1UTQA

Trypsin specificity as elucidated by lie calculations, x-ray structures and association constant measurements
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Trypsin Specificity as Elucidated by Lie Calculations, X-Ray Structures, and Association Constant Measurements
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords TRYPSINOGEN
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1utqA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1utqA02
4YESB 5HM2A 3SBKA 1BMAA 2XBWA 2A0QB 2C4FH 4MNWA 5DP4A 2BD7A 3A80A 1JWTA 3M36A 2VVUA 3P92A 1GJDB 2ODPA 1IQHA 1BDAA 2H5CA 2J92A 3LGUA 1TNGA 1SVPA 1D3QB 3D65E 4Q80A 2SGFE 2GTBA 3FANA 2BXUH 3SUFA 3SUDA 1BMLA 3L6PA 3RMNH 5SGAE 1V2NT 1EXFA 1TPPA 2WYGA 1FXYA 1AMHA 3SU6A 4AGKA 3PYHA 2ZU3A 3I77A 4FUCA 3B23B 3VGCB 5GXPA 3P8GA 4ZKOU 4UFGH 1NS3A 2BDYA 2Z3CA 1MTVA 3BTKE 1OS8A 1ELFA 1HJ8A 1O34A 1P9UA 3RU4E 1O2LA 5B6OA 1MTWA 3RXIA 1F5LA 4AB9A 1ABIH 1V2WT 5I46H 3RXSA 3E8LA 4Y79A 3NCLA 1DXWA 1QB6A 4LOYH 3S7KB 4BTUB 2R0LA 1UK2A 3MNSA 1PQ8A 2ZCHP 1L0ZA 1LVYA 2NU3E 1IQNA 3KN2A 1C5RA 1O5BB 3BTDE 2ZGBH 1JBUH 3ZZ5A 1TLDA 1G36A 1LHFH 5JBAS 2ANWA 4WWYA 1H1BA 1BRAA 3GY3A 3M3TA 1OWJA 1XMNB 1C5SA 3QZRA 5K0HA 3BTME 3RXKA 1FDPA 1D4PB 3AVZA 1C4U2 4U32A 3GISB 2ANMH 1JIRA 5C5NA 3HATH 4H6SB 5E0JA 2DE8A 1FMGA 1Z6EA 1UHBB 4OS2A 3SU2A 3KQDA 2XWBI 4ZHLU 1Y3WA 1DSTA 5C1UA 1SBWA 3E0PB 2AGGX 3RXAA 2PKAB 1FY3A 1ZMNA 2ULLA 5DKMA 2CMYA 1GI7B 1V2VT 4AG2A 1ZZZA 5BRRE 2VWMA 1O3IA 3MOCA 4FUFA 3SV7A 4LK4A 4IN1A 3KQBA 1B0EA 2B8OH 3PTNA 1H9HE 4B73A 1V2JT 2OC0A 4TY6A 1K1JA 1W13U 4ABBA 1T32A 3GCHB 3RXGA 2C8WB 3GDUA 3MNBA 1D9IA 1DOJA 4ZHMU 4ZUHA 3LH3A 1N6YA 5A0CA 1O5CB 5EPNA 1CQQA 1H9IE 2G4UA 3UTUH 3F9FA 2XYAA 4AYVB 2D26C 1ACBE 1D6RA 1DY8A 1TPAE 4CBOA 2G8TA 2VGCB 1Z7KA 1ZTKA 3K65B 1DDJA 5FAHA 6CHAC 3FP6E 4I8GA 1LVBA 3PO1B 4E7NA 2G81E 4O97A 3A86A 1TA2A 4MPXA 4NIYA 3Q76A 5I25A 1AVWA 1QIXB 5DP6A 3ESTA 4Q7ZA 2Y81A 2A45B 4ZXXH 5GIBA 4OGXA 1GWAA 4X6MA 2WYJA 1EPTC 1QRXA 1SB1H 2AIQA 3BIVH 1YPEH 1E0FD 3QLPH 1V3XA 3A8AA 4CRFA 1SFIA 1C5XB 1T4UH 1NFYA 3A7ZA 3MU0A 1V2OT 1J9CH 1XVOA 1G37A 1MQ5A 1PPFE 3SHCH 3R3GB 2Z9GA 1T8LA 3FVFB 1GHYH 2ZNKH 4UFFH 4IS5A 2IJOB 5F8XA 1OOKB 4A6LA 1FIZA 4BAOB 4JK6A 1EATA 1H4WA 1ZSJA 3RXLA 3AAUA 4CRAA 4NG9H 3E6PH 1C5ZB 2O8TA 2FP7B 2Y5HA 4IC5A 1HAVA 4ABFA 2QV1A 4X2XA 2UWOA 2JH0D 3V12A 1AB9C 5LPFA 1HAVB 1GGDB 3I29A 1UK3A 1NTPA 1TRYA 3S0NA 1UTKA 3PM3A 2G51A 3NZIA 1C2EA 2GD4B 1DS2E 2IN2A 4MNXA 1EAWA 1WV7H 2J94A 2ZEBA 3KIDU 1QGFA 1S6HA 3M7TA 1JXPA 1NRPH 1NT1A 1W14U 1O32A 1IQLA 1W0ZU 1SGTA 4DCDA 1TPOA 3AASA 5DP7A 3L33A 1ANBA 4IBLH 2ZO3H 2XBVA 3ZZ6A 1BJUA 3TU7H 2HRVA 4E05H 2W5EA 1HGTH 5IDKA 1O39A 2VWLA 1AFEH 2TGTA 1VCQA 1AUTC 5FX5A 5FHTA 4GAWA 3BTEE 2THFB 1HYLA 2EI6A 2QXIA 1F0RA 3GY6A 1Y5AT 4WF8A 2OUAA 4GHQA 1DFPA 1QY6A 1K9OE 4YOGA 4CBNA 5H4IB 3DD2H 1ELCA 1RIWC 3BN9A 3IWMA 5TCCA 2BY7X 1O2ZA 2XTTB 1TRNA 1TOMH 4FUDA 1O5DH 3HGPA 1W7XH 3LGVA 1SGEE 2VIVA 1KXEA 1OWEA 5DPAA 5FCRA 4WXVA 1SGFA 4CHAB 1C1NA 4DG4A 1O36A 1KXCA 2C93B 2HGTH 1CA0C 5AHGH 5JPMH 3A87A 3A89A 1WAYB 2GCHG 5GPIB 1Y5UT 1WU1A 1OX1A 2GV6A 2FYRA 4D8NA 3M5LA 1F0SA 1DPOA 1IQFA 3FZZA 4YOJA 3BEFB 3TLOA 1GJCB 1O33A 2DE9A 2H9TH 1GBKA 2BVXH 1W3CA 1WOFA 1OWDA 1L1NA 1RTLA 2Z6BD 2OXSA 2CHAC 4AOQA 3D62A 4I8HA 2F9PA 1V2QT 1C2HA 2B7DH 4TYDA 1RRKA 3UFAA 1EB2A 2QF3A 2XC0A 3P8OA 1NPMA 4JYTA 5ETXA 4BNRA 3SV6A 1HIAA 1YCPK 3GDSA 4CRCA 5T6GA 3TGKE 2H9EH 4K1EA 2QXGA 4CREA 1XUHA 2XNIA 3ATLA 1XKAC 1TOCB 1GMHF 6GCHG 1Z1IA 2ZGHA 1TFXA 5EU8A 5FX6A 4X6NA 1O3DA 3SHAH 1FUJA 4ABJA 1IHTH 2PHBA 1LQEA 4JZFH 3E0NB 4Y8XA 1GI4A 5K7RA 1O3JA 3IG6B 1WQVH 1TGCA 3EA9A 3SN8A 3SU5A 5TCAA 4Y76A 5EG4A 1RD3B 3F9EA 3LC3A 3MO3A 4U01A 1ZRKA 3A8CA 1BTPA 1SFQB 4RN6A 4AB8A 2ZFFH 2D8WA 3MH4A 1P10A 4GUXA 1AWHB 1MTSA 1GVLA 2R0KA 1C1VH 3CP7A 1ZTJA 4BANB 3C27B 1EPTB 3MYWA 3RLWH 1HB0B 1OKXA 3HKIB 4AFUA 2HNTF 2F91A 1AO5A 3MH7A 1AI8H 3S9BA 3P95A 3QWCH 1VCWA 3P8NA 1TONA 1Y8TA 1ESAA 1QURH 4MDSA 3D23A 1UTLM 1L4ZA 4OS4A 1TBQH 3VB4A 4D9QA 4ISHH 1EAUA 1AIXH 3BTGE 1SGNE 1TGNA 3T28A 1IQKA 1AE8H 1GI3A 1UO6A 2BY9X 1KIGH 4BXWA 1CHGA 3VPKA 5JB8S 3DFJA 3SGAE 3FAOA 1IQGA 3LGWA 4U2WA 1CGJE 5DGJA 3NUMA 1DWDH 2BMGB 3UUZA 2CN0H 4K3JA 4JYUH 1D3TB 1W7GH 3LIWA 2R9PA 1BQYA 2P8OB 1BMMH 1BITA 1ELGA 1KDQA 1N8OC 5GDSH 5C2ZA 4D7FA 3SU1A 1GBEA 4WJG2 4DY7B 4KTSA 4IC6A 4O03A 2WPKS 4ASHA 2PSXA 1TWXB 3DUXH 3BTHE 1VGCC 4UE7H 3RC4A 1GBMA 1KLTA 3E16B 1C9TA 1S0RA 4JZDH 1O3NA 1C5MD 1YGCH 5IYTA 1YPHC 2RA3A 1TB6H 1UVSH 1HRTH 1EB1H 4FUHA 1SHYA 2C8ZB 1THPB 3F9GA 1MTUA 4NA9H 1O3GA 1GJ7B 4KTUA 5HMAA 1AQ7A 4HTCH 5FBEA 2JETC 2AS9A 2EA3A 1YBWA 4BTTB 2XC5A 1Y59T 1GDUA 1KSNA 2FTMA 3UY9A 3O8DA 4K60A 3SUEA 1C1MA 4KGAA 3RXUA 4OS6A 2PUXB 2WINI 1C2IA 5LH8A 3A7YA 2ZWLH 5LPEA 3M37A 3U8OH 4BTIB 1S81A 1ETSH 4XFQA 1V2KT 3VXEH 4B2BA 9LPRA 5CMXH 1ZOMA 2ZQ2A 2VIQA 1FPCH 2BD2A 2OLGA 3RMMH 3V0XA 2TGDA 5JBCS 1ZHMA 2ZFSA 1F7ZA 1YPMH 1XXDA 4NZLA 4B74A 2RA0A 1D3PB 2VH0A 2OP9A 3ZVCA 1TMBH 2FM2A 5C3NA 4X2WA 1C5OH 1C5VA 2FESH 3VFEA 4DIHH 3GY7A 4R0IA 1YLCA 3QDZB 3MU5A 2J4IA 2AERH 1DT2A 1PJPA 1NRNH 1GHVH 1ZGVA 2VWOA 3SI3H 1NZQH 3SO3A 3SNEA 1C2FA 1AU8A 1S82A 1F2SE 2RG3A 1JOUB 2J38A 2I6QA 4BAMB 3ZZ9A 1P03A 5E0HA 1EQ9A 2ZPQA 2BOKA 3PMJA 5HYOA 2EC9H 1Z8RA 2OQ5A 1O2YA 3AW1A 5EQSA 1CHOF 1QRWA 4RKJB 4I8JA 3T2NA 4KKDA 1NRQH 1A5GH 1O2KA 2QAAA 3Q77A 4A1TA 5CHAB 3QTOH 1P8VC 5FPSA 2VJ1A 2NU4E 4XBBA 4WXIA 3S9CA 2VB0A 1O2GH 2EI8A 1O2VA 2ZF0H 1DICA 4YO9A 3SZNA 1ETTH 3MI4A 4WVPE 2XXLA 1MCVA 1O37A 1MD7A 2ZFPH 1LKBA 3PMHB 1SGRE 4B2AA 1K1MA 1O2OA 1A4WH 2V0BA 2O8WA 5F8ZA 1HBTH 3URDA 3SU0A 3O8RA 2G52A 1A46H 1OP8A 1BBRE 1YF4A 1PYTC 3MU1A 1O2HA 3OX7U 2SGEE 4K2YA 3ATIA 1ZPBA 1ZRBA 3LGIA 2W7UA 2A31A 4IW4E 1EASA 2ZHQH 1W10U 1ELBA 3S9AA 3WY8A 2GDDA 1TNKA 3F68H 4UEHH 3TNTA 2OTVA 1AFQB 1RTFB 3M61U 3ZV8A 2SGAA 3JZ2B 1J16A 2QIQA 2D1JA 1ABJH 1AE5A 1F5KU 4GCHG 2PUQH 1GHAF 3UWJH 1ZYOA 3PLKA 1SI5H 1C5PA 4TY7A 1A3BH 3A7VA 5A0BA 1P06A 4DT7B 1VITF 5C20A 2QGRA 4WH6A 2J9NA 4X1QU 1QBOA 4NFFA 1GJBB 3MMGA 4YTAA 4A92A 9ESTA 2Z3DA 2AMDA 3BG4B 2BX4A 2PR3A 4LZ4B 5ESBA 1LTOA 4FUJA 1V2PT 3GY5A 2ZIQH 1GBHA 4Y6DA 1C2DA 1VJAU 3K6ZA 1GJ5H 3RXEA 4BAHB 1UTJA 1MBMA 1QBVH 2HALA 1SC8U 2FDAA 1NO9H 2IOTA 4PROA 3RU4T 1UVTH 1TA6A 2P95A 4IMQA 2WUCA 3LGYA 1OP2A 3PTBA 3SJ8A 4ISNA 2NU2E 2QYIA 4JYVH 4CH8B 5JYIA 2HNTE 3A83A 1K1NA 1G3EA 1UHBA 3SV9A 1AKSA 3ZYDA 4WMEA 3M5NA 3ZYEA 1C5WB 5EXLA 1YPKH 4XDEA 3S7HB 5DP5A 1UTNA 4THNH 2BLWA 5FPYA 1Z8GA 4GHTA 1SGIB 3QO6A 3ZZCA 4ABGA 1SQOA 1TYNA 3VB7A 1O3EA 1X7AC 1O3PB 4X6PA 3MO9A 2ZPSA 3GCNA 2AMQA 1DITH 3UIRA 4FXGH 1VZQH 1GBBA 3SU3A 4TPIZ 3W95A 3BSQA 2HLCA 5L2YH 2H2ZA 5A8XA 2BDGA 4IN2A 3DA9B 1TE0A 2BD5A 2ZHEH 1GHXH 1SGCA 2C90B 3P70B 1MAXA 5HGGA 1TALA 4Y0YE 2Y80A 3NKKA 1HXEH 1NROH 3MU4A 3RXDA 2AIPA 1HPGA 1YKTA 5DK1A 1GBJA 5GJ4B 2ZGCA 1ZMJA 2CV3A 1O2NA 3MNXA 4UFEH 2Q6DA 4FUIA 2TGPZ 1C4Y2 3OY6U 1WTGH 2VIOA 3TK9A 4JMYA 1ELAA 2ZDNA 3U1JB 2G55A 5JBTA 2P16A 1EX3A 1V2UT 1UK4A 2OC8A 3MNCA 1DLKB 1AWFH 1LHDH 3UOUA 2BHGA 1G2MA 2GGVB 1C1WH 2G00A 4XOJA 3V3MA 1FY4A 3RXMA 3FP7E 1O3HA 3A7WA 2EEKA 1GHBF 1GCTB 3Q3KA 3STIA 4FU8A 1Z8JB 2FTLE 5E8EH 4K5ZA 3TGIE 1SHHB 1YCPM 5FBIA 1EKBB 4A5TS 1W2KH 4LXBH 2OBQA 5A0AE 1SQAA 3UPEA 1RS0A 2Y7XA 3ODDA 1ZJDA 3ZZ3A 4VGCB 1O30A 4FUBA 1A1RA 4I32A 2ZKSA 2BQ6B 4AORA 1O2QA 2P3UB 1GBTA 3PMAB 3I78A 3ATMA 4Q7XA 1BRCE 2TPIZ 2SGDE 1P12E 3STJA 1WYKA 2GT7A 5GWZA 4K8BA 2ZZUH 1C2MA 3ZZ8A 1XUIA 3RXTA 2C8XB 1V2ST 2D2DA 4ISLA 1GI9B 1KLJH 1D3DB 2FS9A 1GG6B 3LU9B 1PPZA 3ZZAA 1ELTA 2A7CA 1UMAH 3M35A 1PFXC 2NU0E 1P2QA 1AY6H 1MTNC 4NZQA 1ETRH 1VJ9U 1LQDB 1YPLH 2AGEX 3FFGA 3TH2H 1T8OA 1A5HA 3DHKH 5E2PA 4FUEA 4MPUA 4YLUA 2P8OC 1WUNH 1OXGA 5F6MA 1OWHA 3SUGA 1KTTB 5DP3A 2GCTC 2ALPA 3T5FH 1MKXK 2ZC9H 2QA9E 1CVWH 1IAUA 1W8BH 3B8JA 1TX6A 2ZA5A 4ZAEA 5T6FA 3KF2A 2TIOA 1S85A 1O2JA 2STBE 1A61H 2BDBA 2G5VA 2BY5X 1O3FA 3GY8A 2PSYA 4Y10E 3RXFA 3LJJA 3OY5U 4FVDA 4Y11E 1Q31A 2A7HA 4B2CA 1MKWK 1CU1A 1GDQA 1GI6A 1O3CA 3MFJA 4FUGA 3F9HA 1DUEA 1FN6A 3GCOA 1J14A 4ZH8A 4MNVA 1WSSH 4E7RG 4ZMAH 2GCHF 4YT6H 3A88A 2A2QH 3GCTF 3MWIU 4UDWH 2SGQE 1GGDC 5C1XA 3ODFA 1QNJA 3TVJB 2ZDLA 1TGBA 4WMFA 1ESTA 1QA7A 1O3LA 3RXOA 2F9OA 4F49A 5A2MH 2R3UA 1C2LA 1QQUA 3SNBA 1DXPA 5EW2H 3BV9B 4E06H 2WPLS 3ZVDA 1DWEH 1DWBH 1Q2WA 1ZHPA 1P09A 2VIWA 1GMHG 1HAHH 1YYY1 5DP9A 2ZP0H 2OINA 1BRUP 1O3AA 3DFLA 4MG3A 1RXPA 4UD9H 1CBWC 4K1SA 4TPYA 1EJAA 5ESTE 1GI0A 1AUJA 2JH5D 1E38B 2CXVA 5L2ZH 1FN8A 4RKOB 1K1IA 1BJVA 4H42U 1K21H 1SGPE 1J8AA 1W11U 3SJOA 2F3CE 4DVAU 1RGQA 1HIAB 3AW0A 3LKWA 4KP0A 1O2UA 4M7GA 5AF9H 2ZDAH 5ABWA 4RSPA 2RCEA 1QJ6B 4MVNA 1VR1H 1XUFA 3B9FH 3A7TA 2I6SA 4O3TA 2XWAA 1FPHH 2Y6TA 3Q3YA 4ZHAA 5J4SA 1FY1A 2P93A 3LOXA 1G32B 2GKVE 3LPRA 2BX3A 1GL0E 3QTVH 2Z9LA 2GVFA 3HKJB 1SSXA 3UWIA 3UNQA 2BTCE 1KXAA 1HJAC 1HDTH 2FLRH 1ZSKA 1T31A 3PROA 1QRZA 1K22H 1MH0A 1O3BA 3EGKH 4JZEH 1BBRH 1Q3XA 1S83A 1TGTA 4ISIH 4QT8C 1ZR0A 1NRRH 1LPGB 1IOEA 5BPEA 1GCTC 4WMDA 3TJNA 1EPTA 1C5TA 4D9RA 3P17H 2A4GA 1P3EA 5A8YA 4YOIA 1T8MA 1IQMA 2FYQA 5EQQA 3ZZ4A 4XBDA 2VGCC 4TWWA 4A7IB 2BYAX 1TIOA 4DW2U 1T4VH 2F9UA 1KXBA 4B1TA 6CHAB 3MHWU 4AN7A 3L3TA 2VWNA 3RDZA 3U1IB 1NFXA 3CS0A 7ESTE 1IQIA 4KTCA 1HV7A 1O5FH 1TABE 2OD3B 4OS5A 5A8ZA 1V2RT 1J15A 5C5OA 2CF9H 2QY0B 4I7YH 2A1DB 1GJAB 1SGQE 3M7QA 1UVPA 1V2TT 2V3HH 3KEEA 2ZU1A 2FOBA 1GG6C 3KQCA 1ZTLA 1QHRB 4AFSA 1BUIA 1C5UA 3HK6B 2XCFA 3UNSA 1YPHE 2Y5FA 1HAYB 1NESE 3FZDA 4ABIA 1MKWH 3VGCC 2J34A 2WPJS 2FIRH 3RXVA 3E3TA 2AEIH 1K28D 2FOGA 1H8DH 2ZU2A 1HAXB 2A4QA 1W0YH 2HPPH 1N6XA 2FX4A 2NU1E 2BLVA 3MO6A 2LPRA 1Y3YA 4CRBA 1P2NA 1M9UA 2Z9IA 4OS7A 2W7SA 2GZ9A 2ODQA 2P94A 1G2LA 1ZGIA 1QFKH 4AZ2B 4X2YA 4X1SU 3EA8A 1Z71A 1AZ8A 1GJ8B 1EP6A 4I31A 3OTJE 2PTCE 4XE4A 1O2MA 4CRDA 2FI3E 2ZI2H 3G01A 2B9LA 1G30B 4O3UA 1XKBC 1ZPZA 2ZDVH 2Q6FA 5L30H 3R0FA 3RC5A 1GDNA 3UR6A 2OCVB 4A1VA 1KTSB 2GDEH 1BOQA 5J4QA 5EODA 1FIWA 1PYTD 2F9NA 1YCPH 4YM9A 4CR5A 4YLQH 3BIUH 3T29A 4CRGA 1LPKB 1IHSH 3TGJE 1P2IA 3A7XA 1CE5A 3ZV9A 1EOJA 2K1QA 4YT7H 2CGAA 2PV9B 3LDXH 1CT4E 1N8OB 3ZVBA 1B7XB 2B5TB 1BHXF 1QL8A 4Z6AH 3M5MA 3TH3H 1TAWA 3LH1A 1VGCB 1O3OA 1CBWB 1XUJA 3SNCA 1GVKB 2UUFB 1CHOG 1KXDA 1O2PA 2H1UA 4CH2B 2V6NA 1LHGH 3TH4H 1DY9A 1FNIA 1L1JA 3RC6A 1GHWH 2P3TB 1EZUC 1F0UA 2Z9JA 4F4OC 1CSOE 4UFDH 1T7CA 3GICB 4YZUA 1ELEE 1HFDA 1TBZH 1S84A 1SOTA 1DANH 1LHEH 4MPVA 1TMTH 2DUCA 2OQUA 1LKAA 1HNEE 1BCUH 1DX5M 2UUKB 1LPZB 1XVMA 2H6MA 3NPSA 3TK5A 1A3EH 5L6NH 1G3BA 5E0GA 1HAPH 1BA8B 3GY4A 1MQ6A 2XW9A 4JZ1A 1A7SA 3PLBA 1BTUA 1LHCH 3KCGH 2Z9KA 1B5GH 2BVSH 3D49H 4HGCA 1V6DA 5F03A 2BY6X 3U98H 1NY22 1PQ7A 1L4DA 3QZQA 4MQAA 3T25A 4WH8A 1EAIA 3URCA 1T8NA 1QJ1B 3EYDA 4AX9H 4X8UH 1MZDA 5G4BA 1EZXC 4I8LA 1YPJH 1GCDA 3T62A 2VIPA 4OGYA 1THSH 2GZ7A 4INHA 2ILNA 4X1RU 3ENSB 3KQEA 1ORFA 4Q7YA 1GMCF 1BTHH 3TNSA 1AHTH 3PMBB 4MTBA 2GZ8A 4WY3A 2O8UA 3RXRA 4NIVA 5EXMA 4NA7A 1DM4B 1P3CA 3KGPA 3QGNB 3QGJA 1UTQA 1MU8B 2G4TA 3BEIB 1AKSB 4AFZA 1VCPA 8GCHF 1RJXB 2Q6GA 2A2XH 2VU8E 3PLPA 1QCPA 1AD8H 2PGQB 3SV8A 1ESBA 2AMPA 2FOHA 4D7GA 2TBSA 1TQ7B 1FAKH 1MBQA 1OYQA 2JH6D 4X8VH 3VXFH 1QTFA 5HXFA 1RFNA 2OBOA 1QBNA 1AZZA 4ABHA 1XXFA 2BDAA 1JRSA 2FMJA 3M5OA 5EOKA 1O35A 1XUGA 4I33A 1PPEE 2QF0A 2H5DA 5GCHF 2BDCA 3TJUA 3QK1A 1UTMA 3T27A 1QL9A 1C1QA 2HNTC 4NSYA 1G3CA 4JK5A 2BD8A 1KXFA 2XC4A 5E2OA 2PLXA 1P11E 1HAZB 3E91A 1MZAA 2O8LA 4NGAH 2ODYB 5TJXA 1P2KA 1ZLRA 4D76A 3BF6H 2ZTZA 2A4OA 3O8CA 1OP0A 3ITIA 3QX5H 2ZQ1A 1GI2A 1UTOA 1FLEE 1SPJA 3TPIZ 2ALVA 2FOEA 3M3SA 1FI8A 1MKXH 2BB4A 3ZVFA 3RXPA 2QXJA 2FO9A 1SGFG 1EJNA 3M7UA 2PW8H 5F8TA 2KAIA 5JDUB 3RMLH 1S5SA 2M5TA 4IGDA 1N1LA 1BHXB 1Y3UA 1SGYE 2ANYA 5LPRA 2ZECA 3UQVA 2Z7FE 1SMFE 2VNTA 1THRH 1Z6JH 1GHBG 1BIOA 1ZMLA 4ESTE 3RUOA 1O2TA 4IMZA 1GPZA 3F6UH 4H4FA 4FU9A 2BQ7B 8ESTE 4X8SH 2GMTB 2Y7ZA 4UONA 3BEUA 1TMUH 1S6FA 1AGJA 1OSSA 4BAQB 1NFUA 4CR9A 3BG4C 4Y7AA 1FZZA 3HK3B 3PWBA 4LZ1H 4MPWA 3EAJA 1O2XA 2SGPE 4NFEA 3SW2B 2ESTE 1TRMA 4HZHA 1GBIA 1HJAB 1SGDE 4K8YA 2FXRA 1JMOH 1O5EH 2IPHA 1TQ0B 2Q1JA 1O38A 3QUMP 3VB5A 1INCA 4DJZB 2A5AA 2FPZA 2ASUB 2ZHDA 3OYPA 5DP8A 2W3IA 5T3HA 2WPHS 1C1RA 1HUTH 2QCYA 1GBLA 4GSOA 2WPMS 3PB1E 3SGBE 1C1PA 2ANKH 1Y5BT 3ATWA 3ELAH 4X1NU 4X1PU 1O3KA 7LPRA 2BDHA 3S69A 1SL3A 1FJSA 3FP8E 3DT0H 2F9BH 2ZTYA 1WQSA 3ZZ7A 1JIMA 1FONA 2FLBH 1P0SH 2HWLB 1E36B 1C1SA 1ELVA 1K2I1 3BG8A 1U6QA 1QQ4A 2W26A 2GT8A 2ZFQH 8KME2 1QR3E 1P05A 1DLEA 1O2WA 1GJ6A 2VIDA 1C2JA 1SOZA 1ID5H 8LPRA 4NIWA 2ZDKA 2VVVA 1DVAH 1G3DA 2OC1A 3A84A 2BVRH 4GVUA 2OC7A 1GBFA 3TIUA 4BOHA 3BTWE 3ATKA 1E37B 2R3YA 3MH5A 2PKSB 3TITA 1TX8A 4X2VA 1EUFA 1SLWB 1QB1A 1AVGH 3GYMA 1GI8B 3RU4D 3RXQA 2UWLA 4ZXYH 1O0DH 1LDTT 4JCNA 1SG8B 1OWIA 3JZ1B 2CF8H 1BTWA 3A8DA 1A0LA 1BTYA 1RIWB 3F1SB 5JB9S 2XBXA 2AYWA 3ZVGA 4DGJA 2XBYA 1PPGE 3CENA 4Y7BA 3SGQE 3ZZDA 4DIIH 1VITH 3GYLB 3SOSA 4NIXA 1L1GA 1PPCE 4X6OA 1NC6A 2O8MA 2ZDMA 3RXCA 1TBRH 5HM9A 4JZIA 2H9HA 4H6TA 2LNCA 4CHAC 1HAOH 4OS1A 2EI7A 3LC5A 1A0JA 3KL6A 3U69H 4VGCC 4AG1A 1C5NH 3P8FA 1CA0B 4O9VA 1YPGH 5DO4H 3VB6A 3EDXB 1ANDA 3Q00A 1TGSZ 4X0WU 4B75A 1CT2E 1ZHRA 1V2LT 1ZJKA 1Y3XA 3QN7A 3UR9A 2A4RA 1NM6A 3SU4A 1O2SA 1O5GH 2F9VA 1YP9A 2XCNA 1J17T 1P04A 1H9LB 1TNJA 1BTXA 1TNIA 2CHAB 1KYNA 1HAIH 3U8RH 1GMDG 1F0TA 2QXHA 3Q3XA 1ARBA 1MUEB 2BY8X 1GMDF 2PFEA 1BBRK 5T6DA 1EOLA 2GCTB 4INLA 1S0QA 1EP5A 1ZPCA 3SORA 5FCKA 2BD9A 5EGMA 3LONA 1UVUH 4ABAA 1V2MT 4J1YA 4B71A 2YNAA 4KELA 1EZSC 1TNLA 4SGAE 2A5KA 2R2MB 2ZCKP 3A8BA 2A7JA 3MTYA 1GVZA 3RLYH 1Z1JA 1CGHA 2TGAA 1PQ5A 2ZHFH 2XRCA 1BT7A 2ZTXA 1A2CH 1QB9A 1C1UH 3A81A 5JBBS 1C1OA 3ZVEA 3KNXA 5C67A 2GMTC 2FZZA 3ZVAA 1QJ7B 2ZCLP 4SGBE 3MU8A 3H7TA 1CA8B 3PV4A 4NCYA 2BXTH 1BB0B 1C2GA 1OYTH 4Y8YA 7KMEH 2FOCA 2O9QA 4XBCA 3SQEE 5CHAC 1IQJA 2VINA 3A85A 3RM0H 3VB3A 1RTKA 1XX9A 1WBGB 3BTTE 1LMWB 1NFWA 2FOMB 1BMNH 1P57B 2AH4X 2WV5A 3V13A 1A5IA 3HGNA 1P01A 1OPHB 5C1YA 4TWYA 2J2UA 1HLTH 3EE0B 3GCHC 1G9IE 4NWLA 1CGIE 1O3MA 6ESTA 2SFAA 4ABDA 4ZROA 5AFZH 1UVOA 2F83A 3UREA 4NSVA 4Z0KA 1P9SA 1L2EA 2ZFRH 2SNVA 3GCTG 4U30A 1GBAA 1LCYA 2Y82A 3NK8A 3SNDA 1ANCA 3AAVA 1O2IA 3H5CB 3K2UA 1FQ3A 1HXFH 5AVDA 3KHVA 2RDLA 2P59A 4AFQA 4ABEA 2B0FA 2J95A 1GJ9B 3U8TH 1BZXE 2V3OH 2STAE 4FVBA 1EAXA 1SLVB 2V35A 1O2RA 1ZSLA 1P2OA 3P6ZB 1KLIH 1YM0A 1UJ1A 3H7OA 3K9XB 1XUKA 1FAXA 2P3FH 1HAGE 1K1LA 3PWCA 2PKSC 4FU7A 1SLUB 4BXSA 6GCHF 1GI5A 2ZPRA 4AGJA 1MU6B 2NWNA 5FPTA 2JETB 3VEQB 1F92A 2QN5T 3BTQE 4B76A 3UOPA 1XM1A 2FOAA 2FODA 5FXLA 2FI4E 1AVXA 3LGTA 1TPSA 1UCYH 2BOHB 4J2YB 2ZGXH 5EQRA 3K6YA 3NWUA 4GCHF 1P2MA 3GOVB 3RP2A 1GHAG 2WV4A 3N7OA 2TRMA 2Y5GA 3TJVA 3E1XB 4X8TH 4HFPB 1C5LH 2BD4A 3LT3A 2FEQH 5EPYA 2C3SA 2FOFA 5A09A 2VVCA 1FV9A 2PWXA 1C2KA 3U9AH 3SJIA 1UCYK 4ZKRU 1E34B 1JRTA 1DE7H 1DWCH 4GPGA 3RXBA 1MMJN 2FX6A 3A82A 2ZU4A 2C8YB 2BDIA 1YC0A 6LPRA 1GBDA 2Z3EA 4AYYB 4A1XA 1EZQA 3TJOA 3CS7A 3SV2H 1LO6A 2HPQH 2YOLA 5DJ7A 1DSUA 2ZGJA 1GJ4H 2FS8A 1GHZA 2JKHA 1MD8A 2GV7A 1AN1E 2VH6A 1E35B 2R2WU 2WPIS 4R8TB 3HPTB 1BRBE 3V7TA 3IITA 4Y0ZE 2GP9B 2HVXA 3SQHE 1PQAA 1CT0E 2BQWB 3SNAA 1O31A 1ELDE 1TNHA 2W3KA 1QL7A 1QA0A 4ZKNU 2FI5E 2HOBA 5PTPA 3RMOH 2YNBA 2ZFTA 1NU9A 1WCZA 4MNYA 4BAKB 5CE1A 3UQOA 5AFYH 4ZKSU 2Z94A 3SI4H 1D6WA 2ZU5A 5EXNA 3O8BA 5DG6A 1GBCA 2AFQB 1DUAA 1OWKA 1FY8E 3RXHA 1IQEA 4NA8A 2UUJB 3LJOA 4Y8ZA 1BTZA 1H8IH 1SLXB 1KDQB 7GCHG 1C9PA 1MCTA 1P02A 2BZ6H 3RM2H 3EA7A 1SQTA 1ARCA 3M3VA 1K1OA 1O5AB 1NRSH 2BD3A 1SR5C 7GCHF 3OU0A 1YLDA 1ANEA 2GX4A 1LVOA 3NXPA 2WUBA 4DURA 4XSKU 3ZZBA 2BZAA 2PTNA 4INKA 1UTPA 4GLYA 3UNRA 1VITG 2AGIX 2ZG0H 1P2JA 3PO1C 1C5QA 3SJ9A 1GMCG 1Z8IB 2BLQA 3BTFE 8GCHG 2BLOA 1NN6A 3E90B 3GDVA 3RXJA 2G5NA 5EW1H 1B0FA 4Y71A 2A5IA 4K1TA 1GI1A 2BM2A 1CO7E 1WTHD 4NWKA 1KY9A 2A32A 1LVMA 1AFQC 1MAYA 4K69A 3GY2A 5LGOA 4DOQA 4ISOA 2SNWA 4I8KA 3T26A 5GCHG 1MTNB 1K1PA 1C5YB 3C1KA 3OSYA 2UUYA 1PPBH 1EJMA 1HJ9A 1UCYE 1NU7B 1Y3VA 1FY5A 3W94A 1C1TA 3SJKA 1HCGA 4Q2KA 1A0HB 2QC2A 3MH6A 1W12U 2PKAA 4HI3A 3TK6A 2ZHWH 1AB9B 1C4V2 1PPHE 4MLFB 3EQ0H 2KAIB 2PGBB 1F5RA 1GL1A 1TX7A 2FWWA 2UWPA 2CJIA
chains in the Genus database with same CATH superfamily
4YESB 5HM2A 3SBKA 1BMAA 2XBWA 2A0QB 2C4FH 4MNWA 5DP4A 2BD7A 3A80A 1JWTA 3M36A 2VVUA 3P92A 1GJDB 2ODPA 1IQHA 1BDAA 2H5CA 5IK2D 2J92A 3LGUA 1TNGA 1SVPA 1D3QB 3D65E 4Q80A 2SGFE 2GTBA 3FANA 2BXUH 3SUFA 3SUDA 1BMLA 3L6PA 3RMNH 5SGAE 1V2NT 1EXFA 1TPPA 2WYGA 2HLDD 1FXYA 1AMHA 4XRNA 3SU6A 4AGKA 3PYHA 2ZU3A 3I77A 4FUCA 3B23B 3VGCB 5GXPA 3P8GA 4ZKOU 4UFGH 1NS3A 2BDYA 2Z3CA 1MTVA 3BTKE 1OS8A 1ELFA 1HJ8A 1O34A 1P9UA 3RU4E 1O2LA 5B6OA 1MTWA 3RXIA 1F5LA 4AB9A 4HG6A 1ABIH 1V2WT 4P00A 3RXSA 5I46H 3E8LA 5C94A 4Y79A 3NCLA 1DXWA 1QB6A 4LOYH 3S7KB 4BTUB 2R0LA 1UK2A 3MNSA 1PQ8A 2ZCHP 1L0ZA 1LVYA 2NU3E 1IQNA 3KN2A 1C5RA 1O5BB 2GJGA 3BTDE 2ZGBH 1JBUH 3ZZ5A 1TLDA 1G36A 4RT0A 4ACBA 1LHFH 5JBAS 2ANWA 4WWYA 1H1BA 1BRAA 3GY3A 5KGOA 3M3TA 1OWJA 1XMNB 1C5SA 3QZRA 5K0HA 3BTME 3RXKA 1FDPA 2EY4C 4ABFA 3OFND 1D4PB 3AVZA 1C4U2 4U32A 3GISB 2ANMH 1JIRA 5C5NA 3HATH 4H6SB 5E0JA 2DE8A 1FMGA 1Z6EA 1UHBB 4OS2A 3SU2A 3KQDA 2XWBI 4ZHLU 1Y3WA 1DSTA 5C1UA 1SBWA 3VG8A 3E0PB 2AGGX 3RXAA 2PKAB 1FY3A 1ZMNA 2ULLA 5DKMA 2CMYA 1GI7B 4M9FA 1V2VT 4AG2A 1ZZZA 5BRRE 2VWMA 1O3IA 3MOCA 4FUFA 3SV7A 4LK4A 4IN1A 3KQBA 1B0EA 1VKYA 4TSFD 2B8OH 3PTNA 1H9HE 3EE7A 4B73A 1V2JT 2OC0A 4TY6A 1K1JA 1W13U 2KFWA 1T32A 3GCHB 4ABBA 3RXGA 2C8WB 3GDUA 3MNBA 1D9IA 1DOJA 4ZHMU 4ZUHA 3LH3A 1N6YA 5A0CA 1O5CB 5EPNA 3W1EA 1CQQA 1H9IE 5EJ1A 2G4UA 3UTUH 3F9FA 2XYAA 4AYVB 2D26C 1ACBE 1D6RA 1DY8A 1TPAE 4CBOA 2G8TA 2VGCB 1Z7KA 1ZTKA 3K65B 4FETA 1DDJA 5FAHA 6CHAC 3FP6E 4I8GA 1LVBA 3PO1B 4E7NA 2G81E 4O97A 3A86A 3F3BA 1TA2A 4MPXA 4NIYA 3Q76A 5I25A 1AVWA 1QIXB 5DP6A 3ESTA 3U28C 4Q7ZA 2Y81A 2A45B 4ZXXH 5GIBA 5EJLA 4OGXA 1GWAA 4X6MA 2WYJA 1EPTC 1QRXA 1SB1H 2AIQA 3BIVH 1YPEH 1E0FD 3QLPH 1V3XA 3A8AA 4CRFA 2K8IA 1SFIA 1C5XB 1T4UH 1NFYA 3A7ZA 3MU0A 1V2OT 1J9CH 1XVOA 1G37A 1MQ5A 1PPFE 3SHCH 3R3GB 2Z9GA 1T8LA 3FVFB 1GHYH 2ZNKH 4UFFH 4IS5A 2IJOB 5F8XA 1OOKB 4A6LA 1FIZA 4BAOB 4JK6A 1EATA 1H4WA 1ZSJA 3RXLA 3AAUA 4CRAA 3OEHD 4NG9H 3E6PH 1C5ZB 2O8TA 2FP7B 2Y5HA 4IC5A 1HAVA 2J98B 2QV1A 3PRBA 2UWOA 4X2XA 2JH0D 3V12A 1AB9C 5LPFA 1HAVB 1GGDB 2J98A 3I29A 1UK3A 3NRLA 1NTPA 1TRYA 3S0NA 1UTKA 3PM3A 2G51A 3NZIA 1C2EA 2GD4B 1DS2E 2IN2A 4MNXA 1OHHD 2KM0A 1EAWA 1WV7H 2J94A 2ZEBA 3KIDU 1QGFA 1S6HA 3M7TA 1JXPA 1NRPH 1NT1A 1W14U 1O32A 1IQLA 1W0ZU 1SGTA 5FL7D 4DCDA 1TPOA 3AASA 5DP7A 3L33A 1ANBA 4IBLH 2ZO3H 2XBVA 3ZZ6A 1BJUA 3TU7H 2HRVA 4E05H 2W5EA 1HGTH 5IDKA 1O39A 2VWLA 1AFEH 2TGTA 1VCQA 1AUTC 5FX5A 5FHTA 4Q4LA 4GAWA 3BTEE 2THFB 1HYLA 4OM9A 2EI6A 2QXIA 1F0RA 3GY6A 1Y5AT 4WF8A 2OUAA 4GHQA 1DFPA 1QY6A 1K9OE 4XD7D 4YOGA 4CBNA 5H4IB 5C0TA 3DD2H 2JJ1D 3N7DA 1ELCA 1RIWC 3BN9A 3IWMA 5TCCA 2BY7X 1O2ZA 2XTTB 1TRNA 1TOMH 4FUDA 1O5DH 3HGPA 1W7XH 3LGVA 1SGEE 2VIVA 1KXEA 1OWEA 5DPAA 5FCRA 4WXVA 1SGFA 4CHAB 1C1NA 4DG4A 1O36A 1KXCA 2C93B 2HGTH 1CA0C 3PV2A 5AHGH 5JPMH 2J97A 3A87A 3A89A 3PV5A 1WAYB 2GCHG 5GPIB 1Y5UT 1WU1A 1OX1A 2GV6A 2FYRA 4D8NA 3M5LA 1F0SA 1DPOA 1IQFA 3FZZA 4YOJA 3BEFB 3TLOA 1GJCB 1O33A 2DE9A 2H9TH 1GBKA 2BVXH 1W3CA 1WOFA 2KCYA 1OWDA 1L1NA 1RTLA 4YXWD 4B6FA 2Z6BD 2OXSA 2CHAC 4AOQA 3D62A 4I8HA 2F9PA 1V2QT 1C2HA 2B7DH 4TYDA 1RRKA 3UFAA 1EB2A 2QF3A 2XC0A 3P8OA 1NPMA 4JYTA 5ETXA 4BNRA 3SV6A 1HIAA 1YCPK 2V7QD 3GDSA 4CRCA 5T6GA 3TGKE 2H9EH 4K1EA 2QXGA 4CREA 1XUHA 2XNIA 3ATLA 1XKAC 1TOCB 1GMHF 2OK5A 6GCHG 1Z1IA 2ZGHA 1TFXA 5EU8A 5FX6A 4X6NA 1O3DA 3SHAH 1FUJA 4ABJA 1IHTH 2PHBA 1LQEA 4JZFH 3E0NB 4Y8XA 1GI4A 5K7RA 1O3JA 3IG6B 1WQVH 1TGCA 3EA9A 3SN8A 3SU5A 5TCAA 4Y76A 5EG4A 1RD3B 3F9EA 2PP6A 3LC3A 3MO3A 4U01A 1ZRKA 3A8CA 1BTPA 1SFQB 4RN6A 4AB8A 2ZFFH 2D8WA 3MH4A 1P10A 4GUXA 1AWHB 1MTSA 1GVLA 2R0KA 1C1VH 3CP7A 1ZTJA 4BANB 3C27B 1EPTB 3MYWA 3RLWH 1HB0B 1OKXA 3HKIB 4AFUA 2HNTF 2F91A 1AO5A 3MH7A 1AI8H 3S9BA 3P95A 3OAAD 3QWCH 1VCWA 3P8NA 1TONA 1Y8TA 1ESAA 1QURH 4MDSA 3D23A 1UTLM 1L4ZA 4OS4A 1TBQH 3VB4A 4D9QA 4ISHH 1EAUA 1AIXH 3BTGE 1SGNE 1TGNA 3T28A 3F2HA 1IQKA 2QE7D 1AE8H 1GI3A 1UO6A 2BY9X 1KIGH 1E79D 4BXWA 1CHGA 5HKKD 3VPKA 5JB8S 3DFJA 3SGAE 3FAOA 1IQGA 3LGWA 4U2WA 1CGJE 5DGJA 3NUMA 1DWDH 2BMGB 3UUZA 2CN0H 4K3JA 2XNDD 4JYUH 1D3TB 1W7GH 3LIWA 2R9PA 1BQYA 2P8OB 1BMMH 1BITA 1ELGA 1KDQA 1N8OC 5GDSH 5C2ZA 4D7FA 1E1QD 3SU1A 1GBEA 4WJG2 4DY7B 4KTSA 4IC6A 4O03A 2WPKS 4ASHA 2PSXA 1TWXB 3DUXH 3BTHE 1VGCC 4UE7H 3RC4A 1GBMA 1KLTA 3E16B 1C9TA 1S0RA 4JZDH 1O3NA 2QF5A 1QZ8A 1C5MD 1YGCH 5IYTA 1YPHC 2RA3A 1TB6H 1UVSH 1HRTH 1EB1H 2YMSC 4FUHA 1SHYA 2C8ZB 1THPB 3F9GA 1MTUA 4NA9H 1O3GA 1GJ7B 4KTUA 5HMAA 1AQ7A 4HTCH 5FBEA 2JETC 1MABB 2AS9A 2EA3A 1YBWA 4BTTB 2XC5A 1Y59T 1GDUA 1KSNA 2FTMA 3N7EA 3UY9A 3O8DA 4K60A 3SUEA 1C1MA 4KGAA 3RXUA 4OS6A 2PUXB 2WINI 1C2IA 5LH8A 3A7YA 2ZWLH 5LPEA 1FX0B 3M37A 3U8OH 4BTIB 1S81A 1ETSH 4XFQA 1V2KT 3VXEH 4B2BA 9LPRA 5CMXH 1ZOMA 2W6ID 2ZQ2A 2VIQA 1FPCH 2BD2A 2OLGA 3RMMH 3V0XA 2TGDA 5JBCS 1W0JD 1ZHMA 2ZFSA 1F7ZA 1YPMH 1XXDA 4NZLA 4B74A 2RA0A 1D3PB 2VH0A 2OP9A 3ZVCA 1TMBH 2FM2A 5C3NA 4X2WA 1C5OH 1C5VA 2FESH 3VFEA 4DIHH 1S6LA 3GY7A 4R0IA 1YLCA 3QDZB 3MU5A 2J4IA 2AERH 1DT2A 1PJPA 1NRNH 1GHVH 1ZGVA 2VWOA 3SI3H 1NZQH 3SO3A 3SNEA 1C2FA 1AU8A 1S82A 1F2SE 2RG3A 1JOUB 2J38A 2I6QA 4BAMB 3ZZ9A 1P03A 5E0HA 1EQ9A 2ZPQA 2BOKA 3PMJA 5HYOA 2EC9H 1Z8RA 2OQ5A 1O2YA 3AW1A 5EQSA 1CHOF 1QRWA 4RKJB 4I8JA 3T2NA 4KKDA 1NRQH 1A5GH 1O2KA 2QAAA 3Q77A 4A1TA 5CHAB 3QTOH 1P8VC 5FPSA 2VJ1A 2NU4E 4XBBA 3CNRA 4WXIA 3S9CA 2VB0A 1O2GH 2EI8A 1O2VA 2ZF0H 1DICA 4YO9A 3SZNA 1ETTH 3MI4A 4WVPE 2XXLA 1MCVA 1O37A 1MD7A 2ZFPH 1LKBA 3PMHB 1SGRE 4B2AA 1K1MA 1O2OA 1A4WH 2V0BA 2O8WA 5F8ZA 1HBTH 3URDA 3SU0A 3O8RA 2G52A 1A46H 1OP8A 1BBRE 1YF4A 1PYTC 3MU1A 1O2HA 2LP6A 3OX7U 2SGEE 4K2YA 2HVYB 3ATIA 1ZPBA 1ZRBA 3LGIA 2W7UA 2A31A 4IW4E 1EASA 2ZHQH 1W10U 1ELBA 3S9AA 3WY8A 4ACAA 2GDDA 1TNKA 3F68H 4UEHH 3SYJA 3TNTA 2OTVA 1AFQB 1RTFB 3M61U 3ZV8A 2SGAA 3JZ2B 1J16A 2QIQA 2D1JA 3SZEA 1ABJH 1AE5A 1F5KU 4GCHG 2PUQH 1GHAF 3UWJH 1ZYOA 3PLKA 1SI5H 1C5PA 4TY7A 1A3BH 3A7VA 5A0BA 1P06A 4DT7B 1VITF 2L74A 5C20A 2QGRA 4WH6A 2J9NA 4X1QU 2KZ4A 1QBOA 4NFFA 1GJBB 3MMGA 4YTAA 4A92A 9ESTA 2Z3DA 2AMDA 3BG4B 2BX4A 2PR3A 4LZ4B 5ESBA 1LTOA 4FUJA 1V2PT 3GY5A 2ZIQH 5EIYA 1GBHA 4Y6DA 1C2DA 1VJAU 3K6ZA 1GJ5H 3RXEA 4BAHB 1UTJA 1MBMA 1QBVH 2HALA 1SC8U 2FDAA 1NO9H 2IOTA 4PROA 3RU4T 1UVTH 1TA6A 2P95A 4IMQA 2WUCA 3LGYA 1OP2A 3PTBA 3SJ8A 4ISNA 2NU2E 2QYIA 4JYVH 4CH8B 5C0UA 5JYIA 2HNTE 3A83A 1K1NA 1G3EA 1UHBA 3SV9A 1AKSA 3ZYDA 4WMEA 3M5NA 3ZYEA 1C5WB 5EXLA 1YPKH 4XDEA 3S7HB 5DP5A 1UTNA 4THNH 2BLWA 5FPYA 1YLNA 1Z8GA 4GHTA 1SGIB 3QO6A 3ZZCA 4ABGA 1SQOA 1TYNA 3VB7A 1O3EA 1X7AC 1O3PB 4X6PA 3OTPA 3MO9A 2ZPSA 3GCNA 3OEED 3DSGA 2AMQA 1DITH 3UIRA 4FXGH 1VZQH 1GBBA 3SU3A 4TPIZ 3W95A 3BSQA 2HLCA 5L2YH 2H2ZA 5A8XA 2BDGA 4IN2A 3DA9B 1TE0A 2BD5A 2ZHEH 1GHXH 1SGCA 2C90B 3P70B 1MAXA 5HGGA 1TALA 4Y0YE 4ZCNA 2Y80A 3NKKA 1HXEH 1NROH 3MU4A 3RXDA 2AIPA 1HPGA 2WPDD 1YKTA 4Q63A 5DK1A 1GBJA 5GJ4B 2ZGCA 1ZMJA 2CV3A 1O2NA 3MNXA 4UFEH 2Q6DA 4FUIA 2TGPZ 1C4Y2 3OY6U 1WTGH 2VIOA 3TK9A 4JMYA 1ELAA 2ZDNA 3H09A 2G55A 3U1JB 5JBTA 1SQRA 2P16A 1EX3A 1V2UT 1UK4A 2OC8A 3MNCA 1DLKB 1AWFH 1LHDH 3UOUA 2BHGA 1G2MA 2GGVB 1C1WH 2G00A 4XOJA 3V3MA 1FY4A 3RXMA 3FP7E 1O3HA 3A7WA 2EEKA 1GHBF 1GCTB 3Q3KA 3STIA 4FU8A 1Z8JB 2FTLE 5E8EH 4K5ZA 3TGIE 1SHHB 1YCPM 5FBIA 1EKBB 3FN8A 4A5TS 1W2KH 4LXBH 2OBQA 5A0AE 1SQAA 3UPEA 1RS0A 2Y7XA 3ODDA 1ZJDA 3ZZ3A 4VGCB 1O30A 4FUBA 1A1RA 4I32A 2ZKSA 5GNDA 2BQ6B 4AORA 1O2QA 2P3UB 1GBTA 3PMAB 3I78A 3ATMA 4Q7XA 1BRCE 2TPIZ 2SGDE 1P12E 3STJA 1WYKA 2GT7A 5GWZA 4K8BA 2ZZUH 1C2MA 3ZZ8A 1XUIA 3RXTA 2C8XB 1V2ST 2D2DA 4ISLA 1GI9B 1KLJH 1D3DB 2FS9A 1GG6B 3LU9B 1PPZA 3ZZAA 1ELTA 2A7CA 1UMAH 3M35A 1PFXC 2NU0E 1P2QA 1AY6H 1MTNC 4NZQA 1ETRH 1VJ9U 1LQDB 1YPLH 2AGEX 3FFGA 3TH2H 1T8OA 1A5HA 3DHKH 5E2PA 4FUEA 4MPUA 4YLUA 2P8OC 1WUNH 2L6OA 1OXGA 5F6MA 1OWHA 1BMFD 2VBCA 3SUGA 1KTTB 5DP3A 2GCTC 2ALPA 3FKSD 3T5FH 1MKXK 2ZC9H 2QA9E 1CVWH 1IAUA 1W8BH 1W0KD 3B8JA 1TX6A 2ZA5A 4ZAEA 5T6FA 3KF2A 2TIOA 1S85A 1O2JA 2STBE 1A61H 2BDBA 2G5VA 2BY5X 1O3FA 3GY8A 2PSYA 4Y10E 3RXFA 3LJJA 3OY5U 4FVDA 4Y11E 1Q31A 2A7HA 4B2CA 1MKWK 1CU1A 1GDQA 1GI6A 1O3CA 3MFJA 4FUGA 3F9HA 1DUEA 1FN6A 3GCOA 1J14A 4ZH8A 4MNVA 1WSSH 4E7RG 4ZMAH 2GCHF 4YT6H 2IJD1 3A88A 2A2QH 3GCTF 3MWIU 4UDWH 2SGQE 1GGDC 5C1XA 3ODFA 1QNJA 3TVJB 2ZDLA 1TGBA 3MQKC 4WMFA 1ESTA 1QA7A 2LELA 1O3LA 3RXOA 2F9OA 4F49A 5A2MH 2R3UA 1C2LA 1QQUA 3SNBA 1DXPA 5EW2H 3FOAA 3BV9B 4E06H 2WPLS 3ZVDA 1DWEH 1DWBH 1Q2WA 1ZHPA 1P09A 2VIWA 1GMHG 1HAHH 1YYY1 5DP9A 2ZP0H 2OINA 2KCOA 1BRUP 1O3AA 3DFLA 4RI0A 4MG3A 1RXPA 4UD9H 1CBWC 4K1SA 4TPYA 1EJAA 5ESTE 1GI0A 1AUJA 2JH5D 1E38B 2CXVA 5L2ZH 1FN8A 4RKOB 1K1IA 1BJVA 4H42U 1K21H 1SGPE 1J8AA 1W11U 3SJOA 2F3CE 4DVAU 1RGQA 1HIAB 3AW0A 3LKWA 4KP0A 1O2UA 4M7GA 5AF9H 2ZDAH 5ABWA 4RSPA 2RCEA 1QJ6B 4MVNA 1VR1H 1XUFA 3FO8D 3B9FH 3A7TA 2I6SA 4O3TA 2XWAA 1FPHH 2Y6TA 3Q3YA 4ZHAA 5J4SA 1FY1A 2P93A 3LOXA 1G32B 2GKVE 3LPRA 2BX3A 3WWFA 1GL0E 3QTVH 2Z9LA 2GVFA 2W6JD 1SSXA 3HKJB 3UWIA 3UNQA 3WW7A 2BTCE 1KXAA 1HJAC 1HDTH 2FLRH 1ZSKA 1T31A 3PROA 1QRZA 1K22H 1MH0A 1O3BA 3EGKH 4ASUD 4JZEH 1BBRH 1Q3XA 1S83A 1TGTA 2J5UA 3F2GA 4ISIH 4QT8C 1ZR0A 1NRRH 1LPGB 1IOEA 5BPEA 1GCTC 4WMDA 3TJNA 1EPTA 1C5TA 4D9RA 3P17H 2A4GA 1P3EA 5A8YA 4YOIA 1T8MA 1IQMA 3PRDA 2FYQA 5EQQA 3ZZ4A 4XBDA 2VGCC 4TWWA 4A7IB 2BYAX 1TIOA 4DW2U 1T4VH 2F9UA 1KXBA 4B1TA 6CHAB 3MHWU 4AN7A 3L3TA 2VWNA 3RDZA 3U1IB 1NFXA 3CS0A 3F2FA 7ESTE 1IQIA 4KTCA 1HV7A 1O5FH 1TABE 2OD3B 4OS5A 5A8ZA 1V2RT 1J15A 5C5OA 2CF9H 2QY0B 4I7YH 1EFRD 2A1DB 1GJAB 1SGQE 3M7QA 1UVPA 1V2TT 2V3HH 3KEEA 2ZU1A 2FOBA 1GG6C 3KQCA 1ZTLA 1QHRB 4AFSA 1BUIA 1C5UA 1COWD 3HK6B 2XCFA 3UNSA 1YPHE 2Y5FA 1HAYB 1NESE 2WZQA 3FZDA 4ABIA 1MKWH 3VGCC 2J34A 2WPJS 2FIRH 3RXVA 3E3TA 2AEIH 1K28D 2FOGA 1H8DH 2ZU2A 1HAXB 2A4QA 1W0YH 2HPPH 1N6XA 2FX4A 2NU1E 2BLVA 3MO6A 2LPRA 3KYFA 1Y3YA 4CRBA 1P2NA 2WV9A 1M9UA 2Z9IA 4OS7A 2W7SA 3OE7D 2GZ9A 2ODQA 2P94A 1G2LA 1ZGIA 1QFKH 4AZ2B 4X2YA 4X1SU 3EA8A 1Z71A 1AZ8A 1GJ8B 1EP6A 4I31A 3OTJE 2PTCE 4XE4A 1O2MA 4CRDA 2FI3E 2ZI2H 3G01A 2B9LA 1G30B 4O3UA 1XKBC 1ZPZA 2ZDVH 2Q6FA 5L30H 3R0FA 3RC5A 1GDNA 3UR6A 2OCVB 4A1VA 1KTSB 2GDEH 1NBMD 5T1VA 1BOQA 5J4QA 5EODA 1FIWA 1PYTD 2F9NA 1YCPH 4YM9A 4CR5A 4YLQH 3BIUH 4P02A 3T29A 4CRGA 1LPKB 1IHSH 3TGJE 1P2IA 3A7XA 1CE5A 3KYGA 3ZV9A 1EOJA 2K1QA 4YT7H 2CGAA 2PV9B 3LDXH 1CT4E 1N8OB 3ZVBA 2EQNA 1B7XB 2B5TB 1BHXF 1QL8A 4RT1A 4Z6AH 3GS9A 3M5MA 3TH3H 1TAWA 3LH1A 1VGCB 1O3OA 1CBWB 1XUJA 3SNCA 1GVKB 2UUFB 1CHOG 1KXDA 1O2PA 2H1UA 4CH2B 2V6NA 1LHGH 3TH4H 1DY9A 1FNIA 1L1JA 3RC6A 1GHWH 1E1RD 2P3TB 1EZUC 1F0UA 2Z9JA 4F4OC 1CSOE 4UFDH 1T7CA 3GICB 4YZUA 1ELEE 1HFDA 1TBZH 1S84A 1SOTA 1DANH 1LHEH 4MPVA 1TMTH 3N99A 2DUCA 2OQUA 1LKAA 2K0QA 1HNEE 1BCUH 1DX5M 2UUKB 1LPZB 1XVMA 2H6MA 3NPSA 3TK5A 1A3EH 5L6NH 1G3BA 5E0GA 1HAPH 1BA8B 3GY4A 1MQ6A 2XW9A 2JDID 4JZ1A 1A7SA 3PLBA 1BTUA 4F48B 1LHCH 3KCGH 2Z9KA 1B5GH 2BVSH 3D49H 4HGCA 1V6DA 5F03A 2BY6X 3U98H 1NY22 1PQ7A 1L4DA 3QZQA 4MQAA 3T25A 4WH8A 1EAIA 3URCA 2M2AA 1H8ED 1T8NA 1QJ1B 3EYDA 4AX9H 4X8UH 1MZDA 5G4BA 1EZXC 4I8LA 1YPJH 2F43B 1GCDA 3T62A 2VIPA 4OGYA 1THSH 2GZ7A 4INHA 2ILNA 4X1RU 3ENSB 3KQEA 1ORFA 4Q7YA 1GMCF 1BTHH 3TNSA 1AHTH 3PMBB 4MTBA 2GZ8A 4WY3A 2O8UA 3RXRA 4NIVA 5EXMA 4NA7A 1DM4B 1P3CA 1YY3A 3KGPA 3QGNB 3QGJA 1UTQA 1MU8B 2G4TA 3BEIB 1AKSB 4AFZA 1VCPA 2XOKD 8GCHF 1RJXB 2Q6GA 2CK3D 2A2XH 2VU8E 3PLPA 1QCPA 2QF4A 1AD8H 2PGQB 3SV8A 1ESBA 2AMPA 2FOHA 4D7GA 2TBSA 1TQ7B 1FAKH 1MBQA 4I86A 1OYQA 2JH6D 4X8VH 3VXFH 1QTFA 5HXFA 1RFNA 2OBOA 1QBNA 1AZZA 4ABHA 1XXFA 2BDAA 1JRSA 2FMJA 3M5OA 5EOKA 1O35A 1XUGA 4I33A 1PPEE 2QF0A 2H5DA 5GCHF 2BDCA 3TJUA 3QK1A 1UTMA 3T27A 1QL9A 1C1QA 2HNTC 1WDIA 4NSYA 3DSOA 1G3CA 4JK5A 2BD8A 1KXFA 2XC4A 5E2OA 2PLXA 3F0PA 1P11E 1HAZB 3E91A 1MZAA 2O8LA 4NGAH 2ODYB 5TJXA 1P2KA 1ZLRA 4D76A 3BF6H 2ZTZA 2A4OA 3O8CA 1OP0A 3ITIA 3QX5H 2ZQ1A 1GI2A 1UTOA 1FLEE 1SPJA 3TPIZ 2ALVA 2FOEA 3M3SA 1FI8A 1MKXH 2BB4A 3ZVFA 3RXPA 2QXJA 2FO9A 1SGFG 1EJNA 3M7UA 2PW8H 5F8TA 2KR7A 2KAIA 5JDUB 3RMLH 1S5SA 2M5TA 4IGDA 1N1LA 1BHXB 1Y3UA 1SGYE 2ANYA 5LPRA 2ZECA 3UQVA 2Z7FE 1SMFE 2VNTA 1THRH 1Z6JH 1GHBG 1BIOA 1ZMLA 4ESTE 3RUOA 1O2TA 4IMZA 1GPZA 3F6UH 4H4FA 4FU9A 2BQ7B 8ESTE 4X8SH 2GMTB 2Y7ZA 4UONA 3BEUA 1TMUH 2RDEA 1S6FA 5C17A 1AGJA 1OSSA 4BAQB 1NFUA 4CR9A 3BG4C 4Y7AA 1FZZA 1WXRA 3HK3B 3PWBA 4LZ1H 4MPWA 3EAJA 3KQ5A 1O2XA 2SGPE 4NFEA 3SW2B 2ESTE 1TRMA 4HZHA 1GBIA 1HJAB 1SGDE 4K8YA 2FXRA 1JMOH 1O5EH 2IPHA 2YMSD 1TQ0B 2Q1JA 1O38A 3QUMP 3VB5A 1INCA 4DJZB 2A5AA 2FPZA 2ASUB 2ZHDA 3OYPA 1KMHB 2W3IA 5DP8A 5T3HA 2WPHS 1C1RA 1HUTH 2QCYA 1GBLA 4GSOA 2WPMS 3PB1E 3SGBE 1C1PA 2ANKH 1Y5BT 3ATWA 3ELAH 4X1NU 4X1PU 1O3KA 7LPRA 2BDHA 3S69A 1SL3A 1FJSA 3FP8E 3DT0H 2F9BH 2ZTYA 1WQSA 4DT4A 3ZZ7A 1JIMA 2KCAA 1FONA 2FLBH 1P0SH 2HWLB 1E36B 1C1SA 1ELVA 1K2I1 3BG8A 1U6QA 1QQ4A 2W26A 2GT8A 2ZFQH 8KME2 1QR3E 1P05A 1DLEA 1O2WA 1GJ6A 2VIDA 1C2JA 1SOZA 1ID5H 8LPRA 4NIWA 2ZDKA 2AHME 2VVVA 1DVAH 1G3DA 2OC1A 3A84A 2BVRH 4GVUA 2OC7A 1GBFA 3TIUA 4BOHA 3BTWE 3ATKA 1E37B 2R3YA 3MH5A 2PKSB 3TITA 1TX8A 4X2VA 1EUFA 1SLWB 1QB1A 1AVGH 3GYMA 1GI8B 3RU4D 3RXQA 2UWLA 4ZXYH 1O0DH 1LDTT 5EJZA 4JCNA 1SG8B 1OWIA 3JZ1B 2CF8H 1BTWA 3A8DA 1A0LA 1BTYA 1RIWB 3F1SB 5JB9S 2RFKC 2XBXA 2AYWA 3ZVGA 4DGJA 2XBYA 1PPGE 3CENA 4Y7BA 3SGQE 3ZZDA 4DIIH 1VITH 3GYLB 3SOSA 4NIXA 1L1GA 1PPCE 4X6OA 1NC6A 2O8MA 2ZDMA 3RXCA 1TBRH 5HM9A 4JZIA 1YWUA 2H9HA 4H6TA 2LNCA 4CHAC 1HAOH 4OS1A 2EI7A 3LC5A 1A0JA 3KL6A 3U69H 4VGCC 4AG1A 1C5NH 3P8FA 2YMSB 1CA0B 4O9VA 1YPGH 3UB0A 5DO4H 3VB6A 3EDXB 1ANDA 3Q00A 1TGSZ 4X0WU 4B75A 1CT2E 1ZHRA 1V2LT 1UW7A 1ZJKA 1Y3XA 3QN7A 3UR9A 2A4RA 1NM6A 3SU4A 5F53A 1O2SA 1O5GH 2F9VA 1YP9A 2XCNA 1J17T 1P04A 1H9LB 1TNJA 1BTXA 1TNIA 2CHAB 1KYNA 1HAIH 3U8RH 1GMDG 1F0TA 2QXHA 3Q3XA 1ARBA 1MUEB 2BY8X 1GMDF 4FOUC 2PFEA 1BBRK 5T6DA 1EOLA 2GCTB 4INLA 1S0QA 1EP5A 1ZPCA 3SORA 5FCKA 2F4LA 3AK5A 2BD9A 5EGMA 3LONA 1UVUH 4ABAA 1V2MT 4J1YA 4B71A 2YNAA 5CDFE 4KELA 1EZSC 1TNLA 4SGAE 2A5KA 2R2MB 2ZCKP 3A8BA 2A7JA 3MTYA 1GVZA 3RLYH 1Z1JA 1CGHA 2TGAA 1PQ5A 2ZHFH 2XRCA 1BT7A 2ZTXA 1A2CH 1QB9A 1C1UH 3A81A 5JBBS 1C1OA 3ZVEA 3KNXA 5C67A 2GMTC 2FZZA 3ZVAA 1QJ7B 2ZCLP 4SGBE 3MU8A 3H7TA 5DSFA 1CA8B 3PV4A 4NCYA 2BXTH 1BB0B 1C2GA 1OYTH 4Y8YA 7KMEH 2FOCA 2O9QA 4XBCA 3SQEE 5CHAC 1IQJA 2VINA 3A85A 3RM0H 3VB3A 3DCLA 1RTKA 1XX9A 1WBGB 3BTTE 1LMWB 1NFWA 2FOMB 1BMNH 1P57B 2AH4X 2WV5A 3V13A 1A5IA 2JIZD 4Z1MD 3HGNA 1P01A 1OPHB 5C1YA 4TWYA 1H8HD 2J2UA 1HLTH 3EE0B 3GCHC 1G9IE 4NWLA 1CGIE 1O3MA 6ESTA 2SFAA 3F0OA 4ABDA 4ZROA 2KCPA 5AFZH 1UVOA 2F83A 3UREA 4NSVA 4Z0KA 1P9SA 1L2EA 2ZFRH 2SNVA 3GCTG 4U30A 1GBAA 1LCYA 2Y82A 3NK8A 3SNDA 1ANCA 3AAVA 1O2IA 3H5CB 3K2UA 1FQ3A 1HXFH 5AVDA 3KHVA 5KECA 2RDLA 2P59A 4AFQA 4ABEA 2B0FA 2J95A 1GJ9B 3U8TH 1BZXE 2V3OH 2STAE 4FVBA 1EAXA 1SLVB 2V35A 1O2RA 1ZSLA 1P2OA 3P6ZB 1KLIH 1YM0A 1UJ1A 3H7OA 3K9XB 1XUKA 1FAXA 2P3FH 1HAGE 1K1LA 3PWCA 2PKSC 4FU7A 1SLUB 2IPQX 4BXSA 5DN6D 6GCHF 1GI5A 2ZPRA 4AGJA 4AC9A 1MU6B 2NWNA 5FPTA 2JETB 3VEQB 1F92A 2QN5T 3BTQE 4B76A 3UOPA 1XM1A 2FOAA 2FODA 5FXLA 2FI4E 1AVXA 3LGTA 1TPSA 1UCYH 2BOHB 4J2YB 4F55A 2ZGXH 5EQRA 3K6YA 3NWUA 5KEDA 3DSPA 4GCHF 1P2MA 3GOVB 3RP2A 1GHAG 2WV4A 3N7OA 2TRMA 2Y5GA 3TJVA 3E1XB 4X8TH 4HFPB 1C5LH 2BD4A 3LT3A 2FEQH 5EPYA 2C3SA 2FOFA 5A09A 1SKYE 2VVCA 1FV9A 2PWXA 1C2KA 3U9AH 3SJIA 1UCYK 4ZKRU 1E34B 1JRTA 1DE7H 1DWCH 4GPGA 3RXBA 1MMJN 2FX6A 3A82A 2ZU4A 2C8YB 2BDIA 1YC0A 6LPRA 1GBDA 2Z3EA 4AYYB 1K0HA 4A1XA 1EZQA 3TJOA 3CS7A 3SV2H 1LO6A 2HPQH 2YOLA 5DJ7A 1DSUA 2ZGJA 1GJ4H 2FS8A 1GHZA 2JKHA 3UAIC 1MD8A 2GV7A 1AN1E 2VH6A 1E35B 2R2WU 2WPIS 4R8TB 3HPTB 1BRBE 3V7TA 3IITA 4Y0ZE 4TT3D 2GP9B 2HVXA 2JJ2D 3SQHE 1PQAA 1CT0E 2BQWB 3SNAA 1O31A 1ELDE 1TNHA 5HIYA 2W3KA 1QL7A 1QA0A 4ZKNU 2FI5E 2HOBA 5PTPA 3RMOH 2YNBA 2ZFTA 1NU9A 1WCZA 1NBME 4MNYA 4B6EA 4BAKB 5CE1A 3UQOA 5AFYH 4ZKSU 2Z94A 3SI4H 1D6WA 2ZU5A 5EXNA 3O8BA 5DG6A 1GBCA 2AFQB 1DUAA 1OWKA 1FY8E 3RXHA 1IQEA 4NA8A 2UUJB 3LJOA 4Y8ZA 1BTZA 1H8IH 1SLXB 1KDQB 7GCHG 1C9PA 1MCTA 1P02A 2BZ6H 3RM2H 3EA7A 1SQTA 1ARCA 3M3VA 1K1OA 1O5AB 1NRSH 5B6LA 2BD3A 1SR5C 7GCHF 3OU0A 1YLDA 1ANEA 2GX4A 1LVOA 3NXPA 5CHBA 2WUBA 4DURA 4XSKU 3ZZBA 2BZAA 2PTNA 4INKA 3ZIAD 2WSSD 1UTPA 4GLYA 3UNRA 1VITG 2AGIX 2ZG0H 1P2JA 3PO1C 1C5QA 3SJ9A 1GMCG 1Z8IB 2BLQA 3BTFE 8GCHG 2BLOA 1NN6A 3E90B 3GDVA 3RXJA 2G5NA 5EW1H 2WHXA 1B0FA 4Y71A 2A5IA 4K1TA 1GI1A 2BM2A 1CO7E 1WTHD 2KX4A 4NWKA 1KY9A 2A32A 1LVMA 1AFQC 1MAYA 4K69A 3GY2A 5HIZA 5LGOA 4DOQA 4ISOA 2SNWA 4I8KA 3T26A 5GCHG 1MTNB 1K1PA 1C5YB 3C1KA 3OSYA 3WWBA 2UUYA 1PPBH 1EJMA 1HJ9A 1UCYE 1NU7B 1Y3VA 1FY5A 3W94A 1C1TA 3SJKA 2V3MA 1HCGA 4Q2KA 1A0HB 2QC2A 3MH6A 1W12U 2PKAA 4HI3A 3TK6A 2ZHWH 1AB9B 1C4V2 1PPHE 4MLFB 3EQ0H 2KAIB 2PGBB 1F5RA 1GL1A 1TX7A 2FWWA 2UWPA 2CJIA
chains in the Genus database with same CATH topology
4YESB 5HM2A 3SBKA 1BMAA 2XBWA 2A0QB 2C4FH 4MNWA 5DP4A 2BD7A 3A80A 1JWTA 3M36A 2VVUA 3P92A 1GJDB 2ODPA 1IQHA 1BDAA 2H5CA 2J92A 3LGUA 1TNGA 1SVPA 1D3QB 3D65E 4Q80A 2SGFE 2GTBA 3FANA 2BXUH 3SUFA 3SUDA 1BMLA 3L6PA 3RMNH 5SGAE 1V2NT 1EXFA 1TPPA 2WYGA 1FXYA 1AMHA 3SU6A 4AGKA 3PYHA 2ZU3A 3I77A 4FUCA 3B23B 3VGCB 5GXPA 3P8GA 4ZKOU 4UFGH 1NS3A 2BDYA 2Z3CA 1MTVA 3BTKE 1OS8A 1ELFA 1HJ8A 1O34A 1P9UA 3RU4E 1O2LA 5B6OA 1MTWA 3RXIA 1F5LA 4AB9A 1ABIH 1V2WT 5I46H 3RXSA 3E8LA 4Y79A 3NCLA 1DXWA 1QB6A 4LOYH 3S7KB 4BTUB 2R0LA 1UK2A 3MNSA 1PQ8A 2ZCHP 1L0ZA 1LVYA 2NU3E 1IQNA 3KN2A 1C5RA 1O5BB 3BTDE 2ZGBH 1JBUH 3ZZ5A 1TLDA 1G36A 1LHFH 5JBAS 2ANWA 4WWYA 1H1BA 1BRAA 3GY3A 3M3TA 1OWJA 1XMNB 1C5SA 3QZRA 5K0HA 3BTME 3RXKA 1FDPA 1D4PB 3AVZA 1C4U2 4U32A 3GISB 2ANMH 1JIRA 5C5NA 3HATH 4H6SB 5E0JA 2DE8A 1FMGA 1Z6EA 1UHBB 4OS2A 3SU2A 3KQDA 2XWBI 4ZHLU 1Y3WA 1DSTA 5C1UA 1SBWA 3E0PB 2AGGX 3RXAA 2PKAB 1FY3A 1ZMNA 2ULLA 5DKMA 2CMYA 1GI7B 1V2VT 4AG2A 1ZZZA 5BRRE 2VWMA 1O3IA 3MOCA 4FUFA 3SV7A 4LK4A 4IN1A 3KQBA 1B0EA 2B8OH 3PTNA 1H9HE 4B73A 1V2JT 2OC0A 4TY6A 1K1JA 1W13U 4ABBA 1T32A 3GCHB 3RXGA 2C8WB 3GDUA 3MNBA 1D9IA 1DOJA 4ZHMU 4ZUHA 3LH3A 1N6YA 5A0CA 1O5CB 5EPNA 1CQQA 1H9IE 2G4UA 3UTUH 3F9FA 2XYAA 4AYVB 2D26C 1ACBE 1D6RA 1DY8A 1TPAE 4CBOA 2G8TA 2VGCB 1Z7KA 1ZTKA 3K65B 1DDJA 5FAHA 6CHAC 3FP6E 4I8GA 1LVBA 3PO1B 4E7NA 2G81E 4O97A 3A86A 1TA2A 4MPXA 4NIYA 3Q76A 5I25A 1AVWA 1QIXB 5DP6A 3ESTA 4Q7ZA 2Y81A 2A45B 4ZXXH 5GIBA 4OGXA 1GWAA 4X6MA 2WYJA 1EPTC 1QRXA 1SB1H 2AIQA 3BIVH 1YPEH 1E0FD 3QLPH 1V3XA 3A8AA 4CRFA 1SFIA 1C5XB 1T4UH 1NFYA 3A7ZA 3MU0A 1V2OT 1J9CH 1XVOA 1G37A 1MQ5A 1PPFE 3SHCH 3R3GB 2Z9GA 1T8LA 3FVFB 1GHYH 2ZNKH 4UFFH 4IS5A 2IJOB 5F8XA 1OOKB 4A6LA 1FIZA 4BAOB 4JK6A 1EATA 1H4WA 1ZSJA 3RXLA 3AAUA 4CRAA 4NG9H 3E6PH 1C5ZB 2O8TA 2FP7B 2Y5HA 4IC5A 1HAVA 4ABFA 2QV1A 4X2XA 2UWOA 2JH0D 3V12A 1AB9C 5LPFA 1HAVB 1GGDB 3I29A 1UK3A 1NTPA 1TRYA 3S0NA 1UTKA 3PM3A 2G51A 3NZIA 1C2EA 2GD4B 1DS2E 2IN2A 4MNXA 1EAWA 1WV7H 2J94A 2ZEBA 3KIDU 1QGFA 1S6HA 3M7TA 1JXPA 1NRPH 1NT1A 1W14U 1O32A 1IQLA 1W0ZU 1SGTA 4DCDA 1TPOA 3AASA 5DP7A 3L33A 1ANBA 4IBLH 2ZO3H 2XBVA 3ZZ6A 1BJUA 3TU7H 2HRVA 4E05H 2W5EA 1HGTH 5IDKA 1O39A 2VWLA 1AFEH 2TGTA 1VCQA 1AUTC 5FX5A 5FHTA 4GAWA 3BTEE 2THFB 1HYLA 2EI6A 2QXIA 1F0RA 3GY6A 1Y5AT 4WF8A 2OUAA 4GHQA 1DFPA 1QY6A 1K9OE 4YOGA 4CBNA 5H4IB 3DD2H 1ELCA 1RIWC 3BN9A 3IWMA 5TCCA 2BY7X 1O2ZA 2XTTB 1TRNA 1TOMH 4FUDA 1O5DH 3HGPA 1W7XH 3LGVA 1SGEE 2VIVA 1KXEA 1OWEA 5DPAA 5FCRA 4WXVA 1SGFA 4CHAB 1C1NA 4DG4A 1O36A 1KXCA 2C93B 2HGTH 1CA0C 5AHGH 5JPMH 3A87A 3A89A 1WAYB 2GCHG 5GPIB 1Y5UT 1WU1A 1OX1A 2GV6A 2FYRA 4D8NA 3M5LA 1F0SA 1DPOA 1IQFA 3FZZA 4YOJA 3BEFB 3TLOA 1GJCB 1O33A 2DE9A 2H9TH 1GBKA 2BVXH 1W3CA 1WOFA 1OWDA 1L1NA 1RTLA 2Z6BD 2OXSA 2CHAC 4AOQA 3D62A 4I8HA 2F9PA 1V2QT 1C2HA 2B7DH 4TYDA 1RRKA 3UFAA 1EB2A 2QF3A 2XC0A 3P8OA 1NPMA 4JYTA 5ETXA 4BNRA 3SV6A 1HIAA 1YCPK 3GDSA 4CRCA 5T6GA 3TGKE 2H9EH 4K1EA 2QXGA 4CREA 1XUHA 2XNIA 3ATLA 1XKAC 1TOCB 1GMHF 6GCHG 1Z1IA 2ZGHA 1TFXA 5EU8A 5FX6A 4X6NA 1O3DA 3SHAH 1FUJA 4ABJA 1IHTH 2PHBA 1LQEA 4JZFH 3E0NB 4Y8XA 1GI4A 5K7RA 1O3JA 3IG6B 1WQVH 1TGCA 3EA9A 3SN8A 3SU5A 5TCAA 4Y76A 5EG4A 1RD3B 3F9EA 3LC3A 3MO3A 4U01A 1ZRKA 3A8CA 1BTPA 1SFQB 4RN6A 4AB8A 2ZFFH 2D8WA 3MH4A 1P10A 4GUXA 1AWHB 1MTSA 1GVLA 2R0KA 1C1VH 3CP7A 1ZTJA 4BANB 3C27B 1EPTB 3MYWA 3RLWH 1HB0B 1OKXA 3HKIB 4AFUA 2HNTF 2F91A 1AO5A 3MH7A 1AI8H 3S9BA 3P95A 3QWCH 1VCWA 3P8NA 1TONA 1Y8TA 1ESAA 1QURH 4MDSA 3D23A 1UTLM 1L4ZA 4OS4A 1TBQH 3VB4A 4D9QA 4ISHH 1EAUA 1AIXH 3BTGE 1SGNE 1TGNA 3T28A 1IQKA 1AE8H 1GI3A 1UO6A 2BY9X 1KIGH 4BXWA 1CHGA 3VPKA 5JB8S 3DFJA 3SGAE 3FAOA 1IQGA 3LGWA 4U2WA 1CGJE 5DGJA 3NUMA 1DWDH 2BMGB 3UUZA 2CN0H 4K3JA 4JYUH 1D3TB 1W7GH 3LIWA 2R9PA 1BQYA 2P8OB 1BMMH 1BITA 1ELGA 1KDQA 1N8OC 5GDSH 5C2ZA 4D7FA 3SU1A 1GBEA 4WJG2 4DY7B 4KTSA 4IC6A 4O03A 2WPKS 4ASHA 2PSXA 1TWXB 3DUXH 3BTHE 1VGCC 4UE7H 3RC4A 1GBMA 1KLTA 3E16B 1C9TA 1S0RA 4JZDH 1O3NA 1C5MD 1YGCH 5IYTA 1YPHC 2RA3A 1TB6H 1UVSH 1HRTH 1EB1H 4FUHA 1SHYA 2C8ZB 1THPB 3F9GA 1MTUA 4NA9H 1O3GA 1GJ7B 4KTUA 5HMAA 1AQ7A 4HTCH 5FBEA 2JETC 2AS9A 2EA3A 1YBWA 4BTTB 2XC5A 1Y59T 1GDUA 1KSNA 2FTMA 3UY9A 3O8DA 4K60A 3SUEA 1C1MA 4KGAA 3RXUA 4OS6A 2PUXB 2WINI 1C2IA 5LH8A 3A7YA 2ZWLH 5LPEA 3M37A 3U8OH 4BTIB 1S81A 1ETSH 4XFQA 1V2KT 3VXEH 4B2BA 9LPRA 5CMXH 1ZOMA 2ZQ2A 2VIQA 1FPCH 2BD2A 2OLGA 3RMMH 3V0XA 2TGDA 5JBCS 1ZHMA 2ZFSA 1F7ZA 1YPMH 1XXDA 4NZLA 4B74A 2RA0A 1D3PB 2VH0A 2OP9A 3ZVCA 1TMBH 2FM2A 5C3NA 4X2WA 1C5OH 1C5VA 2FESH 3VFEA 4DIHH 3GY7A 4R0IA 1YLCA 3QDZB 3MU5A 2J4IA 2AERH 1DT2A 1PJPA 1NRNH 1GHVH 1ZGVA 2VWOA 3SI3H 1NZQH 3SO3A 3SNEA 1C2FA 1AU8A 1S82A 1F2SE 2RG3A 1JOUB 2J38A 2I6QA 4BAMB 3ZZ9A 1P03A 5E0HA 1EQ9A 2ZPQA 2BOKA 3PMJA 5HYOA 2EC9H 1Z8RA 2OQ5A 1O2YA 3AW1A 5EQSA 1CHOF 1QRWA 4RKJB 4I8JA 3T2NA 4KKDA 1NRQH 1A5GH 1O2KA 2QAAA 3Q77A 4A1TA 5CHAB 3QTOH 1P8VC 5FPSA 2VJ1A 2NU4E 4XBBA 4WXIA 3S9CA 2VB0A 1O2GH 2EI8A 1O2VA 2ZF0H 1DICA 4YO9A 3SZNA 1ETTH 3MI4A 4WVPE 2XXLA 1MCVA 1O37A 1MD7A 2ZFPH 1LKBA 3PMHB 1SGRE 4B2AA 1K1MA 1O2OA 1A4WH 2V0BA 2O8WA 5F8ZA 1HBTH 3URDA 3SU0A 3O8RA 2G52A 1A46H 1OP8A 1BBRE 1YF4A 1PYTC 3MU1A 1O2HA 3OX7U 2SGEE 4K2YA 3ATIA 1ZPBA 1ZRBA 3LGIA 2W7UA 2A31A 4IW4E 1EASA 2ZHQH 1W10U 1ELBA 3S9AA 3WY8A 2GDDA 1TNKA 3F68H 4UEHH 3TNTA 2OTVA 1AFQB 1RTFB 3M61U 3ZV8A 2SGAA 3JZ2B 1J16A 2QIQA 2D1JA 1ABJH 1AE5A 1F5KU 4GCHG 2PUQH 1GHAF 3UWJH 1ZYOA 3PLKA 1SI5H 1C5PA 4TY7A 1A3BH 3A7VA 5A0BA 1P06A 4DT7B 1VITF 5C20A 2QGRA 4WH6A 2J9NA 4X1QU 1QBOA 4NFFA 1GJBB 3MMGA 4YTAA 4A92A 9ESTA 2Z3DA 2AMDA 3BG4B 2BX4A 2PR3A 4LZ4B 5ESBA 1LTOA 4FUJA 1V2PT 3GY5A 2ZIQH 1GBHA 4Y6DA 1C2DA 1VJAU 3K6ZA 1GJ5H 3RXEA 4BAHB 1UTJA 1MBMA 1QBVH 2HALA 1SC8U 2FDAA 1NO9H 2IOTA 4PROA 3RU4T 1UVTH 1TA6A 2P95A 4IMQA 2WUCA 3LGYA 1OP2A 3PTBA 3SJ8A 4ISNA 2NU2E 2QYIA 4JYVH 4CH8B 5JYIA 2HNTE 3A83A 1K1NA 1G3EA 1UHBA 3SV9A 1AKSA 3ZYDA 4WMEA 3M5NA 3ZYEA 1C5WB 5EXLA 1YPKH 4XDEA 3S7HB 5DP5A 1UTNA 4THNH 2BLWA 5FPYA 1Z8GA 4GHTA 1SGIB 3QO6A 3ZZCA 4ABGA 1SQOA 1TYNA 3VB7A 1O3EA 1X7AC 1O3PB 4X6PA 3MO9A 2ZPSA 3GCNA 2AMQA 1DITH 3UIRA 4FXGH 1VZQH 1GBBA 3SU3A 4TPIZ 3W95A 3BSQA 2HLCA 5L2YH 2H2ZA 5A8XA 2BDGA 4IN2A 3DA9B 1TE0A 2BD5A 2ZHEH 1GHXH 1SGCA 2C90B 3P70B 1MAXA 5HGGA 1TALA 4Y0YE 2Y80A 3NKKA 1HXEH 1NROH 3MU4A 3RXDA 2AIPA 1HPGA 1YKTA 5DK1A 1GBJA 5GJ4B 2ZGCA 1ZMJA 2CV3A 1O2NA 3MNXA 4UFEH 2Q6DA 4FUIA 2TGPZ 1C4Y2 3OY6U 1WTGH 2VIOA 3TK9A 4JMYA 1ELAA 2ZDNA 3U1JB 2G55A 5JBTA 2P16A 1EX3A 1V2UT 1UK4A 2OC8A 3MNCA 1DLKB 1AWFH 1LHDH 3UOUA 2BHGA 1G2MA 2GGVB 1C1WH 2G00A 4XOJA 3V3MA 1FY4A 3RXMA 3FP7E 1O3HA 3A7WA 2EEKA 1GHBF 1GCTB 3Q3KA 3STIA 4FU8A 1Z8JB 2FTLE 5E8EH 4K5ZA 3TGIE 1SHHB 1YCPM 5FBIA 1EKBB 4A5TS 1W2KH 4LXBH 2OBQA 5A0AE 1SQAA 3UPEA 1RS0A 2Y7XA 3ODDA 1ZJDA 3ZZ3A 4VGCB 1O30A 4FUBA 1A1RA 4I32A 2ZKSA 2BQ6B 4AORA 1O2QA 2P3UB 1GBTA 3PMAB 3I78A 3ATMA 4Q7XA 1BRCE 2TPIZ 2SGDE 1P12E 3STJA 1WYKA 2GT7A 5GWZA 4K8BA 2ZZUH 1C2MA 3ZZ8A 1XUIA 3RXTA 2C8XB 1V2ST 2D2DA 4ISLA 1GI9B 1KLJH 1D3DB 2FS9A 1GG6B 3LU9B 1PPZA 3ZZAA 1ELTA 2A7CA 1UMAH 3M35A 1PFXC 2NU0E 1P2QA 1AY6H 1MTNC 4NZQA 1ETRH 1VJ9U 1LQDB 1YPLH 2AGEX 3FFGA 3TH2H 1T8OA 1A5HA 3DHKH 5E2PA 4FUEA 4MPUA 4YLUA 2P8OC 1WUNH 1OXGA 5F6MA 1OWHA 3SUGA 1KTTB 5DP3A 2GCTC 2ALPA 3T5FH 1MKXK 2ZC9H 2QA9E 1CVWH 1IAUA 1W8BH 3B8JA 1TX6A 2ZA5A 4ZAEA 5T6FA 3KF2A 2TIOA 1S85A 1O2JA 2STBE 1A61H 2BDBA 2G5VA 2BY5X 1O3FA 3GY8A 2PSYA 4Y10E 3RXFA 3LJJA 3OY5U 4FVDA 4Y11E 1Q31A 2A7HA 4B2CA 1MKWK 1CU1A 1GDQA 1GI6A 1O3CA 3MFJA 4FUGA 3F9HA 1DUEA 1FN6A 3GCOA 1J14A 4ZH8A 4MNVA 1WSSH 4E7RG 4ZMAH 2GCHF 4YT6H 3A88A 2A2QH 3GCTF 3MWIU 4UDWH 2SGQE 1GGDC 5C1XA 3ODFA 1QNJA 3TVJB 2ZDLA 1TGBA 4WMFA 1ESTA 1QA7A 1O3LA 3RXOA 2F9OA 4F49A 5A2MH 2R3UA 1C2LA 1QQUA 3SNBA 1DXPA 5EW2H 3BV9B 4E06H 2WPLS 3ZVDA 1DWEH 1DWBH 1Q2WA 1ZHPA 1P09A 2VIWA 1GMHG 1HAHH 1YYY1 5DP9A 2ZP0H 2OINA 1BRUP 1O3AA 3DFLA 4MG3A 1RXPA 4UD9H 1CBWC 4K1SA 4TPYA 1EJAA 5ESTE 1GI0A 1AUJA