJH 3EDXB 2D26C 2AGIX 1OP0A 2GTBA 7GCHG 1LO6A 1HUTH 3URDA 3MI4A 3BTEE 3H5CB 1KYNA 2DE9A 3F68H 5E0GA 3RM0H 1SMFE 3MO9A 1S0QA 2O8TA 1C5MD 1SI5H 2CV3A 2ULLA 2LPRA 1V2JT 2QY0B 3GCHB 2P95A 1TRNA 2ZGCA 1XXFA 5ESTE 4X2WA 3VB3A 1G2LA 3FZZA 1JRSA 1WQVH 3TH4H 3ATIA 1TMBH 2JETB 1W0YH 1BTYA 1P2MA 4K8BA 2FI4E 1HAVA 1SFIA 1FV9A 1BTWA 3MU0A 1EP5A 1O30A 2VWMA 4R0IA 3TH2H 1SGDE 2VJ1A 2XRCA 4GCHF 2JH6D 1HBTH 2BLWA 1C1WH 3A87A 2FX4A 5FCKA 1P8VC 1OWKA 1O5GH 3GYMA 2XBYA 4E7RG 7KMEH 4DT7B 2ZGHA 1GVKB 4JMYA 2NU3E 1DDJA 4MNXA 1S6FA 2WV5A 3L33A 3VEQB 4U01A 2PGQB 4E05H 1YCPM 4MQAA 4CRBA 2VH6A 2TBSA 1TB6H 4NSYA 2W3IA 1MAYA 1NU9A 1UTKA 2XC5A 2RA3A 5DK1A 2BDYA 3FFGA 1D9IA 1XKBC 3BEFB 1V2NT 1HJAC 2QC2A 3UIRA 1P57B 4B75A 2G4UA 2TGTA 2PWXA 1O3CA 1BMLA 1C1PA 3E16B 4ZAEA 1LKAA 5EQSA 5DGJA 3SJ8A 1DS2E 1E38B 4GAWA 4AFZA 1SGFA 4B74A 2VVUA 1AFEH 2I6SA 2BXTH 2XNIA 2BDCA 1O2PA 5EXMA 3VGCC 1Y59T 1E35B 5I46H 1WAYB 3RXOA 1Y3UA 2HNTC 1MTNC 4FVBA 3KNXA 2AIPA 1DT2A 1MD8A 4K1TA 4BANB 1HJ8A 1F0SA 1Y5UT 1H9IE 1O5EH 1QR3E 2BXUH 2XCNA 5K0HA 4Q7YA 3ZVBA 1SQAA 3KQCA 4CRGA 1IQEA 1DE7H 4I31A 3A80A 4GVUA 1O2GH 1C5NH 1EAWA 1OYQA 1PQ5A 2Y5FA 2GDDA 2ZHEH 3UR9A 4KKDA 1ZTKA 1AIXH 3BIVH 2WUBA 4Q2KA 1LVOA 2FTLE 4X1RU 3RXJA 1EX3A 2ZFQH 1NZQH 4WMFA 1BITA 3D23A 4TYDA 4Y7AA 1ELAA 4ZKOU 3BTME 1AKSA 5EW2H 4NWKA 2BY7X 1DICA 1T8MA 1UTJA 1HIAB 2FLBH 5C1XA 1HXEH 1TBRH 2ZDMA 3GCNA 1S82A 1C9PA 1GG6C 1P2JA 3SJ9A 3ZVAA 3AAVA 3ZZ8A 1ELDE 2WPMS 4INKA 4ABGA 1HAZB 3LH1A 1THPB 2J2UA 4OS1A 2HNTE 1T4UH 2XTTB 1HXFH 1O5AB 1IOEA 1W7GH 5ETXA 1CBWB 1YM0A 5A8YA 1FN6A 1SOTA 4MNWA 1O2UA 1C2IA 4U30A 7LPRA 2OUAA 3T5FH 3KHVA 2OQUA 2B0FA 3MH4A 1RJXB 1L4ZA 2UUFB 1NM6A 1S6HA 1SL3A 3C1KA 3O8BA 1SBWA 1OWEA 2J95A 3TU7H 3URCA 3OY5U 2ZU5A 1PPFE 1UCYE 2C3SA 4SGAE 4B73A 1MAXA 2SGEE 5HM9A 5A0AE 3CS0A 4BXSA 1HAHH 4D9QA 4K8YA 1RTLA 1DY8A 2C4FH 1EP6A 1J15A 1TGSZ 4WXIA 1O3OA 3UNSA 2OLGA 4YOGA 2IJOB 1AFQB 3SV2H 2GCHG 1TBQH 2GZ9A 3ZZ3A 1F2SE 2FOCA 4NG9H 5E2PA 4UONA 5GXPA 2AFQB 1W11U 2XBXA 4CH2B 2HVXA 5FHTA 1MUEB 3UREA 1OXGA 1T8OA 1YPHC 1NRQH 2XXLA 1ETRH 3RXHA 3D62A 3SGAE 4U2WA 2WPHS 5L6NH 5FBIA 4K60A 2WUCA 1CT4E 2ZZUH 2ZGJA 1E36B 1QTFA 1P03A 4ZKRU 3A7WA 1GBMA 4ZHMU 2YOLA 1O38A 1UTMA 3PV4A 1NY22 1GCTB 1ZZZA 3I78A 1TOMH 1XUHA 2PFEA 1NPMA 1SLXB 2ZHFH 1XKAC 3UNRA 3SGQE 4ZKNU 2UUYA 3SV9A 3UNQA 1BUIA 4ZROA 2AEIH 2UWPA 3S9CA 1JRTA 2ZCKP 1GI7B 2PUQH 1AHTH 1C2EA 2P93A 1GBJA 1GDQA 5JB9S 1UK4A 1GI8B 3CS7A 1AB9C 1F0RA 2ZCLP 4KELA 3RXGA 3ZZAA 1THRH 5K7RA 1LHFH 1O32A 4LK4A 3KL6A 1ZRKA 2BDBA 4E06H 5F8ZA 1JOUB 3MHWU 1QL9A 3GDSA 3PMJA 2BLOA 1LCYA 2PLXA 5E8EH 1IHSH 1O2KA 2Z94A 1GBDA 2O8UA 3P8NA 4WWYA 4ZXYH 3UPEA 4FU7A 3T28A 1C4V2 1N1LA 3FVFB 3MO6A 1FY4A 3K65B 3GYLB 4GPGA 2H6MA 1GI4A 4H4FA 1NESE 2ZFTA 3LH3A 1S0RA 3SBKA 1P04A 3VXFH 3PTNA 1BMMH 3NK8A 4FUDA 1HJAB 1P2QA 4BAKB 1TNGA 1C2HA 3ATMA 2VVCA 1H9HE 5A8ZA 3OU0A 2SGFE 4UDWH 1C1MA 4NFFA 4X1PU 1CGHA 5C1UA 1GI1A 2ZO3H 4IS5A 4JCNA 1HJ9A 1UVTH 1OP8A 3VGCB 4FUBA 4TWWA 2VGCB 4Y71A 2JH0D 3W95A 4AGKA 3QLPH 1J14A 1MTNB 3UFAA 2F9PA 1VCPA 1TAWA 3D65E 1FNIA 4WF8A 3SNCA 1XUJA 4I8HA 1KDQA 1O2WA 4MPWA 4RKOB 1BOQA 5EQQA 1T8LA 3EGKH 1DFPA 2A7HA 2FDAA 2Y81A 1O3NA 2PTNA 1QIXB 4MNVA 2BLQA 2BD9A 1T31A 1BMAA 1H8DH 2XWAA 5HYOA 2Y80A 1GJCB 2OQ5A 1NS3A 5HMAA 3KF2A 3AW1A 1ZSJA 5JDUB 2NU1E 2OD3B 3MNCA 4NFEA 1FIWA 3GY6A 1TX8A 3MU4A 5C3NA 3GCTG 1ABIH 5PTPA 1O2LA 1ZYOA 1G30B 1G32B 2Z3EA 5B6OA 2WPLS 1EZQA 1SGFG 5A0CA 3BTHE 4YLQH 1TMTH 5HM2A 3GDVA 2QYIA 1EOLA 1HGTH 3MNBA 5AVDA 5A2MH 1FDPA 1PQ8A 4Y0ZE 2VNTA 2PSXA 1KTTB 1B0FA 2WYJA 1UHBB 2ZHWH 3HK6B 1IQGA 4X1NU 4R8TB 4O97A 3PWBA 3STIA 1DLKB 1XM1A 2ZA5A 3SO3A 4YTAA 1A5IA 3BTFE 4TY7A 1WTGH 2FOEA 3SOSA 1Q31A 2FXRA 3Q3XA 4MG3A 5GIBA 2XC0A 3LOXA 3TJVA 1FAKH 1G9IE 1SLWB 9ESTA 2H1UA 1V3XA 1GDUA 2PV9B 1GHVH 3VB7A 2JH5D 4DW2U 1YLCA 2Z9LA 4X8UH 1PQAA 1KXAA 3DD2H 1NO9H 4HZHA 4INLA 4ZXXH 4YM9A 5FX6A 3LGVA 1A3EH 1C5QA 1YGCH 1ZHMA 1OYTH 2BVSH 3ZZBA 1O3GA 1FQ3A 2VIQA 1HNEE 2A45B 2Y7XA 2SGAA 4FUEA 3MU5A 1D3DB 1O34A 2HWLB 1IQFA 4BAMB 3MWIU 3PB1E 3MH6A 3K6YA 2BD2A 5E0HA 1AVGH 1GJ4H 1J17T 2R3UA 4ABBA 3LU9B 1OWIA 5T6GA 5EW1H 1SOZA 3RLYH 1W0ZU 1C1TA 4AGJA 1A2CH 2F91A 3SN8A 2BOHB 2VU8E 1J8AA 1ESAA 4QT8C 1MQ5A 1TNHA 1ZOMA 1EB2A 1LHEH 1H4WA 4UFGH 4ABAA 2H5DA 1EPTC 1HAXB 1C5YB 3EA8A 2D8WA 2EC9H 1PPEE 3A84A 1DANH 2ZQ1A 1O31A 1YC0A 1DWCH 5EXNA 1S81A 4CBNA 2A4QA 3SU5A 1CU1A 5JBBS 3RU4T 3DFLA 1W12U 2A5IA 2FPZA 2UUKB 1DSTA 1VJ9U 2TGAA 3SW2B 2A7CA 1BRBE 3MYWA 1O2SA 1EOJA 1GJ9B 1TWXB 1LHGH 3L3TA 2R2WU 2G8TA 1AB9B 1O35A 2JKHA 1EAIA 1PYTD 3SNBA 4JZEH 2AERH 4X6PA 1SSXA 2BQ6B 3F9GA 3M3TA 4XBBA 5AFYH 4Y10E 2DE8A 1HV7A 4NA9H 4A5TS 2P8OC 1A5HA 4NA7A 1P12E 3Q77A 3F6UH 1J9CH 2V3OH 8KME2 2PKAA 1DOJA 1O3AA 1F5LA 1GPZA 1DXPA 1QBNA 4Z6AH 2AMPA 1V2VT 2GV7A 1TALA 1FXYA 2SGQE 4Y6DA 1K1JA 1XUGA 1RGQA 1CQQA 1A5GH 1BJVA 2NU0E 2QXHA 5FPSA 1UTOA 1GI3A 2H2ZA 3DUXH 2ZDLA 1ANBA 1C1UH 1W3CA 2ZPQA 4O3UA 1EZUC 2GCHF 2ZU4A 1D6WA 1B0EA 5LPFA 2FOFA 3KGPA 1HB0B 1VITH 3MO3A 5J4QA 2QIQA 3ITIA 3SUEA 3U8OH 1C5PA 2PR3A 2R3YA 4IN2A 2ALVA 2J38A 5C67A 1CA0C 2BQ7B 1ZSKA 2FI3E 3GY4A 2A4RA 1JIMA 2GVFA 1UMAH 3SU6A 5DKMA 1V2KT 2LNCA 3U8RH 1FUJA 3SQEE 2FOAA 2AH4X 4NIYA 1V2WT 3U8TH 1P9SA 2ZEBA 2THFB 1OPHB 3PO1C 3SU1A 4BAOB 1LVBA 3LIWA 2BOKA 1ELTA 1GJ5H 1SHHB 4K1EA 5IDKA 3ZZ4A 1UCYK 3E8LA 2A5AA 1BRAA 1BTHH 4ISIH 2Q6FA 1UO6A 2O8MA 1Z8RA 5FPYA 1G37A 1L1GA 2QA9E 1QRZA 1RTKA 1C4Y2 4ZHAA 3LC3A 2BM2A 3BTKE 1GJBB 1ELGA 4NIXA 1GBCA 1HAOH 3LJOA 2G52A 3OY6U 1ZGVA 3ZZCA 1QGFA 2CMYA 4KP0A 4OS4A 2B9LA 2CN0H 4NCYA 4BTIB 1T8NA 3SU3A 2QXGA 3SI3H 3BV9B 1C5XB 4M7GA 3HK3B 5A0BA 3T25A 1O3EA 1O3HA 1TLDA 1GBAA 3QTOH 1GBLA 1N8OB 3LONA 1ZJKA 4KTCA 3EE0B 1QB6A 1H9LB 1V2ST 4UFFH 1ZMNA 1KXCA 2F83A 1FONA 3I77A 3M7UA 3CENA 1O2QA 4CRCA 1SQTA 1HAVB 2ZDAH 4B2CA 1NFYA 1XVMA 3NXPA 4MLFB 1K28D 2G51A 3IITA 2B5TB 2XC4A 2VWOA 1TGBA 5GPIB 1TBZH 1JMOH 3ZYEA 1CHGA 1GBEA 4UE7H 1D3QB 5L30H 4SGBE 2XYAA 4CHAC 2C8YB 9LPRA 3BTTE 3ATWA 2ZDNA 1P2IA 1DITH 4BAQB 5EQRA 3BG4C 4WH6A 3QO6A 3UR6A 1ELBA 5BPEA 1F0TA 3RXPA 4CRAA 1ZJDA 1P2NA 3A82A 5DP7A 1QB9A 3K9XB 3HGNA 1RRKA 4MVNA 1YPLH 1BBRE 2NU4E 1EPTA 3M36A 1LMWB 1GMDF 3LGIA 2OC7A 2F3CE 3UQVA 2BYAX 1RFNA 3KCGH 3ZZDA 1EJMA 1NC6A 2ZNKH 3SV7A 3PLBA 2G4TA 3A8BA 2XBVA 1L1JA 1ZMLA 2BD7A 1E37B 4IC5A 1S5SA 2B7DH 4JK6A 5FXLA 4XE4A 4JZFH 1IQIA 1C5WB 1Y5BT 3VFEA 2TPIZ 4JYUH 3ZVEA 1TPPA 2P3UB 4D76A 1GL0E 3PWCA 3RXBA 3PLPA 4CRDA 1ETSH 3GCTF 5FX5A 1GI6A 1N6YA 1RD3B 3MU1A 1O0DH 3R3GB 3M3VA 3NKKA 2A7JA 3S9AA 5LPRA 3P17H 1O5BB 2ASUB 1WYKA 3PLKA 4LXBH 1CE5A 1CT0E 2EI6A 1WUNH 3UTUH 2C8XB
chains in the Genus database with same CATH superfamily
3E3TA 1GHYH 3WWBA 1DY9A 2W7UA 3F2FA 4VGCC 3QK1A 2GV6A 4FETA 3K6ZA 1D3PB 1INCA 1GI5A 3SQHE 1Q3XA 5DJ7A 2A4OA 2WPJS 2AIQA 4LZ1H 1NFWA 3FO8D 1FY5A 3KYGA 4UEHH 4X6NA 3DCLA 3A7VA 2Q6GA 2Y5GA 1SQRA 1GMHF 1EJAA 3M61U 6CHAB 4FUIA 3UB0A 4NA8A 3RXEA 2M5TA 3JZ2B 1SC8U 1AY6H 4FVDA 3TK9A 1PFXC 1GI0A 4OS5A 1DWBH 4YLUA 1ANDA 1BT7A 2GMTC 2D2DA 4KGAA 4DIIH 1T7CA 1Z7KA 2CHAB 2GP9B 1TQ7B 2P8OB 1IQNA 1AKSB 4GLYA 3LDXH 4A1TA 3B9FH 3DT0H 2ANYA 3TNSA 3V12A 3QN7A 4Q7ZA 3PMBB 2ZU3A 3SV6A 4AFUA 1C5LH 1IHTH 3ZYDA 2XWBI 5TCCA 4AB9A 3ZZ7A 1P11E 4U32A 3VPKA 1C1RA 2Z3DA 1A61H 3M5NA 5LGOA 2A0QB 2BD5A 1DM4B 1FJSA 1IQLA 1K0HA 2ZPRA 3PV5A 1AU8A 3A7XA 4Y8YA 1O3FA 2R9PA 4MDSA 5JB8S 2OXSA 2AGGX 1BBRH 1V2RT 1GMCG 4O9VA 1P10A 1TNIA 1TRYA 2HLDD 4MPUA 5E2OA 4DCDA 4ISHH 1B7XB 4Q80A 1K22H 1CA0B 2VIOA 2FESH 3AVZA 5C5NA 5F53A 2Z9KA 2FWWA 3GY2A 1MKWK 1SQOA 4XBDA 3S69A 1QRXA 4Y8XA 1TPSA 2P94A 2PP6A 1JWTA 3P6ZB 4ZCNA 3QWCH 2FS8A 1VZQH 1MTSA 2TGPZ 1LVYA 4Y11E 1DUEA 4AX9H 1SGPE 2WINI 2R0KA 1ELFA 3L6PA 1O2RA 4FXGH 3SNDA 5JPMH 1AE5A 3FANA 3O8DA 3TGKE 3T62A 1BIOA 2PSYA 3RC4A 3NCLA 2K8IA 1A4WH 1CGIE 2GCTC 4NWLA 2OP9A 5DPAA 1UVSH 1JXPA 1PPBH 3CNRA 1J16A 1BRUP 2V35A 3RXUA 2A1DB 3Q00A 1TOCB 2OTVA 1LPZB 1O2XA 5C2ZA 1W10U 3A7YA 5L2YH 3ZZ5A 4NSVA 1C2MA 1V2QT 2FI5E 3H09A 4XOJA 5ESBA 1VGCC 2BDAA 2XNDD 1HAYB 3BTGE 1JIRA 1O36A 2KCPA 3K2UA 3TGJE 1MZAA 3N99A 1NU7B 3TIUA 1XMNB 2R0LA 4NGAH 1K1MA 1FX0B 3LC5A 1BCUH 2RA0A 1O2VA 3HPTB 1KIGH 1GJ8B 1EAUA 1NROH 4K5ZA 1GJAB 5JBTA 4M9FA 3PYHA 1GCDA 4BOHA 4DIHH 1L1NA 3SJKA 2BTCE 2Q6DA 1K9OE 4F4OC 3TGIE 1KTSB 4RN6A 1W0KD 2BY5X 5IK2D 2J9NA 1UCYH 1MCTA 1Z6JH 1IAUA 1GVLA 2TGDA 2GGVB 4ISNA 4Y7BA 4YOIA 2ZWLH 3T26A 1YPKH 1MCVA 1GBIA 5A09A 2FEQH 1LDTT 1X7AC 2FM2A 1WBGB 4JK5A 2Z9GA 1CVWH 3MH7A 1BMNH 4BAHB 3ZZ9A 2FLRH 1ELCA 2JIZD 3RMLH 3BG4B 2YMSB 5DP3A 1B5GH 2ZDVH 1FIZA 4DOQA 5C5OA 4ZMAH 3S9BA 1AI8H 2I6QA 2ANWA 2Y6TA 2PHBA 3R0FA 2BY9X 3D49H 2ODYB 2ZC9H 2VH0A 4HG6A 1EZSC 4FUGA 3RMMH 2QN5T 4AYYB 5AFZH 1GMDG 1O5CB 2HNTF 2V0BA 4FU8A 3V3MA 1AO5A 2ODQA 4ASHA 1W2KH 2HLCA 5FCRA 2WPIS 2FOGA 1D3TB 3TPIZ 2C8ZB 1P3EA 3U69H 1KLTA 3OAAD 1Z8GA 1V2TT 1GBTA 2VWNA 1EATA 2STBE 4I33A 3PMAB 1CSOE 3A86A 4UFEH 3F2GA 3OEED 1MTUA 5T6DA 1NRSH 2QXIA 2SNWA 1MQ6A 1WQSA 3RU4E 2JETC 5EODA 1KDQB 5FBEA 1WSSH 1ZHPA 2P3FH 1BTXA 3P8GA 1EAXA 1SGNE 3TJUA 1GG6B 1EASA 1JBUH 4FUHA 4X1QU 3MOCA 3LJJA 3PMHB 4AN7A 2SGDE 3U1IB 1H8HD 1BRCE 2BDIA 3RXMA 2C93B 1FZZA 1LHDH 1LHCH 1QRWA 3AK5A 4LZ4B 1ZHRA 3TJNA 3RMNH 2AHME 1GMHG 1OSSA 4XFQA 3ELAH 3SUFA 2B8OH 4X8VH 2ZPSA 1O3PB 2Y7ZA 1SR5C 1F92A 5EG4A 2FOBA 3U9AH 1E0FD 3RP2A 1GDNA 2G81E 2ZG0H 3GY7A 2BB4A 4AG1A 3C27B 4TWYA 1SVPA 1UK3A 3A85A 2OC1A 1KY9A 2J4IA 3LGYA 1UVPA 1KXBA 1C5OH 2QXJA 2ZFSA 3MTYA 4ZKSU 1SGCA 1OWJA 1QJ6B 1BJUA 4BTUB 3QZRA 4X8SH 1GHWH 1PQ7A 2YNBA 3VG8A 4YT6H 4Y8ZA 4O3TA 1ESTA 1LPKB 1ABJH 1TGTA 1YY3A 3GY8A 5LPEA 1MU6B 2ZIQH 1Y3WA 4Y76A 1ZGIA 1MKXK 1S83A 1EUFA 1VR1H 2FIRH 1RIWC 3E1XB 2BMGB 1C2LA 3E0NB 5B6LA 1YF4A 3RXSA 1P0SH 1ZMJA 3ODFA 2G5VA 1PPGE 3SU0A 1TGNA 2ODPA 3QGNB 3I29A 1SGTA 1AQ7A 4OGYA 2RCEA 2FTMA 1SLVB 3NWUA 4I8GA 4TSFD 4H6TA 1VKYA 1TPAE 5CMXH 4DY7B 3DSOA 1A0LA 3GICB 1ANCA 1C5VA 1WOFA 5A8XA 3OE7D 1O2IA 1FLEE 1GVZA 4LOYH 1C4U2 5HIZA 4UFDH 4D9RA 1TE0A 1UVUH 2KZ4A 1O5FH 5C1YA 1C5SA 3KIDU 2VIDA 4XRNA 3KQBA 1O2ZA 4B6FA 2ZHQH 1S84A 1O3KA 1O33A 2GT8A 1AVWA 3E91A 3BTQE 5CE1A 5DP8A 3B8JA 1CT2E 2LP6A 1YBWA 4Y0YE 2ZFRH 1BBRK 1NFXA 4IMQA 2KX4A 2V3HH 4DURA 1KXFA 2ZI2H 1QBVH 4JZIA 3S7HB 1LQEA 1BHXB 1TYNA 2HPQH 1ID5H 1W14U 5DG6A 1HAPH 2ZU2A 4AZ2B 3GOVB 2KAIA 4GSOA 1AGJA 1N6XA 1WTHD 1G3CA 1V2PT 3LT3A 4ZH8A 4CR5A 1FI8A 3E0PB 1GHZA 4WY3A 2OC0A 1BHXF 2J98B 3M37A 1MKWH 3OYPA 3SYJA 2EEKA 4THNH 3SGBE 3FAOA 3UWIA 4YZUA 1GBHA 3RUOA 2ESTE 4HTCH 3LPRA 1NN6A 5HIYA 3T2NA 1CBWC 5C20A 5SGAE 4E7NA 1O3BA 1OWHA 1OP2A 2Y82A 2W26A 4XDEA 2FYRA 2HPPH 3P8FA 3HKJB 1QQ4A 5DP4A 2BX3A 2ZP0H 5EOKA 1AVXA 2HRVA 3BF6H 4ESTE 1ETTH 1NBMD 1QB1A 1W13U 1GMCF 2RG3A 1YPMH 4B6EA 1OS8A 4AFSA 2BD3A 2NU2E 1Y3YA 1O2JA 3AAUA 3GS9A 2VWLA 5J4SA 3M3SA 2PKSC 1XX9A 4YOJA 3VB4A 1DUAA 2SFAA 4DJZB 3E90B 1LVMA 3M7TA 4MTBA 1HFDA 4UD9H 3T29A 1PPZA 1GL1A 1H8IH 2F9NA 2OINA 2PKAB 2VINA 3RMOH 4A7IB 4K3JA 4A1VA 1GWAA 1D4PB 5TCAA 3F9HA 3A7TA 1ZSLA 1RTFB 3A8DA 1UTPA 2OC8A 2XBWA 4H6SB 5EU8A 1QJ7B 1YPEH 4NZQA 1TNKA 2ZU1A 3ZVDA 3BIUH 1DLEA 1MMJN 2TRMA 2O9QA 1AUTC 2GZ7A 1FPHH 2PTCE 4AYVB 1EB1H 1PPCE 1ZLRA 5EJLA 1E34B 1BDAA 4H42U 1C5UA 2W7SA 1TRMA 4HI3A 5G4BA 1GCTC 8LPRA 4FU9A 3TNTA 2WPKS 3V0XA 5HXFA 3QX5H 3DA9B 4DG4A 3M5LA 1YPGH 5EPYA 2KFWA 2QV1A 1H8ED 1O2MA 5AHGH 1VITF 1W0JD 2BZAA 3B23B 3OTJE 4NIVA 8GCHG 1WCZA 1GI2A 6ESTA 4K1SA 3RC5A 2D1JA 4JZDH 1TFXA 2L74A 2EI7A 3OTPA 2H5CA 4D7FA 4B76A 4OS6A 2F9VA 3A81A 1VCQA 1VJAU 1U6QA 3HATH 2STAE 1TA2A 3VB6A 6LPRA 3BEUA 4IN1A 3HGPA 1FY3A 1SFQB 1HRTH 3A89A 2OK5A 3STJA 1GHAF 5GDSH 1NRPH 5AF9H 1ORFA 3MH5A 1CHOF 1Z71A 1AE8H 4OS7A 1ARCA 3EQ0H 1F5RA 1K21H 1GGDC 2W5EA 4B71A 1D6RA 5HGGA 1EJNA 2QF3A 2R2MB 3M7QA 3LGUA 1P3CA 3E6PH 3EAJA 1O3DA 1SHYA 3SNEA 1P2OA 2W3KA 2UWOA 1L0ZA 2W6ID 1Y3VA 1MBMA 1M9UA 2WV4A 5IYTA 1QFKH 3Q3KA 1KSNA 3M5MA 1O5DH 1XUFA 2FP7B 3RLWH 1YCPK 3LGWA 1ELVA 1RIWB 2ZQ2A 3SU4A 3ZVFA 3O8RA 2SNVA 1T4VH 2WHXA 3RXKA 3SNAA 3RXDA 1IQJA 3QTVH 5EJ1A 2VGCC 4Q63A 4JYTA 1FY8E 4A6LA 1K1LA 3V13A 2Z9IA 3SUGA 1O2TA 6GCHG 1BB0B 2FMJA 5T6FA 2JJ2D 3BN9A 4JYVH 1HPGA 3TLOA 3F1SB 1DWEH 2FOHA 1TA6A 1HIAA 2QCYA 3KEEA 4TT3D 3RXQA 1A0JA 1O39A 1C1VH 1TQ0B 1S85A 3RM2H 1GHBG 1ZPBA 2ZGXH 3A8CA 1UVOA 1PPHE 1TMUH 2FO9A 3RXIA 1EPTB 4A1XA 1MBQA 1ESBA 2F43B 1TGCA 2QGRA 1P05A 1C2DA 1C2GA 2CF9H 1HAIH 3M5OA 3O8CA 5GCHG 1QJ1B 2GZ8A 1O2OA 1A1RA 4HFPB 1SGYE 1GJDB 3FP7E 1UW7A 2VIWA 3SV8A 1ELEE 1SPJA 4BNRA 3MFJA 1SG8B 1MKXH 3SHCH 1Z8IB 2G00A 2BLVA 4A92A 3ENSB 4FUCA 2HGTH 4YO9A 1ZTLA 5TJXA 1ZPZA 5GWZA 3GISB 2WZQA 3P95A 2A31A 3FZDA 3MQKC 2ANKH 1G3EA 1Q2WA 3T27A 3A7ZA 2WSSD 3TITA 3PTBA 4DVAU 1QQUA 4WMDA 1XVOA 3BEIB 1P9UA 2O8WA 3U28C 1KXDA 4IBLH 4ZUHA 1TONA 1NRNH 2FX6A 3EA9A 4AC9A 3ZV9A 1BTZA 3G01A 2FS9A 1TNLA 3W1EA 1W8BH 2CF8H 1TABE 5EJZA 4YESB 1GJ7B 3IWMA 3ATLA 2ZGBH 4ABIA 4Z0KA 2C90B 2PW8H 1ACBE 1DX5M 3EYDA 2A32A 2SGPE 3RXRA 4ZHLU 2H9EH 4TY6A 1MU8B 2ZCHP 3A83A 1SGQE 2F9UA 5T3HA 4Q7XA 4BXWA 1QL8A 4WXVA 1AWHB 1O3IA 3PM3A 5DO4H 1V2LT 1BA8B 1EZXC 3F3BA 4MNYA 4KTSA 1TIOA 1QCPA 4RI0A 3UQOA 4CREA 2PKSB 2BDHA 1ARBA 4WVPE 4OGXA 2A5KA 2W6JD 4RT0A 3GY3A 3UOPA 2Y5HA 2XW9A 2QF0A 2Z3CA 4ABEA 3PO1B 1XXDA 4WH8A 1HAGE 2BX4A 3VXEH 4KTUA 1ZRBA 2WYGA 1THSH 1BTUA 1Y3XA 1O2HA 5LH8A 4AB8A 3KQDA 1Y5AT 3BG8A 4AOQA 3MMGA 2VIVA 2ZKSA 4D8NA 4TPYA 5CHAC 1AZZA 1C1SA 1K1NA 1DWDH 3RXVA 3SHAH 2BY8X 3TJOA 4WMEA 4ABHA 3ZVGA 1ZTJA 3M35A 2ZFPH 4TPIZ 1OKXA 4K69A 3SUDA 1A7SA 1SGIB 1UJ1A 1G3DA 2ALPA 1E1QD 2J34A 2ZFFH 1C5ZB 5DP9A 5H4IB 1EKBB 1F5KU 2P16A 4GHTA 4IGDA 4Y79A 1O3LA 1CO7E 2Z7FE 1KXEA 3UWJH 4GHQA 1WDIA 2PGBB 4NIWA 2AS9A 2GKVE 3VB5A 4X2VA 3FP8E 1VITG 1ANEA 3GY5A 3RXFA 1F7ZA 4P02A 3V7TA 3Q76A 4FUJA 1C2FA 4CBOA 2F9BH 2VVVA 3QUMP 2K1QA 1H1BA 1LTOA 3SU2A 4FUFA 4GCHG 4I7YH 3RXTA 4MPXA 4CRFA 1CA8B 2CXVA 3U98H 4ABJA 2RDLA 2NWNA 5E0JA 1PJPA 2DUCA 2FZZA 4X2YA 5GJ4B 4AFQA 2ZTZA 1GHAG 1NRRH 1IQHA 2IOTA 4O03A 1CHOG 1OOKB 2PUXB 3NUMA 2ILNA 4CHAB 3MU8A 1YPHE 1CGJE 1Z1JA 4IW4E 1AN1E 1Y8TA 2BY6X 2EA3A 3BTWE 3GDUA 3RU4D 1GGDB 1UTLM 4YT7H 1QY6A 1C1OA 1TPOA 1YWUA 5GNDA 4CR9A 2EI8A 2ANMH 2QF4A 2LELA 5DP5A 5FPTA 5ABWA 5CHBA 1VCWA 2GX4A 1FN8A 2QE7D 5F6MA 2BZ6H 2QAAA 1YLDA 3P70B 3OX7U 1EXFA 2CGAA 1L2EA 2ZTYA 7GCHF 1C5RA 3U1JB 4OS2A 3BSQA 4J2YB 3P8OA 3ATKA 5FAHA 2FODA 2VB0A 1FPCH 3CP7A 1C2JA 4ABDA 4I8JA 1SGEE 1ZPCA 1OX1A 2TIOA 3F9EA 3SJIA 1OWDA 2Z9JA 4X6MA 3W94A 3GCOA 1EQ9A 4DGJA 1LKBA 3GCHC 5DSFA 2IPHA 8ESTE 2G55A 1GBKA 3F9FA 1MTVA 3S0NA 5EXLA 2IN2A 3WY8A 2UWLA 4IC6A 3QDZB 3RC6A 1UHBA 3NZIA 4XSKU 2BD4A 3ZVCA 1O2YA 1YYY1 3RDZA 4VGCB 1GBBA 1K1IA 3DFJA 2F9OA 4B1TA 8GCHF 4BTTB 1AD8H 3H7OA 1COWD 4K2YA 2A2QH 3TK6A 2AMDA 2ZF0H 4MPVA 3JZ1B 1SB1H 1AUJA 1C1NA 1V6DA 1MTWA 3LKWA 2YNAA 3RXLA 1QHRB 2AGEX 1DPOA 1Z1IA 3ZZ6A 4HGCA 1LPGB 1YCPH 2ZDKA 1P2KA 1XUIA 7ESTE 2CJIA 2J92A 2BD8A 1FY1A 2H9HA 4JZ1A 2ZTXA 3SORA 4AG2A 3NPSA 1O37A 1P09A 2XCFA 3P92A 1YP9A 4AORA 4RSPA 1DVAH 1MH0A 3PRBA 1N8OC 2GMTB 2OBQA 1YLNA 3RXCA 2BDGA 5F8TA 3S7KB 3F0OA 3ODDA 2RFKC 1GBFA 3SI4H 4INHA 1L4DA 2GD4B 3TVJB 1NTPA 1G2MA 3QGJA 3A8AA 2GDEH 3EA7A 1AMHA 1C5TA 1HLTH 5F03A 1A3BH 2P3TB 5EGMA 2GT7A 2Z6BD 4X8TH 1GI9B 3IG6B 1C1QA 4J1YA 1AWFH 1KLIH 3N7OA 1SGRE 1Z8JB 6GCHF 5CDFE 1O2NA 1TX6A 1P01A 5EPNA 1LQDB 1MD7A 1P02A 1TX7A 2FYQA 3TH3H 2A2XH 1K1PA 1YKTA 2C8WB 1V2UT 2BVXH 1IQMA 3UAIC 2BHGA 1C9TA 1GHBF 3H7TA 1T32A 5JBCS 1W7XH 3HKIB 3TK5A 2A4GA 1A46H 3ESTA 2ZHDA 2AYWA 1TNJA 2GCTB 1IQKA 3LGTA 5JBAS 2OBOA 5GCHF 1A0HB 3OSYA 3SZEA 1QA0A 1RS0A 3DSGA 3DHKH 5CHAB 1C2KA 4ABFA 3A88A 3BTDE 3UOUA 3UUZA 4X0WU 2ZECA 3ZV8A 3SZNA 5C94A 1GHXH 2VIPA 1QBOA 2F4LA 5BRRE 3Q3YA 5F8XA 1O3JA 1DXWA 1K1OA 1P06A 1VGCB 4X2XA 1QL7A 2O8LA 4WJG2 1V2MT 1UTNA 3FP6E 1UK2A 4F48B 1RXPA 1XUKA 2FOMB 1F0UA 2HOBA 3SJOA 1KLJH 1HDTH 4I32A 4B2BA 1WU1A 1G36A 3AW0A 4GUXA 4RKJB 1DSUA 1QURH 2HALA 1PYTC 1UTQA 1QA7A 3AASA 6CHAC 1GJ6A 1ZR0A 1O3MA 1HCGA 1WV7H 1QNJA 4X1SU 3MNXA 1SLUB 2BVRH 1V2OT 3PROA 2V6NA 2BQWB 3QZQA 4ISLA 1NFUA 5C17A 4NZLA 2AMQA 3KN2A 2G5NA 4IMZA 5DP6A 3RXAA 2CHAC 4F49A 1Z6EA 1BQYA 1FAXA 4PROA 1NT1A 3UY9A 4B2AA 2UUJB 2V3MA 2KAIB 2P59A 2JDID 5I25A 2Q1JA 4CH8B 4D7GA 5EIYA 5L2ZH 4ISOA 2OCVB 4I8LA 1AZ8A 4X6OA 1FMGA 1G3BA 5DN6D 1K2I1 2J94A 5JYIA 3KQEA 1BTPA 3MNSA 4OM9A 2H9TH 1MZDA 4I8KA 1AFQC 4XBCA 1BZXE 1HYLA 1YPJH 3EDXB 2D26C 2AGIX 1OP0A 3FKSD 2GTBA 7GCHG 1LO6A 1HUTH 3URDA 3MI4A 3BTEE 3H5CB 1KYNA 2DE9A 3F68H 5E0GA 3RM0H 1SMFE 3MO9A 1KMHB 3NRLA 1S0QA 2O8TA 1C5MD 1SI5H 2CV3A 2ULLA 2LPRA 1V2JT 2QY0B 3GCHB 2P95A 1TRNA 2J5UA 2ZGCA 1XXFA 3DSPA 5ESTE 4X2WA 3VB3A 1G2LA 3FZZA 1JRSA 1WQVH 3TH4H 1MABB 3ATIA 1TMBH 2JETB 1W0YH 1BTYA 1P2MA 4K8BA 2FI4E 1HAVA 1SFIA 1FV9A 1BTWA 3MU0A 1EP5A 1O30A 2VWMA 4R0IA 3WW7A 3TH2H 1SGDE 2VJ1A 2XRCA 4GCHF 2JH6D 1HBTH 2BLWA 1C1WH 3A87A 2FX4A 5FCKA 1P8VC 1OWKA 1O5GH 3GYMA 2XBYA 5FL7D 1BMFD 4E7RG 7KMEH 4DT7B 2ZGHA 1GVKB 4JMYA 2NU3E 1DDJA 4MNXA 1S6FA 2WV5A 3L33A 3VEQB 4U01A 2PGQB 4E05H 1YCPM 4MQAA 3PV2A 4CRBA 2VH6A 2TBSA 1TB6H 4NSYA 2W3IA 1MAYA 1NU9A 1UTKA 2XC5A 2RA3A 5DK1A 2BDYA 3FFGA 1D9IA 1XKBC 3BEFB 1V2NT 1HJAC 2QC2A 3UIRA 1P57B 4ASUD 2G4UA 2TGTA 2PWXA 4B75A 1O3CA 1BMLA 1C1PA 3E16B 4ZAEA 1LKAA 5EQSA 5DGJA 1WXRA 3SJ8A 5KEDA 1DS2E 1E38B 4GAWA 4AFZA 1SGFA 4B74A 2VVUA 1AFEH 2I6SA 2WPDD 5C0UA 2BXTH 2XNIA 2BDCA 1O2PA 5EXMA 3VGCC 1Y59T 1E35B 5I46H 1WAYB 3RXOA 1Y3UA 2HNTC 1MTNC 4Q4LA 4FVBA 3KNXA 2AIPA 5KECA 2L6OA 1DT2A 1MD8A 4K1TA 4BANB 1HJ8A 1F0SA 4P00A 2JJ1D 3OEHD 1Y5UT 1H9IE 1O5EH 1QR3E 2BXUH 2XCNA 5K0HA 4Q7YA 3ZVBA 1SQAA 3KQCA 4ACAA 3F0PA 4CRGA 1IQEA 1DE7H 4I31A 3A80A 4GVUA 1O2GH 4XD7D 2EQNA 1C5NH 1EAWA 1OYQA 1PQ5A 2Y5FA 2GDDA 2ZHEH 3UR9A 4KKDA 1ZTKA 1AIXH 3BIVH 2WUBA 4Q2KA 1LVOA 2FTLE 4X1RU 3RXJA 1EX3A 2ZFQH 4DT4A 1NZQH 4WMFA 1BITA 3D23A 4ACBA 4TYDA 4Y7AA 1ELAA 4ZKOU 3BTME 1AKSA 5EW2H 4NWKA 2BY7X 1DICA 1T8MA 1UTJA 1HIAB 2FLBH 5C1XA 1HXEH 1TBRH 2ZDMA 3GCNA 1S82A 1C9PA 1GG6C 1P2JA 3SJ9A 3ZVAA 3AAVA 3ZZ8A 1ELDE 2WPMS 4INKA 4ABGA 1HAZB 3LH1A 1THPB 2J2UA 4OS1A 2HNTE 1T4UH 2XTTB 1HXFH 3ZIAD 1O5AB 1IOEA 1W7GH 5ETXA 1CBWB 1YM0A 5A8YA 1FN6A 1SOTA 4MNWA 1O2UA 4YXWD 1C2IA 4U30A 7LPRA 2OUAA 3T5FH 3KHVA 2OQUA 2B0FA 2M2AA 3MH4A 1RJXB 1L4ZA 2UUFB 1NM6A 1S6HA 1SL3A 3C1KA 3O8BA 1SBWA 1OWEA 1E79D 2J95A 3TU7H 3URCA 5HKKD 3OY5U 2ZU5A 1PPFE 1UCYE 2C3SA 4SGAE 4B73A 1MAXA 2SGEE 5HM9A 5A0AE 3CS0A 4BXSA 1HAHH 4D9QA 4K8YA 1RTLA 1DY8A 2C4FH 1EP6A 2KCOA 1J15A 1TGSZ 4WXIA 1O3OA 3UNSA 2OLGA 4YOGA 2IJOB 1AFQB 3SV2H 2GCHG 1TBQH 2GZ9A 3ZZ3A 1F2SE 2FOCA 4NG9H 5E2PA 4UONA 5GXPA 2AFQB 1W11U 2XBXA 4CH2B 2HVXA 5FHTA 1MUEB 2HVYB 3UREA 1OXGA 1T8OA 1YPHC 1NRQH 2XXLA 1ETRH 3RXHA 3D62A 3SGAE 4U2WA 2WPHS 5L6NH 5FBIA 4K60A 2WUCA 1CT4E 2ZZUH 2ZGJA 1E36B 1QTFA 1P03A 4ZKRU 3A7WA 1GBMA 1QZ8A 4ZHMU 2YOLA 1O38A 1UTMA 3PV4A 1NY22 1GCTB 1ZZZA 3I78A 1TOMH 1XUHA 2PFEA 1NPMA 1SLXB 2ZHFH 1XKAC 3UNRA 3SGQE 4ZKNU 2UUYA 2CK3D 3SV9A 2KR7A 3UNQA 1BUIA 4ZROA 2AEIH 2UWPA 2GJGA 3S9CA 1JRTA 2ZCKP 1GI7B 2PUQH 1AHTH 1C2EA 2P93A 1GBJA 1GDQA 3N7EA 5JB9S 1UK4A 1GI8B 3CS7A 1AB9C 1F0RA 2ZCLP 4KELA 3RXGA 3ZZAA 1THRH 5K7RA 1LHFH 1O32A 4LK4A 3KL6A 1ZRKA 2BDBA 4E06H 5F8ZA 1JOUB 3MHWU 1QL9A 3GDSA 4I86A 3PMJA 2BLOA 1LCYA 4RT1A 2PLXA 5E8EH 1IHSH 1O2KA 2Z94A 1GBDA 2O8UA 3P8NA 4WWYA 4ZXYH 3UPEA 4FU7A 3T28A 1C4V2 1N1LA 3FVFB 3MO6A 1FY4A 3K65B 3GYLB 4GPGA 2H6MA 1GI4A 4H4FA 1NESE 2ZFTA 3LH3A 1S0RA 3SBKA 1P04A 3VXFH 3F2HA 3PTNA 1BMMH 3NK8A 4FUDA 1HJAB 1P2QA 4BAKB 1TNGA 1C2HA 3ATMA 2VVCA 1H9HE 5A8ZA 3OU0A 2SGFE 4UDWH 1C1MA 3FOAA 4NFFA 4X1PU 1CGHA 1CT0E 5C1UA 1GI1A 2ZO3H 4IS5A 4JCNA 1HJ9A 1UVTH 1OP8A 3VGCB 4FUBA 4TWWA 2VGCB 4Y71A 2JH0D 3W95A 4AGKA 3QLPH 1J14A 1MTNB 3UFAA 2F9PA 1VCPA 1TAWA 5T1VA 3D65E 1FNIA 4WF8A 3SNCA 1SKYE 2J97A 1XUJA 4I8HA 1KDQA 1O2WA 4MPWA 4RKOB 1BOQA 5EQQA 1T8LA 3EGKH 1DFPA 2A7HA 2FDAA 2Y81A 1O3NA 2PTNA 1QIXB 4MNVA 2BLQA 2BD9A 1T31A 1BMAA 1H8DH 2XWAA 5HYOA 2Y80A 1GJCB 2OQ5A 1NS3A 5HMAA 3KF2A 3AW1A 1ZSJA 5JDUB 2NU1E 2OD3B 3MNCA 4NFEA 2K0QA 1FIWA 3GY6A 1TX8A 3MU4A 5C3NA 3GCTG 1ABIH 5PTPA 1O2LA 1ZYOA 1G30B 1G32B 2Z3EA 5B6OA 2WPLS 1EZQA 1SGFG 5A0CA 3BTHE 4YLQH 1TMTH 1S6LA 5HM2A 3GDVA 4F55A 2WV9A 2QYIA 1EOLA 1HGTH 3MNBA 5AVDA 5A2MH 1FDPA 1PQ8A 4Y0ZE 2VBCA 2VNTA 1OHHD 2PSXA 1KTTB 1B0FA 2WYJA 1UHBB 2ZHWH 3HK6B 1IQGA 4X1NU 4R8TB 4O97A 3PWBA 3STIA 1DLKB 1XM1A 2ZA5A 3SO3A 4YTAA 1A5IA 3BTFE 4TY7A 3OFND 1WTGH 2FOEA 3SOSA 1Q31A 2FXRA 3Q3XA 4MG3A 5GIBA 2XC0A 3LOXA 3TJVA 1FAKH 1G9IE 1SLWB 9ESTA 2H1UA 1V3XA 1GDUA 2PV9B 1GHVH 3VB7A 2JH5D 4DW2U 5KGOA 1YLCA 2Z9LA 4X8UH 1PQAA 1KXAA 3DD2H 1NO9H 4HZHA 4INLA 4ZXXH 4YM9A 5FX6A 3LGVA 1A3EH 1C5QA 1YGCH 1ZHMA 1OYTH 2BVSH 3ZZBA 1O3GA 1FQ3A 2VIQA 1HNEE 2A45B 2Y7XA 2SGAA 4FUEA 3MU5A 1D3DB 1O34A 2HWLB 1IQFA 4BAMB 3MWIU 3PB1E 3MH6A 3K6YA 2BD2A 5E0HA 1AVGH 1GJ4H 4FOUC 1J17T 2R3UA 4ABBA 3LU9B 1OWIA 5T6GA 5EW1H 1SOZA 3RLYH 1W0ZU 1C1TA 4AGJA 1A2CH 2F91A 3SN8A 2BOHB 2VU8E 1J8AA 1ESAA 2V7QD 4QT8C 1MQ5A 1TNHA 1ZOMA 1EB2A 1LHEH 1H4WA 2KM0A 2J98A 4UFGH 4ABAA 2H5DA 1EPTC 1HAXB 1C5YB 3EA8A 2D8WA 1EFRD 2EC9H 1PPEE 3A84A 1DANH 2ZQ1A 1O31A 1YC0A 1DWCH 5EXNA 1S81A 4CBNA 2A4QA 3SU5A 1CU1A 3PRDA 5JBBS 3RU4T 3DFLA 1W12U 2A5IA 2FPZA 2UUKB 1DSTA 1VJ9U 2TGAA 3SW2B 2A7CA 1BRBE 3MYWA 1O2SA 1EOJA 1GJ9B 1TWXB 1LHGH 3L3TA 2R2WU 2G8TA 1AB9B 1O35A 2JKHA 1EAIA 1E1RD 1PYTD 3SNBA 4JZEH 2AERH 4X6PA 1SSXA 2BQ6B 3EE7A 3F9GA 3M3TA 4XBBA 5AFYH 4Y10E 2DE8A 1HV7A 4NA9H 4A5TS 2P8OC 1A5HA 4NA7A 1P12E 3Q77A 3F6UH 1J9CH 2V3OH 8KME2 2KCAA 2PKAA 1DOJA 1O3AA 3N7DA 1F5LA 1GPZA 1DXPA 1QBNA 4Z6AH 2AMPA 1V2VT 2GV7A 1TALA 1FXYA 2SGQE 4Y6DA 1K1JA 1XUGA 1RGQA 1CQQA 1A5GH 1BJVA 3WWFA 2NU0E 2QXHA 5FPSA 1UTOA 1GI3A 2H2ZA 3DUXH 2ZDLA 1ANBA 1C1UH 1W3CA 2ZPQA 4O3UA 1EZUC 2GCHF 2ZU4A 1D6WA 1B0EA 5LPFA 2FOFA 3KGPA 1HB0B 1VITH 3MO3A 5J4QA 2QIQA 3ITIA 3SUEA 3U8OH 1C5PA 2PR3A 2R3YA 4IN2A 2ALVA 2J38A 5C67A 1CA0C 2BQ7B 1ZSKA 2FI3E 3GY4A 2A4RA 1JIMA 2GVFA 1UMAH 3SU6A 5DKMA 1V2KT 2LNCA 3U8RH 1FUJA 3SQEE 2FOAA 2AH4X 4NIYA 1V2WT 3U8TH 1P9SA 2QF5A 2ZEBA 2THFB 1OPHB 3PO1C 3SU1A 4BAOB 1LVBA 5C0TA 3LIWA 2BOKA 1ELTA 1GJ5H 1SHHB 4K1EA 5IDKA 3ZZ4A 1UCYK 3E8LA 2A5AA 1BRAA 1BTHH 4ISIH 2Q6FA 1UO6A 2O8MA 1Z8RA 5FPYA 1G37A 1L1GA 2QA9E 1QRZA 1RTKA 1C4Y2 4ZHAA 3LC3A 2BM2A 3BTKE 1GJBB 1ELGA 4NIXA 1GBCA 1NBME 1HAOH 3LJOA 2G52A 3OY6U 1ZGVA 3ZZCA 1QGFA 2CMYA 3FN8A 4KP0A 3KQ5A 4OS4A 2B9LA 2CN0H 3KYFA 4NCYA 4BTIB 1T8NA 3SU3A 2QXGA 3SI3H 3BV9B 1C5XB 4M7GA 3HK3B 5A0BA 3T25A 1O3EA 1O3HA 1TLDA 1GBAA 3QTOH 1GBLA 1N8OB 3LONA 1ZJKA 4KTCA 3EE0B 1QB6A 1H9LB 1V2ST 4UFFH 1ZMNA 1KXCA 2F83A 1FONA 3I77A 3M7UA 3CENA 1O2QA 4CRCA 1SQTA 1HAVB 2ZDAH 4B2CA 1NFYA 1XVMA 3NXPA 4MLFB 1K28D 2G51A 3IITA 2B5TB 2XC4A 2VWOA 1TGBA 5GPIB 2IJD1 1TBZH 1JMOH 3ZYEA 1CHGA 1GBEA 4UE7H 2IPQX 1D3QB 5L30H 4SGBE 2XYAA 4CHAC 2C8YB 9LPRA 3BTTE 3ATWA 2ZDNA 1P2IA 1DITH 4BAQB 5EQRA 3BG4C 2YMSC 3QO6A 4WH6A 1ELBA 3UR6A 5BPEA 1F0TA 3RXPA 4CRAA 1ZJDA 1P2NA 3A82A 5DP7A 1QB9A 3K9XB 3HGNA 1RRKA 4MVNA 2YMSD 1YPLH 1BBRE 2NU4E 1EPTA 3M36A 1LMWB 1GMDF 2XOKD 2OC7A 2F3CE 3LGIA 3UQVA 2RDEA 2BYAX 1RFNA 3KCGH 3ZZDA 1EJMA 1NC6A 2ZNKH 3SV7A 3PLBA 2G4TA 3A8BA 2XBVA 1L1JA 1ZMLA 2BD7A 1E37B 4IC5A 1S5SA 2B7DH 4JK6A 5FXLA 4XE4A 4JZFH 1IQIA 1C5WB 1Y5BT 3VFEA 2TPIZ 4JYUH 3ZVEA 1TPPA 2P3UB 4D76A 1GL0E 3PWCA 3RXBA 3PLPA 4CRDA 1ETSH 3GCTF 5FX5A 1GI6A 1N6YA 1RD3B 3MU1A 1O0DH 3R3GB 3M3VA 3NKKA 4Z1MD 2A7JA 3S9AA 2KCYA 5LPRA 3P17H 1O5BB 2ASUB 1WYKA 3PLKA 4LXBH 1CE5A 2EY4C 2EI6A 1WUNH 3UTUH 2C8XB
chains in the Genus database with same CATH topology
3E3TA 1GHYH 1DY9A 2W7UA 4VGCC 3QK1A 2GV6A 3K6ZA 1D3PB 1INCA 1GI5A 3SQHE 1Q3XA 5DJ7A 2A4OA 2WPJS 2AIQA 4LZ1H 1NFWA 1FY5A 4UEHH 4X6NA 3A7VA 2Q6GA 2Y5GA 1GMHF 1EJAA 3M61U 6CHAB 4FUIA 4NA8A 3RXEA 2M5TA 3JZ2B 1SC8U 1AY6H 4FVDA 3TK9A 1PFXC 1GI0A 4OS5A 1DWBH 4YLUA 1ANDA 1BT7A 2GMTC 2D2DA 4KGAA 4DIIH 1T7CA 1Z7KA 2CHAB 2GP9B 1TQ7B 2P8OB 1IQNA 1AKSB 4GLYA 3LDXH 4A1TA 3B9FH 3DT0H 2ANYA 3TNSA 3V12A 3QN7A 4Q7ZA 3PMBB 2ZU3A 3SV6A 4AFUA 1C5LH 1IHTH 3ZYDA 2XWBI 5TCCA 4AB9A 3ZZ7A 1P11E 4U32A 3VPKA 1C1RA 2Z3DA 1A61H 3M5NA 5LGOA 2A0QB 2BD5A 1DM4B 1FJSA 1IQLA 2ZPRA 1AU8A 3A7XA 4Y8YA 1O3FA 2R9PA 4MDSA 5JB8S 2OXSA 2AGGX 1BBRH 1V2RT 1GMCG 4O9VA 1P10A 1TNIA 1TRYA 4MPUA 5E2OA 4DCDA 4ISHH 1B7XB 4Q80A 1K22H 1CA0B 2VIOA 2FESH 3AVZA 5C5NA 2Z9KA 2FWWA 3GY2A 1MKWK 1SQOA 4XBDA 3S69A 1QRXA 4Y8XA 1TPSA 2P94A 1JWTA 3P6ZB 3QWCH 2FS8A 1VZQH 1MTSA 2TGPZ 1LVYA 4Y11E 1DUEA 4AX9H 1SGPE 2WINI 2R0KA 1ELFA 3L6PA 1O2RA 4FXGH 3SNDA 5JPMH 1AE5A 3FANA 3O8DA 3TGKE 3T62A 1BIOA 2PSYA 3RC4A 3NCLA 1A4WH 1CGIE 2GCTC 4NWLA 2OP9A 5DPAA 1UVSH 1JXPA 1PPBH 1J16A 1BRUP 2V35A 3RXUA 2A1DB 3Q00A 1TOCB 2OTVA 1LPZB 1O2XA 5C2ZA 1W10U 3A7YA 5L2YH 3ZZ5A 4NSVA 1C2MA 1V2QT 2FI5E 4XOJA 5ESBA 1VGCC 2BDAA 1HAYB 3BTGE 1JIRA 1O36A 3K2UA 3TGJE 1MZAA 1NU7B 3TIUA 1XMNB 2R0LA 4NGAH 1K1MA 3LC5A 1BCUH 2RA0A 1O2VA 3HPTB 1KIGH 1GJ8B 1EAUA 1NROH 4K5ZA 1GJAB 5JBTA 3PYHA 1GCDA 4BOHA 4DIHH 1L1NA 3SJKA 2BTCE 2Q6DA 1K9OE 4F4OC 3TGIE 1KTSB 4RN6A 2BY5X 2J9NA 1UCYH 1MCTA 1Z6JH 1IAUA 1GVLA 2TGDA 2GGVB 4ISNA 4Y7BA 4YOIA 2ZWLH 3T26A 1YPKH 1MCVA 1GBIA 5A09A 2FEQH 1LDTT 1X7AC 2FM2A 1WBGB 4JK5A 2Z9GA 1CVWH 3MH7A 1BMNH 4BAHB 3ZZ9A 2FLRH 1ELCA 3RMLH 3BG4B 5DP3A 1B5GH 2ZDVH 1FIZA 4DOQA 5C5OA 4ZMAH 3S9BA 1AI8H 2I6QA 2ANWA 2Y6TA 2PHBA 3R0FA 2BY9X 3D49H 2ODYB 2ZC9H 2VH0A 1EZSC 4FUGA 3RMMH 2QN5T 4AYYB 5AFZH 1GMDG 1O5CB 2HNTF 2V0BA 4FU8A 3V3MA 1AO5A 2ODQA 4ASHA 1W2KH 2HLCA 5FCRA 2WPIS 2FOGA 1D3TB 3TPIZ 2C8ZB 1P3EA 3U69H 1KLTA 1Z8GA 1V2TT 1GBTA 2VWNA 1EATA 2STBE 4I33A 3PMAB 1CSOE 3A86A 4UFEH 1MTUA 5T6DA 1NRSH 2QXIA 2SNWA 1MQ6A 1WQSA 3RU4E 2JETC 5EODA 1KDQB 5FBEA 1WSSH 1ZHPA 2P3FH 1BTXA 3P8GA 1EAXA 1SGNE 3TJUA 1GG6B 1EASA 1JBUH 4FUHA 4X1QU 3MOCA 3LJJA 3PMHB 4AN7A 2SGDE 3U1IB 1BRCE 2BDIA 3RXMA 2C93B 1FZZA 1LHDH 1LHCH 1QRWA 4LZ4B 1ZHRA 3TJNA 3RMNH 1GMHG 1OSSA 4XFQA 3ELAH 3SUFA 2B8OH 4X8VH 2ZPSA 1O3PB 2Y7ZA 1SR5C 1F92A 5EG4A 2FOBA 3U9AH 1E0FD 3RP2A 1GDNA 2G81E 2ZG0H 3GY7A 2BB4A 4AG1A 3C27B 4TWYA 1SVPA 1UK3A 3A85A 2OC1A 1KY9A 2J4IA 3LGYA 1UVPA 1KXBA 1C5OH 2QXJA 2ZFSA 3MTYA 4ZKSU 1SGCA 1OWJA 1QJ6B 1BJUA 4BTUB 3QZRA 4X8SH 1GHWH 1PQ7A 2YNBA 4YT6H 4Y8ZA 4O3TA 1ESTA 1LPKB 1ABJH 1TGTA 3GY8A 5LPEA 1MU6B 2ZIQH 1Y3WA 4Y76A 1ZGIA 1MKXK 1S83A 1EUFA 1VR1H 2FIRH 1RIWC 3E1XB 2BMGB 1C2LA 3E0NB 1YF4A 3RXSA 1P0SH 1ZMJA 3ODFA 2G5VA 1PPGE 3SU0A 1TGNA 2ODPA 3QGNB 3I29A 1SGTA 1AQ7A 4OGYA 2RCEA 2FTMA 1SLVB 3NWUA 4I8GA 4H6TA 1TPAE 5CMXH 4DY7B 1A0LA 3GICB 1ANCA 1C5VA 1WOFA 5A8XA 1O2IA 1FLEE 1GVZA 4LOYH 1C4U2 4UFDH 4D9RA 1TE0A 1UVUH 1O5FH 5C1YA 1C5SA 3KIDU 2VIDA 3KQBA 1O2ZA 2ZHQH 1S84A 1O3KA 1O33A 2GT8A 1AVWA 3E91A 3BTQE 5CE1A 5DP8A 3B8JA 1CT2E 1YBWA 4Y0YE 2ZFRH 1BBRK 1NFXA 4IMQA 2V3HH 4DURA 1KXFA 2ZI2H 1QBVH 4JZIA 3S7HB 1LQEA 1BHXB 1TYNA 2HPQH 1ID5H 1W14U 5DG6A 1HAPH 2ZU2A 4AZ2B 3GOVB 2KAIA 4GSOA 1AGJA 1N6XA 1WTHD 1G3CA 1V2PT 3LT3A 4ZH8A 4CR5A 1FI8A 3E0PB 1GHZA 4WY3A 2OC0A 1BHXF 3M37A 1MKWH 3OYPA 2EEKA 4THNH 3SGBE 3FAOA 3UWIA 4YZUA 1GBHA 3RUOA 2ESTE 4HTCH 3LPRA 1NN6A 3T2NA 1CBWC 5C20A 5SGAE 4E7NA 1O3BA 1OWHA 1OP2A 2Y82A 2W26A 4XDEA 2FYRA 2HPPH 3P8FA 3HKJB 1QQ4A 5DP4A 2BX3A 2ZP0H 5EOKA 1AVXA 2HRVA 3BF6H 4ESTE 1ETTH 1QB1A 1W13U 1GMCF 2RG3A 1YPMH 1OS8A 4AFSA 2BD3A 2NU2E 1Y3YA 1O2JA 3AAUA 2VWLA 5J4SA 3M3SA 2PKSC 1XX9A 4YOJA 3VB4A 1DUAA 2SFAA 4DJZB 3E90B 1LVMA 3M7TA 4MTBA 1HFDA 4UD9H 3T29A 1PPZA 1GL1A 1H8IH 2F9NA 2OINA 2PKAB 2VINA 3RMOH 4A7IB 4K3JA 4A1VA 1GWAA 1D4PB 5TCAA 3F9HA 3A7TA 1ZSLA 1RTFB 3A8DA 1UTPA 2OC8A 2XBWA 4H6SB 5EU8A 1QJ7B 1YPEH 4NZQA 1TNKA 2ZU1A 3ZVDA 3BIUH 1DLEA 1MMJN 2TRMA 2O9QA 1AUTC 2GZ7A 1FPHH 2PTCE 4AYVB 1EB1H 1PPCE 1ZLRA 1E34B 1BDAA 4H42U 1C5UA 2W7SA 1TRMA 4HI3A 5G4BA 1GCTC 8LPRA 4FU9A 3TNTA 2WPKS 3V0XA 5HXFA 3QX5H 3DA9B 4DG4A 3M5LA 1YPGH 5EPYA 2QV1A 1O2MA 5AHGH 1VITF 2BZAA 3B23B 3OTJE 4NIVA 8GCHG 1WCZA 1GI2A 6ESTA 4K1SA 3RC5A 2D1JA 4JZDH 1TFXA 2EI7A 4D7FA 2H5CA 4B76A 4OS6A 2F9VA 3A81A 1VCQA 1VJAU 1U6QA 3HATH 2STAE 1TA2A 3VB6A 6LPRA 3BEUA 4IN1A 3HGPA 1FY3A 1SFQB 1HRTH 3A89A 3STJA 1GHAF 5GDSH 1NRPH 5AF9H 1ORFA 3MH5A 1CHOF 1Z71A 1AE8H 4OS7A 1ARCA 3EQ0H 1F5RA 1K21H 1GGDC 2W5EA 4B71A 1D6RA 5HGGA 1EJNA 2QF3A 2R2MB 3M7QA 3LGUA 1P3CA 3E6PH 3EAJA 1O3DA 1SHYA 3SNEA 1P2OA 2W3KA 2UWOA 1L0ZA 1Y3VA 1MBMA 1M9UA 2WV4A 5IYTA 1QFKH 3Q3KA 1KSNA 3M5MA 1O5DH 1XUFA 2FP7B 3RLWH 1YCPK 3LGWA 1ELVA 1RIWB 2ZQ2A 3SU4A 3ZVFA 3O8RA 2SNVA 1T4VH 3RXKA 3SNAA 3RXDA 1IQJA 3QTVH 2VGCC 4JYTA 1FY8E 4A6LA 1K1LA 3V13A 2Z9IA 3SUGA 1O2TA 6GCHG 1BB0B 2FMJA 5T6FA 3BN9A 4JYVH 1HPGA 3TLOA 3F1SB 1DWEH 2FOHA 1TA6A 1HIAA 2QCYA 3KEEA 3RXQA 1A0JA 1O39A 1C1VH 1TQ0B 1S85A 3RM2H 1GHBG 1ZPBA 2ZGXH 3A8CA 1UVOA 1PPHE 1TMUH 2FO9A 3RXIA 1EPTB 4A1XA 1MBQA 1ESBA 1TGCA 2QGRA 1P05A 1C2DA 1C2GA 2CF9H 1HAIH 3M5OA 3O8CA 5GCHG 1QJ1B 2GZ8A 1O2OA 1A1RA 4HFPB 1SGYE 1GJDB 3FP7E 2VIWA 3SV8A 1ELEE 1SPJA 4BNRA 3MFJA 1SG8B 1MKXH 3SHCH 1Z8IB 2G00A 2BLVA 4A92A 3ENSB 4FUCA 2HGTH 4YO9A 1ZTLA 5TJXA 1ZPZA 5GWZA 3GISB 3P95A 2A31A 3FZDA 2ANKH 1G3EA 1Q2WA 3T27A 3A7ZA 3TITA 3PTBA 4DVAU 1QQUA 4WMDA 1XVOA 3BEIB 1P9UA 2O8WA 1KXDA 4IBLH 4ZUHA 1TONA 1NRNH 2FX6A 3EA9A 3ZV9A 1BTZA 3G01A 2FS9A 1TNLA 1W8BH 2CF8H 1TABE 4YESB 1GJ7B 3IWMA 3ATLA 2ZGBH 4ABIA 4Z0KA 2C90B 2PW8H 1ACBE 1DX5M 3EYDA 2A32A 2SGPE 3RXRA 4ZHLU 2H9EH 4TY6A 1MU8B 2ZCHP 3A83A 1SGQE 2F9UA 5T3HA 4Q7XA 4BXWA 1QL8A 4WXVA 1AWHB 1O3IA 3PM3A 5DO4H 1V2LT 1BA8B 1EZXC 4MNYA 4KTSA 1TIOA 1QCPA 3UQOA 4CREA 2PKSB 2BDHA 1ARBA 4WVPE 4OGXA 2A5KA 3GY3A 3UOPA 2Y5HA 2XW9A 2QF0A 2Z3CA 4ABEA 3PO1B 1XXDA 4WH8A 1HAGE 2BX4A 3VXEH 4KTUA 1ZRBA 2WYGA 1THSH 1BTUA 1Y3XA 1O2HA 5LH8A 4AB8A 3KQDA 1Y5AT 3BG8A 4AOQA 3MMGA 2VIVA 2ZKSA 4D8NA 4TPYA 5CHAC 1AZZA 1C1SA 1K1NA 1DWDH 3RXVA 3SHAH 2BY8X 3TJOA 4WMEA 4ABHA 3ZVGA 1ZTJA 3M35A 2ZFPH 4TPIZ 1OKXA 4K69A 3SUDA 1A7SA 1SGIB 1UJ1A 1G3DA 2ALPA 2J34A 2ZFFH 1C5ZB 5DP9A 5H4IB 1EKBB 1F5KU 2P16A 4GHTA 4IGDA 4Y79A 1O3LA 1CO7E 2Z7FE 1KXEA 3UWJH 4GHQA 2PGBB 4NIWA 2AS9A 2GKVE 3VB5A 4X2VA 3FP8E 1VITG 1ANEA 3GY5A 3RXFA 1F7ZA 3V7TA 3Q76A 4FUJA 1C2FA 4CBOA 2F9BH 2VVVA 3QUMP 2K1QA 1H1BA 1LTOA 3SU2A 4FUFA 4GCHG 4I7YH 3RXTA 4MPXA 4CRFA 1CA8B 2CXVA 3U98H 4ABJA 2RDLA 2NWNA 5E0JA 1PJPA 2DUCA 2FZZA 4X2YA 5GJ4B 4AFQA 2ZTZA 1GHAG 1NRRH 1IQHA 2IOTA 4O03A 1CHOG 1OOKB 2PUXB 3NUMA 2ILNA 4CHAB 3MU8A 1YPHE 1CGJE 1Z1JA 4IW4E 1AN1E 1Y8TA 2BY6X 2EA3A 3BTWE 3GDUA 3RU4D 1GGDB 1UTLM 4YT7H 1QY6A 1C1OA 1TPOA 4CR9A 2EI8A 2ANMH 5DP5A 5FPTA 5ABWA 1VCWA 2GX4A 1FN8A 5F6MA 2BZ6H 2QAAA 1YLDA 3P70B 3OX7U 1EXFA 2CGAA 1L2EA 2ZTYA 7GCHF 1C5RA 3U1JB 4OS2A 3BSQA 4J2YB 3P8OA 3ATKA 5FAHA 2FODA 2VB0A 1FPCH 3CP7A 1C2JA 4ABDA 4I8JA 1SGEE 1ZPCA 1OX1A 2TIOA 3F9EA 3SJIA 1OWDA 2Z9JA 4X6MA 3W94A 3GCOA 1EQ9A 4DGJA 1LKBA 3GCHC 2IPHA 8ESTE 2G55A 1GBKA 3F9FA 1MTVA 3S0NA 5EXLA 2IN2A 3WY8A 2UWLA 4IC6A 3QDZB 3RC6A 1UHBA 3NZIA 4XSKU 2BD4A 3ZVCA 1O2YA 1YYY1 3RDZA 4VGCB 1GBBA 1K1IA 3DFJA 2F9OA 4B1TA 8GCHF 4BTTB 1AD8H 3H7OA 4K2YA 2A2QH 3TK6A 2AMDA 2ZF0H 4MPVA 3JZ1B 1SB1H 1AUJA 1C1NA 1V6DA 1MTWA 3LKWA 2YNAA 3RXLA 1QHRB 2AGEX 1DPOA 1Z1IA 3ZZ6A 4HGCA 1LPGB 1YCPH 2ZDKA 1P2KA 1XUIA 7ESTE 2CJIA 2J92A 2BD8A 1FY1A 2H9HA 4JZ1A 2ZTXA 3SORA 4AG2A 3NPSA 1O37A 1P09A 2XCFA 3P92A 1YP9A 4AORA 4RSPA 1DVAH 1MH0A 1N8OC 2GMTB 2OBQA 3RXCA 2BDGA 5F8TA 3S7KB 3ODDA 1GBFA 3SI4H 4INHA 1L4DA 2GD4B 3TVJB 1NTPA 1G2MA 3QGJA 3A8AA 2GDEH 3EA7A 1AMHA 1C5TA 1HLTH 5F03A 1A3BH 2P3TB 5EGMA 2GT7A 2Z6BD 4X8TH 1GI9B 3IG6B 1C1QA 4J1YA 1AWFH 1KLIH 3N7OA 1SGRE 1Z8JB 6GCHF