1UTQA

Trypsin specificity as elucidated by lie calculations, x-ray structures and association constant measurements
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSINOGEN
publication title Trypsin Specificity as Elucidated by Lie Calculations, X-Ray Structures, and Association Constant Measurements
pubmed doi rcsb
molecule tags Hydrolase
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1utqA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1utqA02
1LHEH 3MMGA 1ELBA 3IITA 8GCHG 2PGQB 1GI7B 1FY4A 1UMAH 1NESE 1G9IE 5C5NA 3S0NA 1O3HA 1TGNA 1GJ9B 3LDXH 1PPCE 1FV9A 1GJ6A 1H9HE 1L1NA 1F0UA 1UJ1A 2ZQ1A 1ZSKA 2D8WA 5B6OA 2PR3A 1PPEE 1P09A 2H6MA 2FODA 1LKAA 4D7FA 3RXSA 3RM2H 3V0XA 1TE0A 4O3TA 1JWTA 1IHTH 1L1JA 2ANWA 3DUXH 2SGAA 3RXOA 1BMLA 1UK2A 4ZKRU 3FZDA 5JB9S 4X6PA 2WPJS 5T3HA 2PSXA 1FJSA 1MKWH 1B0EA 3KQCA 1AQ7A 4Y8XA 4ABBA 1V2NT 1YPHC 3MH7A 3I77A 1CGHA 1F5LA 4DURA 3OU0A 4U32A 3PWBA 2HOBA 5DKMA 5L30H 5GCHG 1LPKB 1BRUP 2VU8E 3T5FH 3TH4H 3TLOA 1AMHA 3KQEA 5GCHF 1UVPA 1F5KU 3ODFA 2PSYA 1FNIA 3F9EA 1YBWA 2ODPA 1B0FA 1NPMA 1ZSJA 2P3UB 3RXGA 3OY5U 1S6FA 1XX9A 2IOTA 4TPIZ 1O2ZA 2BVSH 5JBAS 3RXUA 4LZ4B 2JKHA 3O8DA 3URCA 1C1MA 4WH6A 2YNBA 3RXBA 2EA3A 4B2CA 5JBCS 2A5IA 4ASHA 1OOKB 4I31A 1O31A 4FUDA 1C1OA 1GJCB 2UUKB 1HJAC 1F0RA 3ZZ9A 1OP8A 1TMBH 3M5LA 5EU8A 4X8TH 3E0NB 2VIDA 3TJOA 4K60A 2G00A 1ZMJA 2HNTF 3M5OA 2BQ6B 1EPTA 2HPPH 5TCAA 1P02A 1KXAA 2GVFA 1C4Y2 2BM2A 1TNKA 2O9QA 3EDXB 1CT2E 3ATWA 2ZC9H 1AE8H 1SBWA 4WJG2 2WINI 3ZZAA 2BD2A 1QQ4A 3AASA 3QLPH 3VB7A 2Z6BD 2H9HA 1XUKA 5A8XA 1AIXH 4JZEH 3AAUA 1ORFA 4AYYB 2R9PA 1DY8A 2BY7X 1OYTH 2PTCE 2PUXB 4YZUA 2FI3E 3SQHE 1GI4A 3RXQA 4BXSA 3T62A 2P95A 2ZDLA 1GHWH 1N8OC 4K1SA 4MQAA 3A7XA 1TA2A 2V35A 2F9BH 3UTUH 1H8DH 1WQSA 4I8GA 4FVDA 3I78A 2F9UA 1DITH 2J38A 2XCNA 2TGTA 1IQKA 1ELTA 3E1XB 5LGOA 2QF0A 3RXIA 5GPIB 3KF2A 1Y5AT 1TNJA 1O5CB 2W7UA 2FI5E 1HBTH 2OBOA 1PFXC 4WXIA 2ANKH 1GHBF 2UWPA 3T26A 1P10A 2ZNKH 1ELGA 3P8GA 1GWAA 5DGJA 1V2WT 2ULLA 1HGTH 3JZ1B 4X8VH 2V3HH 4GVUA 3K6YA 1D6RA 3FP7E 1HAXB 2UUYA 3A7YA 1LVYA 1W7XH 4FVBA 2FWWA 3RXKA 1C5OH 1XKAC 4Q7ZA 3GDVA 1AHTH 3LPRA 3RXEA 4I7YH 2Z9GA 1T7CA 2A4QA 5PTPA 1DSUA 2A32A 1GMDG 3MWIU 4O97A 4K69A 4IMQA 1IQFA 2ZO3H 3LGIA 2A4OA 1O3NA 4MPXA 3G01A 1O3LA 3PMHB 2GP9B 2UWLA 2ZWLH 1SB1H 4MPWA 3U8OH 1ZHRA 1BJVA 2NU1E 1RTLA 2Y82A 3R3GB 3PMBB 1NFUA 2G51A 1O33A 1GL1A 1EB2A 1SVPA 2B8OH 3E3TA 2KAIB 1AN1E 1KLJH 1A5GH 3BEIB 2VWMA 1GI6A 1BTWA 2FS9A 1W3CA 3MU8A 2CHAB 3BIVH 5C3NA 1AFQC 2VIPA 1C5RA 4FUFA 1FQ3A 4CHAC 1NZQH 1IQGA 4YM9A 1ZGVA 4H6SB 4IGDA 2BX3A 1CHGA 1SGNE 4XE4A 4CHAB 3ZZCA 4DG4A 1TBZH 4X8UH 4X1PU 4Y76A 2BDHA 3BIUH 1TMUH 3A8BA 3OSYA 1THPB 2VWOA 1DVAH 3D23A 1KLIH 1CU1A 1XUJA 4DOQA 2P93A 2SFAA 3U1JB 1PQ7A 1QB6A 1TONA 3KL6A 1HXEH 1QA0A 4BAMB 2VVCA 1AO5A 1BRBE 1KDQA 1QBNA 5C2ZA 1S6HA 3KCGH 1MU6B 1LPGB 1QL9A 4ZH8A 1YPMH 2QXJA 1P2JA 1THSH 1YP9A 3ZZ7A 1YLCA 3TU7H 1NRPH 1C5VA 2GZ9A 1TPSA 4B75A 1EAUA 4HI3A 3UNSA 2GGVB 4FUGA 1GBIA 3CENA 1J16A 1T8OA 2THFB 1J15A 4TY7A 1F0TA 1L4ZA 1JOUB 3PMAB 1DWBH 5EG4A 4D9RA 3ZVEA 5F6MA 2O8WA 3K65B 1IQJA 2BOKA 2C4FH 1ESTA 5A8ZA 2ZDMA 3ZZBA 3SI3H 2VIWA 1FY8E 3RXHA 1ANCA 1AZZA 2W3KA 1E38B 2Z94A 2P16A 2ZTXA 3A7VA 3SU1A 1Q3XA 4Y71A 3SW2B 2A0QB 1C5UA 5K0HA 3JZ2B 1DWDH 1RJXB 4LZ1H 3SGQE 1H8IH 1AFEH 1SGCA 4WWYA 3OYPA 1AD8H 2PLXA 2PUQH 1Z8JB 2J95A 4NA9H 1TRYA 1HJ9A 2GT7A 1HIAB 1O3FA 3QTOH 1ZYOA 4ABGA 1ELVA 2Z3CA 5FPYA 4X8SH 4J2YB 1LVMA 1ZJDA 2W3IA 1MTWA 4YESB 1BMAA 4FU9A 2ALPA 1GBMA 2PWXA 1FY5A 2ZHEH 2ZU5A 4Z0KA 2OCVB 1SGDE 2ZPSA 1ZRBA 2BLQA 2VGCC 2BY6X 1CA8B 4DJZB 1EZQA 3IWMA 1GDQA 1XM1A 2Q6FA 3ZVCA 4UFFH 3BV9B 1G2MA 2VIVA 5EPYA 1B7XB 1CVWH 1O3GA 5FX6A 4IN1A 1C1VH 1QHRB 4GPGA 1LDTT 1MZDA 5K7RA 4TY6A 4BOHA 2ZGHA 1VGCC 1CO7E 2GDDA 1GJ4H 2BVXH 2WUCA 5EOKA 2R2WU 1O35A 1AVGH 1W10U 3S9BA 1SQTA 2XCFA 4UFEH 1NU9A 4FU7A 4SGAE 5DJ7A 4OS1A 3RU4E 4MNWA 4MVNA 1GGDC 2XBVA 3P8OA 4GHTA 3SUGA 3HGNA 1T32A 4X2WA 1A5HA 1UCYE 2TGPZ 1OX1A 4I33A 1X7AC 1FONA 2R2MB 3CS0A 3LIWA 5EPNA 1HLTH 3UPEA 4Y8YA 3RC4A 1C2DA 3QN7A 5JPMH 1S5SA 3TIUA 4K5ZA 1OP2A 5HYOA 1AWFH 4X2XA 5F8TA 3BEFB 1P12E 3K2UA 3Q00A 2FXRA 1GBKA 1TGTA 3M3SA 4KKDA 4DGJA 3M7QA 5DG6A 3VB5A 1MD8A 1O2IA 4Y0ZE 3ATLA 1BCUH 2DUCA 1AKSB 2ZDAH 1TA6A 1A0JA 2J34A 1SGRE 1PYTC 1T8LA 1WAYB 1CQQA 8LPRA 4MNVA 1SGQE 4NCYA 5DP4A 2ODQA 3AVZA 2ZCKP 1KXCA 1V3XA 1XVMA 2H1UA 1NTPA 1CA0B 1K21H 3KHVA 2BX4A 1C9TA 2BY5X 2AEIH 5I25A 3TPIZ 1YKTA 3SV8A 3TGJE 1W8BH 4RKOB 1GVKB 1ELDE 2NWNA 3RMMH 5CHAB 3RU4T 1UTNA 3V3MA 3NPSA 1C2GA 2Z9LA 1GBTA 6LPRA 1C5MD 2FOGA 4ABHA 2NU4E 1V2TT 2BDGA 3DA9B 1BMNH 3UNQA 3MNSA 1V2JT 4IS5A 4OGXA 4Y7BA 1CSOE 3TK9A 3UWIA 2B0FA 2O8TA 1HV7A 3GCNA 4ISHH 4PROA 3SV6A 3ZVAA 3VEQB 4AB9A 1EUFA 3FP8E 5DP7A 1NY22 1YPHE 2BLWA 1G3CA 2VIQA 1BTYA 3TNSA 3W94A 3VFEA 2VVVA 3GY8A 1TPPA 4INKA 1BTUA 1RTFB 4FUJA 1TGCA 1TBRH 2FYQA 2XC4A 3SJOA 1O3IA 2ODYB 2FO9A 5ESTE 1C1QA 2A7HA 1D3PB 3SUFA 3TK6A 1XXDA 1AB9C 1UTKA 1O3AA 4I8LA 1DICA 1DLEA 3GCOA 2A1DB 2F9NA 2BYAX 2I6QA 1K1IA 1F7ZA 1Y3VA 5CMXH 1UK3A 1C2FA 5FCKA 5DK1A 2FOBA 3SGBE 3QWCH 2AMPA 5L2ZH 2RG3A 4MNXA 1GL0E 4INLA 2GKVE 4BAKB 3SJ8A 4IBLH 3P70B 4H4FA 1GI0A 1MQ6A 4A1TA 3MU4A 3GDUA 4CRDA 3MNCA 5AFYH 4AFQA 3IG6B 1MBQA 3ZYEA 3OX7U 1TNGA 1CBWC 2FX4A 3S9CA 2A2XH 1P8VC 1O3MA 1DX5M 1QTFA 1O5DH 5GDSH 1SGEE 4ESTE 1OKXA 3GCTF 4ZHAA 2EEKA 1EP6A 5AF9H 1JRSA 5JBTA 3E91A 2F3CE 2C8WB 3SBKA 4ABAA 4CBOA 1TFXA 4FUIA 1IOEA 1O36A 1EZXC 2UUFB 1GI1A 1VCWA 1ZSLA 2FOAA 1G37A 4E7NA 3H5CB 1SOTA 5GJ4B 1D3QB 1SG8B 1Z8GA 1MTNC 7GCHG 4MG3A 3F68H 1LHDH 1O3OA 1GG6B 3H7TA 2BLVA 4IN2A 1BB0B 2FX6A 2J92A 7GCHF 1B5GH 4A1VA 3F9GA 1EASA 2JH0D 3W95A 1PJPA 1LPZB 4DW2U 1IQEA 5AHGH 1AWHB 1QBVH 2TRMA 1O3KA 5FPTA 5FBEA 3A7WA 1QRZA 8GCHF 3GYMA 3V12A 5AFZH 3L3TA 3ATKA 4BAHB 3RUOA 1V2ST 1GVZA 1L2EA 5EQQA 3RXDA 1NT1A 1EPTC 3SORA 1OP0A 2F9PA 3A7ZA 5LH8A 1NROH 1EPTB 1K1LA 2B5TB 3KIDU 1QB1A 1ANEA 1A7SA 5E2PA 2FPZA 2AIQA 1LKBA 1OSSA 1O2XA 1G3EA 1GJ7B 1TOMH 3ATMA 1SGTA 2GV7A 1C5SA 2HGTH 3I29A 1C2IA 4A7IB 2ZU1A 3ATIA 4JYUH 1VITG 1ESAA 4NGAH 3SJIA 4B73A 1VJAU 2D1JA 4YT7H 1Z1JA 2UWOA 3SNBA 1O2TA 3M3VA 4BTUB 3T2NA 1CE5A 1KTSB 1DY9A 1UCYK 5DPAA 1DSTA 1QURH 2AMQA 2ZHDA 2ZHFH 3SGAE 2BZAA 2ZKSA 4R0IA 1S85A 2G52A 2HNTE 2J4IA 2TIOA 1VJ9U 2Q6GA 2JETC 3SZNA 3F1SB 1ANBA 3MYWA 3NZIA 1C1TA 1P2OA 3C1KA 3RXRA 4ISIH 3GISB 2JETB 1CGIE 2W5EA 1YCPK 1GBBA 3SV2H 2IPHA 1XUIA 2PW8H 3HPTB 5A0AE 2ZU4A 2OP9A 1K9OE 3RC6A 1QRWA 1V2PT 2BOHB 1BJUA 3VXFH 1FY1A 4WH8A 3FANA 2FLRH 1C1PA 4XBCA 1OWHA 4WMDA 4UE7H 1QR3E 4TWWA 6GCHG 4AG1A 1XMNB 1MCVA 1Z7KA 4ZKOU 1GVLA 1HFDA 2EI6A 1JBUH 1O32A 4UFGH 6GCHF 2AGGX 1UTMA 2GV6A 4ZUHA 1MKWK 1QB9A 4AZ2B 3O8CA 4IC5A 4UDWH 1EATA 1S0RA 1TQ7B 2FESH 4ISNA 4Z6AH 3FZZA 4JZDH 5H4IB 1HAVA 5E0GA 5G4BA 1HB0B 2XBYA 2Y5FA 3K6ZA 1GI9B 1GMCG 1O2LA 1IQIA 1P03A 1QA7A 3LGTA 3RLWH 3SQEE 4XBDA 3UNRA 5E2OA 3EA7A 1JXPA 1YLDA 1P9SA 5HGGA 3UQOA 2FOCA 2WPLS 3P8NA 1GMCF 2D2DA 1T8MA 2A4GA 4NFFA 4DVAU 1NU7B 1WU1A 3M7TA 1DWEH 3HKJB 5A8YA 4H42U 3RMNH 1NRRH 3GY5A 1AGJA 1O2JA 4ZHLU 4R8TB 4I8KA 3ZV9A 3U98H 3A7TA 9LPRA 4INHA 2HWLB 2FOMB 1DPOA 1YCPM 1C2MA 3Q3XA 4A5TS 1G2LA 3S7KB 1P2KA 1KDQB 1YGCH 4OS6A 2WPHS 1SGFG 1XUGA 1ACBE 4FUEA 1HCGA 2ZFQH 1SGIB 4ABJA 1K1OA 1BBRK 5JYIA 1YM0A 1DE7H 1WTHD 1IQNA 3QZRA 3TVJB 3ZZDA 3TJVA 1GMDF 2ZCLP 3MI4A 1NFXA 3PB1E 1DFPA 3HK3B 1D3DB 5HXFA 5AVDA 1D3TB 1MBMA 1FXYA 4ZAEA 1DANH 5DP9A 3QK1A 1BITA 2CHAC 2P3FH 3UIRA 1E34B 3ZZ6A 2HLCA 3Q77A 3ZZ8A 1V2RT 2QXHA 3SO3A 3ZZ4A 2BLOA 1DT2A 3SHAH 3BTQE 1EB1H 3LGVA 3OTJE 3U9AH 1A2CH 1NRQH 2Y7ZA 1TABE 1VCPA 4E06H 1MAXA 7KMEH 1UHBA 3RMOH 2G55A 3VB4A 2QF3A 1LHGH 1Y5UT 2C8ZB 3FFGA 1C1RA 2O8MA 1YPJH 2H9EH 4D7GA 3GOVB 4MPVA 4YOJA 4ZMAH 1IQLA 3ZVGA 1A4WH 1ZLRA 2XBXA 3C27B 1Z6JH 4CRGA 1K22H 2AGEX 1ZHPA 5A09A 3BF6H 1KSNA 5JDUB 1K28D 1EJAA 1C5XB 3A8CA 2P8OB 1GI8B 1KTTB 5GWZA 4UFDH 1HAOH 4A1XA 5EQSA 3SNEA 1E0FD 1O3PB 2AIPA 3EQ0H 3GICB 1O2HA 1S83A 1DXWA 1O5BB 1UVTH 1PYTD 3UUZA 2J94A 1FN8A 1HDTH 4GAWA 2Q6DA 4ZKNU 5DP3A 4WVPE 3A88A 2OC1A 3A81A 4ABFA 1KY9A 1SPJA 2BDBA 1Z8RA 4OS5A 3HGPA 4WF8A 3URDA 3KNXA 1BA8B 4Y79A 4E05H 1UTLM 3CP7A 1NN6A 4FUCA 1W13U 3HATH 3KQBA 4B2AA 4CRAA 4YTAA 1HAIH 1P9UA 3RP2A 2OXSA 1GI2A 1EOLA 1O2SA 4ZXXH 6ESTA 1FLEE 3VPKA 5LPFA 2PV9B 2C3SA 3MU5A 3PROA 2P3TB 1TQ0B 4KTCA 3T28A 4GHQA 4NA8A 4Y7AA 5J4QA 1C5NH 2IN2A 3F9FA 2QV1A 3FP6E 2PKAA 2QXGA 3LGUA 2G4TA 5EW1H 1MTUA 2C8YB 1CHOG 4YLQH 1ZGIA 1Y3UA 1QFKH 3QDZB 2RA3A 1DXPA 4KELA 1O5GH 1PQ8A 1CHOF 3LC3A 1RS0A 1XUFA 5J4SA 4CRBA 2FOFA 3TGIE 2BD8A 2BXTH 1H9LB 2A5KA 4O3UA 4X0WU 1O2MA 4JYVH 3H7OA 5DO4H 4D8NA 1S0QA 3BTWE 3MTYA 2C90B 3D65E 2ZI2H 3PLKA 4ISOA 3MO9A 1C1NA 2K1QA 3ZVFA 1TNHA 1KXFA 2QGRA 2XC0A 2GZ7A 1SGYE 3AAVA 2ZGBH 3L33A 2BD5A 1IAUA 1Y8TA 4UONA 1ETTH 4BTIB 1Y3WA 2ZZUH 5T6GA 1O2NA 4CR9A 5ESBA 2BD3A 3Q3KA 2CF8H 1MQ5A 2YOLA 4AOQA 5C1UA 2Y6TA 1P05A 2QYIA 1HXFH 1WOFA 2BD9A 1ZMNA 1W11U 1O37A 3MNBA 3NKKA 2OBQA 4KTUA 1O5EH 1SL3A 1QL8A 3LT3A 2A7JA 4O03A 3BTHE 4O9VA 4YOIA 1AE5A 1C1UH 3DFLA 2R0LA 2WYJA 2ZDNA 2ZEBA 3M5MA 4E7RG 1RRKA 1O2YA 3BG4C 1PPBH 2GMTC 1O2KA 1WSSH 4AN7A 3SJ9A 2NU2E 4BAOB 5TJXA 2XW9A 4OS7A 2CMYA 1F0SA 2B7DH 2F91A 2QN5T 3BG4B 5HM9A 2GMTB 4RKJB 2RCEA 3DT0H 1WQVH 1TALA 1G36A 3VGCC 1GMHG 3B8JA 2VINA 3SOSA 1A3EH 5GIBA 3RXMA 2GD4B 3VGCB 3DD2H 1O3DA 3A83A 1A0HB 1TLDA 2BHGA 1WUNH 3E90B 2SGPE 3EA8A 3T29A 2HALA 1HNEE 1O39A 4CRCA 2P94A 1TYNA 4NIWA 1SOZA 2QIQA 3GCHC 4AB8A 3LJJA 1CA0C 1Q31A 3QGNB 8ESTE 1IHSH 3RXJA 2BDIA 4WXVA 1QJ6B 2SGQE 1PPZA 3SV7A 1GBAA 1KXDA 1LVOA 3GCHB 1E37B 2Y5HA 1QJ7B 5CHAC 6CHAB 1UTJA 5E0HA 1BZXE 2GT8A 2ASUB 3TK5A 1GJBB 2IJOB 3TITA 4BXWA 1ABJH 1V2LT 3T25A 4NIYA 4FUHA 2NU3E 2PKSC 1HAGE 3D62A 2H5DA 1OWIA 1OWJA 1BTXA 5T6FA 4M7GA 2BY9X 1BHXB 2VH0A 1QGFA 5CE1A 4X1QU 5JB8S 3UQVA 2PKSB 4K8YA 1SR5C 3SUDA 2GCTC 1FMGA 1SC8U 2ZFRH 1C5PA 1Y3YA 5C5OA 1AI8H 5FAHA 2AYWA 2A7CA 1G3DA 3EYDA 5FX5A 1C2JA 2GCTB 3U1IB 4BNRA 1EXFA 1Z1IA 2WPKS 4MDSA 1KYNA 1ZR0A 4Q7XA 2ZG0H 2AH4X 1SFQB 2ZU3A 1T4UH 4Q80A 5EW2H 1L1GA 4GUXA 1QJ1B 2J9NA 3GY7A 1O3EA 2ZGCA 1OWKA 3NK8A 4NIXA 2ZDKA 1FUJA 1LMWB 3PLBA 3RXLA 1T4VH 2XYAA 1H9IE 4IW4E 4VGCC 2SNVA 1WV7H 1BIOA 4AFZA 5A0BA 1W7GH 4NA7A 4AGJA 1MKXH 4IMZA 3M61U 1Z6EA 3MH4A 4VGCB 3K9XB 1W12U 1GCTC 1O2QA 2Y80A 2ZQ2A 4Y10E 2O8LA 1GCTB 1E35B 1PPHE 2ZFPH 3ELAH 1LTOA 1RIWC 1YPLH 2BTCE 2G5NA 1DS2E 2J2UA 2XBWA 1S82A 1XXFA 4HGCA 1IQHA 1KXEA 3LC5A 2FOEA 1RIWB 1INCA 5ETXA 3RXPA 5FPSA 1H1BA 3B9FH 2JH6D 1PQ5A 1N1LA 3LJOA 3ESTA 4XBBA 1A1RA 5HMAA 1O34A 1HUTH 3TNTA 4MLFB 5F8ZA 1GG6C 4WY3A 3SV9A 1NRNH 1PPFE 1O30A 2OD3B 4XOJA 1Y3XA 5DP5A 3ZVBA 4D76A 4X6NA 5IDKA 3UY9A 4K1TA 1VR1H 2ZFSA 2STAE 1J9CH 1UO6A 1U6QA 2CXVA 1FY3A 2QC2A 1GBHA 4FUBA 5EXMA 1AZ8A 1HJ8A 1GBCA 2BQ7B 3A82A 4DIIH 3PYHA 1EKBB 1T8NA 1GPZA 2FMJA 3TJNA 5LPRA 2BDCA 2M5TA 1SLXB 1MAYA 1D6WA 2ZIQH 2A5AA 1C9PA 1RD3B 2ZCHP 1SHYA 1GJDB 1C2EA 2OQUA 2DE9A 1QL7A 1GHYH 2XWAA 1DM4B 3NCLA 1P01A 1S84A 3LOXA 1C4U2 3SU3A 1V2QT 3QGJA 4AORA 1BMMH 3MFJA 2EC9H 1S81A 1TWXB 1YCPH 1UVSH 4YO9A 3RLYH 1C5WB 4KGAA 3SU5A 2JH5D 2HVXA 2XC5A 4NG9H 3SN8A 2FEQH 1FIWA 1SFIA 3AW0A 2CJIA 1TGSZ 5T6DA 4AFSA 3U8TH 5C1XA 1FIZA 2QXIA 4BANB 4JCNA 4YOGA 3P95A 1MU8B 2WV4A 2ZTYA 3ODDA 5JBBS 1HAVB 1TX7A 8KME2 3N7OA 1ESBA 1N6XA 7ESTE 1VITF 1V2VT 2VVUA 1NS3A 3EA9A 2XTTB 4HFPB 1OS8A 2DE8A 2UUJB 1ELEE 1ZHMA 3PTBA 1F5RA 1BRCE 1P57B 4B2BA 1AVXA 1NFWA 2BD7A 2TPIZ 1P2NA 3FAOA 1OWEA 1C2LA 1CT4E 3EGKH 3KN2A 4DT7B 2WUBA 3KEEA 1VZQH 3BTGE 1O2RA 2BVRH 4UD9H 1A61H 2RA0A 2HPQH 3LH1A 1N6YA 1K2I1 5BRRE 1A5IA 4K8BA 4ABDA 1MUEB 1O2GH 3F9HA 4YLUA 2VWLA 5LPEA 2A31A 4OS2A 1RTKA 1K1NA 1QCPA 3KGPA 4JK5A 3V13A 4X6MA 4XFQA 3S7HB 2H9TH 1P2IA 1THRH 1K1JA 1ZPCA 4ZKSU 3A80A 1TIOA 3TH3H 1HJAB 1P0SH 4X1SU 1DUEA 1ETSH 3RMLH 1GDNA 1EAWA 3SUEA 1GHXH 4OS4A 4ZXYH 3QZQA 2LPRA 3BSQA 2VNTA 3P8FA 4TYDA 2QCYA 1BBRH 2ESTE 1C1SA 3UOUA 1HAHH 3RXCA 3PO1C 2LNCA 3PV4A 1MD7A 3BTME 3P92A 1LHFH 3RXVA 2VIOA 2OC8A 4THNH 1O3CA 1MCTA 4B76A 3ZZ5A 1KIGH 3PLPA 3PO1B 4MNYA 1OPHB 1O2UA 2AFQB 1YF4A 1YPEH 2R3YA 2BZ6H 1GI5A 1UHBB 4U30A 1C2KA 1NRSH 9ESTA 1N8OB 1ARCA 3UWJH 4TPYA 4I8JA 4X2YA 3A86A 1W0YH 3GYLB 3QUMP 4Y11E 3RC5A 3UFAA 3CS7A 1GBJA 3P6ZB 1GHBG 1TB6H 3TJUA 2P59A 3PM3A 2BQWB 3A85A 1RFNA 1C5LH 2QA9E 3BTDE 2Y81A 1HPGA 4JZFH 2FP7B 1FZZA 3SU6A 5BPEA 1ZJKA 4QT8C 1QY6A 1UTOA 2A45B 2ZHWH 5FCRA 2FIRH 1HYLA 1BTPA 2ZECA 2FM2A 4ABIA 3LH3A 2BB4A 1TPAE 1TGBA 2QY0B 4NSYA 4YT6H 1EAIA 1NFYA 4U01A 5EXNA 5E8EH 3LKWA 1EP5A 1UVOA 2ILNA 1C5ZB 4ISLA 2NU0E 1T31A 4Y8ZA 5TCCA 4CBNA 3T27A 2R3UA 3MOCA 3O8RA 1FPHH 3LGWA 1TX8A 4WMEA 1C1WH 3LU9B 2ANYA 5F8XA 7LPRA 1D4PB 1EZSC 1VITH 4BTTB 2XWBI 1Q2WA 2O8UA 2ZPQA 2AMDA 2G5VA 4ZHMU 1QNJA 1GDUA 1FAXA 2Y7XA 4GLYA 4CR5A 2ZA5A 2CN0H 1MMJN 2HNTC 2F9VA 1CT0E 2BDYA 4GCHG 5EXLA 1V2KT 5E0JA 1V2MT 4B1TA 4MTBA 5EQRA 5FHTA 2F83A 2SGDE 3MO6A 4GCHF 1AFQB 3UR9A 1O2OA 2P8OC 1J8AA 1TOCB 2XNIA 3L6PA 4ABEA 2PKAB 4AG2A 1AUTC 5A0CA 1J14A 1HAZB 3LGYA 1W0ZU 2Z9JA 1SLUB 2GCHG 2FDAA 1GBLA 2Q1JA 1P06A 2FZZA 3UR6A 3DHKH 4CH8B 3GY4A 2GCHF 3A89A 2PHBA 2R0KA 4AGKA 1GBFA 1ARBA 2FTLE 2FS8A 2TGDA 3SNAA 5C1YA 2SGFE 1MZAA 1TNLA 3RXFA 2OTVA 5F03A 3EE0B 1P2MA 2GZ8A 5C20A 1F2SE 1A0LA 3BEUA 4JZ1A 1QBOA 1HAYB 1LQEA 1W14U 3BG8A 2W7SA 1BTHH 2VH6A 4NZLA 1A3BH 1O5FH 1SLVB 5I46H 2OQ5A 4AYVB 1C5QA 3VXEH 4XDEA 1C4V2 1FN6A 3D49H 1XUHA 1O38A 1BDAA 1RGQA 1O5AB 2KAIA 4FXGH 3WY8A 4XSKU 4NFEA 3R0FA 3DFJA 4KP0A 2WPIS 3ENSB 4CREA 1ZPBA 3TH2H 4JYTA 1TBQH 4X6OA 2AGIX 1PPGE 2V0BA 2PTNA 4JMYA 3U8RH 3BTTE 3ZVDA 3MU1A 1YPKH 1PQAA 1NM6A 1RXPA 1W2KH 2FI4E 3UREA 4AFUA 5EODA 2YNAA 1HRTH 3MU0A 2D26C 2XRCA 1MTVA 2GTBA 3Q3YA 1ELCA 4I32A 1XKBC 1OXGA 4F49A 2ZGJA 1BUIA 2G4UA 1FDPA 1BHXF 4K1EA 1AY6H 1P3EA 4RSPA 3RXAA 1BTZA 5EGMA 4NWKA 1P04A 3F6UH 1ID5H 1WBGB 4JK6A 1KXBA 4F4OC 3SU0A 2EI7A 1SMFE 1ZRKA 1P11E 5SGAE 2ZGXH 3UOPA 5FBIA 2CGAA 1C2HA 3M35A 4X1RU 3HKIB 2H2ZA 3SNDA 1NO9H 1SQOA 1G30B 1O3JA 1ZTJA 3B23B 2VGCB 1JMOH 4NWLA 3MHWU 4HTCH 3Q76A 2GX4A 1V2UT 3BN9A 3RDZA 4CRFA 3P17H 3M5NA 3M37A 4X1NU 3SI4H 3A8DA 1AUJA 3NXPA 1ZZZA 3QO6A 1EAXA 4DY7B 1JIMA 1ELAA 4Y0YE 1EQ9A 2ZPRA 3RU4D 1VGCB 5DP6A 4MPUA 4WMFA 1DUAA 1G32B 2Z9KA 3GDSA 4NSVA 1TNIA 2Z3DA 1AU8A 3SNCA 5ABWA 2OINA 3HK6B 5A2MH 1O2VA 1SGPE 1GHAG 1SGFA 2EI8A 1EOJA 1UTQA 1ETRH 1HIAA 1TPOA 3PWCA 3QX5H 1GMHF 5DP8A 1QRXA 2AERH 1GGDB 1ZOMA 1GHAF 3M7UA 3STIA 2SNWA 2SGEE 4Q7YA 1A46H 1BRAA 4A6LA 3QTVH 1ABIH 3O8BA 4I8HA 3GY6A 4NZQA 1L0ZA 4NIVA 1ZTKA 2ZTZA 1FPCH 4U2WA 1MTSA 4X2VA 5IYTA 2FTMA 3U69H 2ZP0H 6CHAC 1LHCH 2TBSA 1WCZA 1BQYA 4TWYA 1IQMA 2ZFTA 5HM2A 3KQDA 3A84A 1ZPZA 4D9QA 2HRVA 1GI3A 1GHZA 2C93B 4RN6A 2TGAA 1VCQA 4J1YA 3SU4A 1LO6A 1GHVH 1SHHB 2ALVA 2WPMS 1LQDB 4GSOA 5GXPA 1H4WA 3MH6A 1L4DA 2G81E 1O0DH 3BTKE 2AS9A 2V6NA 3GY3A 3M36A 5C67A 1SLWB 2VB0A 1Z71A 2Y5GA 1C5YB 2FYRA 4SGBE 1GJAB 3A87A 1GJ5H 4JZIA 1EZUC 1HAPH 2Z7FE 2VJ1A 4CH2B 4BAQB 2BMGB 3E6PH 3MNXA 1GBEA 3MO3A 1G3BA 2B9LA 2A2QH 2ZF0H 1M9UA 2WV5A 1J17T 1ELFA 1TAWA 4K2YA 3AW1A 4Y6DA 3SHCH 3SJKA 4DCDA 1V2OT 3RM0H 4HZHA 4LXBH 4K3JA 1K1MA 3MH5A 2FLBH 3FVFB 1FAKH 1WTGH 1E36B 1QIXB 4DIHH 1LCYA 1QQUA 1P2QA 2OUAA 2H5CA 3RXTA 1C5TA 3BTEE 4KTSA 1EJMA 2WYGA 1EX3A 4LOYH 3ZYDA 3EAJA 3E16B 5FXLA 1AKSA 1KLTA 2BY8X 1WYKA 4FU8A 2ZFFH 1YPGH 2Z9IA 5L2YH 1ZMLA 4IC6A 4A92A 2VWNA 3VB6A 1DLKB 1SSXA 2Z3EA 2PGBB 3ZZ3A 3ITIA 3S9AA 2BDAA 2RDLA 1SI5H 3OY6U 1DOJA 2FOHA 1D9IA 3E0PB 2CV3A 1YYY1 2STBE 1DWCH 1AB9B 2PFEA 2GDEH 1ANDA 1TRNA 3PTNA 2BXUH 1BBRE 4B71A 2V3OH 2OLGA 3NWUA 1V6DA 1O2WA 1LVBA 1OWDA 3TGKE 1GBDA 2C8XB 2QAAA 2ZHQH 1P3CA 2W26A 1BT7A 1K1PA 3ZV8A 1AVWA 1GJ8B 4OGYA 1UK4A 2BD4A 1O3BA 3BTFE 3GCTG 1XVOA 1YC0A 1OYQA 1Y5BT 2XXLA 1TX6A 1UVUH 2OC0A 1UTPA 3GY2A 1F92A 3M3TA 1O2PA 1CBWB 2OC7A 2ZU2A 1EJNA 1GCDA 2A4RA 4H6TA 1TRMA 4LK4A 4ZROA 1CGJE 3A8AA 3PMJA 5L6NH 2F9OA 1DDJA 1Z8IB 2ANMH 3E8LA 4Q2KA 2I6SA 3SU2A 1MH0A 3V7TA 1TMTH 1JRTA 3LONA 1JIRA 3VB3A 2CF9H 2ZDVH 1FI8A 4B74A 1BOQA 2G8TA 4AX9H 3STJA 1MKXK 1Y59T 3NUMA 1MTNB 1UCYH 4UEHH 1NC6A 1ZTLA 3S69A 1SQAA
chains in the Genus database with same CATH superfamily
1LHEH 3MMGA 1ELBA 3IITA 8GCHG 2PGQB 5HKKD 1GI7B 1FY4A 1UMAH 1NESE 1G9IE 5C5NA 3S0NA 1O3HA 1TGNA 1GJ9B 3LDXH 1PPCE 1FV9A 1GJ6A 1H9HE 1L1NA 1F0UA 1UJ1A 3F0OA 2ZQ1A 1ZSKA 3EE7A 2D8WA 5B6OA 2PR3A 1PPEE 1P09A 2H6MA 2FODA 1LKAA 4D7FA 3RXSA 3RM2H 3V0XA 1TE0A 4O3TA 1JWTA 1IHTH 1L1JA 2ANWA 3DUXH 2SGAA 3RXOA 1BMLA 5DN6D 1UK2A 4ZKRU 3FZDA 5JB9S 4X6PA 4ACAA 2WPJS 5T3HA 2PSXA 1FJSA 1MKWH 1B0EA 3KQCA 1AQ7A 4Y8XA 4ABBA 1V2NT 1YPHC 3MH7A 3I77A 1CGHA 1F5LA 4DURA 3OU0A 4U32A 3PWBA 2HOBA 5DKMA 1E79D 5L30H 5GCHG 1LPKB 1BRUP 2VU8E 3T5FH 3TH4H 3TLOA 1AMHA 3KQEA 5GCHF 1UVPA 1F5KU 3ODFA 2PSYA 1FNIA 3F9EA 1YBWA 2ODPA 1B0FA 1NPMA 1H8ED 1ZSJA 2P3UB 3RXGA 3OY5U 1S6FA 1XX9A 2IOTA 4TPIZ 1O2ZA 2BVSH 3FN8A 5JBAS 3RXUA 4LZ4B 2JKHA 2YMSD 3O8DA 3URCA 1C1MA 4WH6A 2YNBA 3RXBA 2EA3A 4B2CA 5JBCS 2A5IA 4ASHA 2WSSD 1OOKB 4I31A 1O31A 4FUDA 1C1OA 3PRDA 1GJCB 2UUKB 1HJAC 1F0RA 3ZZ9A 1OP8A 2L74A 1TMBH 3M5LA 5EU8A 4X8TH 3E0NB 2VIDA 3TJOA 4K60A 2G00A 1ZMJA 2HNTF 3M5OA 2BQ6B 1EPTA 2HPPH 5TCAA 1P02A 1KXAA 2GVFA 1C4Y2 2BM2A 1TNKA 2O9QA 3EDXB 1CT2E 3ATWA 2ZC9H 1AE8H 1SBWA 4WJG2 2WINI 3DCLA 3ZZAA 2BD2A 1QQ4A 3AASA 3QLPH 3VB7A 2Z6BD 2H9HA 1XUKA 5A8XA 1AIXH 4JZEH 3AAUA 1ORFA 4AYYB 2R9PA 1DY8A 2BY7X 1OYTH 2PTCE 2PUXB 3OEED 4YZUA 2FI3E 1BMFD 3SQHE 1GI4A 3RXQA 4BXSA 3T62A 2P95A 2ZDLA 1GHWH 1N8OC 4K1SA 4MQAA 3A7XA 1TA2A 2V35A 2F9BH 3UTUH 1H8DH 4P00A 5B6LA 1WQSA 4I8GA 4FVDA 4YXWD 3I78A 2F9UA 1DITH 2J38A 2XCNA 2TGTA 1IQKA 1ELTA 3E1XB 5LGOA 2QF0A 3RXIA 5GPIB 3KF2A 1Y5AT 1TNJA 1O5CB 2W7UA 2FI5E 1HBTH 2OBOA 1PFXC 4WXIA 2ANKH 1GHBF 2UWPA 3T26A 1P10A 2ZNKH 2J98B 1ELGA 3P8GA 1GWAA 5DGJA 1V2WT 2ULLA 1HGTH 3JZ1B 4X8VH 2V3HH 4GVUA 3K6YA 1D6RA 3FP7E 2QF4A 1HAXB 2UUYA 3A7YA 1LVYA 1W7XH 4FVBA 2FWWA 3RXKA 1C5OH 1XKAC 4Q7ZA 3GDVA 2RDEA 4TSFD 1AHTH 3LPRA 3RXEA 4I7YH 2Z9GA 1T7CA 2A4QA 5PTPA 1DSUA 2A32A 1GMDG 3MWIU 4O97A 4K69A 4IMQA 1IQFA 2ZO3H 3F2HA 3LGIA 2A4OA 1O3NA 4MPXA 3G01A 1O3LA 3PMHB 2GP9B 2UWLA 2ZWLH 1SB1H 4MPWA 3U8OH 1ZHRA 1BJVA 2NU1E 1RTLA 1YLNA 1E1RD 2Y82A 3R3GB 3PMBB 1NFUA 2G51A 1O33A 1GL1A 1EB2A 1SVPA 2B8OH 3E3TA 2KAIB 1AN1E 1KLJH 1A5GH 3BEIB 2KZ4A 2VWMA 1GI6A 1BTWA 2FS9A 1W3CA 3MU8A 2CHAB 3BIVH 5C3NA 1AFQC 2VIPA 1C5RA 4FUFA 1FQ3A 4CHAC 1NZQH 1IQGA 4YM9A 1ZGVA 4H6SB 4IGDA 2BX3A 1CHGA 1KMHB 1SGNE 4XE4A 4CHAB 2EY4C 3ZZCA 4DG4A 1TBZH 4X8UH 4X1PU 4Y76A 2BDHA 3BIUH 1TMUH 3A8BA 3OSYA 1THPB 2VWOA 2KCOA 1DVAH 3D23A 1KLIH 1CU1A 1XUJA 4DOQA 2P93A 2SFAA 3U1JB 1PQ7A 1QB6A 1TONA 3KL6A 1HXEH 1QA0A 4BAMB 2VVCA 1AO5A 1BRBE 1KDQA 1QBNA 5C2ZA 1S6HA 3KCGH 1MU6B 4Z1MD 1LPGB 1QL9A 4ZH8A 1YPMH 2QXJA 1P2JA 1THSH 1YP9A 3ZZ7A 1YLCA 3TU7H 1NRPH 1C5VA 2GZ9A 1TPSA 4B75A 1EAUA 4HI3A 3UNSA 2GGVB 4FUGA 1GBIA 2IJD1 3CENA 1J16A 1T8OA 2THFB 1J15A 4TY7A 1F0TA 1L4ZA 1JOUB 3PMAB 1DWBH 5EG4A 4B6EA 3N99A 4D9RA 3ZVEA 5F6MA 2O8WA 3K65B 1IQJA 2BOKA 2C4FH 1ESTA 5A8ZA 2ZDMA 3ZZBA 3SI3H 3MQKC 2VIWA 1FY8E 3RXHA 1ANCA 1AZZA 4DT4A 2W3KA 1E38B 2Z94A 2P16A 2ZTXA 3A7VA 3SU1A 1Q3XA 4Y71A 2WHXA 3SW2B 2A0QB 1C5UA 5K0HA 3F3BA 3JZ2B 1DWDH 1RJXB 4LZ1H 3SGQE 1H8IH 1AFEH 1SGCA 4WWYA 3OYPA 1AD8H 2PLXA 2PUQH 1Z8JB 2J95A 4NA9H 1TRYA 1HJ9A 2GT7A 1HIAB 1O3FA 2W6JD 3QTOH 1ZYOA 4ABGA 1ELVA 2Z3CA 5FPYA 4X8SH 4J2YB 1LVMA 1ZJDA 2W3IA 1MTWA 4YESB 1BMAA 4RT0A 2LP6A 4FU9A 1H8HD 2ALPA 1GBMA 2PWXA 1FY5A 2ZHEH 2ZU5A 4Z0KA 2OCVB 1SGDE 2ZPSA 1ZRBA 2BLQA 2VGCC 2BY6X 1CA8B 4DJZB 1EZQA 3IWMA 1GDQA 1XM1A 2Q6FA 3ZVCA 4FETA 4UFFH 3BV9B 1G2MA 2VIVA 5EPYA 1B7XB 1CVWH 1O3GA 5FX6A 4IN1A 1C1VH 1QHRB 4GPGA 1LDTT 1MZDA 5K7RA 4TY6A 4BOHA 2ZGHA 1VGCC 1CO7E 2GDDA 1GJ4H 3DSOA 4FOUC 2BVXH 2WUCA 5EJ1A 5EOKA 2R2WU 1O35A 1AVGH 3F2GA 1W10U 3S9BA 1SQTA 2XCFA 4UFEH 1NU9A 4FU7A 1VKYA 4SGAE 5DJ7A 4OS1A 3RU4E 4MNWA 4MVNA 1GGDC 2XBVA 3P8OA 4GHTA 3SUGA 3HGNA 2M2AA 1T32A 4X2WA 1A5HA 1UCYE 2TGPZ 1OX1A 4I33A 1X7AC 1FONA 4OM9A 2R2MB 3CS0A 3LIWA 5EPNA 1HLTH 3UPEA 4Y8YA 3RC4A 1C2DA 3QN7A 5JPMH 1S5SA 3TIUA 4K5ZA 3UB0A 1OP2A 5HYOA 1AWFH 4X2XA 5F8TA 4B6FA 3BEFB 4RI0A 1P12E 3K2UA 3Q00A 2FXRA 1GBKA 1TGTA 2JJ2D 3M3SA 4KKDA 4DGJA 3M7QA 5DG6A 3VB5A 1MD8A 1O2IA 4Y0ZE 3ATLA 1BCUH 2DUCA 1AKSB 2ZDAH 1TA6A 1A0JA 2J34A 1SGRE 1PYTC 1T8LA 1WAYB 1CQQA 8LPRA 4MNVA 3OAAD 1SGQE 4NCYA 5DP4A 2ODQA 3AVZA 2ZCKP 1KXCA 1V3XA 1XVMA 2H1UA 2PP6A 1NTPA 1CA0B 1K21H 3KHVA 2BX4A 1C9TA 2BY5X 2AEIH 5I25A 3TPIZ 1YKTA 3SV8A 3TGJE 1W8BH 4RKOB 1GVKB 1ELDE 2NWNA 3RMMH 3PRBA 5CHAB 3RU4T 1UTNA 3V3MA 3NPSA 1C2GA 2Z9LA 5EJZA 1GBTA 6LPRA 1C5MD 2FOGA 4ABHA 2NU4E 1V2TT 2BDGA 3DA9B 1BMNH 3UNQA 3MNSA 1V2JT 4IS5A 4OGXA 4Y7BA 1CSOE 3TK9A 3UWIA 2B0FA 2O8TA 1HV7A 3GCNA 4ISHH 4PROA 3SV6A 3ZVAA 3VEQB 4AB9A 1EUFA 3FP8E 5DP7A 1NY22 1YPHE 2BLWA 1G3CA 2VIQA 1BTYA 1COWD 3TNSA 3W94A 3VFEA 2VVVA 3GY8A 1TPPA 4INKA 1BTUA 1RTFB 4FUJA 1TGCA 1TBRH 2FYQA 2XC4A 3SJOA 1O3IA 2FO9A 2ODYB 5ESTE 1C1QA 2A7HA 1D3PB 3SUFA 3TK6A 1XXDA 1AB9C 4ZCNA 1UTKA 1FX0B 1O3AA 4I8LA 1DICA 1DLEA 3GCOA 2A1DB 2F9NA 2BYAX 2I6QA 1K1IA 1F7ZA 1Y3VA 5CMXH 1UK3A 1C2FA 5FCKA 4Q4LA 5DK1A 2FOBA 3SGBE 3QWCH 2AMPA 5L2ZH 2RG3A 4MNXA 3NRLA 1GL0E 4INLA 2GKVE 4BAKB 3SJ8A 4IBLH 3P70B 4H4FA 1GI0A 1MQ6A 4A1TA 3MU4A 3GDUA 4CRDA 3MNCA 5AFYH 4AFQA 3IG6B 1MBQA 3ZYEA 3OX7U 1TNGA 1CBWC 2FX4A 3S9CA 2A2XH 1P8VC 1O3MA 1DX5M 1QTFA 1O5DH 5GDSH 1SGEE 4ESTE 1OKXA 3GCTF 4ZHAA 2EEKA 1EP6A 5AF9H 1JRSA 5JBTA 3E91A 2F3CE 2C8WB 3SBKA 4ABAA 4CBOA 1TFXA 4FUIA 1IOEA 1O36A 1EZXC 2UUFB 1GI1A 1VCWA 1ZSLA 2FOAA 1G37A 4E7NA 5GNDA 3H5CB 1SOTA 5GJ4B 1D3QB 1SG8B 1Z8GA 1MTNC 7GCHG 4MG3A 3F68H 1LHDH 2J97A 1O3OA 1GG6B 3H7TA 2BLVA 3PV2A 4IN2A 1BB0B 2FX6A 2J92A 7GCHF 1B5GH 4A1VA 3F9GA 1EASA 2JH0D 3W95A 1PJPA 1LPZB 4DW2U 1IQEA 5AHGH 1AWHB 1QBVH 2TRMA 1O3KA 5FPTA 5FBEA 3A7WA 1QRZA 8GCHF 3GYMA 3V12A 5AFZH 3L3TA 3ATKA 3WWBA 2K8IA 4BAHB 3RUOA 1V2ST 1GVZA 1L2EA 5EQQA 3RXDA 1NT1A 1EPTC 3SORA 1OP0A 2F9PA 3A7ZA 5LH8A 1NROH 1EPTB 1K1LA 2B5TB 3KIDU 1QB1A 1ANEA 1A7SA 5E2PA 2FPZA 2AIQA 1LKBA 1OSSA 1O2XA 3N7DA 1G3EA 1GJ7B 1TOMH 3ATMA 1SGTA 2GV7A 1C5SA 2HGTH 3I29A 1WXRA 1C2IA 4A7IB 2ZU1A 3ATIA 4JYUH 1VITG 1ESAA 4NGAH 3SJIA 4B73A 5C17A 1VJAU 2D1JA 4YT7H 1Z1JA 2UWOA 3SNBA 1O2TA 3M3VA 4BTUB 4XD7D 3T2NA 1CE5A 1KTSB 1DY9A 1UCYK 5DPAA 1DSTA 1QURH 2AMQA 2ZHDA 2ZHFH 3SGAE 2BZAA 2ZKSA 4R0IA 1S85A 2G52A 2HNTE 2WZQA 2J4IA 2TIOA 1VJ9U 2Q6GA 2JETC 3SZNA 3F1SB 1ANBA 3MYWA 3NZIA 1C1TA 1P2OA 3C1KA 3RXRA 4ISIH 3GISB 2JETB 1CGIE 2W5EA 1YCPK 1GBBA 3SV2H 2IPHA 1XUIA 2PW8H 3HPTB 5A0AE 2ZU4A 2OP9A 1K9OE 3RC6A 1QRWA 1V2PT 2BOHB 1BJUA 3VXFH 1FY1A 4WH8A 3FANA 2FLRH 1C1PA 4XBCA 1OWHA 4WMDA 4UE7H 1QR3E 4TWWA 6GCHG 4AG1A 1XMNB 1MCVA 1Z7KA 4ZKOU 1GVLA 1HFDA 2EI6A 1JBUH 1O32A 4UFGH 1K0HA 6GCHF 2AGGX 1UTMA 2GV6A 4ZUHA 5HIYA 1MKWK 1QB9A 4AZ2B 3O8CA 4IC5A 4UDWH 1EATA 1S0RA 1TQ7B 2FESH 4ISNA 4Z6AH 3FZZA 2KR7A 4JZDH 5H4IB 1HAVA 5E0GA 5G4BA 1HB0B 2XBYA 3CNRA 2Y5FA 3K6ZA 1GI9B 1GMCG 1O2LA 1IQIA 1P03A 1QA7A 3LGTA 3RLWH 3SQEE 4XBDA 3UNRA 5E2OA 3EA7A 1JXPA 1YLDA 1P9SA 5HGGA 3UQOA 2FOCA 2WPLS 3P8NA 1GMCF 2D2DA 1T8MA 2A4GA 3GS9A 4NFFA 4DVAU 1NU7B 1WU1A 3M7TA 1DWEH 3HKJB 5A8YA 4H42U 3RMNH 1NRRH 3GY5A 1AGJA 3W1EA 1O2JA 4ZHLU 4R8TB 4I8KA 3ZV9A 3U98H 3A7TA 9LPRA 4INHA 2HWLB 3WWFA 2FOMB 1DPOA 1YCPM 1C2MA 3Q3XA 4A5TS 3H09A 1G2LA 3S7KB 1P2KA 1KDQB 1YGCH 4OS6A 2WPHS 1SGFG 2XOKD 1XUGA 1ACBE 4FUEA 1HCGA 2ZFQH 1SGIB 4ABJA 1K1OA 1BBRK 5JYIA 1YM0A 1DE7H 1WTHD 1IQNA 3QZRA 3TVJB 3ZZDA 3TJVA 1GMDF 2ZCLP 3MI4A 1NFXA 3PB1E 1DFPA 3HK3B 1D3DB 5HXFA 5AVDA 1D3TB 1MBMA 1FXYA 4ZAEA 1DANH 5DP9A 3QK1A 1BITA 2CHAC 2P3FH 3UIRA 1E34B 3ZZ6A 2HLCA 3Q77A 3ZZ8A 1V2RT 2QXHA 3SO3A 3ZZ4A 5CDFE 2BLOA 1DT2A 3SHAH 3BTQE 1EB1H 3LGVA 3OTJE 3U9AH 1A2CH 1NRQH 2Y7ZA 1TABE 1VCPA 4E06H 1MAXA 7KMEH 1UHBA 3RMOH 2G55A 3VB4A 2QF3A 1LHGH 1Y5UT 2C8ZB 3FFGA 1C1RA 4XRNA 2O8MA 1YPJH 2H9EH 4D7GA 3GOVB 4MPVA 4YOJA 4ZMAH 1IQLA 3ZVGA 1A4WH 1ZLRA 5C0TA 5KEDA 2XBXA 3C27B 1Z6JH 4CRGA 2J98A 1K22H 2AGEX 1ZHPA 5A09A 3BF6H 1KSNA 2XNDD 5JDUB 1K28D 1EJAA 1C5XB 3A8CA 2P8OB 1GI8B 1KTTB 5GWZA 4UFDH 1HAOH 4A1XA 5EQSA 3SNEA 3VG8A 1E0FD 1O3PB 2AIPA 3EQ0H 3GICB 1O2HA 3FOAA 1S83A 1DXWA 1O5BB 1UVTH 1PYTD 3UUZA 2J94A 1FN8A 1HDTH 4GAWA 2Q6DA 4ZKNU 5DP3A 4WVPE 3A88A 2OC1A 3A81A 4ABFA 1KY9A 1SPJA 2BDBA 1Z8RA 4OS5A 3HGPA 4WF8A 3URDA 3KNXA 1BA8B 4Y79A 4E05H 1UTLM 3CP7A 4AC9A 1NN6A 4FUCA 1W13U 3HATH 3KQBA 1EFRD 4B2AA 4CRAA 4YTAA 2RFKC 1HAIH 1P9UA 3RP2A 2OXSA 1GI2A 1EOLA 1O2SA 3F2FA 4ZXXH 6ESTA 1FLEE 3VPKA 5LPFA 2PV9B 2C3SA 3MU5A 3PROA 2P3TB 1TQ0B 4KTCA 3T28A 4GHQA 4NA8A 4Y7AA 5J4QA 1C5NH 2KCPA 2IN2A 3F9FA 2QV1A 3FP6E 2PKAA 2QXGA 3LGUA 2G4TA 5EW1H 1MTUA 2C8YB 1CHOG 4YLQH 1ZGIA 5EJLA 1Y3UA 1QFKH 3QDZB 2RA3A 1DXPA 4KELA 1O5GH 1PQ8A 1CHOF 3LC3A 1RS0A 4ACBA 1XUFA 5J4SA 4CRBA 2FOFA 3TGIE 2BD8A 2BXTH 1H9LB 2A5KA 4O3UA 4X0WU 1O2MA 4JYVH 3H7OA 5DO4H 4D8NA 1S0QA 3BTWE 3MTYA 2C90B 3OE7D 3D65E 2ZI2H 3PLKA 4ISOA 3MO9A 1C1NA 2K1QA 3ZVFA 1TNHA 1KXFA 2QGRA 2XC0A 2GZ7A 2LELA 1SGYE 3AAVA 2ZGBH 3L33A 2BD5A 1IAUA 1Y8TA 4UONA 1ETTH 4BTIB 1Y3WA 2ZZUH 5T6GA 1O2NA 4CR9A 5ESBA 2BD3A 3Q3KA 2CF8H 1MQ5A 2YOLA 4AOQA 5C1UA 2Y6TA 1P05A 2QYIA 2F43B 1HXFH 1WOFA 3DSPA 2BD9A 1ZMNA 1W11U 1O37A 3MNBA 3NKKA 2OBQA 4KTUA 1O5EH 1SL3A 1QL8A 3LT3A 2A7JA 4O03A 3BTHE 4O9VA 4YOIA 1WDIA 1AE5A 1C1UH 3DFLA 1UW7A 2R0LA 2WYJA 2ZDNA 2ZEBA 3M5MA 4E7RG 1RRKA 1O2YA 2VBCA 1PPBH 2GMTC 1O2KA 1WSSH 3BG4C 4AN7A 3SJ9A 2NU2E 4BAOB 5TJXA 2XW9A 4OS7A 2CMYA 1F0SA 2B7DH 2F91A 2QN5T 3BG4B 5HM9A 2GMTB 4RKJB 2RCEA 3DT0H 1WQVH 1TALA 1G36A 3VGCC 1GMHG 3B8JA 2VINA 3SOSA 1A3EH 5GIBA 3RXMA 2GD4B 2KM0A 3OEHD 3VGCB 3DD2H 1O3DA 3A83A 1A0HB 1TLDA 2BHGA 1WUNH 2W6ID 3E90B 2SGPE 3EA8A 3T29A 2HALA 1HNEE 1O39A 4CRCA 2P94A 1TYNA 4NIWA 1SOZA 2QIQA 3GCHC 4AB8A 3LJJA 1CA0C 1Q31A 3QGNB 8ESTE 1IHSH 3RXJA 2BDIA 4WXVA 1QJ6B 2SGQE 1PPZA 3SV7A 1GBAA 1KXDA 1LVOA 3GCHB 4I86A 1E37B 2KX4A 2Y5HA 1QJ7B 5CHAC 6CHAB 1UTJA 5E0HA 1BZXE 2GT8A 2ASUB 3TK5A 1GJBB 2IJOB 3TITA 3SZEA 4BXWA 1ABJH 1V2LT 3T25A 4NIYA 4FUHA 2NU3E 1W0JD 2PKSC 1HAGE 3D62A 2H5DA 1OWIA 1OWJA 1BTXA 5T6FA 4M7GA 2BY9X 1BHXB 2VH0A 1QGFA 5CE1A 4X1QU 5JB8S 3UQVA 2PKSB 4K8YA 1SR5C 3SUDA 2GCTC 1FMGA 1SC8U 2ZFRH 1C5PA 1Y3YA 5C5OA 1AI8H 5FAHA 2AYWA 2A7CA 1G3DA 3EYDA 5FX5A 1C2JA 2GCTB 3U1IB 4BNRA 1EXFA 1Z1IA 2WPKS 4MDSA 1KYNA 1ZR0A 4Q7XA 2ZG0H 2AH4X 1SFQB 2ZU3A 1T4UH 4Q80A 5EW2H 1L1GA 4GUXA 1QJ1B 2J9NA 3GY7A 1O3EA 2ZGCA 1OWKA 3NK8A 4NIXA 2ZDKA 1FUJA 1LMWB 3PLBA 3RXLA 1T4VH 2XYAA 1H9IE 4IW4E 4VGCC 2SNVA 1WV7H 1BIOA 4AFZA 5A0BA 1W7GH 4NA7A 4AGJA 1MKXH 4IMZA 3M61U 1Z6EA 3MH4A 4VGCB 3K9XB 1W12U 1GCTC 1O2QA 2Y80A 2ZQ2A 4Y10E 2O8LA 1GCTB 1E35B 1PPHE 2ZFPH 3ELAH 1LTOA 1RIWC 1YPLH 2BTCE 2G5NA 1DS2E 2J2UA 2XBWA 1S82A 1XXFA 4HGCA 1IQHA 1KXEA 3LC5A 2FOEA 1RIWB 1INCA 5ETXA 3RXPA 5FPSA 1H1BA 3B9FH 2JH6D 1PQ5A 1N1LA 3LJOA 3OFND 3ESTA 4XBBA 1A1RA 5HMAA 1O34A 1HUTH 3TNTA 4MLFB 5F8ZA 5T1VA 1GG6C 4WY3A 3SV9A 1NRNH 1PPFE 1O30A 2OD3B 4XOJA 1Y3XA 5DP5A 3ZVBA 4D76A 4X6NA 5IDKA 3UY9A 4K1TA 1VR1H 2ZFSA 2STAE 1J9CH 1UO6A 1U6QA 2CXVA 1FY3A 2QC2A 1GBHA 3WW7A 4FUBA 5DSFA 4F48B 5EXMA 1AZ8A 1HJ8A 1GBCA 2BQ7B 3A82A 4DIIH 3PYHA 1EKBB 1T8NA 1GPZA 2FMJA 3TJNA 5LPRA 3N7EA 2BDCA 2M5TA 1SLXB 1MAYA 1D6WA 2ZIQH 2A5AA 1C9PA 1RD3B 2ZCHP 1SHYA 1GJDB 1C2EA 2OQUA 2DE9A 3OTPA 1QL7A 1GHYH 2XWAA 1DM4B 3NCLA 1P01A 1S84A 3LOXA 1C4U2 3SU3A 1V2QT 3QGJA 4AORA 3DSGA 1BMMH 3MFJA 2EC9H 1S81A 1TWXB 4HG6A 1YCPH 1UVSH 4YO9A 3RLYH 1C5WB 4KGAA 3SU5A 2JH5D 2HVXA 2XC5A 4NG9H 2V7QD 3SN8A 1YWUA 2FEQH 1FIWA 1W0KD 1SFIA 3AW0A 2CJIA 1TGSZ 5T6DA 3ZIAD 4AFSA 3U8TH 5C1XA 1FIZA 2QXIA 5IK2D 4BANB 4JCNA 4YOGA 3P95A 1MU8B 2WV4A 2ZTYA 3ODDA 5JBBS 5C94A 1HAVB 1TX7A 8KME2 3N7OA 1ESBA 1N6XA 7ESTE 1VITF 1V2VT 2VVUA 1MABB 1NS3A 3EA9A 2XTTB 4HFPB 1OS8A 2DE8A 2UUJB 1ELEE 1ZHMA 3PTBA 1F5RA 1BRCE 1P57B 4B2BA 3FO8D 1AVXA 1NFWA 2BD7A 2TPIZ 1P2NA 3FAOA 1OWEA 1C2LA 1CT4E 3EGKH 3KN2A 4DT7B 2WUBA 3KEEA 1VZQH 3BTGE 4M9FA 1O2RA 2BVRH 4UD9H 1A61H 2RA0A 1OHHD 2HPQH 3LH1A 1N6YA 1K2I1 5BRRE 1A5IA 4K8BA 4ABDA 1MUEB 1O2GH 3F9HA 4YLUA 2VWLA 5LPEA 2A31A 4OS2A 1RTKA 1K1NA 1QCPA 3KGPA 4JK5A 3V13A 4X6MA 4XFQA 3S7HB 2H9TH 1P2IA 1THRH 1K1JA 1ZPCA 4ZKSU 3A80A 1TIOA 3TH3H 1HJAB 1P0SH 4X1SU 4F55A 1DUEA 1ETSH 3RMLH 1GDNA 1EAWA 3SUEA 1GHXH 4OS4A 4ZXYH 3QZQA 2LPRA 3BSQA 2VNTA 3U28C 3P8FA 4TYDA 2QCYA 1BBRH 2ESTE 1C1SA 3UOUA 1HAHH 3RXCA 3PO1C 2LNCA 3PV4A 1MD7A 3BTME 3P92A 1LHFH 3RXVA 2VIOA 2OC8A 4THNH 1O3CA 1MCTA 4B76A 3ZZ5A 1KIGH 3PLPA 3PO1B 4MNYA 4P02A 1OPHB 1O2UA 2AFQB 1YF4A 1YPEH 2R3YA 2BZ6H 1GI5A 1UHBB 4U30A 1C2KA 1NRSH 5F53A 9ESTA 1N8OB 1ARCA 3UWJH 4TPYA 4I8JA 4X2YA 3A86A 1W0YH 3GYLB 3QUMP 2V3MA 4Y11E 3RC5A 3CS7A 3UFAA 1GBJA 3P6ZB 1GHBG 1TB6H 3TJUA 2P59A 3PM3A 2BQWB 3A85A 1RFNA 1C5LH 2QA9E 3BTDE 2Y81A 1HPGA 4JZFH 2FP7B 1FZZA 3SU6A 5BPEA 1ZJKA 4QT8C 1QY6A 1UTOA 2A45B 2ZHWH 5FCRA 2FIRH 1HYLA 5FL7D 1BTPA 2ZECA 2FM2A 4ABIA 3LH3A 2BB4A 1TPAE 1TGBA 2QY0B 4NSYA 4YT6H 1EAIA 1NFYA 4U01A 5EXNA 5E8EH 3LKWA 1EP5A 1UVOA 2ILNA 1C5ZB 4Q63A 4ISLA 2NU0E 1T31A 4Y8ZA 5TCCA 5EIYA 2HVYB 4CBNA 3T27A 2R3UA 3MOCA 3O8RA 1FPHH 3LGWA 1TX8A 4WMEA 1C1WH 3LU9B 2ANYA 5F8XA 7LPRA 1D4PB 1EZSC 1VITH 4BTTB 2XWBI 1Q2WA 2O8UA 2ZPQA 2IPQX 2AMDA 2G5VA 4ZHMU 1QNJA 1GDUA 1FAXA 2Y7XA 4GLYA 4CR5A 2ZA5A 2K0QA 2CN0H 1MMJN 2HNTC 3PV5A 3AK5A 2F9VA 1CT0E 2BDYA 4GCHG 5EXLA 1V2KT 5E0JA 1V2MT 4B1TA 4MTBA 5EQRA 5FHTA 2F83A 2SGDE 3MO6A 4GCHF 1AFQB 2OK5A 3UR9A 1O2OA 2P8OC 1J8AA 1TOCB 2XNIA 3L6PA 4ABEA 2PKAB 4AG2A 1AUTC 5A0CA 1J14A 1HAZB 3LGYA 1W0ZU 2Z9JA 1SLUB 2GCHG 2YMSC 2FDAA 1GBLA 2Q1JA 1P06A 1QZ8A 2FZZA 4TT3D 3DHKH 3UR6A 4CH8B 3GY4A 2GCHF 3A89A 2PHBA 2YMSB 2R0KA 4AGKA 2KCYA 3FKSD 1GBFA 1ARBA 2FTLE 2FS8A 2TGDA 3SNAA 5C1YA 2SGFE 1MZAA 1TNLA 2JDID 3RXFA 2OTVA 5F03A 2QE7D 3EE0B 1P2MA 2GZ8A 5C20A 1F2SE 1A0LA 3BEUA 4JZ1A 1QBOA 1HAYB 1LQEA 3SYJA 1W14U 3BG8A 2W7SA 1BTHH 2VH6A 4NZLA 1A3BH 1O5FH 3KYFA 1SLVB 5I46H 2OQ5A 4AYVB 1C5QA 3VXEH 4XDEA 1C4V2 1FN6A 3D49H 1XUHA 1O38A 1BDAA 1RGQA 1O5AB 2KAIA 4FXGH 3WY8A 4XSKU 4NFEA 3R0FA 3DFJA 4KP0A 3F0PA 2WPIS 3ENSB 4CREA 1ZPBA 3TH2H 4JYTA 2EQNA 1TBQH 2KFWA 4X6OA 2AGIX 1NBMD 1PPGE 2V0BA 2PTNA 4JMYA 3U8RH 3BTTE 3ZVDA 3MU1A 1YPKH 1PQAA 1NM6A 1RXPA 1W2KH 2FI4E 3UREA 4AFUA 5EODA 2YNAA 1HRTH 3MU0A 2D26C 2XRCA 1MTVA 1NBME 2GTBA 3Q3YA 1ELCA 4I32A 1XKBC 1OXGA 4F49A 2ZGJA 1BUIA 3UAIC 2G4UA 1FDPA 1BHXF 4K1EA 1AY6H 1P3EA 4RSPA 3RXAA 1BTZA 5EGMA 4NWKA 5KECA 1P04A 3F6UH 1ID5H 1WBGB 4JK6A 1KXBA 4F4OC 3SU0A 2EI7A 1SMFE 1ZRKA 1P11E 5SGAE 2ZGXH 3UOPA 5FBIA 2CGAA 1C2HA 3M35A 4X1RU 3HKIB 2H2ZA 3SNDA 1NO9H 1SQOA 1G30B 1O3JA 1ZTJA 3B23B 2VGCB 1JMOH 4NWLA 3MHWU 4HTCH 3Q76A 2GX4A 1V2UT 3BN9A 3RDZA 4CRFA 3P17H 3M5NA 3M37A 4X1NU 3SI4H 3A8DA 1AUJA 3NXPA 1ZZZA 3QO6A 1EAXA 4DY7B 1JIMA 1ELAA 4Y0YE 1EQ9A 2ZPRA 3RU4D 1VGCB 2JJ1D 4MPUA 4WMFA 5DP6A 1DUAA 1G32B 2Z9KA 3GDSA 4NSVA 1TNIA 2Z3DA 1AU8A 3SNCA 5ABWA 2OINA 3HK6B 5A2MH 1O2VA 1SGPE 1GHAG 2HLDD 5C0UA 1SGFA 2EI8A 1EOJA 1UTQA 1ETRH 1HIAA 1TPOA 3PWCA 3QX5H 1GMHF 5DP8A 1QRXA 5HIZA 2AERH 1GGDB 1ZOMA 1GHAF 3M7UA 3STIA 2SNWA 2SGEE 4Q7YA 1A46H 1BRAA 4A6LA 3QTVH 1ABIH 3O8BA 4I8HA 3GY6A 4NZQA 1L0ZA 4NIVA 1ZTKA 1S6LA 2ZTZA 1FPCH 4U2WA 1MTSA 4X2VA 5IYTA 2FTMA 3U69H 2ZP0H 6CHAC 1LHCH 2TBSA 1WCZA 1BQYA 3KQ5A 4TWYA 1IQMA 2ZFTA 5HM2A 3KQDA 3A84A 1ZPZA 4D9QA 2HRVA 1GI3A 1GHZA 2C93B 4RN6A 2TGAA 1VCQA 4J1YA 3SU4A 1LO6A 1GHVH 1SHHB 2ALVA 2WPMS 1LQDB 4GSOA 4ASUD 5GXPA 1H4WA 3MH6A 1L4DA 2G81E 1O0DH 3BTKE 2AS9A 2V6NA 3GY3A 3M36A 5C67A 1SLWB 3KYGA 2VB0A 1Z71A 2Y5GA 1C5YB 2FYRA 4SGBE 1GJAB 3A87A 1GJ5H 4JZIA 1EZUC 1HAPH 2Z7FE 2VJ1A 4CH2B 4BAQB 2BMGB 3E6PH 3MNXA 1GBEA 3MO3A 1G3BA 2B9LA 2A2QH 2F4LA 2KCAA 2ZF0H 1M9UA 2WV5A 1J17T 1E1QD 1ELFA 2GJGA 1TAWA 4K2YA 1SQRA 3AW1A 4Y6DA 3SHCH 3SJKA 1V2OT 3RM0H 4DCDA 4HZHA 4LXBH 4K3JA 1K1MA 3MH5A 2FLBH 3FVFB 1FAKH 1WTGH 2AHME 1E36B 1QIXB 4DIHH 1LCYA 1QQUA 2H5CA 1P2QA 2OUAA 3RXTA 1C5TA 3BTEE 4KTSA 1EJMA 2WPDD 2WYGA 1EX3A 4RT1A 4LOYH 3ZYDA 3EAJA 3E16B 5FXLA 1AKSA 1KLTA 2BY8X 1WYKA 2QF5A 2ZFFH 1YPGH 2JIZD 4FU8A 2Z9IA 5L2YH 1ZMLA 4IC6A 4A92A 2VWNA 3VB6A 5KGOA 1DLKB 1SSXA 2Z3EA 1YY3A 2PGBB 3ZZ3A 3ITIA 3S9AA 2BDAA 2RDLA 1SI5H 3OY6U 2J5UA 1DOJA 2FOHA 1D9IA 3E0PB 2CV3A 1YYY1 2CK3D 2STBE 1DWCH 1AB9B 2PFEA 2GDEH 1ANDA 1TRNA 3PTNA 2BXUH 1BBRE 4B71A 2V3OH 2OLGA 3NWUA 1V6DA 1O2WA 1LVBA 1OWDA 2L6OA 3TGKE 5CHBA 1GBDA 2C8XB 2QAAA 2ZHQH 1P3CA 2W26A 1BT7A 1K1PA 3ZV8A 1AVWA 1GJ8B 4OGYA 1UK4A 2BD4A 1O3BA 3BTFE 3GCTG 1XVOA 1YC0A 1OYQA 1Y5BT 2WV9A 2XXLA 1TX6A 1UVUH 2OC0A 1UTPA 3GY2A 1F92A 3M3TA 1O2PA 1CBWB 2OC7A 2ZU2A 1EJNA 1GCDA 2A4RA 4H6TA 1TRMA 4LK4A 4ZROA 1CGJE 3A8AA 3PMJA 5L6NH 2F9OA 1DDJA 1Z8IB 2ANMH 3E8LA 4Q2KA 2I6SA 3SU2A 1MH0A 3V7TA 1TMTH 1JRTA 3LONA 1JIRA 1SKYE 3VB3A 2CF9H 2ZDVH 1FI8A 4B74A 1BOQA 2G8TA 4AX9H 3STJA 1MKXK 1Y59T 3NUMA 1MTNB 1UCYH 4UEHH 1NC6A 1ZTLA 3S69A 1SQAA
chains in the Genus database with same CATH topology
1LHEH 3MMGA 1ELBA 3IITA 8GCHG 2PGQB 1GI7B 1FY4A 1UMAH 1NESE 1G9IE 5C5NA 3S0NA 1O3HA 1TGNA 1GJ9B 3LDXH 1PPCE 1FV9A 1GJ6A 1H9HE 1L1NA 1F0UA 1UJ1A 2ZQ1A 1ZSKA 2D8WA 5B6OA 2PR3A 1PPEE 1P09A 2H6MA 2FODA 1LKAA 4D7FA 3RXSA 3RM2H 3V0XA 1TE0A 4O3TA 1JWTA 1IHTH 1L1JA 2ANWA 3DUXH 2SGAA 3RXOA 1BMLA 1UK2A 4ZKRU 3FZDA 5JB9S 4X6PA 2WPJS 5T3HA 2PSXA 1FJSA 1MKWH 1B0EA 3KQCA 1AQ7A 4Y8XA 4ABBA 1V2NT 1YPHC 3MH7A 3I77A 1CGHA 1F5LA 4DURA 3OU0A 4U32A 3PWBA 2HOBA 5DKMA 5L30H 5GCHG 1LPKB 1BRUP 2VU8E 3T5FH 3TH4H 3TLOA 1AMHA 3KQEA 5GCHF 1UVPA 1F5KU 3ODFA 2PSYA 1FNIA 3F9EA 1YBWA 2ODPA 1B0FA 1NPMA 1ZSJA 2P3UB 3RXGA 3OY5U 1S6FA 1XX9A 2IOTA 4TPIZ 1O2ZA 2BVSH 5JBAS 3RXUA 4LZ4B 2JKHA 3O8DA 3URCA 1C1MA 4WH6A 2YNBA 3RXBA 2EA3A 4B2CA 5JBCS 2A5IA 4ASHA 1OOKB 4I31A 1O31A 4FUDA 1C1OA 1GJCB 2UUKB 1HJAC 1F0RA 3ZZ9A 1OP8A 1TMBH 3M5LA 5EU8A 4X8TH 3E0NB 2VIDA 3TJOA 4K60A 2G00A 1ZMJA 2HNTF 3M5OA 2BQ6B 1EPTA 2HPPH 5TCAA 1P02A 1KXAA 2GVFA 1C4Y2 2BM2A 1TNKA 2O9QA 3EDXB 1CT2E 3ATWA 2ZC9H 1AE8H 1SBWA 4WJG2 2WINI 3ZZAA 2BD2A 1QQ4A 3AASA 3QLPH 3VB7A 2Z6BD 2H9HA 1XUKA 5A8XA 1AIXH 4JZEH 3AAUA 1ORFA 4AYYB 2R9PA 1DY8A 2BY7X 1OYTH 2PTCE 2PUXB 4YZUA 2FI3E 3SQHE 1GI4A 3RXQA 4BXSA 3T62A 2P95A 2ZDLA 1GHWH 1N8OC 4K1SA 4MQAA 3A7XA 1TA2A 2V35A 2F9BH 3UTUH 1H8DH 1WQSA 4I8GA 4FVDA 3I78A 2F9UA 1DITH 2J38A 2XCNA 2TGTA 1IQKA 1ELTA 3E1XB 5LGOA 2QF0A 3RXIA 5GPIB 3KF2A 1Y5AT 1TNJA 1O5CB 2W7UA 2FI5E 1HBTH 2OBOA 1PFXC 4WXIA 2ANKH 1GHBF 2UWPA 3T26A 1P10A 2ZNKH 1ELGA 3P8GA 1GWAA 5DGJA 1V2WT 2ULLA 1HGTH 3JZ1B 4X8VH 2V3HH 4GVUA 3K6YA 1D6RA 3FP7E 1HAXB 2UUYA 3A7YA 1LVYA 1W7XH 4FVBA 2FWWA 3RXKA 1C5OH 1XKAC 4Q7ZA 3GDVA 1AHTH 3LPRA 3RXEA 4I7YH 2Z9GA 1T7CA 2A4QA 5PTPA 1DSUA 2A32A 1GMDG 3MWIU 4O97A 4K69A 4IMQA 1IQFA 2ZO3H 3LGIA 2A4OA 1O3NA 4MPXA 3G01A 1O3LA 3PMHB 2GP9B 2UWLA 2ZWLH 1SB1H 4MPWA 3U8OH 1ZHRA 1BJVA 2NU1E 1RTLA 2Y82A 3R3GB 3PMBB 1NFUA 2G51A 1O33A 1GL1A 1EB2A 1SVPA 2B8OH 3E3TA 2KAIB 1AN1E 1KLJH 1A5GH 3BEIB 2VWMA 1GI6A 1BTWA 2FS9A 1W3CA 3MU8A 2CHAB 3BIVH 5C3NA 1AFQC 2VIPA 1C5RA 4FUFA 1FQ3A 4CHAC 1NZQH 1IQGA 4YM9A 1ZGVA 4H6SB 4IGDA 2BX3A 1CHGA 1SGNE 4XE4A 4CHAB 3ZZCA 4DG4A 1TBZH 4X8UH 4X1PU 4Y76A 2BDHA 3BIUH 1TMUH 3A8BA 3OSYA 1THPB 2VWOA 1DVAH 3D23A 1KLIH 1CU1A 1XUJA 4DOQA 2P93A 2SFAA 3U1JB 1PQ7A 1QB6A 1TONA 3KL6A 1HXEH 1QA0A 4BAMB 2VVCA 1AO5A 1BRBE 1KDQA 1QBNA 5C2ZA 1S6HA 3KCGH 1MU6B 1LPGB 1QL9A 4ZH8A 1YPMH 2QXJA 1P2JA 1THSH 1YP9A 3ZZ7A 1YLCA 3TU7H 1NRPH 1C5VA 2GZ9A 1TPSA 4B75A 1EAUA 4HI3A 3UNSA 2GGVB 4FUGA 1GBIA 3CENA 1J16A 1T8OA 2THFB 1J15A 4TY7A 1F0TA 1L4ZA 1JOUB 3PMAB 1DWBH 5EG4A 4D9RA 3ZVEA 5F6MA 2O8WA 3K65B 1IQJA 2BOKA 2C4FH 1ESTA 5A8ZA 2ZDMA 3ZZBA 3SI3H 2VIWA 1FY8E 3RXHA 1ANCA 1AZZA 2W3KA 1E38B 2Z94A 2P16A 2ZTXA 3A7VA 3SU1A 1Q3XA 4Y71A 3SW2B 2A0QB 1C5UA 5K0HA 3JZ2B 1DWDH 1RJXB 4LZ1H 3SGQE 1H8IH 1AFEH 1SGCA 4WWYA 3OYPA 1AD8H 2PLXA 2PUQH 1Z8JB 2J95A 4NA9H 1TRYA 1HJ9A 2GT7A 1HIAB 1O3FA 3QTOH 1ZYOA 4ABGA 1ELVA 2Z3CA 5FPYA 4X8SH 4J2YB 1LVMA 1ZJDA 2W3IA 1MTWA 4YESB 1BMAA 4FU9A 2ALPA 1GBMA 2PWXA 1FY5A 2ZHEH 2ZU5A 4Z0KA 2OCVB 1SGDE 2ZPSA 1ZRBA 2BLQA 2VGCC 2BY6X 1CA8B 4DJZB 1EZQA 3IWMA 1GDQA 1XM1A 2Q6FA 3ZVCA 4UFFH 3BV9B 1G2MA 2VIVA 5EPYA 1B7XB 1CVWH 1O3GA 5FX6A 4IN1A 1C1VH 1QHRB 4GPGA 1LDTT 1MZDA 5K7RA 4TY6A 4BOHA 2ZGHA 1VGCC 1CO7E 2GDDA 1GJ4H 2BVXH 2WUCA 5EOKA 2R2WU 1O35A 1AVGH 1W10U 3S9BA 1SQTA 2XCFA 4UFEH 1NU9A 4FU7A 4SGAE 5DJ7A 4OS1A 3RU4E 4MNWA 4MVNA 1GGDC 2XBVA 3P8OA 4GHTA 3SUGA 3HGNA 1T32A 4X2WA 1A5HA 1UCYE 2TGPZ 1OX1A 4I33A 1X7AC 1FONA 2R2MB 3CS0A 3LIWA 5EPNA 1HLTH 3UPEA 4Y8YA 3RC4A 1C2DA 3QN7A 5JPMH 1S5SA 3TIUA 4K5ZA 1OP2A 5HYOA 1AWFH 4X2XA 5F8TA 3BEFB 1P12E 3K2UA 3Q00A 2FXRA 1GBKA 1TGTA 3M3SA 4KKDA 4DGJA 3M7QA 5DG6A 3VB5A 1MD8A 1O2IA 4Y0ZE 3ATLA 1BCUH 2DUCA 1AKSB 2ZDAH 1TA6A 1A0JA 2J34A 1SGRE 1PYTC 1T8LA 1WAYB 1CQQA 8LPRA 4MNVA 1SGQE 4NCYA 5DP4A 2ODQA 3AVZA 2ZCKP 1KXCA 1V3XA 1XVMA 2H1UA 1NTPA 1CA0B 1K21H 3KHVA 2BX4A 1C9TA 2BY5X 2AEIH 5I25A 3TPIZ 1YKTA 3SV8A 3TGJE 1W8BH 4RKOB 1GVKB 1ELDE 2NWNA 3RMMH 5CHAB 3RU4T 1UTNA 3V3MA 3NPSA 1C2GA 2Z9LA 1GBTA 6LPRA 1C5MD 2FOGA 4ABHA 2NU4E 1V2TT 2BDGA 3DA9B 1BMNH 3UNQA 3MNSA 1V2JT 4IS5A 4OGXA 4Y7BA 1CSOE 3TK9A 3UWIA 2B0FA 2O8TA 1HV7A 3GCNA 4ISHH 4PROA 3SV6A 3ZVAA 3VEQB 4AB9A 1EUFA 3FP8E 5DP7A 1NY22 1YPHE 2BLWA 1G3CA 2VIQA 1BTYA 3TNSA 3W94A 3VFEA 2VVVA 3GY8A 1TPPA 4INKA 1BTUA 1RTFB 4FUJA 1TGCA 1TBRH 2FYQA 2XC4A 3SJOA 1O3IA 2ODYB 2FO9A 5ESTE 1C1QA 2A7HA 1D3PB 3SUFA 3TK6A 1XXDA 1AB9C 1UTKA 1O3AA 4I8LA 1DICA 1DLEA 3GCOA 2A1DB 2F9NA 2BYAX 2I6QA 1K1IA 1F7ZA 1Y3VA 5CMXH 1UK3A 1C2FA 5FCKA 5DK1A 2FOBA 3SGBE 3QWCH 2AMPA 5L2ZH 2RG3A 4MNXA 1GL0E 4INLA 2GKVE 4BAKB 3SJ8A 4IBLH 3P70B 4H4FA 1GI0A 1MQ6A 4A1TA 3MU4A 3GDUA 4CRDA 3MNCA 5AFYH 4AFQA 3IG6B 1MBQA 3ZYEA 3OX7U 1TNGA 1CBWC 2FX4A 3S9CA 2A2XH 1P8VC 1O3MA 1DX5M 1QTFA 1O5DH 5GDSH 1SGEE 4ESTE 1OKXA 3GCTF 4ZHAA 2EEKA 1EP6A 5AF9H 1JRSA 5JBTA 3E91A 2F3CE 2C8WB 3SBKA 4ABAA 4CBOA 1TFXA 4FUIA 1IOEA 1O36A 1EZXC 2UUFB 1GI1A 1VCWA 1ZSLA 2FOAA 1G37A 4E7NA 3H5CB 1SOTA 5GJ4B 1D3QB 1SG8B 1Z8GA 1MTNC 7GCHG 4MG3A 3F68H 1LHDH 1O3OA 1GG6B 3H7TA 2BLVA 4IN2A 1BB0B 2FX6A 2J92A 7GCHF 1B5GH 4A1VA 3F9GA 1EASA 2JH0D 3W95A 1PJPA 1LPZB 4DW2U 1IQEA 5AHGH 1AWHB 1QBVH 2TRMA 1O3KA 5FPTA 5FBEA 3A7WA 1QRZA 8GCHF 3GYMA 3V12A 5AFZH 3L3TA 3ATKA 4BAHB 3RUOA 1V2ST 1GVZA 1L2EA 5EQQA 3RXDA 1NT1A 1EPTC 3SORA 1OP0A 2F9PA 3A7ZA 5LH8A 1NROH 1EPTB 1K1LA 2B5TB 3KIDU 1QB1A 1ANEA 1A7SA 5E2PA 2FPZA 2AIQA 1LKBA 1OSSA 1O2XA 1G3EA 1GJ7B 1TOMH 3ATMA 1SGTA 2GV7A 1C5SA 2HGTH 3I29A 1C2IA 4A7IB 2ZU1A 3ATIA 4JYUH 1VITG 1ESAA 4NGAH 3SJIA 4B73A 1VJAU 2D1JA 4YT7H 1Z1JA 2UWOA 3SNBA 1O2TA 3M3VA 4BTUB 3T2NA 1CE5A 1KTSB 1DY9A 1UCYK 5DPAA 1DSTA 1QURH 2AMQA 2ZHDA 2ZHFH 3SGAE 2BZAA 2ZKSA 4R0IA 1S85A 2G52A 2HNTE 2J4IA 2TIOA 1VJ9U 2Q6GA 2JETC 3SZNA 3F1SB 1ANBA 3MYWA 3NZIA 1C1TA 1P2OA 3C1KA 3RXRA 4ISIH 3GISB 2JETB 1CGIE 2W5EA 1YCPK 1GBBA 3SV2H 2IPHA 1XUIA 2PW8H 3HPTB 5A0AE 2ZU4A 2OP9A 1K9OE 3RC6A 1QRWA 1V2PT 2BOHB 1BJUA 3VXFH 1FY1A 4WH8A 3FANA 2FLRH 1C1PA 4XBCA 1OWHA 4WMDA 4UE7H 1QR3E 4TWWA 6GCHG 4AG1A 1XMNB 1MCVA 1Z7KA 4ZKOU 1GVLA 1HFDA 2EI6A 1JBUH 1O32A 4UFGH 6GCHF 2AGGX 1UTMA 2GV6A 4ZUHA 1MKWK 1QB9A 4AZ2B 3O8CA 4IC5A 4UDWH 1EATA 1S0RA 1TQ7B 2FESH 4ISNA 4Z6AH 3FZZA 4JZDH 5H4IB 1HAVA 5E0GA 5G4BA 1HB0B 2XBYA 2Y5FA 3K6ZA 1GI9B 1GMCG 1O2LA 1IQIA 1P03A 1QA7A 3LGTA 3RLWH 3SQEE 4XBDA 3UNRA 5E2OA 3EA7A 1JXPA 1YLDA 1P9SA 5HGGA 3UQOA 2FOCA 2WPLS 3P8NA 1GMCF 2D2DA 1T8MA 2A4GA 4NFFA 4DVAU 1NU7B 1WU1A 3M7TA 1DWEH 3HKJB 5A8YA 4H42U 3RMNH 1NRRH 3GY5A 1AGJA 1O2JA 4ZHLU 4R8TB 4I8KA 3ZV9A 3U98H 3A7TA 9LPRA 4INHA 2HWLB 2FOMB 1DPOA 1YCPM 1C2MA 3Q3XA 4A5TS 1G2LA 3S7KB 1P2KA 1KDQB 1YGCH 4OS6A 2WPHS 1SGFG 1XUGA 1ACBE 4FUEA 1HCGA 2ZFQH 1SGIB 4ABJA 1K1OA 1BBRK 5JYIA 1YM0A 1DE7H 1WTHD 1IQNA 3QZRA 3TVJB 3ZZDA 3TJVA 1GMDF 2ZCLP 3MI4A 1NFXA 3PB1E 1DFPA 3HK3B 1D3DB 5HXFA 5AVDA 1D3TB 1MBMA 1FXYA 4ZAEA 1DANH 5DP9A 3QK1A 1BITA 2CHAC 2P3FH 3UIRA 1E34B 3ZZ6A 2HLCA 3Q77A 3ZZ8A 1V2RT 2QXHA 3SO3A 3ZZ4A 2BLOA 1DT2A 3SHAH 3BTQE 1EB1H 3LGVA 3OTJE 3U9AH 1A2CH 1NRQH 2Y7ZA 1TABE 1VCPA 4E06H 1MAXA 7KMEH 1UHBA 3RMOH 2G55A 3VB4A 2QF3A 1LHGH 1Y5UT 2C8ZB 3FFGA 1C1RA 2O8MA 1YPJH 2H9EH 4D7GA 3GOVB 4MPVA 4YOJA 4ZMAH 1IQLA 3ZVGA 1A4WH 1ZLRA 2XBXA 3C27B 1Z6JH 4CRGA 1K22H 2AGEX 1ZHPA 5A09A 3BF6H 1KSNA 5JDUB 1K28D 1EJAA 1C5XB 3A8CA 2P8OB 1GI8B 1KTTB 5GWZA 4UFDH 1HAOH 4A1XA 5EQSA 3SNEA 1E0FD 1O3PB 2AIPA 3EQ0H 3GICB 1O2HA 1S83A 1DXWA 1O5BB 1UVTH 1PYTD 3UUZA 2J94A 1FN8A 1HDTH 4GAWA 2Q6DA 4ZKNU 5DP3A 4WVPE 3A88A 2OC1A 3A81A 4ABFA 1KY9A 1SPJA 2BDBA 1Z8RA 4OS5A 3HGPA 4WF8A 3URDA 3KNXA 1BA8B 4Y79A 4E05H 1UTLM 3CP7A 1NN6A 4FUCA 1W13U 3HATH 3KQBA 4B2AA 4CRAA 4YTAA 1HAIH 1P9UA 3RP2A 2OXSA 1GI2A 1EOLA 1O2SA 4ZXXH 6ESTA 1FLEE 3VPKA 5LPFA 2PV9B 2C3SA 3MU5A 3PROA 2P3TB 1TQ0B 4KTCA 3T28A 4GHQA 4NA8A 4Y7AA 5J4QA 1C5NH 2IN2A 3F9FA 2QV1A 3FP6E 2PKAA 2QXGA 3LGUA 2G4TA 5EW1H 1MTUA 2C8YB 1CHOG 4YLQH