1UTQA

Trypsin specificity as elucidated by lie calculations, x-ray structures and association constant measurements
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSINOGEN
publication title Trypsin Specificity as Elucidated by Lie Calculations, X-Ray Structures, and Association Constant Measurements
pubmed doi rcsb
molecule tags Hydrolase
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1utqA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1utqA02
4ABJA 3UWIA 2GT8A 4BAHB 1E34B 3BTGE 1HLTH 1QRZA 1T8LA 2ESTE 3ZV8A 1GI3A 3M35A 3T27A 1UTMA 3LONA 4JZIA 1T7CA 4K1TA 1EPTB 1PJPA 2Z9LA 3R0FA 1HAXB 1GJ8B 2I6QA 3MNXA 1SR5C 5DP4A 1P3CA 2J95A 4JYVH 1WTHD 2Y82A 3QTVH 1EOLA 2GMTC 4X8TH 1GBDA 2XBWA 1HB0B 3RXIA 2RG3A 3QZQA 1EKBB 1ZSLA 2BDYA 4CRBA 1O5BB 4ZUHA 2OTVA 2Z9JA 3NK8A 3A7WA 1P2NA 3T29A 2KAIA 2V0BA 4RKJB 1P2KA 1ZMNA 1CO7E 1UMAH 4Q7ZA 1YPGH 3TJVA 1BRUP 1UTLM 3TU7H 3T5FH 1JRSA 3MO6A 4MPUA 2ZF0H 4BAMB 1WAYB 5C3NA 1TNKA 5EQSA 3NKKA 1ZLRA 3F6UH 4ISLA 2BD2A 3ATLA 4UFFH 1THRH 1QNJA 2LPRA 2LNCA 1JWTA 1TQ7B 2ZTYA 4OS7A 1E35B 4BAKB 6GCHF 2A4QA 3EA8A 2D26C 4KTCA 3T28A 3A82A 1Y3VA 4WXVA 4DIIH 4XBBA 1AU8A 4ABBA 1C2LA 3Q3XA 6GCHG 4Y10E 2H6MA 3KQEA 1C2GA 2FEQH 1BHXF 2BD5A 1DWBH 2VIQA 3H5CB 5BPEA 3VGCB 4Y71A 1FV9A 2D1JA 1SLUB 2P16A 1S6HA 1EPTC 1UTQA 3BF6H 4RKOB 4U01A 1BMNH 2P95A 2WPHS 4NA7A 1HRTH 4CRCA 5HXFA 4MQAA 1SFQB 1QGFA 2PSYA 1GHZA 1VGCC 3AAUA 3P8OA 3TK5A 5L2ZH 3E0PB 2Y6TA 5JPMH 2BHGA 4E06H 1C1VH 3BTQE 2CF8H 3TNTA 1XVMA 4D8NA 5A0CA 1QBNA 4IN1A 2ZA5A 5JBAS 3A80A 4UD9H 1Z1JA 2O9QA 8KME2 4Q7YA 1TA6A 1E36B 1IQJA 1BTHH 2QXJA 2QXIA 5GJ4B 1TX8A 1HCGA 3UY9A 4TWYA 1NFUA 3ZZDA 3MH5A 4OS5A 1G3DA 3ZZ7A 2NU1E 1ABJH 1IQMA 1OWDA 2V35A 2VWMA 3MI4A 3A7XA 1THPB 1AZZA 1FY1A 5JBTA 1CT0E 1ACBE 2Y7XA 3NWUA 4UONA 5AF9H 5E8EH 2EA3A 1O37A 2A5AA 1O3EA 1QJ6B 2ZHEH 1ZRBA 1GI6A 1P05A 2TGTA 4NIXA 3ZZ4A 1IQLA 1V2RT 1TMTH 4NWKA 1GCDA 1F7ZA 2G00A 3VB3A 1NN6A 2EEKA 2SFAA 4CRDA 4XSKU 3MU8A 1C9TA 2PV9B 1P9SA 2WPMS 2OQUA 4WJG2 2QCYA 1EZXC 1O3JA 4MTBA 2FYQA 2GZ7A 3K6YA 3SUGA 1MAXA 2BYAX 3A89A 3V7TA 2FOFA 1XUHA 1UHBB 1PPEE 1EB1H 1KXFA 1WYKA 3STJA 1QL9A 2HNTE 4UFGH 3UREA 2HVXA 1CHGA 2O8WA 3LPRA 1DDJA 5A8XA 1O2MA 2R0LA 3QDZB 2BY9X 1DT2A 4CRGA 2YOLA 3SNAA 1HNEE 2QF3A 3OY5U 3RU4E 3RXKA 2PGQB 1K22H 2W3KA 2CXVA 3OX7U 3GY2A 3RXEA 2PKSB 2FI4E 1O32A 2FODA 4YT7H 1FAKH 2XCNA 4X6MA 4NSVA 4M7GA 3GYMA 2A7JA 2SNVA 2JH5D 2THFB 1GDUA 4TY7A 4ZKNU 1EJAA 5K0HA 6CHAC 1PPCE 1W14U 5LPRA 2AIPA 4WVPE 1DY9A 1NROH 1Z8RA 4KTSA 1QURH 3EYDA 1ZMJA 3UNSA 1V2TT 2ZU3A 2DUCA 4BTTB 1SGCA 1Y5UT 1ZGIA 1FXYA 2ZFRH 4JZDH 4X1SU 4WH6A 4X2WA 1INCA 4Y7BA 5B6OA 3MNSA 1UVTH 2FOCA 1TOMH 1O2OA 1SHYA 2STAE 4ZXXH 1CGJE 2EC9H 3SJ8A 2W26A 1MBQA 2GZ8A 4MNXA 4NIYA 4I8GA 2XC0A 3MNBA 3SI3H 4AG2A 3UNQA 1GHAF 3FAOA 2IJOB 3GISB 1CSOE 2JKHA 4ABAA 1C2EA 1QY6A 1AO5A 2VNTA 3QK1A 4DW2U 1CT2E 2FS8A 4ISNA 4ABDA 2VU8E 2XTTB 1LPGB 3GY8A 3GY4A 5EXNA 1GBBA 1MD8A 1GHAG 2JH6D 4XBDA 3DT0H 3SV6A 3RMNH 3MH4A 1C5XB 1V2LT 1ELBA 1O34A 3VB7A 3SGQE 3ZZ9A 1TNGA 2WYJA 1J8AA 1OWJA 1IQEA 4XBCA 2BOKA 4ABEA 1YKTA 2ZG0H 1AUJA 1KYNA 1PYTC 1T4VH 1YPKH 2SGDE 1HJAB 4FUJA 1O3DA 2TBSA 3SV2H 5AFZH 4I8KA 4BXWA 1ANBA 1SGQE 4NFFA 3KEEA 2STBE 3SQHE 1D3PB 4AGKA 1C1SA 4NWLA 1JOUB 1SMFE 3OYPA 4BXSA 2OUAA 2GT7A 4AYYB 1XM1A 3LT3A 3PTNA 4AFSA 1QR3E 4NZQA 5JB8S 1B0EA 2IOTA 3KNXA 2GTBA 2BQ6B 2FOAA 3FFGA 2GD4B 4GSOA 4IS5A 4AZ2B 1W13U 4WY3A 1NRNH 2PFEA 4ISHH 1QRXA 1TOCB 1WQVH 3V12A 1DXWA 3E1XB 1TX7A 1VJAU 4VGCB 4NCYA 1HIAB 4FU8A 1MU8B 2A45B 3MWIU 3NUMA 1SSXA 5I46H 2FO9A 2Z9GA 2R2WU 2NU4E 5E2OA 1ZJDA 2ZHDA 1A5HA 4Z0KA 5T6DA 3RMLH 5DGJA 2BMGB 2ZDMA 1MKXK 2ZTZA 4KGAA 2VH6A 3E91A 1C1NA 4FUFA 5DKMA 4NA9H 1VZQH 2GV6A 3E3TA 1P11E 5SGAE 2GKVE 2Q6DA 1HAPH 4E05H 1ELDE 2PKAB 1YPEH 1C5SA 2Q1JA 5ESTE 1CA8B 4YLUA 1MU6B 1BJVA 1CHOG 3KGPA 5JB9S 1H4WA 1ZR0A 1TE0A 1V2ST 1ZHMA 1BRAA 3F1SB 1TLDA 3UWJH 4WH8A 2WPLS 2F9UA 1NRQH 1C5YB 4OGYA 1NESE 1QIXB 1K1IA 4GLYA 1ESTA 1TX6A 1TBQH 3PMBB 4K2YA 5FX5A 4XE4A 1P2MA 1P2OA 3SZNA 1FY3A 4OS1A 3M5OA 3PWCA 3TJOA 5DPAA 2J92A 2XBVA 5HMAA 2ZTXA 1C1QA 2BDCA 2FTMA 4U32A 4YLQH 4F49A 3ZZ3A 3MHWU 5E2PA 1BHXB 1GMHF 1O31A 1AI8H 2BY7X 3MO9A 4A7IB 4DY7B 1NU7B 3PMHB 3N7OA 2ZFFH 5K7RA 1AN1E 5FBIA 3BIUH 3A87A 2ZHWH 1Z71A 4I33A 1XUKA 3ATMA 1GMHG 3F9HA 1GVKB 2FTLE 2ZQ2A 2G5NA 1K1LA 1ZTLA 1S84A 1CT4E 2WUBA 3PM3A 3QO6A 4WMFA 5ETXA 4GUXA 1QJ1B 1THSH 1DFPA 1C5QA 1SGFA 1SQAA 1NPMA 1J15A 1FN6A 1RIWC 2Z3EA 4JZEH 1T4UH 1IQGA 2AFQB 4OS2A 1C5LH 4H42U 1SGIB 1C2HA 4I8JA 4GCHF 5EGMA 5EPYA 3ESTA 3VPKA 1YYY1 2ZECA 3MU0A 3QX5H 1W3CA 1YM0A 1S83A 1Z6JH 1FNIA 3TPIZ 1K1OA 1GJ7B 2XC5A 1BBRH 1OYTH 1PPZA 3NPSA 1D6WA 1L2EA 2WUCA 4GCHG 8LPRA 3V3MA 1QRWA 1C5TA 3H7OA 1AWFH 2SGEE 1ELAA 5DP7A 2HNTC 4Q2KA 1O3IA 3RXAA 2ZFTA 3EQ0H 2O8UA 1EAUA 1C2FA 3NXPA 2TGPZ 2C8XB 2PW8H 4LK4A 1YPLH 1A4WH 4X2XA 1MTVA 2B9LA 1GGDB 2FPZA 2Z9IA 1GL0E 1AIXH 1TPSA 2YNBA 1O2KA 3U1JB 1S6FA 2WPIS 1SLVB 3E6PH 1BRCE 4NGAH 3ZZAA 1IQIA 1XXFA 3T26A 1HPGA 1RGQA 1SL3A 2B5TB 1CBWB 4A1XA 2F9PA 3Q3YA 2QGRA 5CHAB 1YCPK 1BDAA 1HXFH 3VFEA 2OC8A 3GCTF 2XCFA 1P10A 2ZDAH 1XKBC 2JH0D 1AVWA 2VVUA 2ZNKH 1TABE 1IQHA 2GCTB 1D4PB 2VVVA 4YO9A 2O8MA 1GG6B 1EAWA 4D7GA 1EJNA 3FANA 1RD3B 2DE8A 4MPVA 1GDNA 1ANDA 3GCTG 5LPEA 1AE5A 1BJUA 1KTTB 1V3XA 3V13A 2QAAA 2TGAA 5T6GA 2FZZA 2ZU1A 4X0WU 2PR3A 1YCPM 4QT8C 1BQYA 1C4V2 2C90B 1LHDH 3EDXB 1YBWA 1LVOA 1GHXH 2HLCA 2RA3A 1RJXB 3SU0A 1XUIA 3KQCA 4Q7XA 1SLWB 5FPTA 4K69A 1LMWB 2G81E 3M36A 1TGSZ 2WINI 1DPOA 1AVXA 3STIA 1O3CA 2A1DB 3EE0B 4WXIA 3L33A 1C5WB 5A8YA 2G8TA 1RTKA 1ZTJA 4H6SB 5C2ZA 2OXSA 4X2YA 1KDQA 1ORFA 1XKAC 3PLBA 1E38B 1U6QA 2BLOA 3M61U 4CH2B 1ESBA 1LO6A 4IN2A 3PMAB 3QGNB 4HTCH 1JIMA 4MNYA 2PWXA 1OWEA 1HAVB 3ATWA 2ZGXH 3K65B 3IITA 1TGTA 5CHAC 3GY7A 1LQEA 1BA8B 2IN2A 1NRRH 1N8OC 4OS6A 2FI3E 6ESTA 1D6RA 1DWEH 1ZTKA 1XMNB 3CENA 1Y5BT 2OCVB 3TJUA 3GDSA 1A2CH 1SQTA 1TAWA 1BT7A 4FXGH 2BOHB 3ZZBA 2BD4A 2FMJA 3M3SA 4BNRA 4CBNA 1KXBA 1HV7A 4BTIB 2C8WB 2FI5E 1JBUH 1WSSH 2BXUH 3H7TA 1G3EA 2V3OH 1L1NA 3KL6A 4O03A 1KXAA 1O2VA 2F83A 1DE7H 4X6PA 2ODQA 2NU0E 5E0GA 2B7DH 3E0NB 3PWBA 2G51A 1QL7A 1F0SA 2ZHQH 2G55A 2ZPSA 4X8UH 1EQ9A 3S7KB 3GCOA 5A09A 1P01A 1O3FA 1V2VT 1GBKA 1LTOA 3S7HB 3PV4A 2QC2A 2W7UA 1BITA 1OWHA 3LGWA 1EZSC 1IQKA 2FESH 2J34A 1SVPA 1ARBA 1J14A 4B74A 1Y3UA 1S0QA 2GV7A 3BG4B 2P59A 4TPIZ 2CHAB 1MBMA 3KQDA 4WF8A 4Y8XA 3JZ2B 2PSXA 4B1TA 2ZO3H 1DANH 1EPTA 4MVNA 1AKSB 3Q3KA 3F68H 3MTYA 2B8OH 1UTJA 3QTOH 1SG8B 1O2LA 1W2KH 4FUEA 2HOBA 3QLPH 1HUTH 3LGIA 2F91A 5DP9A 5I25A 1PYTD 1LVMA 1GCTB 3L6PA 3ATIA 9LPRA 4MNWA 3MU1A 2PLXA 2AMQA 1YLCA 1ARCA 2G5VA 2OLGA 5TCCA 2ODPA 3LOXA 4X8VH 2GX4A 4FU7A 4JMYA 2EI6A 3OY6U 1ZHRA 4HI3A 1MD7A 3TH2H 1YPMH 4AX9H 1MH0A 3RLWH 3ZVEA 2R3UA 2FOHA 4K5ZA 3P8GA 1O2IA 1XUFA 4H6TA 3UUZA 4YOJA 2SNWA 3M7UA 2ZC9H 2VIOA 1FAXA 1VJ9U 1F92A 3EAJA 1YLDA 5JYIA 4FVBA 2V6NA 4GHQA 3SORA 3A7ZA 1GWAA 1LVYA 3FP7E 2ZCKP 4DJZB 4AN7A 2G4TA 4BTUB 4K8YA 3ITIA 4O3UA 1CA0B 3PLKA 1P2JA 4JCNA 1UK4A 4MPXA 1HDTH 1TWXB 4IMQA 3UQOA 2Q6GA 1TNHA 1KXEA 1QQUA 1FLEE 1O3OA 1CQQA 1RTLA 3VGCC 3A84A 1UVUH 1YF4A 3SUEA 4WWYA 1PQ5A 5EW1H 3DFLA 2H5DA 1Z1IA 3A8AA 4TWWA 2K1QA 1C5UA 1CGIE 1N1LA 3VXEH 3ENSB 2HALA 1WBGB 4Q80A 1IQNA 3BTKE 3QZRA 3RXLA 4ZROA 1FPCH 3LGYA 3ZZ6A 5DJ7A 1UK2A 1LKAA 5T6FA 3UR6A 2A5IA 2ZDVH 3BTWE 5BRRE 1BMLA 1O3KA 3ZVDA 1GBIA 1GVLA 2HWLB 4NFEA 5L2YH 4JYTA 1H8IH 1C2MA 1K1MA 1AE8H 3PYHA 1O5GH 1G3CA 4YT6H 2A0QB 4Y6DA 4ZHMU 1AB9B 2A2QH 1GL1A 3CS0A 1BIOA 1FDPA 1O0DH 4YOIA 1C4U2 1MTUA 1ANEA 1UTOA 2O8LA 2P3TB 1C5OH 1HJ9A 2ZPQA 4U2WA 5FHTA 1P9UA 2W3IA 3RXMA 1NC6A 4DOQA 1AWHB 2BM2A 1O3HA 2Y81A 1EZQA 1Z8IB 4BAOB 1AFQB 5C67A 2XWAA 1AY6H 3RXBA 1C5MD 1UVPA 2FX6A 4AYVB 1OP0A 3GCNA 5DP6A 1O2PA 3GICB 7GCHF 1KLJH 1A5IA 2A32A 1BMAA 1SGTA 4JYUH 2BXTH 4RSPA 1DVAH 2QIQA 2ZGBH 4YOGA 2ZWLH 2I6SA 2Y7ZA 1BTUA 7GCHG 1LPZB 3T62A 3RC4A 3ZZ8A 1QFKH 3VEQB 1W8BH 1BOQA 1W7XH 1CU1A 1UHBA 1DWDH 1GBLA 2HPPH 1VR1H 3TH3H 4RN6A 1KSNA 5DK1A 1GI2A 2BDBA 2UWPA 5FCRA 5FPSA 1A46H 5LPFA 1O33A 3HGNA 2BVRH 3LIWA 2PUXB 3BG8A 2ZU5A 3MH6A 1GBFA 2OQ5A 3S9BA 2BLVA 3O8RA 1W10U 1D9IA 2FM2A 2BLWA 3OTJE 2CV3A 1H8DH 1HXEH 4X2VA 2GGVB 3QN7A 3ZVGA 1P2QA 3EA9A 4FUGA 2ZP0H 2WPJS 1Y3XA 1H1BA 4D9RA 1JMOH 2ZU2A 3IG6B 5GPIB 2Y5GA 2PKSC 1HAZB 1O2RA 5EQRA 3FP8E 1BTWA 1OXGA 1LHEH 3HK3B 3P6ZB 3RP2A 4FUIA 5ABWA 1GI4A 1H9LB 1PFXC 2P93A 1GJ4H 2VIDA 1SFIA 1AD8H 1BUIA 1G2LA 3ATKA 3WY8A 1TA2A 9ESTA 3SU6A 1Y5AT 1V2PT 3RU4D 4DT7B 1FIWA 4FVDA 3LH3A 4GPGA 2H1UA 1SGEE 3MMGA 3A8CA 7ESTE 3RXSA 1ELFA 1C5NH 2C4FH 1MKXH 3SNBA 1DWCH 3F9EA 2O8TA 1SLXB 3SU5A 1MKWH 1AVGH 1ZYOA 1GBEA 1FJSA 5FAHA 1GJ9B 3U69H 1FPHH 3ZYEA 2QXGA 3P92A 2ZCHP 2AYWA 4ZHAA 3E16B 1DX5M 1K1NA 3O8BA 4DIHH 1A1RA 4I7YH 1A0JA 2XYAA 2Y5HA 3D23A 2XBYA 4U30A 3FVFB 1QB9A 1S81A 5IYTA 8ESTE 1XUGA 1ETTH 3PMJA 1EATA 1MKWK 1Y3WA 1AZ8A 1O5CB 2FLBH 2ZHFH 1P12E 2D2DA 5C5OA 5C1XA 1A0LA 4FUDA 1K1PA 3O8DA 1CHOF 3RXCA 2AGIX 4IMZA 5E0JA 4NG9H 3A85A 2HGTH 3PTBA 5HYOA 1X7AC 2ALVA 2BX4A 3BV9B 4BAQB 2GDDA 5EXLA 3HK6B 3U1IB 2A7CA 1J16A 3A7YA 3B23B 2BX3A 4OS4A 1DUAA 3Q76A 1HJAC 3A88A 4Y0YE 4I32A 3BEIB 1G32B 2FOMB 1EJMA 2JETB 2BVXH 1ABIH 3A8BA 4F4OC 3SJ9A 1OSSA 2Z3DA 3LH1A 3MH7A 3RM0H 3GYLB 3UPEA 1UVOA 3C1KA 1H9HE 1GBCA 1NS3A 1PPBH 1GJAB 3SU1A 4FUCA 1F2SE 1P02A 1WV7H 3AASA 1MTNB 3M3VA 5DP3A 1V2UT 2PGBB 4Y8ZA 2H5CA 4LXBH 3SV9A 3EGKH 6LPRA 1HIAA 5A0AE 1HAYB 1NY22 1NTPA 1P04A 2R9PA 4VGCC 1V2QT 4K3JA 4CR5A 1GJBB 2TGDA 1Z8JB 2BLQA 1O3PB 1A0HB 1DOJA 1Y59T 1RRKA 3TVJB 1O2XA 1V2OT 1OPHB 1EASA 3RXDA 2BDIA 2FXRA 2XBXA 4ZHLU 1MQ5A 1SOTA 2CJIA 5DG6A 1QB6A 1O30A 1TRNA 3MO3A 2ZI2H 1HJ8A 2VH0A 4KTUA 1UK3A 2FOEA 1TPPA 3RDZA 1KY9A 1SHHB 4ABHA 2ZGHA 5A0BA 2Z94A 2UWLA 3VB4A 2HRVA 3RXVA 3RXRA 1PPGE 2BD3A 1O2JA 2M5TA 1YPHE 3L3TA 3KIDU 5DP5A 4AGJA 5A8ZA 2AERH 3S9CA 2JETC 1SOZA 2P94A 3E8LA 3VB6A 1YP9A 1L4ZA 4AFUA 1TRYA 2ZDLA 4GVUA 3P8FA 1C1PA 3UFAA 1YCPH 5HM9A 3LU9B 1W0ZU 3TGJE 1GDQA 1TQ0B 2WV4A 1PQ7A 1SQOA 2GVFA 1GBMA 1Z6EA 4X6OA 2FLRH 4NZLA 3SUDA 2YNAA 3A86A 1V6DA 4O3TA 2VIWA 1VITG 1UCYE 3UOUA 1GBAA 1K28D 1WOFA 3DUXH 2WV5A 4ZH8A 1A7SA 1O3LA 1P57B 4IGDA 2C8ZB 2AEIH 4K60A 5AVDA 2ASUB 3FZZA 1NFWA 2WYGA 1EXFA 1FZZA 1FMGA 1UTPA 1HAOH 2F9NA 1KLIH 2BD7A 2BDGA 1WCZA 4AG1A 1Z8GA 4ZKSU 3TNSA 1FN8A 1TGBA 1Y3YA 2R0KA 1KXCA 1DSUA 2ZFSA 1VITH 4I8LA 3MFJA 4AFZA 1OWIA 1NRSH 3RXHA 2GMTB 2HPQH 3URCA 1PPHE 1GI0A 1JXPA 2D8WA 3P17H 1C2IA 1TNIA 1TONA 2AMPA 5FXLA 4TY6A 1BBRE 1FI8A 2ZQ1A 5EQQA 3ZVFA 1IHSH 4UDWH 2ZPRA 1XUJA 3SN8A 1V2MT 2BDHA 2G4UA 2C93B 2ZKSA 1QA7A 4AB9A 4KELA 3LGUA 3HKIB 2KAIB 1XXDA 4A5TS 4E7NA 4X1QU 2R3YA 4ASHA 2VGCB 4K1SA 1GI5A 4BOHA 1F0UA 7KMEH 2GCHF 4ZAEA 1J17T 2ZEBA 1EZUC 1TMBH 3LJJA 2FOGA 5IDKA 3ODDA 1NFYA 1BTXA 1GGDC 2A4OA 1O2NA 1CE5A 4FUHA 1GBHA 4D9QA 3BTEE 2GCHG 3GDVA 3F9GA 1TALA 1Q3XA 1LKBA 2QA9E 1GI7B 2GP9B 2UUJB 1S85A 1S5SA 4X6NA 3Q00A 1QL8A 3U8RH 1CBWC 3Q77A 4XOJA 1AGJA 1GHBF 2ANWA 3M7QA 3BTHE 2CGAA 4YESB 4IBLH 1FONA 2ZU4A 1ETRH 1PPFE 5CE1A 2VVCA 3M5NA 4AFQA 3BEFB 1NU9A 3RXTA 1SB1H 1O3NA 2GCTC 4AOQA 1SGYE 1Q31A 3HPTB 2BY8X 4GAWA 1L1JA 1GHBG 1GG6C 1O3MA 3EA7A 2BD9A 1GJDB 2Z9KA 4TPYA 1W11U 3GY3A 5GCHF 2ZCLP 2H9HA 4DVAU 1P0SH 1OS8A 1K2I1 3GCHB 1FY4A 1VGCB 5EW2H 1O35A 1T8OA 2BQWB 1C2DA 1GBTA 1G3BA 1HGTH 4CBOA 2NWNA 3I78A 4Y0ZE 5GCHG 4Y8YA 1DITH 3TLOA 2OBQA 3NCLA 1E37B 3GY5A 1P8VC 5EOKA 2QY0B 1VCPA 3RLYH 1LPKB 1O2YA 1QCPA 4INLA 3SW2B 1SGFG 5C20A 1ELEE 1J9CH 3GOVB 2VGCC 2IPHA 2XW9A 2A31A 5FX6A 1Y8TA 3MYWA 5HM2A 2HNTF 1NO9H 1O2ZA 1LQDB 4LZ4B 1C1TA 4Y7AA 1IQFA 3TIUA 3RMOH 3KHVA 4D7FA 1NRPH 1DLEA 4MNVA 4KKDA 1QB1A 3SU2A 3BSQA 1ZOMA 1GJ6A 1HAVA 4K8BA 4UEHH 2F9BH 1MTWA 4X8SH 1IAUA 3VB5A 4IW4E 3HATH 3AW1A 1O2HA 3RM2H 4NA8A 2BY5X 5A2MH 3A81A 1P06A 1T31A 2W5EA 4ESTE 5GXPA 4WMEA 1AFEH 1EAIA 4WMDA 4O9VA 3BTTE 5F8ZA 1BTYA 1TNJA 3A83A 2PHBA 1C4Y2 2H2ZA 3TH4H 3F9FA 4D76A 3GCHC 4Y11E 2A5KA 1V2KT 4Y79A 1T32A 3BTME 3ZVCA 2ZIQH 2J38A 4IC6A 2BZ6H 2VB0A 4AB8A 3AW0A 5TJXA 4NIVA 1IOEA 2OC1A 2FS9A 1DLKB 3U8TH 1SGPE 2A7HA 1O5EH 1O5AB 1MAYA 1B7XB 3SV8A 1EB2A 5EODA 4LOYH 1GBJA 2G52A 3NZIA 3LC3A 8GCHF 3P8NA 3LC5A 2RCEA 2XWBI 3SU3A 1C5PA 2PTCE 5AHGH 4UFDH 5JBBS 6CHAB 2FDAA 1O2GH 2AGGX 2CF9H 3DHKH 3KQBA 1O2UA 4X1NU 3HKJB 3RC6A 1O3AA 8GCHG 1TYNA 3BG4C 3SBKA 3K2UA 2UWOA 2CHAC 3M3TA 1F0TA 1ZPZA 1AKSA 2ODYB 3PO1B 3TJNA 1QQ4A 2BQ7B 2Q6FA 4A1VA 1W7GH 2C3SA 2EI7A 2BVSH 2VWLA 1YPJH 1OP2A 1O2SA 3D62A 4CR9A 3SGBE 1YPHC 1QTFA 2J94A 1D3DB 1K9OE 3S9AA 1RXPA 3LGTA 4MDSA 2XXLA 1NM6A 3PROA 1Z7KA 2PUQH 3A7TA 1T8NA 1GCTC 4KP0A 4R8TB 3SJOA 3RXJA 1FQ3A 1NT1A 1GJ5H 2W7SA 1C1RA 1NZQH 4A92A 1F0RA 4CRAA 2QN5T 1C5RA 3B8JA 1DM4B 2UUFB 2FYRA 2ANYA 2FX4A 4J2YB 3OSYA 1HBTH 2VWNA 2EI8A 2ANMH 1M9UA 3FZDA 3TK9A 4A6LA 4DCDA 1QJ7B 2XNIA 3PLPA 1C5VA 1PQ8A 4O97A 4CREA 2FIRH 4SGAE 3DFJA 2QF0A 1S0RA 1V2NT 3SHAH 4CH8B 5LH8A 2P3FH 2QYIA 1DY8A 1LHGH 2UUYA 3QUMP 1EOJA 1ESAA 4R0IA 1TIOA 1CA0C 5H4IB 5E0HA 3RC5A 3G01A 3LJOA 1FY8E 5EPNA 1YC0A 1BMMH 1CVWH 1F5RA 3JZ1B 1V2JT 2AGEX 1C5ZB 2XRCA 3P95A 2J2UA 1HAHH 2H9TH 4UE7H 2ZFQH 1BTPA 3PO1C 5GIBA 1TBZH 2V3HH 1DXPA 3OU0A 5F8XA 1RTFB 3HGPA 4CHAB 2UUKB 4OGXA 4AORA 2BY6X 3BEUA 3T25A 4FUBA 1KTSB 1S82A 1L0ZA 1SPJA 3K6ZA 4XFQA 3PB1E 3T2NA 4YM9A 1MTSA 1KXDA 1LHCH 3RXOA 1O2WA 3SO3A 2F9OA 4JZFH 3BTDE 1CGHA 1O38A 1EP5A 3O8CA 5DO4H 3SHCH 4ISOA 2QXHA 1DS2E 2OC0A 1PQAA 5JDUB 1IHTH 2BD8A 5F03A 1AB9C 1C1WH 3U98H 2P8OB 3FP6E 4NSYA 1W0YH 1P03A 1ZRKA 1SGNE 2J9NA 3KCGH 1VCWA 1MCTA 1OYQA 3RMMH 1AFQC 2R2MB 2F3CE 1E0FD 2CMYA 3M7TA 3ODFA 1B5GH 1K1JA 4I8HA 1UJ1A 2OINA 2Z6BD 3SNDA 1TB6H 1TFXA 1RS0A 3M37A 3SQEE 4A1TA 2SGAA 4B2BA 3RXGA 1MMJN 1D3QB 1EUFA 2FP7B 5GWZA 3BTFE 2OD3B 3MNCA 1O39A 2BDAA 1GI8B 5J4QA 4CHAC 3LKWA 3KN2A 4XDEA 3D65E 1V2WT 3QWCH 1GVZA 1ZSKA 5TCAA 4YZUA 5GDSH 3SJIA 1OX1A 1ELCA 3AVZA 3SJKA 1N6YA 1XVOA 5ESBA 3TGIE 4UFEH 5T3HA 1W12U 3UQVA 4INHA 3B9FH 4B76A 5FBEA 1EAXA 4ZKRU 1GPZA 5C1YA 2ZGCA 2NU2E 1BTZA 1OP8A 2QV1A 2OC7A 1GMCF 2VWOA 1FY5A 1DICA 3ZZ5A 2BTCE 3SUFA 2ULLA 1EX3A 5L6NH 1WTGH 1BCUH 2GZ9A 4B73A 4IC5A 1AHTH 1DUEA 4SGBE 2RA0A 3GDUA 1GMCG 2P8OC 4DG4A 2VIVA 1TGNA 1HAIH 3UNRA 4B2AA 2FOBA 3SNEA 1P3EA 4ABFA 2ZDNA 1FIZA 3RUOA 3UR9A 1RIWB 5EG4A 1YGCH 2C8YB 1O3BA 1ZGVA 5EU8A 1LCYA 1ETSH 2WPKS 4ZKOU 3BN9A 3MU4A 2P3UB 1A61H 4CRFA 3RXUA 3VXFH 1C1UH 1O2QA 1O2TA 1QA0A 4NIWA 5PTPA 1UTKA 4ABGA 3UOPA 5EXMA 2B0FA 1C2JA 4HGCA 3ZZCA 1G9IE 3TGKE 2SGPE 3IWMA 4H4FA 3ZYDA 1HYLA 1OKXA 2Y80A 3V0XA 4DURA 1N6XA 3I77A 3U8OH 3RXPA 2Z7FE 4THNH 2OP9A 4ABIA 1BB0B 4BANB 2ZFPH 1AMHA 3SOSA 1TMUH 5DP8A 1SI5H 4MLFB 4J1YA 3UTUH 1ZPCA 1TRMA 1OOKB 3C27B 2XC4A 1UVSH 4B71A 4K1EA 4FU9A 3P70B 3CS7A 2SGFE 4ZMAH 1K21H 3M5LA 3TITA 1D3TB 2PKAA 1O36A 1UCYH 5HGGA 4X1RU 5F6MA 1A3EH 1O5DH 1ZHPA 1G37A 1TGCA 1KIGH 1C9PA 4HFPB 1GI9B 1G30B 3MU5A 2AIQA 1MZAA 2TRMA 4I31A 5C1UA 1BZXE 3U9AH 3DD2H 4B75A 1QHRB 3A7VA 1EP6A 2VINA 5AFYH 3K9XB 1LDTT 2Y5FA 4X1PU 4PROA 1T8MA 1JRTA 1GHWH 4Y76A 5F8TA 1L1GA 2AS9A 1ANCA 1UCYK 2ALPA 3TK6A 2ANKH 1ZZZA 1O5FH 3GY6A 1TPAE 4JK6A 2CN0H 1P09A 3E90B 5FCKA 4TYDA 1GHYH 1ELGA 1ZMLA 1MTNC 7LPRA 1VITF 3SI4H 3BIVH 4LZ1H 4ZXYH 3SGAE 1RFNA 3AAVA 2GDEH 1SC8U 1TNLA 3M5MA 2J4IA 1SBWA 1F5KU 3MOCA 1HAGE 4HZHA 5CMXH 4INKA 1VCQA 4DGJA 3UIRA 1JIRA 3ZV9A 3QGJA 1MCVA 3LDXH 1GMDF 1ELTA 2SGQE 2TPIZ 4JK5A 3CP7A 4MPWA 1BRBE 5L30H 3S0NA 1FUJA 1ELVA 1KLTA 2H9EH 3I29A 1KDQB 2BZAA 4GHTA 3W94A 1GMDG 4JZ1A 1WU1A 1BBRK 2AH4X 5LGOA 1UTNA 2ZGJA 1ZSJA 2VIPA 2FWWA 2ZDKA 3S69A 1MZDA 3ELAH 3RU4T 4B2CA 2PTNA 1A3BH 3DA9B 1GJCB 1ID5H 5G4BA 5FPYA 1ZJKA 2DE9A 1HFDA 1MQ6A 3RXQA 2AMDA 1TBRH 1SGRE 3D49H 3R3GB 2F9VA 1N8OB 1C1OA 1TPOA 1GHVH 4MG3A 3ZVBA 1H9IE 4E7RG 3W95A 5C5NA 1XX9A 2BB4A 2A4RA 1Q2WA 4ISIH 4Z6AH 1A5GH 1QBVH 1NFXA 2ILNA 1LHFH 1F5LA 1AQ7A 1L4DA 1G36A 1QBOA 3ZVAA 2Z3CA 1O3GA 2OBOA 1AUTC 1ZPBA 3LGVA 3SU4A 3SNCA 3RXFA 2A4GA 3URDA 5JBCS 1WUNH 2NU3E 2ZZUH 1G2MA 1OWKA 2VJ1A 1MUEB 4YTAA 1P2IA 3A8DA 5J4SA 1GI1A 1DSTA 1SGDE 1C1MA 1B0FA 1C2KA 1UO6A 2A2XH 1WQSA 2TIOA 1LVBA 2RDLA 3KF2A 3SV7A
chains in the Genus database with same CATH superfamily
4ABJA 3UWIA 2GT8A 4BAHB 1E34B 3BTGE 1HLTH 1QRZA 1T8LA 2ESTE 3ZV8A 1GI3A 3M35A 3T27A 1UTMA 3LONA 4JZIA 1T7CA 4K1TA 1EPTB 1PJPA 2Z9LA 3R0FA 5GNDA 1HAXB 1GJ8B 2I6QA 3MNXA 1SR5C 2HLDD 5DP4A 1P3CA 2J95A 4JYVH 1WTHD 2Y82A 3QTVH 1EOLA 2GMTC 4X8TH 1GBDA 2XBWA 1HB0B 3RXIA 2RG3A 3QZQA 1EKBB 1ZSLA 2BDYA 4CRBA 1O5BB 4ZUHA 2OTVA 2Z9JA 3NK8A 3A7WA 1P2NA 3T29A 2J98A 2KAIA 2V0BA 5KECA 4RKJB 1P2KA 1ZMNA 1CO7E 1UMAH 4Q7ZA 1YPGH 3TJVA 1BRUP 1UTLM 3TU7H 3T5FH 1JRSA 3MO6A 4MPUA 2ZF0H 4BAMB 1W0JD 1WAYB 3OFND 5C3NA 1TNKA 5EQSA 3NKKA 1ZLRA 3F6UH 4ISLA 2BD2A 3ATLA 4UFFH 1THRH 3DCLA 1QNJA 2KM0A 2LPRA 2LNCA 1JWTA 1TQ7B 2ZTYA 4OS7A 1E35B 4BAKB 6GCHF 2K0QA 2A4QA 3EA8A 2D26C 4KTCA 3T28A 3A82A 1Y3VA 4WXVA 4DIIH 4XBBA 1AU8A 4ABBA 1C2LA 3Q3XA 6GCHG 4Y10E 2XOKD 2H6MA 3KQEA 1C2GA 2FEQH 1BHXF 2BD5A 1DWBH 2VIQA 3H5CB 5BPEA 3VGCB 4Y71A 1FV9A 2D1JA 1SLUB 2P16A 1S6HA 1EPTC 1UTQA 3BF6H 2QF4A 4RKOB 4U01A 1BMNH 2P95A 2WPHS 4NA7A 1HRTH 4CRCA 5HXFA 4MQAA 1SFQB 1QGFA 2PSYA 1GHZA 1VGCC 3AAUA 3P8OA 3TK5A 5L2ZH 3E0PB 2Y6TA 5JPMH 2BHGA 4E06H 1C1VH 3BTQE 2CF8H 3TNTA 1XVMA 4D8NA 5A0CA 1QBNA 4IN1A 2ZA5A 5JBAS 3A80A 4UD9H 1Z1JA 2O9QA 8KME2 4Q7YA 3ZIAD 1TA6A 1E36B 1IQJA 1BTHH 2QXJA 2QXIA 5GJ4B 5C94A 1TX8A 1HCGA 3UY9A 4TWYA 1NFUA 3ZZDA 3MH5A 4OS5A 1G3DA 3ZZ7A 2NU1E 1ABJH 1IQMA 1OWDA 2V35A 2VWMA 3MI4A 3A7XA 1THPB 3EE7A 1AZZA 1FY1A 5JBTA 1CT0E 1ACBE 2Y7XA 3NWUA 4UONA 5AF9H 5E8EH 2EA3A 1O37A 2A5AA 1O3EA 1QJ6B 2ZHEH 1ZRBA 1GI6A 1P05A 2TGTA 4NIXA 3ZZ4A 1IQLA 1V2RT 2YMSB 1TMTH 4NWKA 1GCDA 1F7ZA 2G00A 3VB3A 1NN6A 2EEKA 2SFAA 4CRDA 4XSKU 3MU8A 1C9TA 2PV9B 2WPDD 1P9SA 2WPMS 2OQUA 4WJG2 2QCYA 1EZXC 1O3JA 4MTBA 2FYQA 2GZ7A 3K6YA 3SUGA 1MAXA 2BYAX 3A89A 3V7TA 2FOFA 1XUHA 1UHBB 1PPEE 1EB1H 1KXFA 1WYKA 3STJA 1QL9A 2HNTE 4UFGH 3UREA 2HVXA 1CHGA 2O8WA 3LPRA 1DDJA 5A8XA 1O2MA 2R0LA 3QDZB 2BY9X 1DT2A 4CRGA 2YOLA 3SNAA 1HNEE 2QF3A 3OY5U 3RU4E 3RXKA 2PGQB 1K22H 2W3KA 2CXVA 3OX7U 3GY2A 3RXEA 2PKSB 2FI4E 1O32A 2FODA 3UB0A 1FAKH 4YT7H 2XCNA 4X6MA 4NSVA 4M7GA 3GYMA 2A7JA 2SNVA 2JH5D 2THFB 1GDUA 4TY7A 4ZKNU 1EJAA 5K0HA 6CHAC 1PPCE 1W14U 2KCOA 2AIPA 4WVPE 5LPRA 1DY9A 1NROH 1Z8RA 4OM9A 4KTSA 1QURH 3EYDA 1ZMJA 3UNSA 1V2TT 2ZU3A 2DUCA 4BTTB 1SGCA 1Y5UT 1ZGIA 1FXYA 2ZFRH 4JZDH 4X1SU 4WH6A 4X2WA 1INCA 4Y7BA 5B6OA 3MNSA 1UVTH 2FOCA 1TOMH 1O2OA 1SHYA 2STAE 4ZXXH 1CGJE 2EC9H 3SJ8A 2W26A 1MBQA 2GZ8A 4MNXA 4NIYA 4TSFD 4I8GA 2XC0A 4FETA 3MNBA 3SI3H 4AG2A 2V7QD 5HIZA 3UNQA 1GHAF 3FAOA 2IJOB 3GISB 1CSOE 2JKHA 4ABAA 1C2EA 1QY6A 1AO5A 4YXWD 2VNTA 3QK1A 4DW2U 1CT2E 2FS8A 4ISNA 4ABDA 2VU8E 2XTTB 1LPGB 3GY8A 3GY4A 5EXNA 1GBBA 1MD8A 1GHAG 2JH6D 4XBDA 3DT0H 3SV6A 3RMNH 3MH4A 1C5XB 1V2LT 1ELBA 1O34A 3VB7A 3SGQE 3ZZ9A 1TNGA 2WYJA 1J8AA 1OWJA 3FOAA 3OEED 1IQEA 4XBCA 2BOKA 4ABEA 1YKTA 2ZG0H 1AUJA 1KYNA 1PYTC 1T4VH 1YPKH 2SGDE 1HJAB 4FUJA 1O3DA 2TBSA 3SV2H 5AFZH 4I8KA 4BXWA 1ANBA 1SGQE 4NFFA 3KEEA 2STBE 3SQHE 1D3PB 4AGKA 1C1SA 4NWLA 1JOUB 1SMFE 3OYPA 4BXSA 2OUAA 2GT7A 4AYYB 1XM1A 3LT3A 3PRBA 3PTNA 3DSOA 4AFSA 1QR3E 4NZQA 5JB8S 1B0EA 2IOTA 1EFRD 3KNXA 2GTBA 2BQ6B 2FOAA 3FFGA 2GD4B 4GSOA 4IS5A 4AZ2B 1W13U 4WY3A 1NRNH 2PFEA 4ISHH 1QRXA 1TOCB 5HKKD 1WQVH 3V12A 1DXWA 3E1XB 1TX7A 1VJAU 4VGCB 4NCYA 1HIAB 4FU8A 1MU8B 2A45B 3MWIU 3NUMA 4FOUC 1SSXA 5I46H 2FO9A 2Z9GA 2R2WU 2NU4E 5E2OA 1ZJDA 4XRNA 2ZHDA 1A5HA 4Z0KA 5T6DA 3RMLH 5DGJA 2BMGB 2ZDMA 1MKXK 2ZTZA 4KGAA 2VH6A 3E91A 1C1NA 4FUFA 5DKMA 4NA9H 3AK5A 1VZQH 2KZ4A 2GV6A 2IJD1 3E3TA 1P11E 4TT3D 5SGAE 2GKVE 2Q6DA 1HAPH 4E05H 1ELDE 2PKAB 1YPEH 1C5SA 2Q1JA 5ESTE 1CA8B 4YLUA 1MU6B 1BJVA 1CHOG 3KGPA 5JB9S 1H4WA 1ZR0A 1W0KD 1TE0A 1V2ST 1ZHMA 1BRAA 3F1SB 1TLDA 3UWJH 4WH8A 2WPLS 2F9UA 1NRQH 1C5YB 4OGYA 1NESE 1QIXB 1K1IA 4GLYA 1ESTA 1TX6A 1TBQH 3PMBB 4K2YA 5FX5A 4XE4A 1P2MA 1P2OA 3SZNA 5CHBA 1FY3A 4OS1A 3M5OA 3PWCA 3TJOA 5DPAA 2J92A 2XBVA 5HMAA 2ZTXA 1C1QA 2BDCA 2FTMA 4U32A 4YLQH 4F49A 3ZZ3A 3MHWU 5E2PA 1BHXB 1GMHF 1O31A 1AI8H 1YWUA 2BY7X 3MO9A 3OEHD 4A7IB 4DY7B 1NU7B 3PMHB 2EQNA 2ZFFH 3N7OA 5K7RA 1AN1E 5FBIA 3BIUH 4F55A 3A87A 2ZHWH 1Z71A 4I33A 1XUKA 3ATMA 1GMHG 3F9HA 1GVKB 2FTLE 2ZQ2A 2G5NA 1K1LA 1ZTLA 1S84A 1CT4E 2WUBA 3PM3A 3QO6A 4WMFA 5ETXA 4GUXA 1QJ1B 1THSH 1DFPA 1C5QA 1SGFA 1SQAA 1NPMA 1J15A 1FN6A 1RIWC 2Z3EA 4JZEH 1T4UH 1IQGA 2AFQB 4OS2A 1C5LH 4H42U 1SGIB 1C2HA 4I8JA 4GCHF 5EGMA 5EPYA 3ESTA 3VPKA 1YYY1 2ZECA 3MU0A 3QX5H 1W3CA 1YM0A 1S83A 1Z6JH 1FNIA 3TPIZ 1K1OA 1GJ7B 2XC5A 2K8IA 1BBRH 1OYTH 1PPZA 3NPSA 1D6WA 1L2EA 2WUCA 4GCHG 8LPRA 3V3MA 1QRWA 1C5TA 3H7OA 1AWFH 2SGEE 1ELAA 5DP7A 2HNTC 4Q2KA 1O3IA 4AC9A 3RXAA 3NRLA 2ZFTA 3EQ0H 2O8UA 1EAUA 1C2FA 3NXPA 2TGPZ 2C8XB 2PW8H 4LK4A 1YPLH 1A4WH 4X2XA 1MTVA 2B9LA 1GGDB 2FPZA 2Z9IA 1GL0E 1AIXH 1TPSA 3N7DA 2YNBA 1O2KA 3CNRA 3U1JB 1S6FA 2WPIS 1SLVB 3E6PH 1BRCE 4NGAH 4Q63A 3ZZAA 1IQIA 1XXFA 3T26A 1HPGA 1RGQA 1SL3A 2B5TB 1CBWB 4A1XA 2F9PA 3Q3YA 2WZQA 2QGRA 5CHAB 1YCPK 1BDAA 1HXFH 3VFEA 2OC8A 3GCTF 2XCFA 1P10A 2ZDAH 1XKBC 2JH0D 1AVWA 2VVUA 2ZNKH 1TABE 1IQHA 2GCTB 1D4PB 2VVVA 4YO9A 2O8MA 4Q4LA 1GG6B 1EAWA 4D7GA 1EJNA 3FANA 1RD3B 2DE8A 4MPVA 1GDNA 1ANDA 3GCTG 5LPEA 1AE5A 1BJUA 1KTTB 1V3XA 3V13A 2QAAA 2TGAA 5T6GA 2FZZA 2ZU1A 4X0WU 2PR3A 1YCPM 4QT8C 1BQYA 1C4V2 2C90B 1LHDH 3EDXB 1YBWA 1LVOA 3PV2A 1GHXH 2HLCA 2W6JD 2RA3A 1RJXB 3SU0A 1XUIA 3KQCA 4Q7XA 1SLWB 5FPTA 5C0TA 4K69A 1LMWB 2G81E 2J98B 3M36A 1TGSZ 2WINI 1DPOA 1AVXA 3STIA 1O3CA 2A1DB 3EE0B 4WXIA 3L33A 1C5WB 5A8YA 2G8TA 1RTKA 1ZTJA 4H6SB 5C2ZA 2OXSA 3OTPA 1KDQA 1ORFA 1XKAC 3PLBA 4RT0A 4X2YA 1E38B 1U6QA 2BLOA 3M61U 4CH2B 1ESBA 1LO6A 4IN2A 3PMAB 3QGNB 4HTCH 1JIMA 4MNYA 2PWXA 1OWEA 1HAVB 3ATWA 2ZGXH 3K65B 3IITA 1TGTA 5CHAC 3GY7A 1LQEA 1BA8B 2IN2A 1NRRH 1N8OC 4OS6A 1SKYE 2FI3E 3WWFA 6ESTA 1D6RA 1DWEH 1ZTKA 1XMNB 3CENA 1Y5BT 2OCVB 3TJUA 3GDSA 1A2CH 1SQTA 1TAWA 1BT7A 4FXGH 2BOHB 3ZZBA 2BD4A 2FMJA 3M3SA 4BNRA 4CBNA 1KXBA 1HV7A 4BTIB 4DT4A 2C8WB 2FI5E 1JBUH 1WSSH 2BXUH 3H7TA 1G3EA 2V3OH 1L1NA 3KL6A 4O03A 1KXAA 1O2VA 2F83A 1DE7H 4X6PA 2ODQA 2NU0E 5E0GA 2B7DH 3E0NB 3PWBA 2G51A 3SZEA 1QL7A 1F0SA 2ZHQH 2G55A 2ZPSA 4X8UH 1EQ9A 3S7KB 3GCOA 2IPQX 5A09A 1P01A 1O3FA 1V2VT 1GBKA 1LTOA 2L6OA 3S7HB 3PV4A 2QC2A 2W7UA 1BITA 3KYFA 1OWHA 3LGWA 1EZSC 1IQKA 2FESH 2J34A 1SVPA 1ARBA 1J14A 4B74A 1Y3UA 1YY3A 1S0QA 2GV7A 3BG4B 2P59A 4TPIZ 2CHAB 1MBMA 3KQDA 4WF8A 4Y8XA 3JZ2B 2PSXA 4B1TA 2ZO3H 1DANH 1EPTA 4MVNA 1AKSB 3Q3KA 3F68H 2PP6A 3MTYA 2B8OH 1UTJA 3QTOH 1SG8B 1O2LA 1W2KH 4FUEA 2HOBA 3QLPH 1HUTH 3LGIA 1E1RD 2F91A 5DP9A 5I25A 1PYTD 1LVMA 1GCTB 3L6PA 4F48B 3ATIA 9LPRA 4MNWA 3MU1A 2PLXA 2AMQA 1YLCA 1ARCA 2G5VA 2OLGA 5TCCA 2ODPA 3LOXA 4X8VH 2GX4A 4FU7A 4JMYA 2EI6A 3OY6U 1ZHRA 4HI3A 1MD7A 3TH2H 1YPMH 4AX9H 1MH0A 3RLWH 3ZVEA 2R3UA 2FOHA 4K5ZA 3P8GA 1O2IA 1XUFA 4H6TA 3UUZA 4YOJA 2SNWA 3M7UA 2ZC9H 2VIOA 1FAXA 1VJ9U 1F92A 3EAJA 1YLDA 5JYIA 4FVBA 2V6NA 4GHQA 3SORA 3A7ZA 1GWAA 1LVYA 3FP7E 2ZCKP 4DJZB 4AN7A 2G4TA 4BTUB 4K8YA 3ITIA 4O3UA 1CA0B 3PLKA 1E1QD 1P2JA 1UK4A 4JCNA 1COWD 4MPXA 1HDTH 1TWXB 4IMQA 3UQOA 2Q6GA 2VBCA 1TNHA 1KXEA 1QQUA 1FLEE 1O3OA 1CQQA 1RTLA 3VGCC 3A84A 1UVUH 1YF4A 3SUEA 1H8ED 4WWYA 1PQ5A 5EW1H 3DFLA 2H5DA 1Z1IA 3A8AA 4TWWA 2K1QA 1C5UA 1CGIE 1N1LA 3VXEH 3ENSB 2HALA 1WBGB 4Q80A 1IQNA 3BTKE 3QZRA 3RXLA 4ZROA 1FPCH 3LGYA 2LELA 3ZZ6A 5DJ7A 1UK2A 1LKAA 5T6FA 3UR6A 2A5IA 2ZDVH 3BTWE 5BRRE 1BMLA 1O3KA 3ZVDA 1GBIA 1GVLA 2HWLB 4NFEA 5L2YH 4JYTA 1H8IH 1C2MA 1K1MA 1AE8H 3PYHA 1O5GH 1G3CA 4YT6H 2A0QB 4Y6DA 4ZHMU 1AB9B 3UAIC 2A2QH 1GL1A 3CS0A 1BIOA 1FDPA 1O0DH 4YOIA 1C4U2 1MTUA 1ANEA 1UTOA 2O8LA 2P3TB 1C5OH 1HJ9A 2ZPQA 4U2WA 5FHTA 1P9UA 2W3IA 3RXMA 1NC6A 4DOQA 3H09A 1AWHB 2BM2A 2EY4C 1O3HA 2Y81A 1EZQA 1Z8IB 4BAOB 2XNDD 1AFQB 5C67A 3FO8D 2XWAA 1AY6H 3OAAD 3RXBA 1QZ8A 1C5MD 1UVPA 2FX6A 4AYVB 1OP0A 3GCNA 5DP6A 1O2PA 1BMFD 3GICB 7GCHF 1KLJH 2YMSC 1A5IA 2A32A 1BMAA 1SGTA 4JYUH 2BXTH 4RSPA 1K0HA 1DVAH 2QIQA 2ZGBH 4XD7D 2L74A 4YOGA 2ZWLH 2I6SA 2Y7ZA 1BTUA 7GCHG 1LPZB 3T62A 3RC4A 3ZZ8A 3SYJA 1QFKH 3VEQB 1W8BH 1BOQA 1W7XH 1CU1A 1UHBA 1DWDH 5C17A 3MQKC 1GBLA 2HPPH 1VR1H 3TH3H 4RN6A 1KSNA 3PRDA 5DK1A 1GI2A 2BDBA 4RI0A 5B6LA 2UWPA 5FCRA 5FPSA 1A46H 5LPFA 1O33A 3HGNA 2BVRH 3LIWA 2PUXB 3BG8A 2ZU5A 3MH6A 1GBFA 2OQ5A 3S9BA 2BLVA 3O8RA 1MABB 1W10U 1D9IA 2FM2A 2BLWA 3OTJE 2CV3A 1H8DH 1WDIA 1HXEH 4X2VA 2GGVB 1YLNA 3QN7A 3ZVGA 1P2QA 3EA9A 4FUGA 2WHXA 2ZP0H 2WPJS 1Y3XA 1H1BA 4D9RA 1JMOH 2ZU2A 3IG6B 5EJZA 5GPIB 2Y5GA 2PKSC 1HAZB 1O2RA 3U28C 5EQRA 4B6FA 3W1EA 3FP8E 1BTWA 1OXGA 1LHEH 2QF5A 3HK3B 3P6ZB 3RP2A 4FUIA 5ABWA 1GI4A 1H9LB 1PFXC 2P93A 1GJ4H 2VIDA 1SFIA 1AD8H 1BUIA 1G2LA 3ATKA 3WY8A 1TA2A 9ESTA 3SU6A 1Y5AT 1V2PT 3RU4D 4DT7B 1FIWA 4FVDA 3LH3A 4GPGA 2H1UA 1SGEE 3MMGA 3A8CA 7ESTE 3RXSA 1ELFA 1C5NH 2C4FH 1MKXH 3SNBA 1DWCH 3F9EA 2O8TA 1SLXB 3SU5A 2QE7D 1MKWH 1AVGH 1ZYOA 1GBEA 1FJSA 5FAHA 1GJ9B 3U69H 1FPHH 3ZYEA 2QXGA 3P92A 2ZCHP 2AYWA 4ZHAA 2F43B 3E16B 1DX5M 1K1NA 3O8BA 4DIHH 1A1RA 4I7YH 1A0JA 2XYAA 3FN8A 2Y5HA 3D23A 2XBYA 4U30A 3FVFB 1QB9A 1S81A 5IYTA 8ESTE 1XUGA 1ETTH 3PMJA 1EATA 1MKWK 1Y3WA 1AZ8A 1O5CB 2FLBH 2ZHFH 1P12E 2D2DA 5C5OA 5C1XA 1A0LA 4FUDA 1K1PA 3O8DA 1CHOF 3RXCA 2AGIX 4IMZA 5E0JA 4NG9H 3A85A 5EIYA 2HGTH 3PTBA 5HYOA 1X7AC 2ALVA 2BX4A 3BV9B 4BAQB 2GDDA 5EXLA 3HK6B 3U1IB 2A7CA 1J16A 3A7YA 3B23B 2BX3A 4OS4A 1DUAA 3Q76A 1HJAC 3A88A 4Y0YE 4I32A 3BEIB 1G32B 2FOMB 2WSSD 1EJMA 2JETB 2BVXH 1ABIH 3A8BA 4F4OC 3SJ9A 1OSSA 2Z3DA 3LH1A 3MH7A 3RM0H 3GYLB 3UPEA 1UVOA 3C1KA 1H9HE 1GBCA 1NS3A 1PPBH 1GJAB 3SU1A 4FUCA 1F2SE 1P02A 1WV7H 3AASA 1MTNB 1OHHD 3M3VA 1V2UT 5DP3A 2PGBB 4Y8ZA 2H5CA 4LXBH 3SV9A 3EGKH 6LPRA 2WV9A 1HIAA 4ZCNA 5A0AE 1HAYB 1NY22 1NTPA 1P04A 2R9PA 4VGCC 1V2QT 4K3JA 4CR5A 1GJBB 2TGDA 1Z8JB 2BLQA 1O3PB 1WXRA 1A0HB 1DOJA 1Y59T 1RRKA 3TVJB 1O2XA 1V2OT 1OPHB 1EASA 3RXDA 2BDIA 2FXRA 2XBXA 4ZHLU 1MQ5A 1SOTA 2CJIA 5DG6A 1QB6A 1O30A 1TRNA 3MO3A 2ZI2H 1HJ8A 2VH0A 4KTUA 1UK3A 2FOEA 1TPPA 3RDZA 1KY9A 1SHHB 4ABHA 2ZGHA 5A0BA 2Z94A 2UWLA 3VB4A 2HRVA 3RXVA 3RXRA 1PPGE 2BD3A 1O2JA 2M5TA 1YPHE 3L3TA 3KIDU 5DP5A 4AGJA 5A8ZA 2AERH 3S9CA 2JETC 1SOZA 2P94A 3E8LA 3VB6A 4ACBA 1YP9A 1L4ZA 4AFUA 1TRYA 2ZDLA 4GVUA 3P8FA 1C1PA 3UFAA 1YCPH 5HM9A 3LU9B 1W0ZU 3TGJE 1GDQA 1TQ0B 2WV4A 1PQ7A 1SQOA 2GVFA 1GBMA 3KQ5A 2JIZD 1Z6EA 4X6OA 2FLRH 2JJ1D 4NZLA 5C0UA 3SUDA 2YNAA 2M2AA 3A86A 5KGOA 1V6DA 4O3TA 2VIWA 1VITG 1UCYE 3UOUA 1GBAA 1K28D 1WOFA 3DUXH 2WV5A 4ZH8A 1A7SA 1O3LA 1P57B 4IGDA 2C8ZB 2AEIH 4K60A 5AVDA 2ASUB 3FZZA 1NFWA 2WYGA 4RT1A 1EXFA 1H8HD 1FZZA 1FMGA 1UTPA 1HAOH 2F9NA 1KLIH 2BD7A 2BDGA 1WCZA 4AG1A 1Z8GA 4ZKSU 3TNSA 1FN8A 1TGBA 1Y3YA 2R0KA 1KXCA 1DSUA 2ZFSA 1VITH 4I8LA 3MFJA 4AFZA 1OWIA 1NRSH 3RXHA 2GMTB 2HPQH 3URCA 1PPHE 1GI0A 1JXPA 2D8WA 3P17H 1C2IA 1TNIA 1TONA 2AMPA 2KX4A 5FXLA 1VKYA 4TY6A 1BBRE 1FI8A 2ZQ1A 5EQQA 3ZVFA 1IHSH 4UDWH 2ZPRA 1XUJA 3SN8A 1V2MT 2BDHA 2G4UA 2HVYB 2C93B 2ZKSA 1QA7A 4AB9A 4KELA 3LGUA 3HKIB 2KAIB 1XXDA 4A5TS 4E7NA 4X1QU 2R3YA 4ASHA 2VGCB 4K1SA 1GI5A 3VG8A 4BOHA 1F0UA 7KMEH 2GCHF 4ZAEA 1J17T 2ZEBA 1EZUC 1TMBH 3LJJA 2FOGA 5KEDA 5IDKA 3ODDA 1NFYA 1BTXA 1GGDC 2A4OA 1O2NA 1CE5A 4FUHA 1GBHA 4D9QA 3BTEE 2GCHG 3GDVA 3F9GA 1TALA 1Q3XA 1LKBA 2QA9E 1GI7B 2GP9B 2UUJB 1S85A 1S5SA 4X6NA 3Q00A 1QL8A 3U8RH 1CBWC 3Q77A 4XOJA 1AGJA 1GHBF 2ANWA 3M7QA 3BTHE 2CGAA 4YESB 4IBLH 1FONA 2ZU4A 1ETRH 1PPFE 5CE1A 2VVCA 3M5NA 4AFQA 3BEFB 1NU9A 3RXTA 1SB1H 1O3NA 2GCTC 4AOQA 1SGYE 1Q31A 3HPTB 2BY8X 4GAWA 1L1JA 1GHBG 1GG6C 1O3MA 3EA7A 2BD9A 1GJDB 2Z9KA 4TPYA 1W11U 3GY3A 5GCHF 2ZCLP 2H9HA 4DVAU 1P0SH 1OS8A 1K2I1 3GCHB 1FY4A 1VGCB 5EW2H 1O35A 1T8OA 2BQWB 1C2DA 1GBTA 1G3BA 1HGTH 4CBOA 2NWNA 3I78A 4Y0ZE 5GCHG 4Y8YA 1DITH 3F2FA 3TLOA 2OBQA 3NCLA 1E37B 2YMSD 5IK2D 3GY5A 1P8VC 5EOKA 2QY0B 1VCPA 3RLYH 1LPKB 1O2YA 1QCPA 4INLA 3SW2B 1SGFG 5C20A 1ELEE 1J9CH 3GOVB 2VGCC 2IPHA 2XW9A 2A31A 5FX6A 1Y8TA 3MYWA 5HM2A 2HNTF 1NO9H 1O2ZA 1LQDB 5EJ1A 5T1VA 4LZ4B 1C1TA 4Y7AA 1IQFA 3TIUA 3RMOH 3KHVA 2KFWA 4D7FA 1NRPH 1DLEA 4MNVA 4KKDA 1QB1A 3SU2A 3BSQA 1ZOMA 1GJ6A 1HAVA 4K8BA 4UEHH 2F9BH 1MTWA 4X8SH 5DN6D 1IAUA 3VB5A 4IW4E 3HATH 3AW1A 2V3MA 1S6LA 1O2HA 3RM2H 4NA8A 2BY5X 5A2MH 3A81A 1P06A 1T31A 2W5EA 4ESTE 5GXPA 4WMEA 1AFEH 1EAIA 4WMDA 4O9VA 3BTTE 5F8ZA 1BTYA 1TNJA 3A83A 2PHBA 1C4Y2 2H2ZA 3TH4H 3F9FA 4D76A 3GCHC 4Y11E 3WWBA 2A5KA 1V2KT 4Y79A 1T32A 3BTME 3ZVCA 2ZIQH 2J38A 4IC6A 2BZ6H 2VB0A 4AB8A 3AW0A 5TJXA 4NIVA 1IOEA 2OC1A 4P00A 2FS9A 1DLKB 3U8TH 1SGPE 2A7HA 1O5EH 1O5AB 3F0PA 1MAYA 1B7XB 3SV8A 1EB2A 5EODA 4LOYH 1GBJA 2G52A 3NZIA 3LC3A 8GCHF 3P8NA 3LC5A 2RCEA 2XWBI 3SU3A 1C5PA 2PTCE 5AHGH 4UFDH 5JBBS 6CHAB 2FDAA 1O2GH 2AGGX 2CF9H 3DHKH 3KQBA 1O2UA 4X1NU 3HKJB 3RC6A 1O3AA 8GCHG 1TYNA 3BG4C 3SBKA 3K2UA 2UWOA 2CHAC 3M3TA 1F0TA 1ZPZA 1AKSA 1NBME 2ODYB 3PO1B 3TJNA 1QQ4A 2BQ7B 2Q6FA 3PV5A 2AHME 4A1VA 1W7GH 2C3SA 2EI7A 2BVSH 2VWLA 1YPJH 1OP2A 1O2SA 3D62A 3DSGA 4CR9A 3SGBE 1YPHC 1QTFA 2J94A 1D3DB 1K9OE 3S9AA 1RXPA 3LGTA 4MDSA 2XXLA 1NM6A 3PROA 3FKSD 1Z7KA 2PUQH 3A7TA 1T8NA 1GCTC 4KP0A 4R8TB 3SJOA 3RXJA 1FQ3A 1NT1A 2KCAA 1GJ5H 2W7SA 1C1RA 1NZQH 4A92A 1F0RA 4CRAA 2QN5T 1C5RA 3B8JA 1DM4B 2UUFB 2FYRA 2ANYA 2FX4A 4J2YB 3OSYA 1HBTH 2VWNA 2EI8A 2ANMH 1M9UA 3FZDA 3TK9A 4A6LA 4DCDA 1QJ7B 2XNIA 3PLPA 1C5VA 1PQ8A 4O97A 4CREA 2FIRH 2KR7A 4SGAE 3DFJA 2QF0A 1S0RA 1V2NT 1KMHB 3SHAH 4CH8B 5LH8A 2P3FH 3OE7D 4ACAA 2QYIA 1DY8A 1LHGH 2UUYA 3QUMP 1EOJA 1ESAA 4R0IA 1TIOA 1CA0C 5H4IB 5E0HA 3RC5A 3G01A 3LJOA 1FY8E 5EPNA 1YC0A 1BMMH 1CVWH 1F5RA 3JZ1B 1V2JT 2AGEX 1C5ZB 2CK3D 2XRCA 3P95A 2J2UA 1HAHH 2H9TH 4UE7H 2ZFQH 1BTPA 3PO1C 5GIBA 1TBZH 2V3HH 1DXPA 3OU0A 5F8XA 1RTFB 3HGPA 4CHAB 2UUKB 4OGXA 4AORA 2BY6X 3BEUA 3T25A 4FUBA 1KTSB 1S82A 1L0ZA 5HIYA 1SPJA 3K6ZA 4XFQA 3PB1E 3T2NA 4YM9A 1MTSA 1KXDA 1LHCH 3RXOA 1O2WA 2W6ID 2F9OA 3SO3A 1NBMD 4JZFH 5FL7D 3BTDE 1CGHA 1O38A 1EP5A 3O8CA 5DO4H 5DSFA 3SHCH 4ISOA 2QXHA 1DS2E 2OC0A 1PQAA 5JDUB 1IHTH 2BD8A 5F03A 1AB9C 1C1WH 3U98H 2P8OB 3FP6E 5F53A 4NSYA 1W0YH 1P03A 1ZRKA 1SGNE 2J9NA 3KCGH 1VCWA 1MCTA 1OYQA 3RMMH 1AFQC 2R2MB 2F3CE 1E0FD 2CMYA 3M7TA 3ODFA 1B5GH 1K1JA 4I8HA 1UJ1A 2OINA 2Z6BD 3SNDA 1TB6H 1TFXA 1RS0A 4I86A 3M37A 3SQEE 2F4LA 4A1TA 2SGAA 4B2BA 3RXGA 1MMJN 1D3QB 1EUFA 2FP7B 3KYGA 5GWZA 3BTFE 2OD3B 3MNCA 1O39A 2BDAA 1GI8B 5J4QA 4CHAC 3LKWA 3KN2A 3N7EA 4XDEA 1SQRA 3D65E 1V2WT 3QWCH 1GVZA 1ZSKA 5TCAA 4YZUA 5GDSH 3SJIA 1OX1A 1ELCA 3AVZA 3SJKA 1N6YA 1XVOA 5ESBA 3TGIE 4UFEH 5T3HA 1W12U 3UQVA 4INHA 4M9FA 3B9FH 4B76A 5FBEA 1EAXA 4ZKRU 1GPZA 5C1YA 2ZGCA 2NU2E 1BTZA 1OP8A 2QV1A 2OC7A 1E79D 1GMCF 2VWOA 1FY5A 1DICA 3ZZ5A 2BTCE 3SUFA 2ULLA 1EX3A 5L6NH 1WTGH 1BCUH 2GZ9A 4B73A 4IC5A 1AHTH 1DUEA 2KCPA 4SGBE 2RA0A 3GDUA 1GMCG 2P8OC 4DG4A 2VIVA 1TGNA 1HAIH 3UNRA 4B2AA 2RDEA 2FOBA 3SNEA 1P3EA 4ABFA 2ZDNA 1FIZA 3RUOA 3UR9A 1RIWB 5EG4A 1YGCH 2C8YB 1O3BA 1ZGVA 4B6EA 5EU8A 1LCYA 1ETSH 3F2HA 2WPKS 4ZKOU 3BN9A 3MU4A 2P3UB 1A61H 4CRFA 3RXUA 3VXFH 1C1UH 1O2QA 1O2TA 1QA0A 4NIWA 5PTPA 1UTKA 4ABGA 3UOPA 5EXMA 2B0FA 1C2JA 4HGCA 3ZZCA 1G9IE 3TGKE 2JDID 2SGPE 3N99A 3IWMA 4H4FA 3ZYDA 4HG6A 1HYLA 1OKXA 2Y80A 3V0XA 4DURA 1N6XA 3I77A 3U8OH 3RXPA 2Z7FE 4THNH 2OP9A 4ABIA 3F2GA 1BB0B 4BANB 2ZFPH 1AMHA 3SOSA 1TMUH 5DP8A 1SI5H 4MLFB 4J1YA 3UTUH 1ZPCA 1TRMA 1OOKB 3C27B 2XC4A 1UVSH 4B71A 4K1EA 4FU9A 3P70B 3CS7A 2SGFE 4ZMAH 3F3BA 2GJGA 1K21H 3M5LA 3TITA 1D3TB 2PKAA 1O36A 1UCYH 5HGGA 1UW7A 4X1RU 5F6MA 1A3EH 1O5DH 1ZHPA 1FX0B 1G37A 1TGCA 1KIGH 1C9PA 4HFPB 1GI9B 1G30B 3MU5A 2AIQA 1MZAA 2TRMA 4I31A 5C1UA 1BZXE 3U9AH 3DD2H 4B75A 1QHRB 3A7VA 1EP6A 2VINA 5AFYH 3K9XB 1LDTT 4Z1MD 2Y5FA 4X1PU 4PROA 1T8MA 1JRTA 2JJ2D 1GHWH 4Y76A 5F8TA 1L1GA 2AS9A 4P02A 1ANCA 1UCYK 2ALPA 3TK6A 2ANKH 1ZZZA 1O5FH 3GY6A 1TPAE 4JK6A 2CN0H 1P09A 3E90B 5FCKA 4TYDA 1GHYH 1ELGA 1ZMLA 5EJLA 1MTNC 7LPRA 1VITF 3SI4H 3BIVH 4LZ1H 4ZXYH 3SGAE 1RFNA 3AAVA 2GDEH 1SC8U 1TNLA 3M5MA 2J4IA 1SBWA 2KCYA 4ASUD 1F5KU 3MOCA 1HAGE 4HZHA 3WW7A 2RFKC 5CMXH 4INKA 1VCQA 4DGJA 3UIRA 1JIRA 3ZV9A 3QGJA 1MCVA 3LDXH 1GMDF 1ELTA 2SGQE 2TPIZ 4JK5A 3CP7A 4MPWA 1BRBE 5L30H 3S0NA 1FUJA 1ELVA 1KLTA 2H9EH 3I29A 1KDQB 2BZAA 4GHTA 2LP6A 3W94A 1GMDG 4JZ1A 1WU1A 1BBRK 2AH4X 5LGOA 3F0OA 2OK5A 1UTNA 2ZGJA 1ZSJA 2VIPA 2FWWA 2ZDKA 3S69A 1MZDA 3ELAH 3RU4T 4B2CA 2PTNA 1A3BH 3DA9B 1GJCB 1ID5H 5G4BA 5FPYA 1ZJKA 2DE9A 1HFDA 1MQ6A 3RXQA 2AMDA 1TBRH 1SGRE 3D49H 3R3GB 2F9VA 1N8OB 1C1OA 1TPOA 1GHVH 3DSPA 2J5UA 4MG3A 3ZVBA 1H9IE 4E7RG 3W95A 5CDFE 5C5NA 1XX9A 2BB4A 2A4RA 1Q2WA 2J97A 4ISIH 4Z6AH 1A5GH 1QBVH 1NFXA 2ILNA 1LHFH 1F5LA 1AQ7A 1L4DA 1G36A 1QBOA 3ZVAA 2Z3CA 1O3GA 2OBOA 1AUTC 1ZPBA 3LGVA 3SU4A 3SNCA 3RXFA 2A4GA 3URDA 5JBCS 1WUNH 2NU3E 2ZZUH 1G2MA 1OWKA 2VJ1A 1MUEB 4YTAA 1P2IA 3A8DA 5J4SA 1GI1A 1DSTA 1SGDE 1C1MA 1B0FA 1C2KA 1UO6A 2A2XH 1WQSA 2TIOA 1LVBA 3GS9A 2RDLA 3KF2A 3SV7A
chains in the Genus database with same CATH topology
4ABJA 3UWIA 2GT8A 4BAHB 1E34B 3BTGE 1HLTH 1QRZA 1T8LA 2ESTE 3ZV8A 1GI3A 3M35A 3T27A 1UTMA 3LONA 4JZIA 1T7CA 4K1TA 1EPTB 1PJPA 2Z9LA 3R0FA 1HAXB 1GJ8B 2I6QA 3MNXA 1SR5C 5DP4A 1P3CA 2J95A 4JYVH 1WTHD 2Y82A 3QTVH 1EOLA 2GMTC 4X8TH 1GBDA 2XBWA 1HB0B 3RXIA 2RG3A 3QZQA 1EKBB 1ZSLA 2BDYA 4CRBA 1O5BB 4ZUHA 2OTVA 2Z9JA 3NK8A 3A7WA 1P2NA 3T29A 2KAIA 2V0BA 4RKJB 1P2KA 1ZMNA 1CO7E 1UMAH 4Q7ZA 1YPGH 3TJVA 1BRUP 1UTLM 3TU7H 3T5FH 1JRSA 3MO6A 4MPUA 2ZF0H 4BAMB 1WAYB 5C3NA 1TNKA 5EQSA 3NKKA 1ZLRA 3F6UH 4ISLA 2BD2A 3ATLA 4UFFH 1THRH 1QNJA 2LPRA 2LNCA 1JWTA 1TQ7B 2ZTYA 4OS7A 1E35B 4BAKB 6GCHF 2A4QA 3EA8A 2D26C 4KTCA 3T28A 3A82A 1Y3VA 4WXVA 4DIIH 4XBBA 1AU8A 4ABBA 1C2LA 3Q3XA 6GCHG 4Y10E 2H6MA 3KQEA 1C2GA 2FEQH 1BHXF 2BD5A 1DWBH 2VIQA 3H5CB 5BPEA 3VGCB 4Y71A 1FV9A 2D1JA 1SLUB 2P16A 1S6HA 1EPTC 1UTQA 3BF6H 4RKOB 4U01A 1BMNH 2P95A 2WPHS 4NA7A 1HRTH 4CRCA 5HXFA 4MQAA 1SFQB 1QGFA 2PSYA 1GHZA 1VGCC 3AAUA 3P8OA 3TK5A 5L2ZH 3E0PB 2Y6TA 5JPMH 2BHGA 4E06H 1C1VH 3BTQE 2CF8H 3TNTA 1XVMA 4D8NA 5A0CA 1QBNA 4IN1A 2ZA5A 5JBAS 3A80A 4UD9H 1Z1JA 2O9QA 8KME2 4Q7YA 1TA6A 1E36B 1IQJA 1BTHH 2QXJA 2QXIA 5GJ4B 1TX8A 1HCGA 3UY9A 4TWYA 1NFUA 3ZZDA 3MH5A 4OS5A 1G3DA 3ZZ7A 2NU1E 1ABJH 1IQMA 1OWDA 2V35A 2VWMA 3MI4A 3A7XA 1THPB 1AZZA 1FY1A 5JBTA 1CT0E 1ACBE 2Y7XA 3NWUA 4UONA 5AF9H 5E8EH 2EA3A 1O37A 2A5AA 1O3EA 1QJ6B 2ZHEH 1ZRBA 1GI6A 1P05A 2TGTA 4NIXA 3ZZ4A 1IQLA 1V2RT 1TMTH 4NWKA 1GCDA 1F7ZA 2G00A 3VB3A 1NN6A 2EEKA 2SFAA 4CRDA 4XSKU 3MU8A 1C9TA 2PV9B 1P9SA 2WPMS 2OQUA 4WJG2 2QCYA 1EZXC 1O3JA 4MTBA 2FYQA 2GZ7A 3K6YA 3SUGA 1MAXA 2BYAX 3A89A 3V7TA 2FOFA 1XUHA 1UHBB 1PPEE 1EB1H 1KXFA 1WYKA 3STJA 1QL9A 2HNTE 4UFGH 3UREA 2HVXA 1CHGA 2O8WA 3LPRA 1DDJA 5A8XA 1O2MA 2R0LA 3QDZB 2BY9X 1DT2A 4CRGA 2YOLA 3SNAA 1HNEE 2QF3A 3OY5U 3RU4E 3RXKA 2PGQB 1K22H 2W3KA 2CXVA 3OX7U 3GY2A 3RXEA 2PKSB 2FI4E 1O32A 2FODA 4YT7H 1FAKH 2XCNA 4X6MA 4NSVA 4M7GA 3GYMA 2A7JA 2SNVA 2JH5D 2THFB 1GDUA 4TY7A 4ZKNU 1EJAA 5K0HA 6CHAC 1PPCE 1W14U 5LPRA 2AIPA 4WVPE 1DY9A 1NROH 1Z8RA 4KTSA 1QURH 3EYDA 1ZMJA 3UNSA 1V2TT 2ZU3A 2DUCA 4BTTB 1SGCA 1Y5UT 1ZGIA 1FXYA 2ZFRH 4JZDH 4X1SU 4WH6A 4X2WA 1INCA 4Y7BA 5B6OA 3MNSA 1UVTH 2FOCA 1TOMH 1O2OA 1SHYA 2STAE 4ZXXH 1CGJE 2EC9H 3SJ8A 2W26A 1MBQA 2GZ8A 4MNXA 4NIYA 4I8GA 2XC0A 3MNBA 3SI3H 4AG2A 3UNQA 1GHAF 3FAOA 2IJOB 3GISB 1CSOE 2JKHA 4ABAA 1C2EA 1QY6A 1AO5A 2VNTA 3QK1A 4DW2U 1CT2E 2FS8A 4ISNA 4ABDA 2VU8E 2XTTB 1LPGB 3GY8A 3GY4A 5EXNA 1GBBA 1MD8A 1GHAG 2JH6D 4XBDA 3DT0H 3SV6A 3RMNH 3MH4A 1C5XB 1V2LT 1ELBA 1O34A 3VB7A 3SGQE 3ZZ9A 1TNGA 2WYJA 1J8AA 1OWJA 1IQEA 4XBCA 2BOKA 4ABEA 1YKTA 2ZG0H 1AUJA 1KYNA 1PYTC 1T4VH 1YPKH 2SGDE 1HJAB 4FUJA 1O3DA 2TBSA 3SV2H 5AFZH 4I8KA 4BXWA 1ANBA 1SGQE 4NFFA 3KEEA 2STBE 3SQHE 1D3PB 4AGKA 1C1SA 4NWLA 1JOUB 1SMFE 3OYPA 4BXSA 2OUAA 2GT7A 4AYYB 1XM1A 3LT3A 3PTNA 4AFSA 1QR3E 4NZQA 5JB8S 1B0EA 2IOTA 3KNXA 2GTBA 2BQ6B 2FOAA 3FFGA 2GD4B 4GSOA 4IS5A 4AZ2B 1W13U 4WY3A 1NRNH 2PFEA 4ISHH 1QRXA 1TOCB 1WQVH 3V12A 1DXWA 3E1XB 1TX7A 1VJAU 4VGCB 4NCYA 1HIAB 4FU8A 1MU8B 2A45B 3MWIU 3NUMA 1SSXA 5I46H 2FO9A 2Z9GA 2R2WU 2NU4E 5E2OA 1ZJDA 2ZHDA 1A5HA 4Z0KA 5T6DA 3RMLH 5DGJA 2BMGB 2ZDMA 1MKXK 2ZTZA 4KGAA 2VH6A 3E91A 1C1NA 4FUFA 5DKMA 4NA9H 1VZQH 2GV6A 3E3TA 1P11E 5SGAE 2GKVE 2Q6DA 1HAPH 4E05H 1ELDE 2PKAB 1YPEH 1C5SA 2Q1JA 5ESTE 1CA8B 4YLUA 1MU6B 1BJVA 1CHOG 3KGPA 5JB9S 1H4WA 1ZR0A 1TE0A 1V2ST 1ZHMA 1BRAA 3F1SB 1TLDA 3UWJH 4WH8A 2WPLS 2F9UA 1NRQH 1C5YB 4OGYA 1NESE 1QIXB 1K1IA 4GLYA 1ESTA 1TX6A 1TBQH 3PMBB 4K2YA 5FX5A 4XE4A 1P2MA 1P2OA 3SZNA 1FY3A 4OS1A 3M5OA 3PWCA 3TJOA 5DPAA 2J92A 2XBVA 5HMAA 2ZTXA 1C1QA 2BDCA 2FTMA 4U32A 4YLQH 4F49A 3ZZ3A 3MHWU 5E2PA 1BHXB 1GMHF 1O31A 1AI8H 2BY7X 3MO9A 4A7IB 4DY7B 1NU7B 3PMHB 3N7OA 2ZFFH 5K7RA 1AN1E 5FBIA 3BIUH 3A87A 2ZHWH 1Z71A 4I33A 1XUKA 3ATMA 1GMHG 3F9HA 1GVKB 2FTLE 2ZQ2A 2G5NA 1K1LA 1ZTLA 1S84A 1CT4E 2WUBA 3PM3A 3QO6A 4WMFA 5ETXA 4GUXA 1QJ1B 1THSH 1DFPA 1C5QA 1SGFA 1SQAA 1NPMA 1J15A 1FN6A 1RIWC 2Z3EA 4JZEH 1T4UH 1IQGA 2AFQB 4OS2A 1C5LH 4H42U 1SGIB 1C2HA 4I8JA 4GCHF 5EGMA 5EPYA 3ESTA 3VPKA 1YYY1 2ZECA 3MU0A 3QX5H 1W3CA 1YM0A 1S83A 1Z6JH 1FNIA 3TPIZ 1K1OA 1GJ7B 2XC5A 1BBRH 1OYTH 1PPZA 3NPSA 1D6WA 1L2EA 2WUCA 4GCHG 8LPRA 3V3MA 1QRWA 1C5TA 3H7OA 1AWFH 2SGEE 1ELAA 5DP7A 2HNTC 4Q2KA 1O3IA 3RXAA 2ZFTA 3EQ0H 2O8UA 1EAUA 1C2FA 3NXPA 2TGPZ 2C8XB 2PW8H 4LK4A 1YPLH 1A4WH 4X2XA 1MTVA 2B9LA 1GGDB 2FPZA 2Z9IA 1GL0E 1AIXH 1TPSA 2YNBA 1O2KA 3U1JB 1S6FA 2WPIS 1SLVB 3E6PH 1BRCE 4NGAH 3ZZAA 1IQIA 1XXFA 3T26A 1HPGA 1RGQA 1SL3A 2B5TB 1CBWB 4A1XA 2F9PA 3Q3YA 2QGRA 5CHAB 1YCPK 1BDAA 1HXFH 3VFEA 2OC8A 3GCTF 2XCFA 1P10A 2ZDAH 1XKBC 2JH0D 1AVWA 2VVUA 2ZNKH 1TABE 1IQHA 2GCTB 1D4PB 2VVVA 4YO9A 2O8MA 1GG6B 1EAWA 4D7GA 1EJNA 3FANA 1RD3B 2DE8A 4MPVA 1GDNA 1ANDA 3GCTG 5LPEA 1AE5A 1BJUA 1KTTB 1V3XA 3V13A 2QAAA 2TGAA 5T6GA 2FZZA 2ZU1A 4X0WU 2PR3A 1YCPM 4QT8C 1BQYA 1C4V2 2C90B 1LHDH 3EDXB 1YBWA 1LVOA 1GHXH 2HLCA 2RA3A 1RJXB 3SU0A 1XUIA 3KQCA 4Q7XA 1SLWB 5FPTA 4K69A 1LMWB 2G81E 3M36A 1TGSZ 2WINI 1DPOA 1AVXA 3STIA 1O3CA 2A1DB 3EE0B 4WXIA 3L33A 1C5WB 5A8YA 2G8TA 1RTKA 1ZTJA 4H6SB 5C2ZA 2OXSA 4X2YA 1KDQA 1ORFA 1XKAC 3PLBA 1E38B 1U6QA 2BLOA 3M61U 4CH2B 1ESBA 1LO6A 4IN2A 3PMAB 3QGNB 4HTCH 1JIMA 4MNYA 2PWXA 1OWEA 1HAVB 3ATWA 2ZGXH 3K65B 3IITA 1TGTA 5CHAC 3GY7A 1LQEA 1BA8B 2IN2A 1NRRH 1N8OC 4OS6A 2FI3E 6ESTA 1D6RA 1DWEH 1ZTKA 1XMNB 3CENA 1Y5BT 2OCVB 3TJUA 3GDSA 1A2CH 1SQTA 1TAWA 1BT7A 4FXGH 2BOHB 3ZZBA 2BD4A 2FMJA 3M3SA 4BNRA 4CBNA 1KXBA 1HV7A 4BTIB 2C8WB 2FI5E 1JBUH 1WSSH 2BXUH 3H7TA 1G3EA 2V3OH 1L1NA 3KL6A 4O03A 1KXAA 1O2VA 2F83A 1DE7H 4X6PA 2ODQA 2NU0E 5E0GA 2B7DH 3E0NB 3PWBA 2G51A 1QL7A 1F0SA 2ZHQH 2G55A 2ZPSA 4X8UH 1EQ9A 3S7KB 3GCOA 5A09A 1P01A 1O3FA 1V2VT 1GBKA 1LTOA 3S7HB 3PV4A 2QC2A 2W7UA 1BITA 1OWHA 3LGWA 1EZSC 1IQKA 2FESH 2J34A 1SVPA 1ARBA 1J14A 4B74A 1Y3UA 1S0QA 2GV7A 3BG4B 2P59A 4TPIZ 2CHAB 1MBMA 3KQDA 4WF8A 4Y8XA 3JZ2B 2PSXA 4B1TA 2ZO3H 1DANH 1EPTA 4MVNA 1AKSB 3Q3KA 3F68H 3MTYA 2B8OH 1UTJA 3QTOH 1SG8B 1O2LA 1W2KH 4FUEA 2HOBA 3QLPH 1HUTH 3LGIA 2F91A 5DP9A 5I25A 1PYTD 1LVMA 1GCTB 3L6PA 3ATIA 9LPRA 4MNWA 3MU1A 2PLXA 2AMQA 1YLCA 1ARCA 2G5VA 2OLGA 5TCCA 2ODPA 3LOXA 4X8VH 2GX4A 4FU7A 4JMYA 2EI6A 3OY6U 1ZHRA 4HI3A 1MD7A 3TH2H 1YPMH 4AX9H 1MH0A 3RLWH 3ZVEA 2R3UA 2FOHA 4K5ZA 3P8GA 1O2IA 1XUFA 4H6TA 3UUZA 4YOJA 2SNWA 3M7UA 2ZC9H 2VIOA 1FAXA 1VJ9U 1F92A 3EAJA 1YLDA 5JYIA 4FVBA 2V6NA 4GHQA 3SORA 3A7ZA 1GWAA 1LVYA 3FP7E 2ZCKP 4DJZB 4AN7A 2G4TA 4BTUB 4K8YA 3ITIA 4O3UA 1CA0B 3PLKA 1P2JA 4JCNA 1UK4A 4MPXA 1HDTH 1TWXB 4IMQA 3UQOA 2Q6GA 1TNHA 1KXEA 1QQUA 1FLEE 1O3OA 1CQQA 1RTLA 3VGCC 3A84A 1UVUH 1YF4A 3SUEA 4WWYA 1PQ5A 5EW1H 3DFLA 2H5DA 1Z1IA 3A8AA 4TWWA 2K1QA 1C5UA 1CGIE 1N1LA 3VXEH 3ENSB 2HALA 1WBGB 4Q80A 1IQNA 3BTKE 3QZRA 3RXLA 4ZROA 1FPCH 3LGYA 3ZZ6A 5DJ7A 1UK2A 1LKAA 5T6FA 3UR6A 2A5IA 2ZDVH 3BTWE 5BRRE 1BMLA 1O3KA 3ZVDA 1GBIA 1GVLA 2HWLB 4NFEA 5L2YH 4JYTA 1H8IH 1C2MA 1K1MA 1AE8H 3PYHA 1O5GH 1G3CA 4YT6H 2A0QB 4Y6DA 4ZHMU 1AB9B 2A2QH 1GL1A 3CS0A 1BIOA 1FDPA 1O0DH 4YOIA 1C4U2 1MTUA 1ANEA 1UTOA 2O8LA 2P3TB 1C5OH 1HJ9A 2ZPQA 4U2WA 5FHTA 1P9UA 2W3IA 3RXMA 1NC6A 4DOQA 1AWHB 2BM2A 1O3HA 2Y81A 1EZQA 1Z8IB 4BAOB 1AFQB 5C67A 2XWAA 1AY6H 3RXBA 1C5MD 1UVPA 2FX6A 4AYVB 1OP0A 3GCNA 5DP6A 1O2PA 3GICB 7GCHF 1KLJH 1A5IA 2A32A 1BMAA 1SGTA 4JYUH 2BXTH 4RSPA 1DVAH 2QIQA 2ZGBH 4YOGA 2ZWLH 2I6SA 2Y7ZA 1BTUA 7GCHG 1LPZB 3T62A 3RC4A 3ZZ8A 1QFKH 3VEQB 1W8BH 1BOQA 1W7XH 1CU1A 1UHBA 1DWDH 1GBLA 2HPPH 1VR1H 3TH3H 4RN6A 1KSNA 5DK1A 1GI2A 2BDBA 2UWPA 5FCRA 5FPSA 1A46H 5LPFA 1O33A 3HGNA 2BVRH 3LIWA 2PUXB 3BG8A 2ZU5A 3MH6A 1GBFA 2OQ5A 3S9BA 2BLVA 3O8RA 1W10U 1D9IA 2FM2A 2BLWA 3OTJE 2CV3A 1H8DH 1HXEH 4X2VA 2GGVB 3QN7A 3ZVGA 1P2QA 3EA9A 4FUGA 2ZP0H 2WPJS 1Y3XA 1H1BA 4D9RA 1JMOH 2ZU2A 3IG6B 5GPIB 2Y5GA 2PKSC 1HAZB 1O2RA 5EQRA 3FP8E 1BTWA 1OXGA 1LHEH 3HK3B 3P6ZB 3RP2A 4FUIA 5ABWA 1GI4A 1H9LB 1PFXC 2P93A 1GJ4H 2VIDA 1SFIA 1AD8H 1BUIA 1G2LA 3ATKA 3WY8A