1UTQA

Trypsin specificity as elucidated by lie calculations, x-ray structures and association constant measurements
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Trypsin Specificity as Elucidated by Lie Calculations, X-Ray Structures, and Association Constant Measurements
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords TRYPSINOGEN
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1utqA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1utqA02
3ZVDA 4CRCA 4M7GA 4FXGH 1NFXA 1S83A 2P95A 1HB0B 1V2ST 1Q2WA 1ANCA 5EGMA 1TQ7B 2A1DB 3SOSA 1BHXF 1H4WA 5LH8A 4BNRA 1YC0A 2O8MA 1CGJE 3NPSA 5JBBS 2STAE 2Q6GA 3M5MA 1AIXH 1DSUA 1K21H 1RXPA 1TRNA 2H6MA 3PLKA 4X8UH 3SJOA 3ATWA 3E1XB 6GCHG 1SOZA 2ZHFH 4GLYA 3SORA 2O8LA 4OS6A 4JCNA 1LHCH 2ODYB 3DFLA 2AGEX 5CE1A 1L0ZA 1UO6A 2ODQA 4UD9H 3M37A 1N6YA 1J16A 4NFEA 1QURH 1KXFA 1G36A 2BY5X 3BTEE 1L4DA 1SQOA 2F3CE 2TBSA 2PSXA 2V0BA 4ISIH 1HRTH 5T6DA 3VXEH 3EGKH 1V2OT 3IWMA 4ZUHA 1FN8A 3W95A 2GTBA 2ZU1A 1N8OC 1AMHA 1SLVB 2ZZUH 5CHAB 1C2HA 1UTNA 1FIZA 2G51A 2DE9A 1RIWB 2IJOB 2H5DA 4MPXA 1B7XB 2WYGA 2TGAA 4FU7A 3LGVA 3DHKH 4B74A 3W94A 2FI5E 2XBWA 2FOEA 4MNYA 2TRMA 2A31A 2XYAA 1O2XA 3K2UA 1GHYH 1O38A 4YOJA 1FN6A 2ZGHA 1SR5C 1ZMLA 1LTOA 3GY6A 2AERH 1QBNA 3CENA 4H4FA 1GBMA 5A8ZA 1HJ9A 2VVCA 1GJDB 3RMLH 1GBFA 4KKDA 4TPIZ 4AB8A 5A0BA 5F6MA 1PPZA 2PLXA 4HTCH 3SJIA 4BAKB 1CA0C 2ZHEH 3RXVA 3TITA 3OTJE 3TJNA 3Q3XA 2V3OH 1ABIH 4X6OA 3FP7E 4X1QU 1Z8JB 4X1PU 2P93A 1PYTC 3Q76A 3PO1B 7LPRA 1OWJA 5DP4A 2ZCHP 2ZIQH 3A81A 3KF2A 4WMDA 3O8BA 1SQTA 2GZ9A 3A83A 1ESTA 2R0LA 1SL3A 4DVAU 3SGQE 4E7RG 3TK6A 3RMOH 3ESTA 1TBZH 1YLCA 1A5IA 1TABE 2P59A 3A87A 3ATMA 1C1RA 1O37A 1ZSLA 2RA3A 1VGCC 3K9XB 3RLYH 3VB6A 1DPOA 1ZRKA 4KTCA 1F7ZA 1THSH 4CH2B 1F2SE 1ZOMA 1ETTH 8GCHF 5JBTA 1X7AC 1QRZA 2HNTE 2XC0A 4IC6A 5SGAE 3UNRA 1ZHPA 1F92A 3PB1E 3DFJA 2AYWA 3NWUA 4D9QA 2ALPA 2BLQA 4NIWA 1C2GA 1VJ9U 2QA9E 3SV6A 4D76A 1EB2A 4YT7H 1NS3A 3C27B 2ZDMA 2UUYA 1Y5UT 2ZC9H 2ZGCA 2A7CA 1CQQA 5FX6A 2GMTB 3RXFA 4FUBA 1DY9A 3P6ZB 3LONA 1IQLA 3ITIA 1WAYB 3GY8A 2TGDA 3V13A 3H7OA 3ZVGA 4UFFH 1SC8U 2V35A 3L33A 4MNXA 1FPCH 8LPRA 4I8LA 3MU5A 2OC1A 4RKJB 1RRKA 1QA7A 4JZ1A 4D7FA 4U01A 4YTAA 1OPHB 1PYTD 1OS8A 2HPPH 1XUJA 1GCTB 1J17T 1W0YH 1G2LA 2EEKA 1NU9A 1OWIA 4Y76A 1O3AA 1C5LH 4A1TA 4DIHH 1T8OA 5FHTA 2PWXA 4O03A 3SI4H 4FVDA 1MKWK 1GHAF 2C8WB 1UCYH 4NCYA 3LGUA 3UIRA 1O3EA 3M3TA 4CHAC 1BMAA 1AVGH 2RG3A 3GY4A 1ESAA 1UK4A 1QRXA 1JWTA 1MMJN 3U9AH 2FOHA 1TNHA 1SVPA 1UK3A 2BTCE 3ENSB 4AYYB 1BTWA 3M36A 1W12U 2H1UA 5LPEA 2EI7A 2SGEE 1GMCF 2ZI2H 2P3UB 2VINA 5EODA 1K22H 4I8HA 5CMXH 3ODDA 5G4BA 2BY8X 2V6NA 1QJ6B 4CRBA 1S84A 4DCDA 3SQEE 1GGDB 6CHAB 1P01A 2WPLS 3DA9B 3Q3KA 3P17H 2G55A 3RDZA 1W2KH 1UVSH 1DE7H 3KGPA 1K9OE 1WSSH 2ANWA 1GJ5H 3GCHC 4ZKSU 1C1OA 3TJUA 5FCKA 2EI8A 1OP8A 2GT7A 4BXSA 1YPHC 7KMEH 2Y7ZA 5DP7A 3FZZA 1C2MA 5LPRA 3AW0A 1G9IE 1AE8H 1P04A 3L3TA 1C5VA 4DOQA 1UJ1A 1EXFA 4A6LA 1GCTC 1LHDH 1SB1H 3P8OA 2ZFFH 1Z1JA 2JH0D 2W7SA 3TVJB 3A7YA 3OY6U 1GI2A 1DLKB 2P16A 1HJAC 1ZPBA 4DJZB 1MTUA 4Y7AA 2BDHA 1CA0B 2QXGA 4JYTA 3MWIU 1F5KU 1GPZA 2BDBA 3M5LA 1FONA 3UOPA 2FTLE 1JRSA 1P8VC 1BMMH 4I8KA 3PMAB 1AHTH 1WUNH 5E2OA 1C4Y2 5EXNA 3BF6H 2GCTC 3V3MA 2BLVA 2Y82A 3HKIB 3HK3B 2Z9KA 2QYIA 1O3MA 1QQ4A 4B76A 3ZZ8A 3QTOH 1GHBG 5I46H 1INCA 3HKJB 1MCVA 1TALA 4SGBE 4Z6AH 1MU8B 4X6NA 3QLPH 4F49A 3Q00A 1O35A 1WOFA 2UUJB 2H9HA 2AEIH 1E37B 3FZDA 4YZUA 2XW9A 2BD4A 3ELAH 1ZMNA 3QK1A 1S82A 1OOKB 1Z6JH 3OU0A 1GHXH 2Z9LA 3ATLA 4K60A 4Y71A 1AFEH 1O2LA 2PKAA 2SGPE 4B2AA 2QV1A 2ZFTA 1Q3XA 1C5OH 2F9UA 1ZPZA 1IQIA 1LO6A 3RM2H 3VPKA 3MU1A 2A4RA 1IQJA 2QF0A 1PQ8A 2BD7A 2D8WA 1LPGB 1PPFE 1UTJA 2FMJA 1TMBH 4INKA 4NA9H 2VWNA 2ZG0H 3MU8A 1TNGA 2A2QH 2PGBB 1AB9B 1O33A 1SHHB 4HGCA 2NWNA 4KTUA 1TAWA 3I29A 1DITH 4O3UA 4Y0ZE 1ZHMA 2ZPRA 1MTWA 4BOHA 1AFQC 1YPLH 9LPRA 3UWJH 5EQSA 4WXVA 1P03A 2VWMA 8KME2 2ZU4A 1AGJA 1TRMA 1LMWB 1YLDA 2Z6BD 3F9FA 4O9VA 5TCAA 4IMQA 2DE8A 1DM4B 3NZIA 5BPEA 1QY6A 3B23B 3UY9A 2OINA 1A0HB 2KAIB 4FUEA 1P2NA 1SGQE 1RTLA 2A2XH 2ZNKH 3N7OA 3EAJA 4AN7A 1GI7B 3SU2A 2HLCA 1OWDA 2AGIX 1CBWB 1S0RA 2GCHG 3RU4D 1EAIA 2PGQB 4B71A 3LOXA 3T2NA 5C67A 2NU1E 1C2FA 4ZH8A 1CVWH 3F6UH 3SZNA 1KLJH 1BA8B 1S6HA 1YPJH 3ZVBA 3EDXB 2G00A 4I8GA 3M35A 2HWLB 1QB9A 1C4U2 3KL6A 1Z1IA 3S9CA 2CF9H 3SO3A 2J9NA 3A86A 3SU5A 5C3NA 2BD2A 2OQ5A 3PYHA 3GY2A 2ZTZA 2LPRA 4GVUA 2C4FH 3JZ1B 3STJA 4ZKRU 1Y5AT 1YPGH 1KXEA 5DP3A 3OX7U 1A4WH 3PV4A 1AE5A 3KCGH 3ZV8A 1MTNB 4O3TA 1LVMA 3H7TA 4ABFA 4NA8A 1MU6B 2O9QA 3SU4A 1DS2E 2OXSA 1PJPA 1UTOA 1GHBF 3EE0B 3RC6A 1GBIA 2R2WU 1O0DH 4ISOA 3GCTF 1GI9B 5E0HA 3S0NA 5L30H 3A7VA 1WYKA 2H5CA 3K65B 1C2KA 1G37A 1O36A 1O2PA 2BDIA 4GCHF 2R9PA 4K8BA 2ODPA 1P0SH 1QCPA 1A61H 2FLRH 1P3CA 1TB6H 2C8YB 1DDJA 4Y7BA 4ZHMU 3GCNA 1DWBH 2XC4A 1HBTH 2XCNA 1C1NA 1CA8B 2SNWA 1V2TT 4OS5A 2W3KA 3MTYA 2P8OB 3BTTE 2BMGB 3GCTG 2HNTC 4BTTB 2XWAA 4UEHH 2ZA5A 2GDEH 4DT7B 3GISB 1WBGB 1LHEH 1FLEE 2BB4A 3RUOA 2VVUA 1Y5BT 2A4GA 2GP9B 2R3UA 1EJAA 3GICB 2QC2A 5K7RA 1AVWA 3LGTA 1EATA 1HCGA 1C1TA 2BQ6B 2FI3E 5FCRA 2ZO3H 4OS2A 2QIQA 3HATH 1LKBA 3GDUA 2FI4E 1K1OA 3A7ZA 3F9HA 3KQCA 2SGDE 2PTCE 1TNKA 4UE7H 1CT0E 3SQHE 1YGCH 1TA2A 1GVLA 1UTLM 3HK6B 4RSPA 1WCZA 1W13U 1BTXA 1SGFA 5DGJA 1ZPCA 1F0TA 3ZYEA 1ETRH 3EA8A 4X8TH 4A1XA 1O32A 2PUQH 2Q1JA 1LPZB 5LGOA 6LPRA 2QF3A 1C5MD 3PWCA 1RJXB 2ANKH 3ZZBA 1TA6A 3FFGA 1J8AA 3BIVH 4BTIB 2J95A 2D26C 1C1VH 1W7XH 1AKSA 4CRGA 3KEEA 4XSKU 2TGTA 2VH6A 2GCHF 1SLWB 5AHGH 1CGIE 1F5RA 4H6TA 5EG4A 1Z8GA 2VGCC 3DT0H 2AIQA 1GJ7B 5EPYA 2J34A 1DXWA 2C3SA 2J4IA 2FYQA 1OX1A 2CN0H 1O5EH 2GKVE 3LDXH 4FUJA 2PFEA 3NUMA 1EZUC 1C2IA 5DP9A 3P8FA 1O3HA 3G01A 1K1LA 1RGQA 5C2ZA 4R8TB 5JDUB 1DUEA 3E8LA 1GMDG 1GJBB 1NRSH 2BXTH 3RXTA 2F9PA 3ZZ9A 1MZAA 3UPEA 1EOJA 5EW2H 2FO9A 2AS9A 1RD3B 1MCTA 4YO9A 3RU4E 1IHTH 4X6PA 1K28D 1O5DH 3SU1A 1DFPA 1KXDA 5T6FA 2CHAC 1O3JA 3GY5A 1T4UH 3ZZ5A 2XRCA 4XFQA 3BSQA 2FP7B 1GMHG 1YYY1 4NZLA 3RXMA 1FXYA 4ZMAH 2QCYA 5GXPA 5HM9A 2WV5A 1XVMA 4FUGA 3RMNH 3T28A 1Y8TA 3SW2B 3A7WA 3MOCA 2OUAA 3WY8A 1GBLA 3A8BA 4GCHG 1VCWA 4ZXXH 1GHZA 1H1BA 5EW1H 1LHFH 1TGBA 4YOGA 1IQMA 1GJCB 1O3KA 2AIPA 4D9RA 1TMTH 1VGCB 3MHWU 1V2VT 3TNTA 1GI4A 3ZZDA 3SU0A 3SN8A 1KDQA 2OD3B 4AGKA 2WYJA 3STIA 1ELBA 1NN6A 3SV2H 3VB3A 5F8TA 3RXSA 1PPBH 4AZ2B 1F0RA 1SBWA 1V2PT 3MNXA 2OLGA 4NWKA 5A2MH 4ISLA 3RMMH 5EU8A 1SGYE 5A0AE 1L4ZA 3BTGE 5HM2A 1ANEA 2UUKB 3SUGA 3RXUA 1AVXA 3Q3YA 1E0FD 3LPRA 4U32A 1MKWH 2WUCA 1Y3WA 2ZFSA 5AVDA 1YM0A 1TONA 2ZTXA 1SGDE 1BUIA 3M7TA 3RXBA 1O3BA 4RKOB 1A46H 2FS9A 1KYNA 3MNSA 3SHCH 1QL9A 1KIGH 1FUJA 1MD8A 1GDQA 1KDQB 3EYDA 2M5TA 1NRNH 4JK5A 4AFUA 2AFQB 1Z7KA 4UDWH 4AG1A 2ZPQA 1V2JT 2G52A 2XNIA 2TPIZ 1Z8RA 2FYRA 3MMGA 1VITG 3ZZCA 1WQSA 3KIDU 1TGCA 5LPFA 2FX4A 4WVPE 4ABJA 4AGJA 1V2NT 1FMGA 1GI1A 4IMZA 1AZ8A 3BTWE 2VH0A 4XBDA 1AO5A 2AMDA 2XBYA 4IN1A 1E34B 2HGTH 2SNVA 1ZR0A 2FPZA 2O8UA 2BQWB 4XBCA 3E6PH 2J38A 1GMCG 3SHAH 1JBUH 3F68H 3RXCA 4K5ZA 1P02A 3E16B 5ESBA 2FOCA 1J9CH 2B5TB 1GVKB 2BVRH 1O2VA 1QHRB 1TLDA 1KLTA 1ZHRA 3R0FA 1GWAA 1MBQA 2VVVA 4UFDH 3B9FH 4E7NA 3LH1A 1D4PB 1AU8A 1MUEB 1GBKA 4K3JA 4CREA 1IQFA 4Y10E 2GZ8A 1GBJA 5E0JA 1KLIH 7GCHG 2A0QB 2B8OH 2BD5A 1MKXH 1LPKB 3FAOA 1BIOA 1EZSC 1NZQH 1A7SA 1L1GA 1HAGE 2VGCB 4Y8ZA 4ABHA 3IITA 4Y11E 5DP5A 3M5OA 1HNEE 4Y0YE 1L2EA 2FEQH 2C8ZB 6GCHF 1OWEA 2VIOA 4X8SH 4AYVB 1UCYK 3SNCA 2WV4A 3TJOA 2OBQA 1GJ9B 4A5TS 1V2LT 5IYTA 1O34A 5FXLA 1EP5A 1Z8IB 1W8BH 3D65E 3MH6A 3OYPA 1N8OB 3UWIA 1MAYA 2Y7XA 1AKSB 4ZXYH 2Y80A 5ESTE 2ZU2A 2HOBA 3MH7A 1C1UH 1LQEA 1BBRE 1TYNA 1LQDB 2LNCA 1U6QA 1DSTA 1EZQA 3AAVA 1ARCA 1C5XB 6CHAC 1K2I1 5L6NH 1ETSH 3TH3H 3TGIE 4X2XA 4YLQH 1SGFG 1HGTH 3F9GA 3UR9A 3RXDA 7ESTE 4B1TA 1D6RA 3TNSA 1MQ6A 2F91A 4NFFA 1MTSA 5J4QA 3KHVA 1JIMA 3VB7A 1J15A 2ZKSA 2UWPA 3RXAA 2W7UA 3UTUH 1ELCA 3ZYDA 1PPHE 4K1TA 5DK1A 2QXJA 1YKTA 1DANH 3UUZA 1JMOH 1KY9A 4MNVA 2FOFA 2NU4E 4YM9A 5A0CA 3KQBA 2GCTB 1XXFA 1UCYE 2GV6A 1KXAA 2G5VA 1ZRBA 2AH4X 1AB9C 1G3EA 1P06A 4Q7ZA 1S6FA 1GBDA 3MH5A 2O8TA 1THPB 5JB9S 3QZRA 1IAUA 4TPYA 1BITA 1A5GH 1K1NA 2A5IA 4ISHH 5JBAS 1EPTB 1AUTC 1FY3A 1O2OA 3K6YA 4TY6A 2IPHA 1T8MA 1TWXB 2SFAA 2BD9A 2BVSH 4Y8YA 2FIRH 2A4QA 2ZECA 2ZGJA 3O8RA 1KXCA 3SNBA 2QY0B 4J1YA 1LHGH 3SV7A 1TOMH 1HAXB 1A3BH 1GMHF 3A7XA 3SV9A 1C5YB 3LC5A 2A7HA 4TWWA 1EASA 4HZHA 4GSOA 1WV7H 2GX4A 2FODA 1ORFA 2J2UA 1CHGA 3SNEA 2BYAX 4FUCA 1EUFA 2ANMH 1GBAA 1MZDA 1O3OA 2ZHQH 5L2ZH 2PSYA 4NZQA 3B8JA 5ABWA 4FVBA 4UFGH 4CBOA 1SQAA 4IN2A 4D7GA 2G8TA 1XKAC 4WH6A 5A8XA 3M3SA 2BY6X 3D62A 3PROA 3ZVEA 4XBBA 4XOJA 1NT1A 1BRUP 3KQDA 4ZAEA 1AZZA 3O8DA 3RXEA 1W0ZU 3UREA 1TE0A 2BZ6H 2AMPA 1P09A 2CHAB 2W3IA 1BMLA 2D2DA 3I78A 1TFXA 1GG6B 4FU8A 2STBE 2BQ7B 2ZDVH 2SGFE 1HXEH 2I6QA 5BRRE 3ODFA 3VGCC 1C2JA 5T3HA 1CU1A 3SGAE 1CHOF 1FPHH 1MQ5A 5FBEA 5HXFA 1FAKH 3MI4A 5A09A 3TIUA 2TGPZ 1UK2A 2YNAA 1AN1E 3A8DA 1HLTH 3GOVB 3UOUA 1P2KA 1HAHH 2JETC 5FPYA 5C1UA 1EJNA 2Z9JA 3LIWA 1EOLA 2WPJS 1VCQA 2G81E 2W26A 1Y3YA 4A7IB 4K69A 2QGRA 4OS1A 3LH3A 4JZDH 4ABAA 1GBCA 3TPIZ 1ID5H 3A85A 1Y3VA 4LK4A 1YP9A 2ZHDA 2Z3EA 2YNBA 1ELEE 1FV9A 2ZTYA 3ZVFA 1O2NA 1LDTT 1O30A 3HGNA 3MO9A 1G30B 1F0SA 2PHBA 3LT3A 2UWOA 4DY7B 1FY1A 1O3FA 1P2JA 1DWCH 1TBRH 3QZQA 4DG4A 3E91A 8GCHG 4LZ4B 3LJOA 1F5LA 1LVOA 5C5NA 1HFDA 3UFAA 3PTBA 2B7DH 2PKSC 2Z3DA 4Y8XA 1SFQB 4CRFA 1C5UA 3URCA 3VGCB 2A7JA 3UNQA 2PR3A 5ETXA 1D3PB 4BXWA 2F9VA 2ZGXH 3A8AA 3D49H 4HFPB 1GJ6A 4K8YA 4PROA 3GCOA 1GJ8B 1FY5A 1QRWA 1VJAU 5J4SA 5A8YA 2P8OC 5TCCA 2VJ1A 4ZHLU 1FY8E 2BX4A 1O3LA 4AFQA 2HVXA 3LC3A 3IG6B 4OGYA 2EA3A 4I7YH 3P8GA 2IN2A 1O3IA 1BJVA 4J2YB 4MNWA 3TU7H 1A5HA 4BAOB 1B5GH 1S85A 1YBWA 2P94A 2BDCA 1GBBA 1T8NA 3BTKE 2F9BH 3RXRA 1K1IA 2A5KA 1GJAB 2RA0A 3F1SB 4ZKNU 5C20A 8ESTE 1P12E 4AFSA 5F03A 1C5RA 1NO9H 2VIVA 3ZZ4A 4OS7A 1EAUA 1SGNE 1GHWH 2DUCA 1NY22 3VB5A 3BTFE 4CH8B 1YCPH 4Q80A 3SNDA 3CP7A 3BG8A 2QAAA 2GVFA 2O8WA 2VU8E 3PO1C 4NG9H 3A84A 4YOIA 1UTQA 4CR9A 3LJJA 1GDUA 1O2SA 4BTUB 1BHXB 3MO6A 2BM2A 5DG6A 3SU3A 1HJ8A 3A88A 3TH4H 1PPEE 2OTVA 2HRVA 1BTPA 2FOBA 1TIOA 2FTMA 4IGDA 1IOEA 4BAQB 1AY6H 4X2WA 1PPCE 2FS8A 1J14A 1TNLA 3DD2H 1K1PA 2QXIA 3GY7A 2JETB 1VR1H 1D9IA 1O3PB 1P11E 1SLXB 1H8DH 1BRBE 4AFZA 1GHAG 1TBQH 1V2UT 5EPNA 5K0HA 3FANA 1MH0A 6ESTA 1ANBA 1ZMJA 1GI0A 3RXQA 1BOQA 2Z9IA 3U98H 1T4VH 1NRRH 3LGYA 4XE4A 1A0JA 3U8TH 3GDVA 1ELDE 3UQVA 2ZEBA 5GPIB 3MH4A 1C5WB 1HIAA 1XUIA 1OP0A 9ESTA 4WH8A 2H9TH 4I8JA 5PTPA 4WY3A 5E8EH 3FVFB 1D3QB 1HAIH 1SG8B 2ZP0H 5IDKA 1FI8A 1NRPH 3S9AA 1TPPA 2J92A 1TMUH 2QXHA 4JK6A 1JRTA 4Q2KA 3KNXA 2BLOA 3P70B 5GJ4B 4U30A 3ZZ7A 1NFYA 2W5EA 3S7HB 3EA9A 1GBHA 5T6GA 4WXIA 4ZKOU 4KTSA 1H9HE 4X2YA 4CRAA 4WMEA 1C1PA 3I77A 1P2OA 1H9IE 1C5SA 3RC5A 1QGFA 3KQEA 2BDGA 1V6DA 4WWYA 4NWLA 1V2QT 1YPEH 4H6SB 1YPMH 3AW1A 1EPTC 1MD7A 1O5GH 1C1MA 2HALA 2VB0A 4Y79A 2THFB 2ZU5A 1D3TB 4NIYA 3PM3A 1KXBA 3RLWH 3S7KB 1C2DA 2F9OA 4JMYA 5AF9H 1ELTA 1EKBB 1NRQH 3UNSA 2XWBI 1O5AB 1SGTA 1FZZA 2VWLA 2BOHB 1C5ZB 1AFQB 1B0FA 2XCFA 1BDAA 4GPGA 4FUIA 4I33A 1HYLA 4MVNA 3BEIB 1NFWA 3BG4C 4BAHB 2XBVA 3SU6A 3JZ2B 1SSXA 1DICA 1T31A 4KELA 2IOTA 4KGAA 3QTVH 4AB9A 1ZTLA 3M5NA 3MNCA 2BHGA 1SPJA 3AAUA 3BTME 4Q7XA 1O2HA 3ZV9A 3GYLB 3MNBA 5DP8A 2Y5FA 1DWDH 1G32B 1AWFH 1D3DB 3LGIA 1SGPE 2VIDA 1XXDA 1BBRK 1A3EH 1AI8H 2FLBH 1ZTKA 5B6OA 1V2RT 1CT4E 2ZPSA 3TK5A 1YPKH 2BVXH 1GVZA 1YCPM 3M7UA 4A92A 4MLFB 1EAXA 4DGJA 4UONA 1XUGA 3SJKA 1C5TA 4SGAE 1V2MT 1ZGVA 1ZSJA 1UVTH 2ZF0H 3SNAA 1HIAB 3ATKA 1C5QA 2ZDNA 3M7QA 4NSYA 1P57B 3BTQE 2UWLA 3QDZB 2Y5HA 2BDAA 3E0PB 4INHA 1A1RA 3OY5U 1ESBA 3PLBA 3U8OH 2P3FH 5GCHF 1OWKA 3T29A 1B0EA 2RCEA 1HUTH 4TY7A 3MFJA 1RIWC 5E2PA 4E06H 1UVOA 1P2MA 2OC0A 4O97A 4DW2U 1W7GH 1QBOA 1DX5M 3QWCH 2AGGX 1E36B 2OC8A 4DURA 3ZVAA 2ZWLH 2XC5A 5AFZH 3RXPA 2CF8H 1GMDF 3ZZAA 2HPQH 1CGHA 3E0NB 1SLUB 4IBLH 2OQUA 3GCHB 3A7TA 2VIPA 2ZGBH 2WUBA 2ZFQH 1PQAA 1YF4A 2ZQ1A 1DVAH 1S5SA 1DT2A 1IQHA 1G3CA 2BY7X 4ZHAA 1BRCE 3P92A 4QT8C 4X6MA 4NSVA 3FP6E 4ASHA 1GI5A 2ZDAH 1T7CA 1XUHA 1BCUH 2OBOA 4VGCC 1EPTA 1GBEA 3UR6A 1LVBA 1SI5H 4IC5A 1IQEA 4GHQA 1DLEA 1QIXB 1ZJDA 1T8LA 3CS7A 1AD8H 2OC7A 2PTNA 2B0FA 1O2RA 1KTSB 2Z3CA 1GL0E 4ZROA 2XBXA 2BX3A 1C9PA 1C5PA 3P95A 3TJVA 2VNTA 1XKBC 3QX5H 2GDDA 4KP0A 1EJMA 1OP2A 4INLA 4RN6A 4MQAA 1ZYOA 4JYVH 4FU9A 1NC6A 1O2WA 3RU4T 3V7TA 2FOGA 4CR5A 1VCPA 1C4V2 1BMNH 4ABEA 3MO3A 2WPKS 4U2WA 3RM0H 5DO4H 1TGNA 3AVZA 2GT8A 3BTHE 1O3GA 3V12A 1TPOA 1O39A 2ZDKA 2ZDLA 4ABIA 3UQOA 3QGJA 2GD4B 3D23A 3T26A 2OP9A 5C5OA 1FDPA 1O5BB 2FOMB 4IS5A 1QFKH 1EQ9A 3RP2A 3T62A 3TLOA 2SGQE 1C2LA 1ZJKA 2WINI 1SGRE 1G3BA 1EAWA 3OSYA 2PW8H 2BZAA 1ELFA 1GL1A 1HV7A 4JZIA 3MU0A 2I6SA 1P2QA 3PMHB 1UHBA 3P8NA 1C9TA 4LXBH 4WMFA 3SGBE 1VZQH 4THNH 1D6WA 2KAIA 2BD8A 1PPGE 2FX6A 1IQNA 1BQYA 3SI3H 1SGIB 4AG2A 1HAOH 2PUXB 2GV7A 1PQ5A 3SUEA 3LU9B 1DWEH 1W11U 1QB6A 1O2QA 2Y5GA 5FX5A 3EQ0H 3GDSA 1CE5A 2G4UA 5HYOA 1N1LA 2WPIS 1OSSA 1M9UA 3RXIA 2BD3A 1Y59T 2A45B 4CHAB 4YLUA 5DJ7A 5JYIA 2NU2E 1TX7A 1C1WH 3ATIA 2R3YA 4A1VA 4MPVA 1DY8A 1GBTA 3H5CB 2FWWA 1ZLRA 4I32A 4TWYA 3O8CA 1CSOE 4DIIH 1MTNC 3U8RH 3M61U 2C93B 4AORA 4ESTE 1JIRA 4K1EA 2FM2A 4NA7A 1E35B 2F83A 3VFEA 4YT6H 2VIQA 2CMYA 2Z94A 2WPMS 1WU1A 3A8CA 2UUFB 1H9LB 2BOKA 2CGAA 3EA7A 1Z6EA 1S0QA 4IW4E 1MAXA 2R0KA 2SGAA 1MTVA 1SOTA 5FPSA 3ZVCA 3F9EA 4B75A 1SMFE 2JH5D 1YCPK 1CT2E 1MKXK 3RC4A 4E05H 7GCHF 4NIXA 2QN5T 2XXLA 1O2YA 1TX8A 4FUFA 4YESB 1HAPH 1DUAA 3RXJA 1L1NA 3SBKA 1GJ4H 2ESTE 3RXLA 4X1SU 3VB4A 1NM6A 2ALVA 1SGCA 5HMAA 1UTKA 1G3DA 2GMTC 1O2JA 4FUDA 2GGVB 3SJ8A 3PTNA 3FP8E 3S69A 3E3TA 1NU7B 1QL8A 3AASA 1FJSA 3QUMP 3LGWA 4WJG2 1TOCB 1A2CH 4JZEH 5JB8S 2FESH 3SUFA 1EP6A 1O5FH 4NGAH 2D1JA 3DUXH 4B73A 2CJIA 1LKAA 1P2IA 3E90B 1EX3A 3QGNB 1O2IA 1O5CB 1UTPA 2ZU3A 1VITF 3NK8A 2ASUB 1ANDA 1N6XA 3BG4B 5H4IB 3SJ9A 1ELGA 5GCHG 4VGCB 1TGSZ 1ZZZA 1QJ7B 4OS4A 1HAVA 3U1JB 1KSNA 1W10U 1BB0B 1GG6C 1THRH 3RXHA 3BEUA 1UVPA 1O31A 3TK9A 4AOQA 1TRYA 3TGJE 1ZGIA 5DKMA 1BZXE 1BJUA 1E38B 3A80A 2EI6A 2FXRA 5F8XA 5C1XA 1TPAE 1HDTH 1MBMA 2XTTB 3U1IB 2G5NA 4H42U 5CHAC 1O3NA 1TNJA 2CXVA 1BBRH 3BIUH 1FIWA 2A32A 2C8XB 3RXKA 1ACBE 1LCYA 4HI3A 5L2YH 4Y6DA 1YPHE 3VXFH 1EB1H 1TQ0B 2YOLA 3NKKA 1O3CA 1HAYB 2B9LA 3GY3A 1ABJH 2A5AA 2ANYA 4FUHA 4B2BA 1IQKA 1WQVH 2HNTF 1JOUB 2RDLA 1FQ3A 1HAVB 1W14U 1OYQA 4ABDA 3SUDA 1XUKA 3HGPA 3NCLA 4UFEH 5TJXA 4TYDA 1UMAH 3MYWA 2Q6FA 1UVUH 1XVOA 1RS0A 1S81A 1NPMA 1SFIA 2ZFPH 3BV9B 2BXUH 1BTUA 1SHYA 5AFYH 1NESE 3U69H 4D8NA 1K1MA 4K1SA 3PLPA 5JBCS 3TH2H 1NFUA 1EZXC 5EQQA 3RXGA 3QN7A 2FZZA 3V0XA 1K1JA 3RXOA 1UTMA 3L6PA 2JH6D 4CBNA 3ZZ6A 3QO6A 3GYMA 1P3EA 2P3TB 5E0GA 1C1SA 2BLWA 1BTZA 4CRDA 4GUXA 3HPTB 5FAHA 4X8VH 2Y6TA 2ZHWH 4LZ1H 3NXPA 3LKWA 5F8ZA 1RTKA 1GCDA 1P05A 3TGKE 5JPMH 3SV8A 4X2VA 1P9UA 3A82A 1GHVH 1Y3XA 1QBVH 2VWOA 3T27A 3K6ZA 1QJ1B 4X0WU 4LOYH 4R0IA 1C1QA 2A4OA 2K1QA 1BRAA 1O2GH 1QTFA 2FOAA 4MTBA 2Z7FE 1SGEE 1O2KA 1O3DA 4K2YA 4B2CA 3A89A 1CHOG 4Q7YA 1ZTJA 1V3XA 1ARBA 1RTFB 4ABGA 1OYTH 5GDSH 1HAZB 2V3HH 1TPSA 1XMNB 3CS0A 3PMBB 1QR3E 2PV9B 1H8IH 4GHTA 3C1KA 3ZZ3A 4F4OC 4BAMB 1QB1A 1QA0A 3M3VA 4I31A 1XM1A 1NROH 1O2MA 2OCVB 1T32A 4ISNA 1WTHD 2J94A 1GI8B 2ULLA 2Z9GA 1V2KT 2BDYA 1DXPA 1JXPA 2H9EH 1PQ7A 1G2MA 1O2UA 5GIBA 3Q77A 1KTTB 2G4TA 1W3CA 5C1YA 4JYUH 1HXFH 2ZQ2A 5EOKA 1HPGA 1FY4A 5EXMA 4BANB 3S9BA 2TIOA 1L1JA 5FPTA 1CO7E 3PMJA 3BTDE 1UHBB 2EC9H 1GI3A 3T5FH 4Z0KA 1A0LA 1QL7A 3T25A 2F9NA 1TNIA 1OXGA 2C90B 1LVYA 1AQ7A 2H2ZA 1BTYA 3KN2A 5FBIA 3VEQB 2PKAB 2VIWA 2CV3A 4ABBA 4NIVA 1XUFA 4AX9H 2BY9X 1C5NH 4MDSA 5DP6A 1GDNA 1XX9A 1FAXA 3MU4A 4MPUA 1BTHH 4JZFH 1VITH 1ELVA 1GGDC 2AMQA 4OGXA 1P10A 5EQRA 1F0UA 4MPWA 1NTPA 5HGGA 1AWHB 3BN9A 1QQUA 4X1RU 4X1NU 2ZCKP 4MG3A 5GWZA 1GI6A 2NU3E 1CBWC 1ZSKA 1ELAA 2R2MB 1RFNA 1V2WT 1WTGH 2Q6DA 1Y3UA 1DOJA 2NU0E 1TX6A 2GZ7A 2Y81A 1OWHA 3R3GB 1IQGA 1Z71A 5DPAA 1FNIA 1BT7A 1OKXA 2ILNA 2FDAA 2PKSB 1Q31A 4WF8A 4XDEA 1PFXC 1QNJA 4GAWA 1IHSH 2ZCLP 1C2EA 2ZFRH 5I25A 1TGTA 1O2TA 3URDA 1O2ZA 2JKHA 1AUJA 5EXLA 3BEFB 2WPHS 1P9SA 3PWBA 1HJAB
chains in the Genus database with same CATH superfamily
5C94A 3ZVDA 4CRCA 4M7GA 4FXGH 5FL7D 1NFXA 1S83A 2P95A 1HB0B 1V2ST 1Q2WA 1ANCA 5EGMA 1TQ7B 2A1DB 3SOSA 1BHXF 1H4WA 3NRLA 5LH8A 4BNRA 1YC0A 2J97A 2O8MA 1CGJE 3NPSA 5JBBS 2STAE 2Q6GA 3M5MA 1AIXH 1DSUA 1K21H 1RXPA 1TRNA 2H6MA 3PLKA 4X8UH 3SJOA 3ATWA 3E1XB 6GCHG 1SOZA 2ZHFH 3WWFA 4XD7D 5EJZA 4GLYA 3SORA 2O8LA 4OS6A 4JCNA 1LHCH 2ODYB 3DFLA 1YY3A 2AGEX 5CE1A 1L0ZA 1UO6A 2YMSC 2ODQA 4UD9H 3M37A 1N6YA 1J16A 4NFEA 1QURH 1KXFA 1G36A 2BY5X 3BTEE 1L4DA 1SQOA 2F3CE 2TBSA 2PSXA 2V0BA 5DSFA 4ISIH 1HRTH 5T6DA 3VXEH 3EGKH 1V2OT 3IWMA 2KZ4A 4ZUHA 1FN8A 3W95A 2GTBA 2ZU1A 1N8OC 1AMHA 1SLVB 2ZZUH 5CHAB 1C2HA 1UTNA 1FIZA 2G51A 2DE9A 1RIWB 2IJOB 2F43B 2H5DA 4MPXA 1B7XB 2WYGA 2TGAA 4FU7A 3LGVA 3DHKH 4B74A 3W94A 2FI5E 2XBWA 2FOEA 4MNYA 2TRMA 2A31A 2XYAA 1O2XA 3K2UA 1GHYH 1O38A 3SYJA 4YOJA 1FN6A 2ZGHA 1SR5C 2W6ID 1ZMLA 1LTOA 3GY6A 2WSSD 2AERH 1QBNA 3CENA 4H4FA 1GBMA 5A8ZA 1HJ9A 2VVCA 1GJDB 3RMLH 1GBFA 4KKDA 4TPIZ 4AB8A 5A0BA 5F6MA 1PPZA 2PLXA 4HTCH 3SJIA 4BAKB 1CA0C 2ZHEH 3RXVA 3TITA 3OTJE 3TJNA 3Q3XA 2V3OH 1ABIH 4X6OA 3FP7E 4X1QU 1Z8JB 4X1PU 2P93A 1PYTC 3Q76A 3PO1B 7LPRA 1OWJA 5DP4A 2ZCHP 2ZIQH 3A81A 3KF2A 4WMDA 3O8BA 1SQTA 2GZ9A 3A83A 1ESTA 2R0LA 2YMSB 1SL3A 4DVAU 3SGQE 4E7RG 3TK6A 3RMOH 3ESTA 1TBZH 1YLCA 1A5IA 1TABE 2P59A 3A87A 3ATMA 1C1RA 1O37A 1ZSLA 2RA3A 1VGCC 3K9XB 3RLYH 3VB6A 1DPOA 1ZRKA 4KTCA 1F7ZA 1THSH 4CH2B 1F2SE 1ZOMA 1ETTH 8GCHF 5JBTA 1X7AC 1QRZA 2HNTE 2XC0A 4IC6A 4TSFD 2IJD1 5SGAE 3UNRA 1ZHPA 1F92A 3PB1E 3DFJA 2AYWA 3NWUA 4D9QA 2ALPA 2BLQA 4NIWA 1C2GA 1VJ9U 2QA9E 3SV6A 4D76A 1EB2A 4YT7H 1NS3A 3C27B 2ZDMA 2UUYA 1Y5UT 2ZC9H 2ZGCA 2A7CA 1CQQA 5FX6A 2GMTB 3RXFA 5C17A 4FUBA 4OM9A 1DY9A 3P6ZB 1OHHD 3LONA 1IQLA 3ITIA 1WAYB 3GY8A 2TGDA 3V13A 3H7OA 3ZVGA 4UFFH 1SC8U 2V35A 3L33A 4MNXA 1FPCH 8LPRA 4I8LA 3MU5A 2OC1A 4RKJB 1RRKA 1QA7A 4JZ1A 4D7FA 4U01A 4YTAA 1OPHB 1PYTD 1OS8A 2HPPH 1XUJA 1GCTB 1J17T 1W0YH 1G2LA 2EEKA 1NU9A 1OWIA 4Y76A 1O3AA 1C5LH 4A1TA 4DIHH 1T8OA 5FHTA 3OAAD 2PWXA 4O03A 3SI4H 4FVDA 1MKWK 1GHAF 2C8WB 1UCYH 4NCYA 3LGUA 3UIRA 1O3EA 3M3TA 4CHAC 1BMAA 1AVGH 2RG3A 3GY4A 1ESAA 1UK4A 1QRXA 1JWTA 1MMJN 3U9AH 2FOHA 1TNHA 1SVPA 1UK3A 2BTCE 3ENSB 4AYYB 1BTWA 3M36A 1W12U 2H1UA 5LPEA 2EI7A 2SGEE 2EY4C 1GMCF 2ZI2H 2P3UB 2VINA 5EODA 1K22H 4I8HA 5CMXH 3ODDA 2QF4A 5G4BA 2RDEA 2BY8X 2V6NA 1QJ6B 4CRBA 1S84A 4DCDA 1YLNA 3SQEE 1GGDB 6CHAB 1P01A 2WPLS 3DA9B 3Q3KA 3P17H 2G55A 3RDZA 1W2KH 1UVSH 1DE7H 3KGPA 1K9OE 1WSSH 2ANWA 1GJ5H 3GCHC 4ZKSU 1C1OA 3TJUA 5FCKA 2EI8A 4B6EA 1OP8A 2GT7A 4BXSA 1YPHC 7KMEH 2Y7ZA 5DP7A 3FZZA 4RT0A 1C2MA 5LPRA 3AW0A 1G9IE 1AE8H 1P04A 3L3TA 1C5VA 4DOQA 1UJ1A 1EXFA 2V3MA 2KCYA 4A6LA 1GCTC 1LHDH 1SB1H 3P8OA 2ZFFH 1Z1JA 2JH0D 2W7SA 3TVJB 3A7YA 3OY6U 1GI2A 2WPDD 1DLKB 2KM0A 2P16A 1HJAC 1ZPBA 4DJZB 1MTUA 4Y7AA 2BDHA 1CA0B 2QXGA 4JYTA 3MWIU 1F5KU 1GPZA 2BDBA 3M5LA 1FONA 2HVYB 1SQRA 3UOPA 2FTLE 1JRSA 1P8VC 1BMMH 4I8KA 3PMAB 1AHTH 1WUNH 5E2OA 1C4Y2 5EXNA 2QE7D 3BF6H 2GCTC 3V3MA 2BLVA 2Y82A 3HKIB 3HK3B 2Z9KA 2QYIA 1E79D 1O3MA 1QQ4A 4B76A 3F0PA 3ZZ8A 5KGOA 3QTOH 1GHBG 5I46H 1INCA 5CHBA 3HKJB 1MCVA 1TALA 4SGBE 4Z6AH 3N7EA 1MU8B 4X6NA 3QLPH 4F49A 3Q00A 1O35A 1WOFA 2UUJB 2H9HA 2AEIH 1E37B 3FZDA 4YZUA 2XW9A 2BD4A 3ELAH 1ZMNA 3QK1A 1S82A 1OOKB 1Z6JH 3OU0A 1GHXH 2Z9LA 3ATLA 4K60A 4Y71A 1AFEH 1O2LA 2PKAA 2SGPE 4B2AA 2QV1A 2ZFTA 1Q3XA 1C5OH 2F9UA 1ZPZA 1IQIA 1LO6A 3RM2H 3VPKA 3MU1A 2A4RA 1IQJA 2QF0A 1PQ8A 2BD7A 2D8WA 3F0OA 1LPGB 1PPFE 1UTJA 2FMJA 1TMBH 4INKA 4NA9H 2VWNA 2KX4A 2ZG0H 3MU8A 1TNGA 2A2QH 2PGBB 1AB9B 1O33A 1SHHB 4HGCA 2NWNA 4KTUA 1TAWA 3I29A 1DITH 4O3UA 4Y0ZE 1ZHMA 2ZPRA 1MTWA 4BOHA 1AFQC 1YPLH 9LPRA 3UWJH 5EQSA 4WXVA 1P03A 2VWMA 3CNRA 8KME2 2ZU4A 1AGJA 1TRMA 1LMWB 1YLDA 2Z6BD 3F9FA 2WHXA 4O9VA 5TCAA 4IMQA 2DE8A 1DM4B 3NZIA 5BPEA 1QY6A 3B23B 3UY9A 2OINA 1A0HB 2KAIB 4FUEA 1P2NA 1SGQE 1RTLA 2A2XH 2ZNKH 3N7OA 3EAJA 4AN7A 1GI7B 3SU2A 2HLCA 1YWUA 1OWDA 2AGIX 1CBWB 1S0RA 2GCHG 3RU4D 1EAIA 2PGQB 4B71A 3LOXA 3T2NA 5C67A 2NU1E 1KMHB 1C2FA 4ZH8A 1CVWH 5EJLA 3F6UH 3SZNA 1KLJH 1BA8B 1S6HA 3FOAA 1YPJH 3ZVBA 3EDXB 2G00A 4I8GA 3M35A 2HWLB 5B6LA 1QB9A 1C4U2 3KL6A 1Z1IA 3S9CA 2CF9H 3SO3A 2J9NA 2JIZD 3A86A 3SU5A 5C3NA 2BD2A 2OQ5A 3PYHA 3GY2A 3KQ5A 2ZTZA 2LPRA 4GVUA 2C4FH 3JZ1B 3STJA 4ZKRU 1Y5AT 1YPGH 1KXEA 5DP3A 3OX7U 1A4WH 3PV4A 1AE5A 3KCGH 3ZV8A 1MTNB 4O3TA 1LVMA 3H7TA 4ABFA 4NA8A 1MU6B 2O9QA 3SU4A 1DS2E 2OXSA 1PJPA 1UTOA 1GHBF 3EE0B 3RC6A 1GBIA 2R2WU 1O0DH 4ISOA 3GCTF 1GI9B 5E0HA 3S0NA 5L30H 3A7VA 1WYKA 2H5CA 3K65B 3WW7A 1C2KA 1G37A 1O36A 1O2PA 2BDIA 4GCHF 2R9PA 4K8BA 2ODPA 1P0SH 1QCPA 1A61H 2FLRH 1H8ED 1P3CA 1TB6H 2C8YB 1DDJA 4Y7BA 4ZHMU 3GCNA 1DWBH 2XC4A 1HBTH 2XCNA 1C1NA 1CA8B 2SNWA 1V2TT 2KCAA 2M2AA 4OS5A 2W3KA 3MTYA 2P8OB 3BTTE 2BMGB 3GCTG 3KYGA 2HNTC 4BTTB 2XWAA 4UEHH 2ZA5A 2GDEH 4DT7B 3GISB 1WBGB 1LHEH 1FLEE 2BB4A 3RUOA 2VVUA 1Y5BT 2A4GA 2GP9B 2R3UA 1EJAA 3GICB 2QC2A 5K7RA 1AVWA 3LGTA 1EATA 1HCGA 1C1TA 2BQ6B 2FI3E 5FCRA 2ZO3H 4OS2A 2QIQA 3HATH 1LKBA 3GDUA 2FI4E 1K1OA 3A7ZA 3F9HA 3KQCA 2SGDE 2PTCE 1TNKA 4UE7H 1CT0E 3SQHE 1YGCH 1TA2A 1GVLA 1UTLM 3HK6B 4RSPA 1WCZA 1W13U 1BTXA 5HIZA 1SGFA 5DGJA 1ZPCA 1F0TA 3ZYEA 1ETRH 3EA8A 4X8TH 2CK3D 4A1XA 1O32A 2PUQH 2Q1JA 1K0HA 1LPZB 5LGOA 6LPRA 2QF3A 1C5MD 3PWCA 1RJXB 2J98B 2ANKH 3ZZBA 1TA6A 3FFGA 1J8AA 3BIVH 4BTIB 2J95A 2D26C 1C1VH 1W7XH 1AKSA 4CRGA 3KEEA 4XSKU 2YMSD 2TGTA 2VH6A 2GCHF 1SLWB 5AHGH 1CGIE 1F5RA 4H6TA 5EG4A 1Z8GA 2VGCC 3DT0H 2AIQA 4P02A 1GJ7B 5EPYA 2J34A 1DXWA 2C3SA 2J4IA 2FYQA 1OX1A 2CN0H 1O5EH 2GKVE 3LDXH 4FUJA 2PFEA 3NUMA 1EZUC 3MQKC 1C2IA 1E1RD 3P8FA 5DP9A 1O3HA 3G01A 1K1LA 1RGQA 5C2ZA 4R8TB 5JDUB 1DUEA 4RT1A 3E8LA 1GMDG 1GJBB 1NRSH 2BXTH 3RXTA 2F9PA 3ZZ9A 4Z1MD 1MZAA 3F2FA 3OEED 1EOJA 3UPEA 5EW2H 2FO9A 2AS9A 2J98A 1RD3B 1MCTA 4YO9A 3RU4E 1IHTH 2V7QD 4X6PA 1K28D 1O5DH 3SU1A 1DFPA 1KXDA 5T6FA 2CHAC 1O3JA 3GY5A 1T4UH 3ZZ5A 2XRCA 4XFQA 3BSQA 5C0UA 2FP7B 1GMHG 1YYY1 4NZLA 3RXMA 1FXYA 4ZMAH 2QCYA 5GXPA 5HM9A 2WV5A 1XVMA 4FUGA 3RMNH 5GNDA 1Y8TA 3T28A 3SW2B 3A7WA 3MOCA 2OUAA 3WY8A 1GBLA 3A8BA 4GCHG 1VCWA 4ZXXH 1GHZA 1H1BA 5EW1H 1LHFH 1TGBA 4YOGA 1IQMA 1GJCB 1O3KA 2AIPA 4D9RA 1TMTH 1VGCB 3MHWU 1V2VT 3TNTA 4YXWD 1GI4A 3ZZDA 3SU0A 3SN8A 1KDQA 2OD3B 4AGKA 2WYJA 3STIA 1ELBA 1NN6A 3SV2H 3VB3A 5F8TA 3RXSA 1PPBH 4AZ2B 1F0RA 1SBWA 1V2PT 3MNXA 2OLGA 4NWKA 5A2MH 4ISLA 3RMMH 1FX0B 5EU8A 1SGYE 5A0AE 1L4ZA 3BTGE 5HM2A 1ANEA 2UUKB 3SUGA 3RXUA 1AVXA 3Q3YA 1E0FD 3LPRA 4U32A 1MKWH 2WUCA 1Y3WA 2ZFSA 5AVDA 1YM0A 1TONA 2ZTXA 1SGDE 1BUIA 3M7TA 3RXBA 1O3BA 4RKOB 1A46H 2FS9A 1KYNA 3MNSA 3SHCH 1QL9A 1KIGH 1FUJA 1MD8A 1GDQA 1KDQB 3EYDA 2M5TA 1NRNH 4JK5A 4AFUA 2AFQB 1Z7KA 3OTPA 4UDWH 4AG1A 2ZPQA 1V2JT 2G52A 2XNIA 2TPIZ 5CDFE 1Z8RA 2FYRA 3MMGA 1VITG 3ZZCA 1WQSA 3KIDU 1TGCA 5LPFA 2FX4A 4WVPE 4ABJA 4AGJA 1V2NT 1FMGA 1GI1A 4IMZA 1AZ8A 3BTWE 2VH0A 4XBDA 1AO5A 2AMDA 2XBYA 4IN1A 1E34B 2HGTH 2SNVA 1ZR0A 2FPZA 2O8UA 2BQWB 4XBCA 3E6PH 2J38A 1GMCG 3SHAH 1JBUH 3F68H 3RXCA 4K5ZA 1P02A 3E16B 3F2GA 5ESBA 2FOCA 1J9CH 2B5TB 1GVKB 2BVRH 1O2VA 1QHRB 1TLDA 1KLTA 1ZHRA 3R0FA 1GWAA 1MBQA 2VVVA 4UFDH 3B9FH 4E7NA 3LH1A 1D4PB 1AU8A 1MUEB 3W1EA 1GBKA 4K3JA 2K0QA 1IQFA 4CREA 4Y10E 2GZ8A 1GBJA 5E0JA 1KLIH 7GCHG 2A0QB 2B8OH 2BD5A 1MKXH 1LPKB 3FAOA 1BIOA 1EZSC 1NZQH 1A7SA 1L1GA 1HAGE 2VGCB 4Y8ZA 4ABHA 3IITA 4Y11E 5DP5A 3M5OA 1HNEE 4Y0YE 1L2EA 2FEQH 2C8ZB 6GCHF 1OWEA 2VIOA 4X8SH 4AYVB 1UCYK 2LP6A 3SNCA 2WV4A 3OFND 3TJOA 2OBQA 1GJ9B 5KEDA 4A5TS 1V2LT 5IYTA 1O34A 5FXLA 1EP5A 1Z8IB 1W8BH 3D65E 3MH6A 3OYPA 1N8OB 3UWIA 1MAYA 2Y7XA 1AKSB 4ZXYH 2Y80A 5ESTE 2ZU2A 2HOBA 3MH7A 1C1UH 1LQEA 1BBRE 1TYNA 1LQDB 2LNCA 1U6QA 1DSTA 1EZQA 3AAVA 1ARCA 1C5XB 6CHAC 1K2I1 5L6NH 1ETSH 3TH3H 3TGIE 4X2XA 4YLQH 1SGFG 1HGTH 3F9GA 3UR9A 3RXDA 7ESTE 4B1TA 1D6RA 3TNSA 1MQ6A 2F91A 4NFFA 1MTSA 5J4QA 3KHVA 1JIMA 3VB7A 1J15A 2ZKSA 2UWPA 3RXAA 2W7UA 3UTUH 1ELCA 3ZYDA 1PPHE 4K1TA 5DK1A 2QXJA 1YKTA 1DANH 3UUZA 1JMOH 1KY9A 4MNVA 2FOFA 2NU4E 4YM9A 5A0CA 3KQBA 2GCTB 1XXFA 1UCYE 2GV6A 1KXAA 2G5VA 1ZRBA 5IK2D 2AH4X 1AB9C 1G3EA 1P06A 4Q7ZA 1S6FA 1GBDA 3MH5A 2O8TA 1THPB 5JB9S 3QZRA 1IAUA 4TPYA 1BITA 1A5GH 1K1NA 2A5IA 4ISHH 5JBAS 1EPTB 3PV5A 1AUTC 1FY3A 1O2OA 3K6YA 4TY6A 2IPHA 1T8MA 1TWXB 2SFAA 2BD9A 2BVSH 4Y8YA 2FIRH 2A4QA 2ZECA 2ZGJA 3O8RA 1KXCA 3SNBA 2QY0B 4J1YA 1LHGH 3SV7A 1TOMH 1HAXB 1A3BH 1NBME 1GMHF 3A7XA 5HIYA 1C5YB 3LC5A 3SV9A 3DCLA 2A7HA 4TWWA 1EASA 4HZHA 4GSOA 1WV7H 2GX4A 2FODA 1ORFA 2J2UA 1CHGA 3SNEA 2BYAX 4FUCA 1EUFA 2ANMH 1GBAA 1MZDA 1O3OA 2ZHQH 1H8HD 4P00A 5L2ZH 2PSYA 4NZQA 3B8JA 5ABWA 4FVBA 4UFGH 4CBOA 1SQAA 4IN2A 4D7GA 2G8TA 1NBMD 1XKAC 4WH6A 5A8XA 3M3SA 2BY6X 3D62A 3PROA 3ZVEA 4XBBA 4XOJA 1NT1A 1BRUP 3KQDA 4ZAEA 1AZZA 3O8DA 3RXEA 1W0ZU 3UREA 1TE0A 2BZ6H 2L74A 2AMPA 1P09A 2CHAB 2W3IA 1BMLA 2D2DA 3I78A 1TFXA 1GG6B 4FU8A 2STBE 2BQ7B 2ZDVH 2SGFE 1HXEH 2I6QA 5BRRE 3ODFA 3VGCC 3KYFA 1C2JA 5T3HA 1CU1A 3SGAE 1CHOF 1FPHH 1MQ5A 5FBEA 5HXFA 1FAKH 3MI4A 5A09A 3TIUA 2TGPZ 1UK2A 2YNAA 4F48B 1AN1E 3A8DA 1HLTH 3GOVB 3UOUA 1P2KA 1HAHH 3F2HA 2JETC 5FPYA 5C1UA 1EJNA 2Z9JA 3LIWA 1EOLA 1SKYE 2WPJS 1VCQA 2G81E 2W26A 1Y3YA 4A7IB 4K69A 2QGRA 4OS1A 3LH3A 4JZDH 1W0JD 4ABAA 1GBCA 3TPIZ 1ID5H 3A85A 1Y3VA 4LK4A 1YP9A 2ZHDA 2Z3EA 2YNBA 1ELEE 1FV9A 2ZTYA 3ZVFA 1O2NA 1LDTT 1O30A 3HGNA 3MO9A 1G30B 1F0SA 2PHBA 3LT3A 2UWOA 4DY7B 1FY1A 2KCPA 1O3FA 1P2JA 4FETA 1DWCH 1TBRH 3QZQA 4DG4A 3E91A 8GCHG 4LZ4B 3LJOA 1F5LA 1LVOA 5C5NA 1HFDA 3PRDA 2JDID 3UFAA 3PTBA 2B7DH 2PKSC 2Z3DA 4Y8XA 1SFQB 4CRFA 3FO8D 4Q63A 1C5UA 3URCA 3VGCB 2A7JA 3UNQA 2PR3A 5ETXA 1D3PB 4BXWA 2F9VA 2ZGXH 3A8AA 3D49H 4HFPB 1GJ6A 2RFKC 4K8YA 4PROA 3GCOA 1GJ8B 1FY5A 1QRWA 1VJAU 5J4SA 2LELA 5A8YA 2P8OC 5TCCA 2VJ1A 4ZHLU 3AK5A 1FY8E 2BX4A 1O3LA 4AFQA 4DT4A 2HVXA 3LC3A 3OE7D 3IG6B 4OGYA 2EA3A 4I7YH 3P8GA 2IN2A 1O3IA 1BJVA 4J2YB 4MNWA 3TU7H 1A5HA 4BAOB 1B5GH 1S85A 1YBWA 2P94A 2BDCA 1GBBA 1T8NA 3BTKE 2F9BH 3RXRA 1K1IA 2A5KA 1GJAB 2RA0A 3F1SB 4ZKNU 5C20A 8ESTE 1P12E 4AFSA 5F03A 1C5RA 1NO9H 2VIVA 3ZZ4A 4OS7A 1EAUA 1SGNE 1GHWH 2AHME 2DUCA 1NY22 3VB5A 3BTFE 4CH8B 1YCPH 4Q80A 3SNDA 3CP7A 3BG8A 2QAAA 2GVFA 2O8WA 1WXRA 2VU8E 3PO1C 4NG9H 3A84A 4YOIA 1UTQA 4CR9A 3LJJA 1GDUA 1O2SA 4BTUB 1BHXB 3MO6A 2BM2A 5DG6A 3SU3A 1HJ8A 3A88A 3TH4H 1PPEE 2JJ1D 2HRVA 2OTVA 1BTPA 2FOBA 1MABB 1TIOA 2FTMA 4IGDA 1IOEA 4BAQB 1AY6H 4X2WA 1PPCE 2FS8A 1J14A 1TNLA 3DD2H 1K1PA 2QXIA 3GY7A 2JETB 1VR1H 1D9IA 1O3PB 1P11E 1SLXB 1H8DH 1BRBE 4AFZA 1GHAG 1TBQH 4FOUC 1V2UT 5EPNA 5K0HA 3FANA 1MH0A 6ESTA 1ANBA 1ZMJA 1GI0A 3RXQA 1BOQA 2Z9IA 3U98H 1T4VH 1NRRH 3LGYA 4Q4LA 4XE4A 1A0JA 3U8TH 3GDVA 1ELDE 3UQVA 2ZEBA 5GPIB 3MH4A 1C5WB 1HIAA 1XUIA 1OP0A 9ESTA 4WH8A 2H9TH 4I8JA 5PTPA 4WY3A 1EFRD 5E8EH 3FVFB 1D3QB 1HAIH 1SG8B 2ZP0H 3UAIC 5IDKA 1FI8A 1NRPH 3S9AA 1TPPA 2J92A 1TMUH 2QXHA 4JK6A 5KECA 1JRTA 4Q2KA 2HLDD 3KNXA 2BLOA 3P70B 5GJ4B 4U30A 3ZZ7A 1NFYA 2W5EA 3S7HB 3EA9A 1GBHA 5T6GA 4HG6A 4WXIA 4ZKOU 4KTSA 1H9HE 4X2YA 4CRAA 4WMEA 1C1PA 3I77A 1P2OA 1H9IE 1C5SA 3RC5A 1QGFA 3KQEA 2BDGA 1V6DA 4WWYA 4NWLA 4ACBA 1V2QT 1YPEH 4H6SB 2F4LA 1YPMH 3GS9A 3AW1A 1EPTC 1MD7A 1O5GH 1C1MA 2HALA 2VB0A 4Y79A 2THFB 2ZU5A 1D3TB 4NIYA 3PM3A 1KXBA 3RLWH 3S7KB 1C2DA 2F9OA 4JMYA 5AF9H 1ELTA 1UW7A 1EKBB 1NRQH 3FN8A 3UNSA 2L6OA 2XWBI 1O5AB 1SGTA 1FZZA 2VWLA 3ZIAD 2BOHB 1C5ZB 1AFQB 1B0FA 2XCFA 5C0TA 1BDAA 4GPGA 4FUIA 4I33A 1HYLA 4MVNA 3BEIB 1NFWA 3BG4C 4BAHB 3WWBA 2XBVA 3SU6A 3JZ2B 1SSXA 1DICA 1T31A 4KELA 2IOTA 4KGAA 3QTVH 4AB9A 1ZTLA 3M5NA 3MNCA 2BHGA 1SPJA 3AAUA 3BTME 4Q7XA 1O2HA 3ZV9A 3GYLB 3MNBA 5DP8A 2Y5FA 1DWDH 2QF5A 1G32B 1AWFH 1D3DB 3LGIA 1SGPE 3PRBA 2VIDA 3H09A 1XXDA 1BBRK 1A3EH 1AI8H 2WV9A 2FLBH 1ZTKA 5B6OA 1V2RT 1CT4E 2ZPSA 3TK5A 1YPKH 2BVXH 1GVZA 1YCPM 3M7UA 4A92A 1QZ8A 4MLFB 1EAXA 4DGJA 4UONA 1XUGA 3SJKA 1C5TA 4AC9A 4SGAE 1V2MT 1ZGVA 1ZSJA 1UVTH 2ZF0H 3SNAA 1HIAB 3ATKA 1C5QA 2ZDNA 3M7QA 4NSYA 1P57B 3BTQE 2UWLA 3QDZB 2Y5HA 2BDAA 3E0PB 4INHA 1E1QD 1A1RA 3OY5U 1ESBA 3PLBA 2J5UA 3U8OH 2P3FH 5GCHF 1OWKA 3T29A 1B0EA 2RCEA 1HUTH 4TY7A 3MFJA 1RIWC 5E2PA 4E06H 1UVOA 1P2MA 2OC0A 4O97A 4DW2U 2IPQX 1W7GH 1QBOA 1DX5M 3QWCH 2AGGX 1E36B 2OC8A 4DURA 3ZVAA 3F3BA 2ZWLH 2XC5A 5AFZH 3RXPA 2CF8H 1GMDF 3ZZAA 2HPQH 1CGHA 3E0NB 1SLUB 4IBLH 2OQUA 3GCHB 3A7TA 2VIPA 2ZGBH 2WUBA 2ZFQH 1PQAA 3VG8A 1YF4A 2ZQ1A 1DVAH 1S5SA 1DT2A 1IQHA 1G3CA 2BY7X 4ZHAA 1BRCE 3P92A 4QT8C 4X6MA 4NSVA 3FP6E 4ASHA 1GI5A 2ZDAH 1T7CA 1XUHA 1BCUH 2OBOA 4VGCC 1EPTA 1GBEA 3UR6A 1LVBA 1SI5H 4IC5A 1IQEA 4GHQA 1DLEA 1QIXB 1ZJDA 1T8LA 3CS7A 1AD8H 2OC7A 2PTNA 2B0FA 2XOKD 1O2RA 1KTSB 2Z3CA 1W0KD 1GL0E 4ZROA 2XBXA 2BX3A 1C9PA 1C5PA 3P95A 3TJVA 2VNTA 1XKBC 3QX5H 2GDDA 4KP0A 1EJMA 1OP2A 4INLA 4RN6A 4MQAA 1ZYOA 4JYVH 4FU9A 1NC6A 1O2WA 3RU4T 3V7TA 2FOGA 4CR5A 1VCPA 1C4V2 1BMNH 4ABEA 3MO3A 2WPKS 4U2WA 3RM0H 5DO4H 1TGNA 3AVZA 2GT8A 3BTHE 1O3GA 3V12A 2W6JD 1TPOA 1O39A 2ZDKA 2ZDLA 4ABIA 3UQOA 3QGJA 2GD4B 3D23A 3T26A 3OEHD 2OP9A 5C5OA 1FDPA 1BMFD 1O5BB 2FOMB 4IS5A 1QFKH 1EQ9A 3RP2A 3T62A 3TLOA 2SGQE 1C2LA 1ZJKA 2WINI 1SGRE 1S6LA 1G3BA 5DN6D 1EAWA 3OSYA 2PW8H 2BZAA 1ELFA 1GL1A 1HV7A 4JZIA 3MU0A 2I6SA 1P2QA 3PMHB 1UHBA 3P8NA 1C9TA 4LXBH 4WMFA 3SGBE 1VZQH 4THNH 1D6WA 2KAIA 2BD8A 1PPGE 2FX6A 1IQNA 1BQYA 3SI3H 1SGIB 4AG2A 1HAOH 4TT3D 2PUXB 2GV7A 1PQ5A 3DSGA 3SUEA 3LU9B 1DWEH 1W11U 1QB6A 1O2QA 2Y5GA 5FX5A 3EQ0H 3GDSA 1CE5A 2G4UA 5HYOA 2PP6A 1N1LA 2WPIS 1OSSA 1M9UA 3RXIA 2BD3A 1Y59T 2A45B 4CHAB 4YLUA 5DJ7A 5JYIA 2NU2E 1TX7A 1C1WH 3ATIA 2R3YA 4A1VA 2JJ2D 4MPVA 1DY8A 1GBTA 3H5CB 2FWWA 1ZLRA 4I32A 4TWYA 3O8CA 1CSOE 4DIIH 1MTNC 3U8RH 3PV2A 3M61U 2C93B 4AORA 4ESTE 1JIRA 4K1EA 2FM2A 4I86A 4NA7A 1E35B 2F83A 3VFEA 4YT6H 2VIQA 2CMYA 2Z94A 2WPMS 1WU1A 3A8CA 2UUFB 1H9LB 2BOKA 2CGAA 3EA7A 1Z6EA 1S0QA 4IW4E 1MAXA 2R0KA 2SGAA 1MTVA 1SOTA 5FPSA 3ZVCA 3F9EA 4B75A 1SMFE 2JH5D 1YCPK 1CT2E 1MKXK 3RC4A 4E05H 7GCHF 4NIXA 2QN5T 2XXLA 1O2YA 1TX8A 4FUFA 4YESB 1HAPH 1DUAA 3RXJA 3N7DA 1L1NA 3SBKA 1GJ4H 2ESTE 3RXLA 4X1SU 3VB4A 1NM6A 2ALVA 1SGCA 5HMAA 1UTKA 1G3DA 2GMTC 2KFWA 1O2JA 2GGVB 4FUDA 3PTNA 3SJ8A 5EIYA 3FP8E 3S69A 3E3TA 1NU7B 3U28C 1QL8A 3AASA 2GJGA 1FJSA 3QUMP 3LGWA 4WJG2 1TOCB 1A2CH 4JZEH 4M9FA 5JB8S 2FESH 3SUFA 1EP6A 1O5FH 4NGAH 2D1JA 3DUXH 4B73A 2CJIA 1LKAA 1P2IA 3E90B 1EX3A 3QGNB 1O2IA 1O5CB 1UTPA 2ZU3A 1VITF 3NK8A 2ASUB 1ANDA 1N6XA 3BG4B 5H4IB 3SJ9A 1ELGA 5GCHG 4VGCB 1TGSZ 1ZZZA 4ZCNA 3FKSD 1QJ7B 4OS4A 1HAVA 3U1JB 1KSNA 1W10U 1BB0B 1GG6C 1THRH 3RXHA 3BEUA 1UVPA 1O31A 3TK9A 4AOQA 1TRYA 3TGJE 1ZGIA 5DKMA 1BZXE 1BJUA 1E38B 1COWD 3A80A 2EI6A 2FXRA 5F8XA 5C1XA 1TPAE 1HDTH 1MBMA 2XTTB 3U1IB 2G5NA 4H42U 5CHAC 1O3NA 5T1VA 1TNJA 2CXVA 1BBRH 3BIUH 2KCOA 1FIWA 2A32A 2C8XB 3RXKA 1ACBE 1LCYA 4HI3A 5L2YH 4Y6DA 1YPHE 3VXFH 1EB1H 1TQ0B 2YOLA 3NKKA 1O3CA 1HAYB 2B9LA 3GY3A 1ABJH 2A5AA 2ANYA 4FUHA 4B2BA 4F55A 1IQKA 1WQVH 2HNTF 1JOUB 2RDLA 1FQ3A 1HAVB 1W14U 1OYQA 4ABDA 3SUDA 1XUKA 3HGPA 3NCLA 4UFEH 5TJXA 4TYDA 1UMAH 3MYWA 2Q6FA 1UVUH 1XVOA 1RS0A 1S81A 1NPMA 1SFIA 2ZFPH 3BV9B 2BXUH 2OK5A 1BTUA 1SHYA 5AFYH 2K8IA 1NESE 3U69H 4D8NA 1VKYA 1K1MA 4K1SA 3PLPA 2WZQA 5JBCS 3TH2H 1NFUA 1EZXC 5EQQA 3RXGA 3QN7A 2FZZA 3V0XA 1K1JA 3RXOA 1UTMA 3L6PA 2JH6D 3DSOA 4CBNA 3ZZ6A 3QO6A 3GYMA 1P3EA 2P3TB 5E0GA 1C1SA 2BLWA 4XRNA 1BTZA 4CRDA 4GUXA 3HPTB 5FAHA 4X8VH 2Y6TA 2ZHWH 4LZ1H 3NXPA 3LKWA 5F8ZA 1RTKA 1GCDA 1P05A 3TGKE 5JPMH 3SV8A 4X2VA 1P9UA 3A82A 1GHVH 1Y3XA 1QBVH 2VWOA 3T27A 2VBCA 3K6ZA 3UB0A 1QJ1B 4X0WU 4LOYH 4R0IA 1C1QA 2A4OA 2K1QA 1BRAA 1O2GH 1QTFA 2FOAA 4MTBA 2Z7FE 1SGEE 1O2KA 1O3DA 4K2YA 4B2CA 3A89A 1CHOG 4RI0A 4Q7YA 1ZTJA 1V3XA 1ARBA 1RTFB 4ABGA 1OYTH 5EJ1A 5GDSH 1HAZB 2V3HH 1TPSA 1XMNB 3CS0A 3PMBB 1QR3E 2PV9B 1H8IH 4GHTA 3C1KA 3ZZ3A 4F4OC 4BAMB 1QB1A 1QA0A 3M3VA 4I31A 1XM1A 1NROH 1O2MA 2OCVB 1T32A 4ISNA 1WTHD 2J94A 1GI8B 2ULLA 2Z9GA 1V2KT 2BDYA 1DXPA 1JXPA 2H9EH 1PQ7A 1G2MA 1O2UA 3N99A 5GIBA 3Q77A 1KTTB 2G4TA 1W3CA 5C1YA 4JYUH 1HXFH 2ZQ2A 5EOKA 1HPGA 1FY4A 5EXMA 4BANB 5HKKD 3S9BA 2TIOA 1L1JA 5FPTA 1CO7E 3PMJA 3BTDE 1UHBB 3DSPA 2EC9H 3EE7A 1GI3A 3T5FH 4Z0KA 1A0LA 1QL7A 2XNDD 2F9NA 1TNIA 1OXGA 3T25A 2C90B 1LVYA 1AQ7A 2H2ZA 1BTYA 3KN2A 5FBIA 3VEQB 2PKAB 2VIWA 2CV3A 4ABBA 4NIVA 1XUFA 4AX9H 2BY9X 1C5NH 4MDSA 5DP6A 1GDNA 1XX9A 1FAXA 3MU4A 4MPUA 1BTHH 4JZFH 1VITH 5F53A 1ELVA 1GGDC 2AMQA 4ACAA 4OGXA 1P10A 5EQRA 1F0UA 2EQNA 4MPWA 1NTPA 5HGGA 1AWHB 3BN9A 1QQUA 4X1RU 4X1NU 2ZCKP 4MG3A 5GWZA 1GI6A 2NU3E 1CBWC 1ZSKA 2R2MB 1ELAA 1RFNA 1V2WT 1WDIA 1WTGH 2Q6DA 1Y3UA 1DOJA 2NU0E 1TX6A 2GZ7A 2Y81A 1OWHA 3R3GB 1IQGA 1Z71A 5DPAA 1FNIA 1BT7A 4ASUD 1OKXA 2ILNA 4B6FA 2FDAA 2PKSB 1Q31A 2KR7A 4WF8A 4XDEA 1PFXC 1QNJA 4GAWA 1IHSH 2ZCLP 1C2EA 3SZEA 2ZFRH 5I25A 1TGTA 1O2TA 3URDA 2JKHA 1O2ZA 1AUJA 5EXLA 3BEFB 2WPHS 1P9SA 3PWBA 1HJAB
chains in the Genus database with same CATH topology
3ZVDA 4CRCA 4M7GA 4FXGH 1NFXA 1S83A 2P95A 1HB0B 1V2ST 1Q2WA 1ANCA 5EGMA 1TQ7B 2A1DB 3SOSA 1BHXF 1H4WA 5LH8A 4BNRA 1YC0A 2O8MA 1CGJE 3NPSA 5JBBS 2STAE 2Q6GA 3M5MA 1AIXH 1DSUA 1K21H 1RXPA 1TRNA 2H6MA 3PLKA 4X8UH 3SJOA 3ATWA 3E1XB 6GCHG 1SOZA 2ZHFH 4GLYA 3SORA 2O8LA 4OS6A 4JCNA 1LHCH 2ODYB 3DFLA 2AGEX 5CE1A 1L0ZA 1UO6A 2ODQA 4UD9H 3M37A 1N6YA 1J16A 4NFEA 1QURH 1KXFA 1G36A 2BY5X 3BTEE 1L4DA 1SQOA 2F3CE 2TBSA 2PSXA 2V0BA 4ISIH 1HRTH 5T6DA 3VXEH 3EGKH 1V2OT 3IWMA 4ZUHA 1FN8A 3W95A 2GTBA 2ZU1A 1N8OC 1AMHA 1SLVB 2ZZUH 5CHAB 1C2HA 1UTNA 1FIZA 2G51A 2DE9A 1RIWB 2IJOB 2H5DA 4MPXA 1B7XB 2WYGA 2TGAA 4FU7A 3LGVA 3DHKH 4B74A 3W94A 2FI5E 2XBWA 2FOEA 4MNYA 2TRMA 2A31A 2XYAA 1O2XA 3K2UA 1GHYH 1O38A 4YOJA 1FN6A 2ZGHA 1SR5C 1ZMLA 1LTOA 3GY6A 2AERH 1QBNA 3CENA 4H4FA 1GBMA 5A8ZA 1HJ9A 2VVCA 1GJDB 3RMLH 1GBFA 4KKDA 4TPIZ 4AB8A 5A0BA 5F6MA 1PPZA 2PLXA 4HTCH 3SJIA 4BAKB 1CA0C 2ZHEH 3RXVA 3TITA 3OTJE 3TJNA 3Q3XA 2V3OH 1ABIH 4X6OA 3FP7E 4X1QU 1Z8JB 4X1PU 2P93A 1PYTC 3Q76A 3PO1B 7LPRA 1OWJA 5DP4A 2ZCHP 2ZIQH 3A81A 3KF2A 4WMDA 3O8BA 1SQTA 2GZ9A 3A83A 1ESTA 2R0LA 1SL3A 4DVAU 3SGQE 4E7RG 3TK6A 3RMOH 3ESTA 1TBZH 1YLCA 1A5IA 1TABE 2P59A 3A87A 3ATMA 1C1RA 1O37A 1ZSLA 2RA3A 1VGCC 3K9XB 3RLYH 3VB6A 1DPOA 1ZRKA 4KTCA 1F7ZA 1THSH 4CH2B 1F2SE 1ZOMA 1ETTH 8GCHF 5JBTA 1X7AC 1QRZA 2HNTE 2XC0A 4IC6A 5SGAE 3UNRA 1ZHPA 1F92A 3PB1E 3DFJA 2AYWA 3NWUA 4D9QA 2ALPA 2BLQA 4NIWA 1C2GA 1VJ9U 2QA9E 3SV6A 4D76A 1EB2A 4YT7H 1NS3A 3C27B 2ZDMA 2UUYA 1Y5UT 2ZC9H 2ZGCA 2A7CA 1CQQA 5FX6A 2GMTB 3RXFA 4FUBA 1DY9A 3P6ZB 3LONA 1IQLA 3ITIA 1WAYB 3GY8A 2TGDA 3V13A 3H7OA 3ZVGA 4UFFH 1SC8U 2V35A 3L33A 4MNXA 1FPCH 8LPRA 4I8LA 3MU5A 2OC1A 4RKJB 1RRKA 1QA7A 4JZ1A 4D7FA 4U01A 4YTAA 1OPHB 1PYTD 1OS8A 2HPPH 1XUJA 1GCTB 1J17T 1W0YH 1G2LA 2EEKA 1NU9A 1OWIA 4Y76A 1O3AA 1C5LH 4A1TA 4DIHH 1T8OA 5FHTA 2PWXA 4O03A 3SI4H 4FVDA 1MKWK 1GHAF 2C8WB 1UCYH 4NCYA 3LGUA 3UIRA 1O3EA 3M3TA 4CHAC 1BMAA 1AVGH 2RG3A 3GY4A 1ESAA 1UK4A 1QRXA 1JWTA 1MMJN 3U9AH 2FOHA 1TNHA 1SVPA 1UK3A 2BTCE 3ENSB 4AYYB 1BTWA 3M36A 1W12U 2H1UA 5LPEA 2EI7A 2SGEE 1GMCF 2ZI2H 2P3UB 2VINA 5EODA 1K22H 4I8HA 5CMXH 3ODDA 5G4BA 2BY8X 2V6NA 1QJ6B 4CRBA 1S84A 4DCDA 3SQEE 1GGDB 6CHAB 1P01A 2WPLS 3DA9B 3Q3KA 3P17H 2G55A 3RDZA 1W2KH 1UVSH 1DE7H 3KGPA 1K9OE 1WSSH 2ANWA 1GJ5H 3GCHC 4ZKSU 1C1OA 3TJUA 5FCKA 2EI8A 1OP8A 2GT7A 4BXSA 1YPHC 7KMEH 2Y7ZA 5DP7A 3FZZA 1C2MA 5LPRA 3AW0A 1G9IE 1AE8H 1P04A 3L3TA 1C5VA 4DOQA 1UJ1A 1EXFA 4A6LA 1GCTC 1LHDH 1SB1H 3P8OA 2ZFFH 1Z1JA 2JH0D 2W7SA 3TVJB 3A7YA 3OY6U 1GI2A 1DLKB 2P16A 1HJAC 1ZPBA 4DJZB 1MTUA 4Y7AA 2BDHA 1CA0B 2QXGA 4JYTA 3MWIU 1F5KU 1GPZA 2BDBA 3M5LA 1FONA 3UOPA 2FTLE 1JRSA 1P8VC 1BMMH 4I8KA 3PMAB 1AHTH 1WUNH 5E2OA 1C4Y2 5EXNA 3BF6H 2GCTC 3V3MA 2BLVA 2Y82A 3HKIB 3HK3B 2Z9KA 2QYIA 1O3MA 1QQ4A 4B76A 3ZZ8A 3QTOH 1GHBG 5I46H 1INCA 3HKJB 1MCVA 1TALA 4SGBE 4Z6AH 1MU8B 4X6NA 3QLPH 4F49A 3Q00A 1O35A 1WOFA 2UUJB 2H9HA 2AEIH 1E37B 3FZDA 4YZUA 2XW9A 2BD4A 3ELAH 1ZMNA 3QK1A 1S82A 1OOKB 1Z6JH 3OU0A 1GHXH 2Z9LA 3ATLA 4K60A 4Y71A 1AFEH 1O2LA 2PKAA 2SGPE 4B2AA 2QV1A 2ZFTA 1Q3XA 1C5OH 2F9UA 1ZPZA 1IQIA 1LO6A 3RM2H 3VPKA 3MU1A 2A4RA 1IQJA 2QF0A 1PQ8A 2BD7A 2D8WA 1LPGB 1PPFE 1UTJA 2FMJA 1TMBH 4INKA 4NA9H 2VWNA 2ZG0H 3MU8A 1TNGA 2A2QH 2PGBB 1AB9B 1O33A 1SHHB 4HGCA 2NWNA 4KTUA 1TAWA 3I29A 1DITH 4O3UA 4Y0ZE 1ZHMA 2ZPRA 1MTWA 4BOHA 1AFQC 1YPLH 9LPRA 3UWJH 5EQSA 4WXVA 1P03A 2VWMA 8KME2 2ZU4A 1AGJA 1TRMA 1LMWB 1YLDA 2Z6BD 3F9FA 4O9VA 5TCAA 4IMQA 2DE8A 1DM4B 3NZIA 5BPEA 1QY6A 3B23B 3UY9A 2OINA 1A0HB 2KAIB 4FUEA 1P2NA 1SGQE 1RTLA 2A2XH 2ZNKH 3N7OA 3EAJA 4AN7A 1GI7B 3SU2A 2HLCA 1OWDA 2AGIX 1CBWB 1S0RA 2GCHG 3RU4D 1EAIA 2PGQB 4B71A 3LOXA 3T2NA 5C67A 2NU1E 1C2FA 4ZH8A 1CVWH 3F6UH 3SZNA 1KLJH 1BA8B 1S6HA 1YPJH 3ZVBA 3EDXB 2G00A 4I8GA 3M35A 2HWLB 1QB9A 1C4U2 3KL6A 1Z1IA 3S9CA 2CF9H 3SO3A 2J9NA 3A86A 3SU5A 5C3NA 2BD2A 2OQ5A 3PYHA 3GY2A 2ZTZA 2LPRA 4GVUA 2C4FH 3JZ1B 3STJA 4ZKRU 1Y5AT 1YPGH 1KXEA 5DP3A 3OX7U 1A4WH 3PV4A 1AE5A 3KCGH 3ZV8A 1MTNB 4O3TA 1LVMA 3H7TA 4ABFA 4NA8A 1MU6B 2O9QA 3SU4A 1DS2E 2OXSA 1PJPA 1UTOA 1GHBF 3EE0B 3RC6A 1GBIA 2R2WU 1O0DH 4ISOA 3GCTF 1GI9B 5E0HA 3S0NA 5L30H 3A7VA 1WYKA 2H5CA 3K65B 1C2KA 1G37A 1O36A 1O2PA 2BDIA 4GCHF 2R9PA 4K8BA 2ODPA 1P0SH 1QCPA 1A61H 2FLRH 1P3CA 1TB6H 2C8YB 1DDJA 4Y7BA 4ZHMU 3GCNA 1DWBH 2XC4A 1HBTH 2XCNA 1C1NA 1CA8B 2SNWA 1V2TT 4OS5A 2W3KA 3MTYA 2P8OB 3BTTE 2BMGB 3GCTG 2HNTC 4BTTB 2XWAA 4UEHH 2ZA5A 2GDEH 4DT7B 3GISB 1WBGB 1LHEH 1FLEE 2BB4A 3RUOA 2VVUA 1Y5BT 2A4GA 2GP9B 2R3UA 1EJAA 3GICB 2QC2A 5K7RA 1AVWA 3LGTA 1EATA 1HCGA 1C1TA 2BQ6B 2FI3E 5FCRA 2ZO3H 4OS2A 2QIQA 3HATH 1LKBA 3GDUA 2FI4E 1K1OA 3A7ZA 3F9HA 3KQCA 2SGDE 2PTCE 1TNKA 4UE7H 1CT0E 3SQHE 1YGCH 1TA2A 1GVLA 1UTLM 3HK6B 4RSPA 1WCZA 1W13U 1BTXA 1SGFA 5DGJA 1ZPCA 1F0TA 3ZYEA 1ETRH 3EA8A 4X8TH 4A1XA 1O32A 2PUQH 2Q1JA 1LPZB 5LGOA 6LPRA 2QF3A 1C5MD 3PWCA 1RJXB 2ANKH 3ZZBA 1TA6A 3FFGA 1J8AA 3BIVH 4BTIB 2J95A 2D26C 1C1VH 1W7XH 1AKSA 4CRGA 3KEEA 4XSKU 2TGTA 2VH6A 2GCHF 1SLWB 5AHGH 1CGIE 1F5RA 4H6TA 5EG4A 1Z8GA 2VGCC 3DT0H 2AIQA 1GJ7B 5EPYA 2J34A 1DXWA 2C3SA 2J4IA 2FYQA 1OX1A 2CN0H 1O5EH 2GKVE 3LDXH 4FUJA 2PFEA 3NUMA 1EZUC 1C2IA 5DP9A 3P8FA 1O3HA 3G01A 1K1LA 1RGQA 5C2ZA 4R8TB 5JDUB 1DUEA 3E8LA 1GMDG 1GJBB 1NRSH 2BXTH 3RXTA 2F9PA 3ZZ9A 1MZAA 3UPEA 1EOJA 5EW2H 2FO9A 2AS9A 1RD3B 1MCTA 4YO9A 3RU4E 1IHTH 4X6PA 1K28D 1O5DH 3SU1A 1DFPA 1KXDA 5T6FA 2CHAC 1O3JA 3GY5A 1T4UH 3ZZ5A 2XRCA 4XFQA 3BSQA 2FP7B 1GMHG 1YYY1 4NZLA 3RXMA 1FXYA 4ZMAH 2QCYA 5GXPA 5HM9A 2WV5A 1XVMA 4FUGA 3RMNH 3T28A 1Y8TA 3SW2B 3A7WA 3MOCA 2OUAA 3WY8A 1GBLA 3A8BA 4GCHG 1VCWA 4ZXXH 1GHZA 1H1BA 5EW1H 1LHFH 1TGBA 4YOGA 1IQMA 1GJCB 1O3KA 2AIPA 4D9RA 1TMTH 1VGCB 3MHWU 1V2VT 3TNTA 1GI4A 3ZZDA 3SU0A 3SN8A 1KDQA 2OD3B 4AGKA 2WYJA 3STIA 1ELBA 1NN6A 3SV2H 3VB3A 5F8TA 3RXSA 1PPBH 4AZ2B 1F0RA 1SBWA 1V2PT 3MNXA 2OLGA 4NWKA 5A2MH 4ISLA 3RMMH 5EU8A 1SGYE 5A0AE 1L4ZA 3BTGE 5HM2A 1ANEA 2UUKB 3SUGA 3RXUA 1AVXA 3Q3YA 1E0FD 3LPRA 4U32A 1MKWH 2WUCA 1Y3WA 2ZFSA 5AVDA 1YM0A 1TONA 2ZTXA 1SGDE 1BUIA 3M7TA 3RXBA 1O3BA 4RKOB 1A46H 2FS9A 1KYNA 3MNSA 3SHCH 1QL9A 1KIGH 1FUJA 1MD8A 1GDQA 1KDQB 3EYDA 2M5TA 1NRNH 4JK5A 4AFUA 2AFQB 1Z7KA 4UDWH 4AG1A 2ZPQA 1V2JT 2G52A 2XNIA 2TPIZ 1Z8RA 2FYRA 3MMGA 1VITG 3ZZCA 1WQSA 3KIDU 1TGCA 5LPFA 2FX4A 4WVPE 4ABJA 4AGJA 1V2NT 1FMGA 1GI1A 4IMZA 1AZ8A 3BTWE 2VH0A 4XBDA 1AO5A 2AMDA 2XBYA 4IN1A 1E34B 2HGTH 2SNVA 1ZR0A 2FPZA 2O8UA 2BQWB 4XBCA 3E6PH 2J38A 1GMCG 3SHAH 1JBUH 3F68H 3RXCA 4K5ZA 1P02A 3E16B 5ESBA 2FOCA 1J9CH 2B5TB 1GVKB 2BVRH 1O2VA 1QHRB 1TLDA 1KLTA 1ZHRA 3R0FA 1GWAA 1MBQA 2VVVA 4UFDH 3B9FH 4E7NA 3LH1A 1D4PB 1AU8A 1MUEB 1GBKA 4K3JA 4CREA 1IQFA 4Y10E 2GZ8A 1GBJA 5E0JA 1KLIH 7GCHG 2A0QB 2B8OH 2BD5A 1MKXH 1LPKB 3FAOA 1BIOA 1EZSC 1NZQH 1A7SA 1L1GA 1HAGE 2VGCB 4Y8ZA 4ABHA 3IITA 4Y11E 5DP5A 3M5OA 1HNEE 4Y0YE 1L2EA 2FEQH 2C8ZB 6GCHF 1OWEA 2VIOA 4X8SH 4AYVB 1UCYK 3SNCA 2WV4A 3TJOA 2OBQA 1GJ9B 4A5TS 1V2LT 5IYTA 1O34A 5FXLA 1EP5A 1Z8IB 1W8BH 3D65E 3MH6A 3OYPA 1N8OB 3UWIA 1MAYA 2Y7XA 1AKSB 4ZXYH 2Y80A 5ESTE 2ZU2A 2HOBA 3MH7A 1C1UH 1LQEA 1BBRE 1TYNA 1LQDB 2LNCA 1U6QA 1DSTA 1EZQA 3AAVA 1ARCA 1C5XB 6CHAC 1K2I1 5L6NH 1ETSH 3TH3H 3TGIE 4X2XA 4YLQH 1SGFG 1HGTH 3F9GA 3UR9A 3RXDA 7ESTE 4B1TA 1D6RA 3TNSA 1MQ6A 2F91A 4NFFA 1MTSA 5J4QA 3KHVA 1JIMA 3VB7A 1J15A 2ZKSA 2UWPA 3RXAA 2W7UA 3UTUH 1ELCA 3ZYDA 1PPHE 4K1TA 5DK1A 2QXJA 1YKTA 1DANH 3UUZA 1JMOH 1KY9A 4MNVA 2FOFA 2NU4E 4YM9A 5A0CA 3KQBA 2GCTB 1XXFA 1UCYE 2GV6A 1KXAA 2G5VA 1ZRBA 2AH4X 1AB9C 1G3EA 1P06A 4Q7ZA 1S6FA 1GBDA 3MH5A 2O8TA 1THPB 5JB9S 3QZRA 1IAUA 4TPYA 1BITA 1A5GH 1K1NA 2A5IA 4ISHH 5JBAS 1EPTB 1AUTC 1FY3A 1O2OA 3K6YA 4TY6A 2IPHA 1T8MA 1TWXB 2SFAA 2BD9A 2BVSH 4Y8YA 2FIRH 2A4QA 2ZECA 2ZGJA 3O8RA 1KXCA 3SNBA 2QY0B 4J1YA 1LHGH 3SV7A 1TOMH 1HAXB 1A3BH 1GMHF 3A7XA 3SV9A 1C5YB 3LC5A 2A7HA 4TWWA 1EASA 4HZHA 4GSOA 1WV7H 2GX4A 2FODA 1ORFA 2J2UA 1CHGA 3SNEA 2BYAX 4FUCA 1EUFA 2ANMH 1GBAA 1MZDA 1O3OA