1UTQA

Trypsin specificity as elucidated by lie calculations, x-ray structures and association constant measurements
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Trypsin Specificity as Elucidated by Lie Calculations, X-Ray Structures, and Association Constant Measurements
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords TRYPSINOGEN
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1utqA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1utqA02
2FO9A 3LKWA 4FUHA 1LTOA 4OS4A 1C2GA 5FHTA 2AEIH 3Q3KA 2WPMS 1XUJA 2SGDE 5EQSA 1QBNA 3AAUA 3HK6B 3U9AH 1GBMA 1O2IA 1AKSA 1JBUH 4WH8A 1C5UA 3R0FA 1DUEA 1DY8A 1LPZB 2BDYA 1HDTH 3O8DA 3PMBB 4YLUA 3UQOA 8LPRA 1ABIH 2ZHQH 1P2MA 1O2YA 3SHAH 3EDXB 2WPLS 1TQ0B 1V2WT 1DX5M 2FOAA 3TU7H 4BTIB 1GI3A 1EB2A 4AGKA 1FPCH 1EOLA 3SW2B 2ZQ2A 4CRDA 3ZVDA 1VITF 1O2PA 2P3TB 2WUBA 3GDUA 1NRQH 1WOFA 1HCGA 2ZEBA 1C5LH 1BTYA 5SGAE 1WTHD 3OX7U 4LOYH 3ZV9A 1FY5A 3FVFB 4R8TB 5FX6A 2O9QA 1O2HA 5DKMA 1WCZA 1GI7B 3STJA 3SU0A 3BV9B 1BRCE 2FMJA 1BQYA 3ZZ8A 4FXGH 1C5OH 2OINA 1ZHRA 3ESTA 2ZWLH 1EZQA 3GCHB 1EPTA 2GZ7A 1NU9A 1YP9A 1E37B 1GBKA 2EC9H 3O8CA 4NSVA 2FIRH 1VITG 2Q6DA 1NROH 1D6WA 4FU9A 2QA9E 4MPVA 1C5NH 3BTFE 4ABIA 2UUYA 3RXQA 3VEQB 2G4UA 4XE4A 1QHRB 1G37A 1DWCH 1GJ6A 1O5FH 1AY6H 4NSYA 5EW2H 1XVOA 3I78A 2GT7A 1S6HA 1ZHMA 2VGCC 2A7HA 3GY4A 5C5NA 4Y76A 3RU4E 3MU4A 2HNTE 2XYAA 1EAIA 4XBCA 1Z8JB 4CR5A 2LPRA 3QN7A 2CJIA 3GY6A 3S9AA 3ATWA 5DP3A 4F49A 2GVFA 2QXHA 1PQ7A 5K7RA 5EGMA 3GCHC 3LGVA 2CF9H 4WY3A 2VIPA 1LO6A 2ANYA 1FZZA 3IWMA 3NZIA 2ZI2H 3SUGA 1EXFA 1NFUA 4UFEH 2FODA 1A46H 3MHWU 2H9TH 2XRCA 1O2VA 3RXBA 2A4GA 2XCFA 4WVPE 2ODQA 1P0SH 2R9PA 4UFDH 5ESTE 5GDSH 3WY8A 1WQVH 4U32A 1QJ7B 1T8NA 2QXJA 3VGCB 1SMFE 2ZCHP 2Q6GA 1THPB 1V2ST 1K2I1 2JETB 4F4OC 1HAXB 1KDQA 1JIRA 4K1SA 1TRNA 2BD9A 3EYDA 1T8LA 3M7UA 3TNTA 1W7GH 2BOKA 3UIRA 4SGBE 1ANCA 1GMDG 3QTVH 2P8OB 1UCYH 4Z0KA 2R3YA 2FLRH 1EAWA 1PQ5A 4NWKA 5A0AE 4JZEH 1FAKH 4OS5A 1G3CA 1QJ1B 2J2UA 4Y79A 2C93B 3LH3A 1DM4B 5DP5A 3A7ZA 1Y5AT 4IMZA 1LDTT 5LH8A 4NIWA 4KGAA 2ODYB 1P3EA 1L1JA 3MNCA 1INCA 5L2YH 1O2SA 3U8OH 1C1RA 1YKTA 1ELFA 2QXIA 1XMNB 3QTOH 5JDUB 3E6PH 3RDZA 2JETC 1ZTKA 2WV4A 1IHTH 2BX3A 2BD8A 2F9BH 3PLBA 3MU8A 4H4FA 1CGHA 1O5AB 1AE8H 1MCTA 1LKBA 3KL6A 4NIYA 3QGJA 1GI8B 1YLDA 1WV7H 4X8UH 3MU0A 3SV8A 3UWJH 3OSYA 4O3UA 2Z3EA 2ZC9H 4NIXA 1DSUA 3L6PA 1DY9A 1AQ7A 1KXAA 1MBQA 4FUJA 1KXBA 3U98H 3TJNA 2Z9IA 3E0PB 1SOZA 1NY22 3CS0A 4Y8YA 3D65E 4INHA 1SGRE 2EI6A 1GJDB 1WTGH 2OUAA 4WMDA 1J8AA 1BTHH 1C1TA 1B7XB 1YBWA 1FUJA 1TBQH 2ZU2A 4TYDA 2VWLA 1IQEA 1OS8A 3RM2H 1SI5H 2TBSA 2CXVA 3NKKA 1K1LA 2A1DB 1CO7E 4MNXA 2V35A 4FUEA 3BG8A 5DP7A 5CHAB 1MMJN 5LPEA 1AWHB 3RXKA 4B73A 4A92A 4A1TA 3RM0H 3HGNA 1BTZA 5F8TA 1MAYA 1D3PB 4ABAA 1XUIA 5PTPA 1AN1E 5IYTA 5CMXH 1MTNB 1NTPA 2ODPA 4NG9H 1O38A 2HVXA 4XFQA 1F5LA 1O37A 1W3CA 1ZPBA 3PMAB 2W3KA 1AMHA 1S5SA 4X6NA 2FOBA 1TMUH 1SLUB 1A5IA 3E91A 2B9LA 2F9PA 1NO9H 1C1VH 1O3CA 1G3EA 2TGDA 1HUTH 2G00A 3GY8A 3OU0A 1JOUB 4GHQA 5CHAC 3DD2H 3UOPA 1CU1A 1G2LA 2ZG0H 4X1PU 1IAUA 1IQHA 1PYTD 1E34B 1CT0E 1QURH 1OOKB 2AS9A 5DP6A 1S0QA 1OWDA 3V13A 2SGEE 1YPHC 1O39A 4FUBA 3UNQA 2GZ9A 5GJ4B 1ZRBA 3TGKE 4GCHF 1GMCG 1LHFH 3T25A 2ZTXA 2RA3A 2NU0E 3LPRA 2Z9KA 4GAWA 2ZHFH 1TX8A 1QB9A 1J14A 3RXIA 3GOVB 5E2PA 2UWOA 2HRVA 1EUFA 4ZMAH 1CT4E 1XUFA 3ZVEA 1NU7B 3U8TH 4DW2U 8GCHG 2BLWA 1W0ZU 2H1UA 3A89A 1J17T 1AE5A 1NT1A 2ZU4A 2QAAA 1K21H 5T6FA 4INLA 5LPRA 2A4OA 1OWEA 1UCYK 2VNTA 2BXUH 3SZNA 1B0EA 1SHHB 1UK2A 4HFPB 2IOTA 2C90B 3VB6A 1XVMA 4YOIA 1Z1JA 5HXFA 3PTNA 2ANKH 1NRRH 5L30H 1YC0A 1TPSA 2BOHB 1CGJE 1T7CA 1XXFA 4ASHA 1MTWA 3MOCA 1THRH 1TA2A 1AHTH 2UWPA 2QC2A 1RTKA 2PWXA 3ZVFA 2OCVB 4UD9H 1C2EA 2HOBA 1ZHPA 2GCHG 1PPHE 3ZZ4A 1C1MA 1KSNA 1J16A 1AVGH 3F9FA 1J9CH 1HJ9A 3F9GA 1SFQB 5FCKA 4FUGA 1HYLA 2BDIA 1S81A 1K1OA 1UVOA 1GBLA 2EI7A 2ZNKH 2AIQA 3A80A 2CGAA 1HAVA 3LGTA 4X8TH 2GZ8A 1S83A 4I32A 2F9VA 4SGAE 2RG3A 4JZDH 3EQ0H 2FX4A 2VVCA 5TJXA 4YOGA 2D2DA 1F0RA 2BD7A 1H8IH 3HATH 1GMDF 4ISLA 4Y0ZE 3BTHE 3LH1A 2BX4A 1SGPE 4RKOB 2PR3A 3QZRA 1ZPZA 3VB7A 2J34A 1BBRK 1YPKH 1MUEB 2VINA 1GWAA 4FU8A 4JZ1A 4H6SB 4JK6A 3RC6A 4NFEA 3CENA 2P93A 3PTBA 4MPXA 1WQSA 3KNXA 2ZPRA 4MG3A 1YCPM 2QF0A 1SSXA 4GVUA 4X6MA 4X1QU 5E0HA 3SORA 1O3OA 3P8NA 5AFYH 2O8WA 3TK6A 1W14U 1ZMNA 1GI4A 3U1JB 3SOSA 4HZHA 3G01A 2FDAA 1L1GA 1HAOH 2DUCA 1PQ8A 4OS1A 1E0FD 3OYPA 4FUDA 1BTPA 2ZGHA 3ODFA 4FUIA 1OPHB 4YESB 1HAVB 2FOEA 1B5GH 1TBRH 1A5HA 2VIQA 1CBWC 2H6MA 1O3AA 1KIGH 1VJAU 1G32B 1K9OE 2RDLA 4OGYA 4R0IA 3BTDE 4K3JA 1ZSJA 2FLBH 1A0LA 3M61U 5BRRE 5HYOA 4AGJA 2THFB 2WPJS 5ETXA 1D3QB 1DICA 4AX9H 3R3GB 2ZQ1A 1F0SA 1ZTLA 1N8OC 1FMGA 1C2LA 1L2EA 1V2RT 4JCNA 1DUAA 1K1MA 4X1NU 2FI5E 1UVSH 1SGQE 4KTUA 3RLYH 2ZFPH 3ZVCA 1YPEH 4B1TA 1BTXA 3CS7A 1TBZH 3KHVA 3MFJA 1RFNA 4ABDA 4TY6A 3RMOH 5I25A 3DA9B 5FX5A 1RS0A 1TNHA 3FZDA 1RIWB 2RCEA 3SJIA 1AUTC 3ZZ5A 1PPGE 3T29A 1Y3XA 2DE9A 2G81E 3BEFB 4ZKSU 1IQFA 2BZAA 5HM9A 3MNBA 2XBYA 4WXIA 5C1UA 2ZFQH 1G3BA 1GJAB 1PPFE 2ZP0H 1SHYA 1EJAA 2ZPSA 1QJ6B 1DPOA 1MQ6A 1NESE 1QL9A 1P9UA 1SVPA 2C3SA 1SGNE 1QRZA 1EZUC 1BB0B 4FUCA 1AZ8A 2ZTYA 4MVNA 1YPGH 1BJVA 1TNIA 2A45B 2FI3E 2UWLA 5J4QA 5DG6A 3QGNB 3SV2H 2TGPZ 3V7TA 4AN7A 1C5WB 4A1VA 5DP8A 2BLVA 2ZKSA 2D1JA 2Y5FA 3VGCC 2YOLA 1EQ9A 1DLKB 3MO9A 3F6UH 3SI3H 3RU4T 1Z71A 2PKSC 1GHXH 2TRMA 3M5OA 3LGUA 3ZZCA 3MO6A 3EA8A 4K5ZA 5FBIA 4JZFH 1Q3XA 1TGNA 1P9SA 4AYYB 5EW1H 2PTCE 2CMYA 4Y8XA 3SNCA 3V3MA 2QN5T 2PTNA 5E0JA 4ZHLU 1AU8A 3FP6E 3RP2A 1KY9A 2HNTC 1P03A 1PYTC 2BD3A 2XTTB 1V2KT 4DVAU 2VIDA 1HLTH 2ALVA 2FTMA 2OQUA 2O8UA 4CRCA 2G4TA 1FNIA 1EB1H 1HJ8A 4CREA 1N6YA 4A6LA 3ITIA 1V2UT 3F1SB 1GHAF 2K1QA 1JRTA 1C5RA 4IC5A 1IQMA 3ZZAA 1ABJH 3LOXA 3SU6A 2W7SA 1BRUP 1A1RA 1DFPA 4WMFA 2ZFRH 2GV7A 3P8GA 4DY7B 1TMBH 1V6DA 1LQDB 5AHGH 3DT0H 3VFEA 3SUFA 4NWLA 3HKIB 2BVSH 1CBWB 3PV4A 4ABHA 5HMAA 1GHVH 2PUQH 4CRGA 2XC5A 2FOFA 2GCTC 1TWXB 2VB0A 3DFLA 4WWYA 1F7ZA 1OWKA 2BY6X 1BBRE 4YM9A 1O5GH 1F5RA 1SGDE 3KIDU 1EJMA 3QX5H 2FX6A 4LXBH 1ETTH 1N1LA 5ABWA 1FLEE 2NU4E 5AFZH 3M5LA 1HPGA 1QQUA 3SHCH 3L3TA 3MU5A 1L0ZA 3ZYDA 1D9IA 3ZV8A 3SV6A 1SL3A 2C8YB 4DCDA 3P17H 2BDBA 4BNRA 4CRBA 2GX4A 5BPEA 4ZHMU 2FEQH 4AFQA 5C67A 1BDAA 3HK3B 4O3TA 3O8BA 1C5YB 2KAIA 1GJ7B 1NRSH 3UUZA 1GDNA 1MD8A 1V2NT 2VIOA 3ATKA 3KN2A 4X0WU 4YTAA 2ANMH 2O8MA 1YGCH 2TGAA 3LONA 4D9QA 1QFKH 2FI4E 1V2OT 4CBNA 1UVUH 1W7XH 2G55A 2FTLE 1W10U 2A2QH 2SGQE 3RXJA 6GCHF 1CA8B 2AYWA 1ARCA 3ZZ7A 1MTSA 2ZFFH 1JRSA 1EJNA 1GI9B 2J95A 2SGPE 3PB1E 3M5MA 4BXSA 1WBGB 1G3DA 2EEKA 1CE5A 1DWEH 3LC5A 4Q80A 2BYAX 2R2WU 3RU4D 2OXSA 4K1TA 3RXSA 4ISHH 2Y5GA 2P59A 2BVXH 1DE7H 2F9OA 4D7FA 1TMTH 4K8YA 1O2ZA 2F9NA 2ZHEH 5A8YA 3SJ9A 4O9VA 1GI0A 1Y3UA 1AB9B 1TIOA 1O3MA 3O8RA 1OWIA 3RXVA 2ZGCA 2EA3A 3A8AA 4O97A 1OKXA 2PSYA 4NFFA 3ELAH 3BTWE 3A8BA 1BMNH 4UFFH 3UR6A 1O2GH 4B74A 1DWDH 1YPMH 1OXGA 2YNAA 2ZDVH 1T31A 5AF9H 2HPPH 1TX7A 2XWAA 1X7AC 4Y0YE 3S9CA 3TK9A 2STAE 1PPCE 4RSPA 4I33A 3GYLB 1A0HB 4A7IB 4U30A 1UK3A 2UUKB 2P3UB 1RTLA 1P01A 2XBWA 4AORA 1QRWA 1AUJA 1QBOA 3EA9A 1C5QA 4B76A 1AB9C 1UHBA 1BCUH 3A88A 5T3HA 3RMNH 4ZKOU 1D6RA 1UTLM 2J38A 1GI1A 1GBTA 3PROA 1EPTB 1TNGA 4TWYA 3MH6A 1S6FA 1H8DH 4MPUA 1PPZA 1FIWA 1BA8B 3TK5A 4BANB 1E35B 2AMPA 1P2OA 1ANEA 8GCHF 2J92A 2OC7A 3PMHB 1NS3A 2QV1A 1Z6JH 2UUJB 4FVBA 2FS8A 1GHBG 5GXPA 2QF3A 1IQLA 1MTUA 3Q3YA 2V3HH 2WINI 1RRKA 3F9HA 1O5DH 2O8TA 3AW1A 3KGPA 5F8ZA 1LPGB 2D8WA 1EAXA 2FYQA 5DP9A 1QB6A 5LPFA 3FAOA 1ELBA 4ABBA 5A0CA 2A2XH 3PWBA 1KXDA 3Q76A 3LGYA 1NFYA 1ZYOA 1H9IE 4YLQH 4BTUB 2JH6D 3OY6U 1AKSB 2WYGA 1O5CB 1O32A 1Z8IB 3A7TA 2ZA5A 1ZMLA 2FM2A 1BUIA 4D76A 2BTCE 1HB0B 2I6SA 3V12A 1TB6H 1IQKA 4NIVA 3Q77A 1UTNA 1WYKA 3C1KA 3F9EA 1K22H 4KELA 2BMGB 1ZZZA 1HJAB 4HI3A 3DUXH 1TRMA 2D26C 4AG2A 5FAHA 1ID5H 1LHCH 2FZZA 3M5NA 1GGDB 3ATMA 3SV9A 5EQQA 1CHGA 2CV3A 1GDQA 4IN2A 1QY6A 2HALA 2ULLA 3KF2A 1C5SA 1H1BA 1C2IA 1YCPK 1ACBE 1SGFA 4WMEA 3BF6H 1KLIH 3S69A 1BHXB 4Q7YA 4CBOA 1EP5A 4I8KA 4TY7A 4YT6H 5C20A 1ELDE 4I8JA 2C8ZB 3SU1A 2GP9B 3TJVA 4AB9A 4ZKNU 2JKHA 2A31A 2PW8H 2OLGA 1P57B 1T4UH 3F68H 3RXDA 4K1EA 2VVVA 1O2XA 3RXCA 5GWZA 1CA0C 1RXPA 3E0NB 2VH0A 1RTFB 3BEIB 5FXLA 4JYUH 2GD4B 2H5DA 1C4U2 1NPMA 1O2UA 1RIWC 3A81A 1L1NA 1KYNA 3BTEE 2AMQA 2C4FH 1LCYA 1GJ8B 2XBXA 3S0NA 1MKXH 1C9PA 4Q2KA 3RC4A 3I77A 2GTBA 3ZVGA 4H6TA 3BTKE 4X2VA 3T2NA 5LGOA 2GCTB 2A4RA 1TONA 2W7UA 2ZF0H 2V6NA 1LVMA 1MKWK 5A09A 1C5TA 3UTUH 3ZVAA 2GGVB 3T62A 2P16A 3RXGA 3JZ2B 3M35A 3MU1A 3BSQA 1FY8E 3LJJA 2F3CE 1BOQA 2Z7FE 3SNDA 1O2WA 2EI8A 1C4Y2 1G9IE 3RXRA 1LPKB 3UFAA 1CA0B 5C5OA 3SU5A 4JMYA 1NRNH 1UVTH 4E7NA 4WF8A 1WUNH 3TGIE 4AFSA 2A5AA 2RA0A 4XBDA 1LVYA 4NCYA 1ZSKA 4Y11E 3JZ1B 2ZU1A 4BAOB 2ZFSA 3PWCA 1SFIA 2R0LA 1GBFA 4KP0A 1GBCA 4ISOA 3SU2A 2A5IA 1AD8H 1KTSB 1P8VC 1C2MA 3T27A 1HGTH 3NXPA 1SLVB 3P70B 4Q7XA 1TRYA 2CF8H 1GHAG 1F0UA 4JZIA 2FS9A 1LHEH 2OC0A 1N8OB 1C5ZB 5DGJA 1TABE 3E8LA 3ZVBA 4XSKU 1ETRH 2OBQA 2V0BA 1C2HA 3RXAA 4TPIZ 1Y8TA 4KTSA 5A0BA 1CT2E 3UQVA 1U6QA 2SNWA 1SG8B 1C1UH 1DANH 4ZH8A 2PLXA 2SGFE 3N7OA 2Q6FA 1MTVA 1FY4A 1V2QT 5C1XA 3PO1C 3GY3A 1SB1H 1BTUA 1P02A 1QA0A 2ALPA 2ASUB 3A8DA 1FY3A 5EPYA 3UR9A 4CH8B 5AVDA 1QRXA 3HPTB 1SBWA 4HGCA 1TX6A 1XM1A 4DIIH 3BTQE 1O2JA 1GBHA 4GLYA 3U69H 2UUFB 5IDKA 1CVWH 1DITH 3URDA 1DS2E 1VCWA 3IG6B 3E1XB 5EU8A 1P2JA 2OD3B 1GBEA 2G51A 2XC0A 1UVPA 4CHAB 4ISIH 5EQRA 5H4IB 4ZAEA 1ZSLA 1ANDA 2PFEA 4FUFA 2XWBI 3ZZ9A 3RXPA 1VJ9U 1GI6A 1GPZA 2F91A 3MNSA 1LMWB 1WAYB 1AI8H 3RXLA 4VGCC 3GDSA 1QNJA 3K6ZA 1FQ3A 2PKSB 2SGAA 3HGPA 2LNCA 1YM0A 2A32A 7KMEH 3FFGA 1HXEH 4X8VH 2FXRA 1BMAA 1KLTA 1QQ4A 1SGEE 3VB5A 5FPYA 1TPAE 5L6NH 3A85A 4BXWA 4FU7A 1SR5C 4TPYA 2PUXB 3AAVA 3H7OA 1O3EA 3A87A 1DDJA 1DOJA 5TCAA 3RXTA 1C2JA 1FPHH 1FY1A 3M37A 1BITA 1O31A 1GJ5H 2AFQB 1CQQA 2A5KA 2BY9X 3KQDA 4GSOA 4I7YH 1A3BH 2FOMB 1Y5UT 1EASA 2QYIA 1XUHA 1AVWA 3SBKA 4BAKB 3I29A 3ZZDA 4AB8A 2CHAB 7ESTE 1GL0E 1YYY1 2BVRH 4UONA 5JB9S 2PSXA 1MKWH 3HKJB 2ILNA 1NM6A 3UNSA 1O3NA 4CH2B 2HLCA 2GKVE 3MH5A 5JPMH 2XXLA 1EOJA 3BTTE 2H2ZA 3TLOA 3V0XA 1EKBB 3EGKH 4OS7A 2FOCA 1V3XA 1DSTA 3ZZ6A 3VXFH 3A8CA 3KCGH 5L2ZH 3TIUA 4HTCH 1AVXA 4X8SH 7GCHF 3K9XB 2TIOA 3RXMA 2SNVA 1V2TT 1LVOA 4UDWH 1BIOA 4I8GA 1L4DA 3NWUA 2VVUA 8KME2 2A4QA 1P2QA 2ZDMA 3RLWH 3LDXH 1EZXC 1G30B 4IC6A 1GHYH 4MNYA 4OS6A 1QL8A 3CP7A 3NCLA 3SU3A 3TVJB 5EG4A 1Q31A 4XDEA 4GHTA 2C8XB 3PO1B 1QB1A 3PMJA 4KTCA 1QIXB 1FXYA 1HXFH 2WPIS 1KDQB 1HAIH 1O2NA 1VR1H 5HGGA 1MCVA 3UOUA 2KAIB 4A1XA 1EPTC 1ZJDA 2PGBB 2ZFTA 2Z9LA 5TCCA 1C2FA 1KLJH 1QL7A 1DXPA 3GDVA 4BAHB 1ZR0A 1UCYE 4D8NA 3B23B 3U8RH 6GCHG 1G36A 2SFAA 2A7CA 3FP7E 3H5CB 1E36B 1V2LT 4Y71A 3SGAE 4ABJA 1LKAA 5JBBS 2BY5X 2HPQH 1TPOA 1TFXA 4ABFA 1P05A 4WJG2 2ANWA 2WPKS 2ZDAH 1QA7A 5GIBA 4IW4E 1W8BH 3TH3H 4X2YA 1P2NA 3FZZA 4AG1A 3UPEA 3SV7A 2GT8A 2BD4A 1O2OA 4JYTA 2Y7ZA 3ZZ3A 1XUGA 4UE7H 1AFQC 1EX3A 2BDAA 2P8OC 1TGSZ 3RC5A 3P95A 3GCNA 1ZOMA 1BMLA 1QTFA 3B8JA 1UTQA 1EZSC 1MZAA 3Q3XA 3KQBA 2TGTA 3EA7A 5G4BA 1ZTJA 5GCHG 3TJOA 2VIWA 4NZQA 2G5NA 4K8BA 1TGCA 3NPSA 4DOQA 4CRFA 2XW9A 2M5TA 3S7KB 3RXOA 4MPWA 1RD3B 5EOKA 2ZO3H 1ELGA 4LZ1H 3DHKH 1Y3VA 1G2MA 1QR3E 1GMHG 3S7HB 3SUEA 1HJAC 1O2TA 1O3LA 4YO9A 1W12U 4MLFB 1SGTA 1A5GH 1HFDA 4MTBA 5CE1A 2ZCLP 3A84A 4BAMB 1DWBH 1PJPA 2QIQA 4OGXA 3E16B 2Y82A 1GJ4H 4GCHG 2BDHA 2A7JA 1CSOE 1OP0A 2V3OH 3P8FA 1THSH 4YOJA 4ZROA 3UY9A 4DT7B 4B2AA 1LQEA 3RMMH 3GISB 1IHSH 3LJOA 1VITH 2CN0H 1FIZA 3U1IB 1GCDA 1O2RA 2BQ6B 3LT3A 1ORFA 4I8HA 2ZTZA 4Q7ZA 1A7SA 1GI2A 2VGCB 1GBBA 2BQ7B 5B6OA 4ABGA 1YF4A 4K60A 4NA7A 2W3IA 4MQAA 1YPLH 1UTOA 4ZXXH 2Q1JA 1Z7KA 5DK1A 2GV6A 2G52A 3TPIZ 1KXFA 5EODA 3GICB 2ESTE 2HNTF 1W13U 3W94A 1T8MA 1XXDA 1MZDA 2BLQA 1JIMA 1ELEE 1DLEA 1S0RA 1W11U 3PM3A 2OBOA 3Q00A 4Y7BA 1OYTH 5GPIB 1P11E 4OS2A 3BIVH 2PKAA 3PLPA 4B75A 2FESH 4BOHA 3RMLH 4M7GA 1GMCF 2Y81A 1VGCC 3RUOA 1K28D 1OYQA 1PPEE 2IPHA 4IN1A 1F0TA 4E7RG 5C2ZA 4MNWA 2XBVA 3W95A 5HM2A 5I46H 5J4SA 5T6DA 4J1YA 3ATLA 3TH2H 5A8XA 4DG4A 1FV9A 1AFEH 2ZGJA 4Y7AA 1P2IA 1MKXK 3SQHE 1J15A 3FP8E 3A7YA 1C1WH 1QCPA 2R0KA 1XKBC 2J9NA 1IQJA 1EP6A 1O3IA 2P94A 3P92A 5DPAA 4PROA 3ODDA 1K1JA 2VJ1A 1ZMJA 1SLXB 1KTTB 4RN6A 1VCQA 2IN2A 4MDSA 3RXEA 3ATIA 1BRAA 1SGFG 3K2UA 3QDZB 1TPPA 1YPJH 4INKA 3AVZA 3SJ8A 4X1SU 1KXEA 1IQNA 1FDPA 2ZDLA 7LPRA 2FOGA 5A8ZA 1H4WA 1HAHH 1C1OA 1YLCA 2B8OH 4MNVA 5FPTA 3QLPH 2F9UA 2NU3E 1TGTA 1A2CH 3SNBA 1GJBB 2OC1A 3VB4A 1O0DH 2AH4X 1FAXA 2ZCKP 4ABEA 2STBE 1D4PB 1UO6A 2QXGA 3K65B 4AYVB 1GVZA 2P3FH 1GVLA 2CHAC 2GDEH 3H7TA 2BY7X 3VPKA 1SQTA 3M3VA 4BAQB 4DURA 5FCRA 3LU9B 1TOMH 3MNXA 4E06H 3SUDA 3A7XA 1N6XA 2ZIQH 1TAWA 4O03A 1AWFH 1C2DA 3D23A 1VCPA 1OWJA 1TQ7B 5JBAS 2GMTB 3AASA 2W5EA 4ESTE 2XCNA 2XNIA 1QBVH 5C1YA 2ZHDA 4DJZB 2F83A 5A2MH 2B5TB 4NA8A 1NZQH 3SO3A 5DJ7A 1YPHE 1M9UA 1ESBA 1UTPA 1HAGE 1XUKA 2FWWA 3NUMA 2FP7B 4X2WA 3LGIA 5F6MA 3SNAA 4ZUHA 3T26A 1SLWB 3FANA 1ZPCA 2QY0B 4IMQA 2OC8A 3SJOA 2Y5HA 4UEHH 4K69A 3QO6A 1W0YH 1NN6A 4LK4A 5EXLA 2AGIX 2GCHF 2NWNA 2PV9B 3UNRA 3BG4B 4ZHAA 6CHAB 1TALA 1IQIA 2J4IA 1GVKB 3GY5A 5DP4A 2ZU5A 1O2MA 1EAUA 1C1SA 2BXTH 4ZKRU 1V2PT 1ZGIA 3SU4A 1O2LA 5JBTA 2BLOA 4AFUA 1UHBB 1GCTB 3LGWA 1SPJA 1T32A 4LZ4B 3EE0B 4X1RU 4B2BA 2Z3DA 5FBEA 3BIUH 3MH7A 2R2MB 1MQ5A 1B0FA 2GDDA 1Y3YA 1GJ9B 2BZ6H 1C1NA 1P10A 2BDCA 1OP2A 3GY7A 2FPZA 1O3FA 1W2KH 1ELCA 1V2VT 1SC8U 1F5KU 6LPRA 4BTTB 2OQ5A 1O3PB 2WUCA 3KQCA 4AZ2B 1C5MD 1O36A 1MU8B 1CHOF 1ZLRA 1DVAH 1Q2WA 3QZQA 1F2SE 1GBJA 1AFQB 1JMOH 1XKAC 2ZZUH 1ZJKA 3TGJE 1T8OA 2WPHS 4WXVA 1BZXE 1UJ1A 1O33A 2BHGA 2G5VA 3A7WA 1HIAA 4IBLH 1GCTC 1A0JA 4GUXA 4Y10E 2AIPA 4A5TS 1WU1A 1A61H 1K1IA 3QUMP 4NA9H 3A86A 1O2QA 1GL1A 1P09A 2IJOB 2Y80A 1TYNA 2BDGA 1O35A 2ZGBH 1V2JT 1GHZA 1PPBH 1CGIE 1O3JA 2BD2A 4IGDA 1GHWH 1CHOG 2O8LA 3E90B 4AOQA 1MAXA 6ESTA 1Z8RA 2TPIZ 2QCYA 1DT2A 2G8TA 4Z6AH 1BT7A 3BTME 4U01A 1C5XB 1V2MT 2VH6A 4I8LA 5C3NA 3LC3A 3MO3A 1P3CA 1ZGVA 3L33A 4X6OA 3BEUA 2C8WB 3GCTG 1HAPH 3VB3A 1QGFA 1ELTA 7GCHG 4X2XA 2PHBA 1PQAA 4YZUA 2VWNA 4DIHH 2BY8X 4I31A 1P2KA 1C2KA 2NU2E 4RKJB 2JH0D 3M3SA 1DXWA 1MD7A 3M3TA 1BMMH 1WSSH 1O30A 1ARBA 1NFWA 3LIWA 1SGYE 1SOTA 2HWLB 1PFXC 1XX9A 3T28A 3DFJA 3ZZBA 2H5CA 1GI5A 4K2YA 2BQWB 2W26A 2WYJA 2JH5D 3M7QA 1TGBA 1HIAB 5EXMA 1C1QA 4H42U 3MH4A 3UREA 3M36A 1YCPH 3OY5U 1OX1A 1FJSA 1OSSA 1SGIB 1TNLA 1ELVA 3S9BA 1FN6A 3QK1A 4FVDA 1D3TB 4U2WA 1C5PA 2H9HA 4THNH 1TA6A 2VU8E 2B0FA 1UMAH 2Z9GA 1BHXF 3BG4C 2HGTH 4XOJA 2AERH 4Y6DA 4CRAA 5E2OA 3AW0A 2DE8A 1S84A 2PKAB 3STIA 1GMHF 2BD5A 3MWIU 1BJUA 4KKDA 3OTJE 4E05H 5T6GA 1IOEA 1TE0A 1LHDH 2PGQB 1BRBE 5DO4H 3SNEA 3A7VA 1H9HE 1Z6EA 2A0QB 2Y7XA 5E8EH 1UTJA 3MI4A 3SJKA 3EAJA 1O34A 4CHAC 2FOHA 1P04A 1HAYB 3A83A 1H9LB 5E0GA 1EATA 1AIXH 1LHGH 4CR9A 5JYIA 1C4V2 1GDUA 1O3BA 2B7DH 2Z6BD 4Y8ZA 3GCTF 3B9FH 1MH0A 3RXUA 2OP9A 3NK8A 4B2CA 1MBMA 3SI4H 1IQGA 4NZLA 3ENSB 1GBDA 1Y5BT 1L4ZA 3MMGA 3KQEA 5K0HA 4TWWA 1SQOA 2AMDA 3SGBE 5JBCS 4X6PA 1C5VA 2Z94A 1HNEE 1C9TA 5FPSA 3BN9A 3BTGE 4NGAH 5GCHF 5EXNA 2ZECA 4J2YB 1VZQH 3IITA 1KXCA 1GBIA 1GHBF 3D49H 3SQEE 2AGGX 4IS5A 8ESTE 1UTKA 1AO5A 2I6QA 2ZGXH 2VWOA 3MYWA 9LPRA 4JYVH 4UFGH 3A82A 3TNSA 4D7GA 1NRPH 1K1NA 2VWMA 1ANBA 2GMTC 1BTWA 1FI8A 3GY2A 1HRTH 2OTVA 3TH4H 2ZDKA 1SQAA 1Z1IA 1K1PA 1O2KA 1E38B 2Z9JA 3T5FH 2BB4A 4ZXYH 5JB8S 1HBTH 1HAZB 9ESTA 1O3KA 1A4WH 1Y3WA 1UK4A 2YNBA 1ETSH 1GBAA 1O3GA 3TJUA 3VXEH 2ZHWH 1ZRKA 1TOCB 1LVBA 2Y6TA 4XBBA 1FN8A 3PLKA 1GJCB 1ELAA 1ESAA 3C27B 1TNJA 1P06A 1VGCB 2R3UA 1AZZA 3URCA 2WV5A 1F92A 2Z3CA 1OWHA 1T4VH 1RGQA 2FYRA 1AGJA 3SGQE 4AFZA 4YT7H 5F03A 1GG6B 3ZYEA 4WH6A 3PYHA 1JXPA 1P12E 6CHAC 1O3DA 4ISNA 3GYMA 1S85A 3M7TA 3RXFA 1A3EH 2J94A 1SGCA 1C1PA 1OP8A 4QT8C 1NC6A 3RXHA 4GPGA 1O3HA 1UTMA 1MTNC 2NU1E 2ZDNA 1JWTA 5EPNA 3P8OA 2XC4A 3QWCH 1MU6B 1D3DB 2VIVA 5ESBA 1TNKA 1Z8GA 3E3TA 3MTYA 2P95A 2BM2A 1O5EH 4D9RA 3D62A 3K6YA 1RJXB 4VGCB 1NFXA 3TITA 3UWIA 2AGEX 3GCOA 4B71A 3P6ZB 1ESTA 1TLDA 1Y59T 3KEEA 4JK5A 2ZPQA 1HV7A 1S82A 1BBRH 1GG6C 2ZU3A 1FONA 5F8XA 4DGJA 3SN8A 2QGRA 1GGDC 2H9EH 1O5BB
chains in the Genus database with same CATH superfamily
2FO9A 3LKWA 4FUHA 1LTOA 1YY3A 4OS4A 1C2GA 5FHTA 2AEIH 3Q3KA 2WPMS 1XUJA 2SGDE 5EQSA 1QBNA 3AAUA 3HK6B 3U9AH 1GBMA 1O2IA 1AKSA 1JBUH 4WH8A 1C5UA 3R0FA 1DUEA 1DY8A 1LPZB 2BDYA 1HDTH 3O8DA 3PMBB 4YLUA 3UQOA 8LPRA 1ABIH 2ZHQH 1P2MA 1O2YA 3SHAH 3EDXB 2WPLS 1TQ0B 1V2WT 1DX5M 2FOAA 3TU7H 4BTIB 1GI3A 1EB2A 4AGKA 1FPCH 2KCOA 1EOLA 3SW2B 2ZQ2A 4CRDA 3ZVDA 1VITF 1O2PA 2P3TB 2WUBA 3GDUA 1NRQH 1WOFA 1HCGA 2ZEBA 1C5LH 1BTYA 5SGAE 1WTHD 3OX7U 4LOYH 1NBME 3ZV9A 1FY5A 3FVFB 4R8TB 5FX6A 2O9QA 1O2HA 5DKMA 1WCZA 1GI7B 3STJA 3SU0A 3BV9B 1BRCE 2FMJA 1BQYA 3ZZ8A 3N7DA 4FXGH 1C5OH 4M9FA 2OINA 1ZHRA 3ESTA 2ZWLH 1EZQA 3GCHB 1EPTA 2GZ7A 1NU9A 1YP9A 1E37B 1GBKA 2EC9H 3O8CA 4RT1A 4NSVA 2FIRH 1VITG 2Q6DA 1NROH 4RT0A 1D6WA 4FU9A 2QA9E 4MPVA 1C5NH 3BTFE 4ABIA 2UUYA 3RXQA 3VEQB 2G4UA 2J98B 4XE4A 1QHRB 1G37A 1DWCH 1GJ6A 1O5FH 1AY6H 4NSYA 5HIYA 5EW2H 1XVOA 3I78A 2GT7A 2LP6A 1S6HA 1ZHMA 2VGCC 2A7HA 3GY4A 5EIYA 5C5NA 4Y76A 3RU4E 3MU4A 2JJ2D 2HNTE 2XYAA 1EAIA 4XBCA 1Z8JB 4CR5A 2LPRA 3QN7A 2CJIA 3GY6A 3S9AA 3ATWA 5DP3A 4F49A 2GVFA 2QXHA 1PQ7A 5K7RA 5EGMA 2KCAA 3GCHC 3LGVA 2CF9H 4WY3A 2VIPA 1LO6A 2ANYA 1FZZA 3IWMA 3NZIA 2ZI2H 3SUGA 1EXFA 1NFUA 4UFEH 2FODA 1A46H 4B6EA 3MHWU 2H9TH 2XRCA 1O2VA 3RXBA 2A4GA 2XCFA 2KFWA 4WVPE 2ODQA 1P0SH 2R9PA 4UFDH 5ESTE 5GDSH 3WY8A 1WQVH 4U32A 1QJ7B 4OM9A 1T8NA 2QXJA 3VGCB 1SMFE 2ZCHP 3F2HA 2Q6GA 1THPB 1V2ST 1K2I1 2JETB 4F4OC 1HAXB 1KDQA 1JIRA 4K1SA 1TRNA 2BD9A 3EYDA 1T8LA 3M7UA 3TNTA 1W7GH 5DN6D 2BOKA 3UIRA 4SGBE 1ANCA 1GMDG 3QTVH 2P8OB 1UCYH 4Z0KA 2R3YA 2FLRH 1EAWA 1PQ5A 4NWKA 5A0AE 4JZEH 1FAKH 4OS5A 1G3CA 1QJ1B 2J2UA 4Y79A 2C93B 3LH3A 1DM4B 5DP5A 3A7ZA 1Y5AT 4IMZA 1LDTT 5LH8A 4NIWA 4AC9A 4KGAA 2ODYB 1P3EA 1L1JA 3MNCA 1INCA 5L2YH 1O2SA 3U8OH 1C1RA 1YKTA 1ELFA 2QXIA 1XMNB 3QTOH 5JDUB 3E6PH 3RDZA 2JETC 1ZTKA 2WV4A 1IHTH 2BX3A 2BD8A 2F9BH 3PLBA 3MU8A 4H4FA 1CGHA 1O5AB 1AE8H 1MCTA 1LKBA 3KL6A 4NIYA 3QGJA 1GI8B 1YLDA 1WV7H 4X8UH 3F2GA 3MU0A 3SV8A 3OTPA 3UWJH 3OSYA 4O3UA 2Z3EA 2ZC9H 4NIXA 1DSUA 3L6PA 1DY9A 1AQ7A 1KXAA 1MBQA 4FUJA 1KXBA 3U98H 3TJNA 2Z9IA 3E0PB 1SOZA 1NY22 3CS0A 4Y8YA 3D65E 4INHA 1SGRE 2EI6A 1GJDB 1WTGH 2OUAA 1H8HD 4WMDA 1J8AA 1BTHH 1C1TA 1B7XB 1YBWA 1FUJA 1TBQH 2ZU2A 4TYDA 2VWLA 1IQEA 1OS8A 3RM2H 1SI5H 2TBSA 2CXVA 3NKKA 1K1LA 2A1DB 2EQNA 1CO7E 4MNXA 2V35A 4FUEA 3BG8A 5T1VA 5DP7A 5CHAB 1MMJN 2QF4A 3KQ5A 5LPEA 1AWHB 3RXKA 4B73A 4A92A 4A1TA 3RM0H 3HGNA 1BTZA 5F8TA 1MAYA 1D3PB 4ABAA 1XUIA 5PTPA 1AN1E 5IYTA 3OFND 5CMXH 1MTNB 1NTPA 2ODPA 4NG9H 1O38A 2HVXA 4XFQA 1F5LA 1O37A 1W3CA 1ZPBA 3PMAB 3WWFA 2W3KA 1AMHA 1S5SA 4X6NA 2FOBA 1TMUH 1SLUB 1A5IA 3E91A 2B9LA 2F9PA 1NO9H 1C1VH 1O3CA 1E1RD 1G3EA 2TGDA 1HUTH 4P02A 2G00A 3GY8A 3OU0A 1JOUB 4GHQA 5CHAC 3DD2H 3UOPA 1CU1A 1G2LA 2ZG0H 4X1PU 1IAUA 1IQHA 1PYTD 1E34B 1CT0E 1QURH 1OOKB 2AS9A 5DP6A 1S0QA 1OWDA 3V13A 2SGEE 1YPHC 1O39A 4FUBA 3UNQA 2GZ9A 5GJ4B 1ZRBA 3TGKE 4GCHF 1GMCG 1LHFH 5CDFE 3T25A 2ZTXA 2RA3A 2NU0E 4ACBA 3LPRA 2Z9KA 4GAWA 3H09A 2ZHFH 1TX8A 3FO8D 1QB9A 1J14A 3RXIA 3KYGA 3GOVB 5E2PA 2UWOA 2HRVA 1EUFA 1FX0B 1CT4E 1XUFA 3ZVEA 1NU7B 4ZMAH 5GNDA 3U8TH 4DW2U 8GCHG 2BLWA 1W0ZU 2H1UA 3A89A 1J17T 3MQKC 1AE5A 1NT1A 2ZU4A 2QAAA 1K21H 5T6FA 4INLA 5LPRA 2A4OA 1OWEA 1UCYK 2VNTA 2BXUH 3SZNA 1B0EA 1SHHB 1UK2A 4HFPB 2IOTA 1COWD 2C90B 2M2AA 3VB6A 1XVMA 4YOIA 1Z1JA 5HXFA 4I86A 3PTNA 2ANKH 1NRRH 5L30H 1YC0A 1TPSA 2BOHB 1CGJE 1T7CA 1XXFA 4ASHA 1MTWA 3WWBA 3MOCA 1THRH 1TA2A 1AHTH 2UWPA 2QC2A 1RTKA 2PWXA 3ZVFA 2OCVB 4UD9H 1C2EA 2HOBA 1ZHPA 4XD7D 2GCHG 1PPHE 3ZZ4A 1C1MA 1KSNA 1J16A 1AVGH 3F9FA 1J9CH 1HJ9A 3F9GA 1SFQB 5FCKA 4FUGA 1HYLA 2BDIA 1S81A 1K1OA 1UVOA 1GBLA 2EI7A 2ZNKH 2AIQA 3A80A 2CGAA 1HAVA 3LGTA 4X8TH 2GZ8A 1S83A 4I32A 2F9VA 4SGAE 2RG3A 4JZDH 3EQ0H 2FX4A 2VVCA 5TJXA 4YOGA 2D2DA 1F0RA 2BD7A 1H8IH 3HATH 1GMDF 4ISLA 4Y0ZE 3BTHE 3LH1A 2BX4A 1SGPE 4RKOB 2PR3A 3QZRA 3AK5A 3F0PA 1ZPZA 3VB7A 2J34A 3GS9A 1BBRK 1YPKH 1MUEB 2VINA 1GWAA 4FU8A 4JZ1A 4H6SB 4JK6A 3RC6A 4NFEA 3CENA 2P93A 3PTBA 4MPXA 1WQSA 3KNXA 2ZPRA 4MG3A 1YCPM 2QF0A 1SSXA 4GVUA 4X6MA 4X1QU 5E0HA 3SORA 1O3OA 3P8NA 5AFYH 2O8WA 3TK6A 1W14U 1ZMNA 1GI4A 3U1JB 1E79D 3SOSA 4HZHA 3G01A 2FDAA 1L1GA 1HAOH 2DUCA 1PQ8A 3DSGA 4OS1A 1E0FD 3OYPA 4FUDA 1BTPA 2ZGHA 3ODFA 4FUIA 1OPHB 4YESB 2F43B 1HAVB 2FOEA 1B5GH 1TBRH 1A5HA 2V3MA 2VIQA 1CBWC 2H6MA 1O3AA 1KIGH 1VJAU 1G32B 1K9OE 2RDLA 4OGYA 4R0IA 3BTDE 4K3JA 1ZSJA 2FLBH 1A0LA 3M61U 5BRRE 5HYOA 1SQRA 4AGJA 2THFB 2WPJS 5ETXA 1D3QB 1DICA 4AX9H 3R3GB 5HKKD 2ZQ1A 1F0SA 1ZTLA 1N8OC 1FMGA 1C2LA 1L2EA 1V2RT 4JCNA 1DUAA 1K1MA 4X1NU 2FI5E 1UVSH 1SGQE 4KTUA 2YMSB 3RLYH 2ZFPH 3ZVCA 1YPEH 4B1TA 1BTXA 3CS7A 1TBZH 3KHVA 3MFJA 1RFNA 4ABDA 4TY6A 3RMOH 5I25A 3DA9B 5FX5A 1RS0A 1TNHA 3FZDA 1RIWB 2RCEA 3SJIA 1AUTC 3ZZ5A 4FETA 1PPGE 3T29A 1Y3XA 2DE9A 2G81E 3BEFB 4ZKSU 1IQFA 3PRDA 2BZAA 5HM9A 3MNBA 2XBYA 4WXIA 5C1UA 2ZFQH 1G3BA 1GJAB 1PPFE 2KX4A 2ZP0H 1SHYA 2QF5A 1EJAA 2ZPSA 2IJD1 1QJ6B 1DPOA 1MQ6A 1NESE 1QL9A 1P9UA 1SVPA 2C3SA 1SGNE 1QRZA 1EZUC 1BB0B 1SKYE 4FUCA 1AZ8A 2ZTYA 4MVNA 1YPGH 1BJVA 1TNIA 2A45B 2FI3E 2UWLA 5J4QA 5DG6A 2PP6A 3QGNB 3SV2H 2TGPZ 3V7TA 4AN7A 1C5WB 4A1VA 5KECA 5DP8A 2BLVA 2ZKSA 1YLNA 2D1JA 2Y5FA 3VGCC 2YOLA 1EQ9A 1DLKB 3MO9A 3F6UH 3SI3H 3RU4T 1Z71A 2PKSC 1GHXH 2TRMA 3M5OA 3LGUA 3ZZCA 3MO6A 3EA8A 4K5ZA 5FBIA 4JZFH 1Q3XA 1TGNA 1P9SA 4AYYB 5EW1H 2PTCE 2CMYA 3W1EA 4Y8XA 3SNCA 3WW7A 3V3MA 2QN5T 2PTNA 5E0JA 4ZHLU 4XRNA 1AU8A 3FP6E 3RP2A 1KY9A 2HNTC 1P03A 1PYTC 2BD3A 2XTTB 1V2KT 4DVAU 2VIDA 1HLTH 4YXWD 2ALVA 2FTMA 2OQUA 2O8UA 4CRCA 2G4TA 1FNIA 1EB1H 1HJ8A 4CREA 1N6YA 4A6LA 3ITIA 1V2UT 3F1SB 1GHAF 2K1QA 1JRTA 1C5RA 1WDIA 2L74A 4IC5A 1IQMA 3ZZAA 1ABJH 3LOXA 3SU6A 2W7SA 3PRBA 1BRUP 1A1RA 1DFPA 4WMFA 2ZFRH 2GV7A 3P8GA 4DY7B 1TMBH 1V6DA 1LQDB 5AHGH 3DT0H 3VFEA 3SUFA 4NWLA 3HKIB 2BVSH 1CBWB 3PV4A 4ABHA 5HMAA 1GHVH 2PUQH 4CRGA 2XC5A 2FOFA 2GCTC 1TWXB 2VB0A 3DFLA 4WWYA 1F7ZA 1OWKA 2BY6X 1BBRE 4YM9A 1O5GH 1F5RA 1SGDE 3KIDU 5EJ1A 1EJMA 3QX5H 2FX6A 4LXBH 1ETTH 1N1LA 5ABWA 1FLEE 2NU4E 5AFZH 3M5LA 1HPGA 1QQUA 3SHCH 3L3TA 3MU5A 1L0ZA 3ZYDA 1D9IA 3ZV8A 3SV6A 5KEDA 1SL3A 2C8YB 4DCDA 3P17H 2BDBA 3F0OA 4BNRA 4CRBA 2GX4A 5BPEA 4ZHMU 2FEQH 4AFQA 5C67A 1BDAA 3HK3B 4O3TA 3O8BA 1C5YB 2KAIA 1GJ7B 1NRSH 3UUZA 1GDNA 1MD8A 1V2NT 2VIOA 3ATKA 3KN2A 4X0WU 4YTAA 2HVYB 2ANMH 2O8MA 1YGCH 2TGAA 3LONA 4D9QA 1MABB 1QFKH 2FI4E 1V2OT 4CBNA 1UVUH 1W7XH 2G55A 2FTLE 1W10U 2A2QH 2SGQE 3RXJA 6GCHF 1CA8B 2AYWA 1ARCA 3ZZ7A 1MTSA 2ZFFH 1JRSA 1EJNA 1GI9B 2J95A 2SGPE 3PB1E 3M5MA 4BXSA 1WBGB 1G3DA 2CK3D 2EEKA 1CE5A 1DWEH 3LC5A 4Q80A 2BYAX 2R2WU 3RU4D 2OXSA 4K1TA 3RXSA 4ISHH 2Y5GA 2P59A 2BVXH 1DE7H 2F9OA 4D7FA 1WXRA 1TMTH 4K8YA 1O2ZA 2F9NA 2ZHEH 5A8YA 3SJ9A 4O9VA 1GI0A 1Y3UA 1AB9B 1TIOA 1O3MA 3O8RA 1OWIA 3RXVA 2ZGCA 2EA3A 3A8AA 4O97A 1OKXA 2PSYA 4NFFA 3ELAH 3BTWE 3A8BA 1BMNH 4UFFH 3UR6A 1O2GH 4B74A 2KZ4A 1DWDH 1YPMH 1OXGA 2YNAA 3FOAA 2ZDVH 1T31A 5AF9H 2HPPH 1TX7A 2XWAA 1X7AC 4Y0YE 3S9CA 3TK9A 2STAE 1PPCE 4RSPA 4I33A 3GYLB 1A0HB 4A7IB 4U30A 1UK3A 2UUKB 5HIZA 2P3UB 1RTLA 1P01A 2XBWA 3OE7D 4AORA 1QRWA 3NRLA 1AUJA 1QBOA 3EA9A 1C5QA 3PV2A 4B76A 1AB9C 1UHBA 1BCUH 3A88A 5T3HA 3RMNH 4ZKOU 1D6RA 1UTLM 2J38A 1GI1A 1GBTA 3PROA 1EPTB 4Q63A 1TNGA 4TWYA 3MH6A 1S6FA 1H8DH 4MPUA 1PPZA 1FIWA 1BA8B 3TK5A 4BANB 1E35B 2AMPA 1P2OA 1ANEA 5C17A 8GCHF 2J92A 2OC7A 3PMHB 1NS3A 2QV1A 1Z6JH 2UUJB 4FVBA 2FS8A 1GHBG 5GXPA 2QF3A 1IQLA 1K0HA 1MTUA 4FOUC 3Q3YA 2V3HH 2V7QD 1RRKA 2WINI 3F9HA 1O5DH 2O8TA 3AW1A 1EFRD 3KGPA 5F8ZA 1LPGB 2D8WA 1EAXA 2FYQA 5DP9A 1QB6A 5LPFA 3FAOA 1ELBA 4ABBA 5A0CA 1YWUA 2A2XH 3PWBA 1KXDA 3Q76A 4F55A 3LGYA 1NFYA 2JIZD 1ZYOA 1H9IE 4YLQH 5FL7D 2KCYA 4BTUB 2JH6D 3OY6U 1AKSB 2WYGA 1O5CB 2J5UA 1O32A 1Z8IB 3A7TA 2ZA5A 1ZMLA 2FM2A 1BUIA 4D76A 2BTCE 1HB0B 2I6SA 3V12A 1TB6H 1IQKA 4NIVA 3Q77A 1UTNA 1WYKA 3C1KA 3F9EA 1K22H 4KELA 2BMGB 1ZZZA 5EJZA 1HJAB 4HI3A 3DUXH 1TRMA 2D26C 4AG2A 5FAHA 2EY4C 1ID5H 1LHCH 2FZZA 3M5NA 1GGDB 3ATMA 3SV9A 5EQQA 1CHGA 2CV3A 1GDQA 5KGOA 4IN2A 1QY6A 2HALA 2ULLA 3KF2A 1C5SA 1H1BA 1C2IA 1YCPK 1ACBE 1SGFA 4WMEA 3BF6H 1KLIH 3S69A 1BHXB 4Q7YA 4CBOA 1EP5A 4I8KA 4TY7A 3DSOA 4YT6H 5C20A 1ELDE 4I8JA 2C8ZB 3SU1A 2GP9B 3TJVA 4AB9A 4ZKNU 2JKHA 2A31A 2PW8H 2OLGA 1P57B 1T4UH 3F68H 3RXDA 3OAAD 4K1EA 2VVVA 1O2XA 3RXCA 5GWZA 1CA0C 1RXPA 3E0NB 2VH0A 1RTFB 3BEIB 5FXLA 4JYUH 2GD4B 2H5DA 1C4U2 1NPMA 1O2UA 1RIWC 3A81A 1L1NA 1KYNA 3BTEE 2AMQA 2C4FH 1LCYA 1GJ8B 2XBXA 3S0NA 1MKXH 1C9PA 4Q2KA 3RC4A 3I77A 2GTBA 3ZVGA 4H6TA 3BTKE 4X2VA 3T2NA 5LGOA 2GCTB 2A4RA 1TONA 2W7UA 2ZF0H 2V6NA 1LVMA 1MKWK 5A09A 1C5TA 3UTUH 3ZVAA 2GGVB 3T62A 1S6LA 2P16A 3RXGA 3JZ2B 3M35A 3MU1A 3BSQA 1FY8E 3LJJA 2F3CE 1BOQA 2Z7FE 3SNDA 1O2WA 2EI8A 1C4Y2 1G9IE 3RXRA 1LPKB 3UFAA 1CA0B 5C5OA 3SU5A 4JMYA 1NRNH 1UVTH 4E7NA 4WF8A 1WUNH 3TGIE 4AFSA 2A5AA 2RA0A 4XBDA 1LVYA 4NCYA 1ZSKA 4Y11E 3JZ1B 2ZU1A 3VG8A 4BAOB 2ZFSA 3PWCA 1SFIA 2R0LA 1GBFA 4KP0A 1GBCA 4ISOA 3SU2A 2A5IA 1AD8H 1KTSB 1P8VC 1C2MA 1VKYA 3T27A 1HGTH 3NXPA 1SLVB 3P70B 4Q7XA 1TRYA 2CF8H 4TT3D 1GHAG 1F0UA 4JZIA 2FS9A 1LHEH 2OC0A 1N8OB 1C5ZB 5DGJA 1TABE 3E8LA 3ZVBA 4XSKU 1ETRH 2OBQA 2V0BA 1C2HA 1OHHD 3RXAA 4TPIZ 1Y8TA 4KTSA 5A0BA 1CT2E 3UQVA 1U6QA 2SNWA 1SG8B 1KMHB 1C1UH 1DANH 4ZH8A 2PLXA 2SGFE 3N7OA 2Q6FA 1MTVA 1FY4A 1V2QT 5C1XA 3PO1C 3GY3A 1SB1H 1BTUA 1P02A 1QA0A 2ALPA 2ASUB 3A8DA 1FY3A 5EPYA 3UR9A 4CH8B 5AVDA 1QRXA 3HPTB 1SBWA 4HGCA 1TX6A 1XM1A 4DIIH 3BTQE 1O2JA 1GBHA 4GLYA 3U69H 2UUFB 2RFKC 5IDKA 1CVWH 1DITH 3URDA 1DS2E 1VCWA 3IG6B 3E1XB 5EU8A 1P2JA 2OD3B 1GBEA 2G51A 2XC0A 1UVPA 4CHAB 4ISIH 5EQRA 5H4IB 4ZAEA 1ZSLA 1ANDA 2PFEA 4FUFA 2XWBI 3ZZ9A 3RXPA 1VJ9U 1GI6A 1GPZA 2F91A 3MNSA 1LMWB 1WAYB 1AI8H 3RXLA 4VGCC 3GDSA 1QNJA 3K6ZA 1FQ3A 2PKSB 2SGAA 3HGPA 2LNCA 1YM0A 2A32A 7KMEH 3FFGA 1HXEH 4X8VH 2FXRA 1BMAA 1KLTA 1QQ4A 1SGEE 3VB5A 2J97A 5FPYA 1TPAE 5L6NH 3PV5A 3A85A 4BXWA 4FU7A 1SR5C 4TPYA 3F2FA 2PUXB 3AAVA 3H7OA 1O3EA 3A87A 1DDJA 1DOJA 3OEED 1QZ8A 5TCAA 3RXTA 1C2JA 1FPHH 1FY1A 3M37A 3OEHD 1BITA 1O31A 1GJ5H 2AFQB 4RI0A 1CQQA 2A5KA 2BY9X 3KQDA 4GSOA 4I7YH 1A3BH 2FOMB 1Y5UT 1EASA 2QYIA 1XUHA 1AVWA 3SBKA 4BAKB 2YMSC 3I29A 3ZZDA 4AB8A 2CHAB 7ESTE 1GL0E 1YYY1 2BVRH 4UONA 5JB9S 2PSXA 1MKWH 3HKJB 2ILNA 1NM6A 3UNSA 1O3NA 4CH2B 2HLCA 2GKVE 3MH5A 5JPMH 2XXLA 1EOJA 3BTTE 2H2ZA 3TLOA 3V0XA 1EKBB 3EGKH 4OS7A 2FOCA 1V3XA 1DSTA 3ZZ6A 3VXFH 3A8CA 3KCGH 5L2ZH 3TIUA 4HTCH 1AVXA 4X8SH 7GCHF 3K9XB 2TIOA 1W0KD 2WV9A 3EE7A 3RXMA 2SNVA 1V2TT 1LVOA 4UDWH 1BIOA 4I8GA 1L4DA 3NWUA 2VVUA 8KME2 2A4QA 2KR7A 1P2QA 2ZDMA 3RLWH 3LDXH 1EZXC 2OK5A 1G30B 4IC6A 1GHYH 1H8ED 4MNYA 4OS6A 1QL8A 3CP7A 3NCLA 3SU3A 3TVJB 5EG4A 3U28C 1Q31A 4XDEA 4GHTA 2C8XB 3PO1B 1QB1A 3PMJA 4KTCA 1QIXB 1FXYA 1HXFH 2J98A 2WPIS 5C0TA 1KDQB 1HAIH 1O2NA 1VR1H 2XNDD 5HGGA 1MCVA 3UOUA 2KAIB 4A1XA 1EPTC 1ZJDA 2PGBB 2ZFTA 2Z9LA 5TCCA 1C2FA 1KLJH 1QL7A 1DXPA 3GDVA 4BAHB 1ZR0A 1UCYE 1W0JD 4D8NA 3B23B 3U8RH 6GCHG 1G36A 2SFAA 2A7CA 3FP7E 3H5CB 1E36B 5IK2D 1V2LT 4Y71A 3SGAE 4ABJA 1LKAA 5JBBS 2BY5X 2HPQH 1TPOA 1TFXA 4ABFA 1P05A 4WJG2 2ANWA 2WPKS 2ZDAH 5C94A 1QA7A 5GIBA 4IW4E 1W8BH 3TH3H 4X2YA 1P2NA 3FZZA 4AG1A 2WHXA 3UPEA 3SV7A 2GT8A 2BD4A 1O2OA 4JYTA 2Y7ZA 3ZZ3A 1XUGA 4UE7H 1AFQC 1EX3A 2BDAA 2K8IA 1TGSZ 2P8OC 3RC5A 3P95A 3GCNA 1ZOMA 1BMLA 1QTFA 4DT4A 3B8JA 1UTQA 1EZSC 1MZAA 3Q3XA 3KQBA 2TGTA 4F48B 3EA7A 5G4BA 1E1QD 1ZTJA 5GCHG 3TJOA 2VIWA 4NZQA 2G5NA 2YMSD 4K8BA 1TGCA 3NPSA 4DOQA 4CRFA 2XW9A 2M5TA 3S7KB 3RXOA 4MPWA 2GJGA 1RD3B 5EOKA 2ZO3H 1ELGA 4LZ1H 3DHKH 1Y3VA 1G2MA 1QR3E 1GMHG 3S7HB 3SUEA 1HJAC 1O2TA 1O3LA 2LELA 4YO9A 1W12U 4MLFB 1SGTA 1A5GH 1HFDA 4MTBA 5CE1A 2ZCLP 3A84A 4BAMB 1DWBH 1PJPA 2QIQA 4OGXA 3E16B 2Y82A 1GJ4H 4GCHG 2BDHA 2A7JA 1CSOE 1OP0A 2V3OH 3P8FA 1THSH 4YOJA 4ZROA 3UY9A 4DT7B 4B2AA 1LQEA 3RMMH 3GISB 1IHSH 3LJOA 1VITH 2CN0H 1FIZA 3U1IB 1GCDA 1O2RA 2BQ6B 2K0QA 3LT3A 1ORFA 4I8HA 2ZTZA 4Q7ZA 1A7SA 1GI2A 2VGCB 1GBBA 5DSFA 2BQ7B 5B6OA 4ABGA 1YF4A 4K60A 4NA7A 2L6OA 2W3IA 4MQAA 1YPLH 1UTOA 4ZXXH 2Q1JA 1Z7KA 5DK1A 2GV6A 2G52A 3TPIZ 1KXFA 5EODA 3GICB 2ESTE 2HNTF 1W13U 3W94A 1T8MA 2VBCA 1XXDA 1MZDA 2BLQA 2HLDD 1JIMA 2WZQA 1ELEE 1DLEA 1S0RA 1W11U 3PM3A 2OBOA 3Q00A 4Y7BA 1OYTH 5GPIB 1P11E 4OS2A 3BIVH 2PKAA 3PLPA 4B75A 2FESH 4BOHA 3RMLH 4M7GA 1GMCF 2Y81A 1VGCC 3RUOA 4TSFD 1K28D 1OYQA 1PPEE 2IPHA 4IN1A 1F0TA 4E7RG 5C2ZA 4MNWA 2XBVA 3W95A 5HM2A 5I46H 5J4SA 5T6DA 4J1YA 3ATLA 3TH2H 5A8XA 4DG4A 1FV9A 1AFEH 2ZGJA 4Y7AA 1P2IA 1MKXK 3SQHE 1J15A 3FP8E 3A7YA 1C1WH 1QCPA 2R0KA 1XKBC 2J9NA 1IQJA 1EP6A 1O3IA 2P94A 3P92A 5DPAA 4PROA 3ODDA 1K1JA 2VJ1A 1ZMJA 1SLXB 3SYJA 1KTTB 4HG6A 4RN6A 1VCQA 2IN2A 4MDSA 3RXEA 3ATIA 1BRAA 1SGFG 3K2UA 3QDZB 1TPPA 1YPJH 2W6ID 4INKA 3AVZA 3SJ8A 4X1SU 1KXEA 1IQNA 1FDPA 2ZDLA 3DCLA 7LPRA 2FOGA 5A8ZA 1H4WA 1HAHH 1C1OA 1YLCA 2B8OH 4MNVA 5FPTA 3QLPH 2F9UA 2NU3E 1TGTA 1A2CH 3SNBA 1GJBB 2OC1A 3VB4A 4B6FA 1O0DH 2AH4X 1FAXA 2ZCKP 4ABEA 2STBE 1D4PB 1UO6A 2QXGA 3K65B 4AYVB 2F4LA 1GVZA 2P3FH 1GVLA 2CHAC 2GDEH 3H7TA 2BY7X 5CHBA 3VPKA 1SQTA 3M3VA 4BAQB 4DURA 5FCRA 3LU9B 1TOMH 3MNXA 4E06H 3SUDA 3A7XA 1N6XA 2ZIQH 1TAWA 4O03A 1AWFH 1C2DA 3D23A 1VCPA 1OWJA 1TQ7B 5JBAS 2GMTB 3AASA 2W5EA 4ESTE 2XCNA 4Z1MD 2XNIA 1QBVH 5C1YA 2ZHDA 4DJZB 2F83A 5A2MH 2B5TB 4NA8A 1NZQH 3SO3A 5DJ7A 1YPHE 1M9UA 1ESBA 1UTPA 1HAGE 4ACAA 2KM0A 1XUKA 2FWWA 3NUMA 2AHME 2FP7B 4X2WA 3LGIA 5F6MA 3SNAA 4ZUHA 3T26A 1SLWB 3FANA 1ZPCA 2QY0B 4IMQA 2OC8A 3SJOA 2Y5HA 4UEHH 4K69A 3ZIAD 3QO6A 1W0YH 1NN6A 4LK4A 5EXLA 2AGIX 2GCHF 3SZEA 2NWNA 2PV9B 5F53A 3UNRA 3BG4B 4ZHAA 6CHAB 1TALA 1IQIA 2J4IA 1GVKB 3GY5A 5DP4A 2ZU5A 1O2MA 1EAUA 1C1SA 2BXTH 4ZKRU 1V2PT 1ZGIA 3SU4A 1O2LA 5JBTA 2BLOA 4AFUA 1UHBB 1GCTB 2WPDD 3LGWA 1SPJA 1T32A 4LZ4B 3EE0B 4X1RU 4B2BA 2Z3DA 5FBEA 3BIUH 3MH7A 2R2MB 1MQ5A 1B0FA 2GDDA 1Y3YA 1GJ9B 2BZ6H 1C1NA 1P10A 2BDCA 1OP2A 3GY7A 2FPZA 1O3FA 1W2KH 1ELCA 2JDID 1V2VT 1SC8U 1F5KU 6LPRA 4BTTB 2OQ5A 1O3PB 2WUCA 3KQCA 4AZ2B 1C5MD 1O36A 1MU8B 1CHOF 1ZLRA 1DVAH 1Q2WA 3QZQA 1F2SE 1GBJA 1AFQB 1JMOH 1XKAC 2ZZUH 1ZJKA 3TGJE 1T8OA 2WPHS 4WXVA 1BZXE 1UJ1A 1O33A 2BHGA 2G5VA 2W6JD 3A7WA 3UB0A 1HIAA 4IBLH 1GCTC 1A0JA 4GUXA 3UAIC 4Y10E 2AIPA 4A5TS 1WU1A 1A61H 1K1IA 3QUMP 4NA9H 3KYFA 2XOKD 3A86A 1O2QA 1GL1A 1P09A 2IJOB 2Y80A 1TYNA 2BDGA 1O35A 2ZGBH 1V2JT 1GHZA 1PPBH 1CGIE 1O3JA 2BD2A 4IGDA 1GHWH 1CHOG 2O8LA 3E90B 4AOQA 1MAXA 6ESTA 1Z8RA 2TPIZ 2QCYA 1DT2A 2G8TA 2RDEA 4Z6AH 1BT7A 3BTME 4U01A 1C5XB 3F3BA 3N7EA 4P00A 1V2MT 2VH6A 4I8LA 5C3NA 3LC3A 3MO3A 2IPQX 1P3CA 1ZGVA 3L33A 4X6OA 3BEUA 2C8WB 3GCTG 1HAPH 3VB3A 1QGFA 1ELTA 7GCHG 4X2XA 2PHBA 1PQAA 4YZUA 2VWNA 4DIHH 2BY8X 4I31A 1P2KA 1C2KA 2NU2E 4RKJB 2JH0D 3M3SA 1DXWA 1MD7A 3M3TA 1BMMH 1WSSH 1O30A 1ARBA 1NFWA 3LIWA 1SGYE 1SOTA 2HWLB 1PFXC 1XX9A 3T28A 3DFJA 3ZZBA 2H5CA 1GI5A 4K2YA 2BQWB 2W26A 2WYJA 2JH5D 3M7QA 1TGBA 2WSSD 1HIAB 5EXMA 1C1QA 4H42U 3MH4A 3UREA 3M36A 1YCPH 3OY5U 1OX1A 1FJSA 1OSSA 1SGIB 1TNLA 1ELVA 3S9BA 1FN6A 3QK1A 4FVDA 1D3TB 4U2WA 1C5PA 2H9HA 4THNH 1TA6A 2VU8E 2B0FA 1UMAH 2Z9GA 1BHXF 1NBMD 3BG4C 2HGTH 4XOJA 2AERH 4Y6DA 4CRAA 5E2OA 3AW0A 2DE8A 1S84A 2PKAB 3STIA 1GMHF 2BD5A 3MWIU 1BJUA 4KKDA 3OTJE 4E05H 5T6GA 1IOEA 1TE0A 1LHDH 2PGQB 1BRBE 5DO4H 3SNEA 3A7VA 1H9HE 1Z6EA 2A0QB 2Y7XA 5E8EH 1UTJA 3MI4A 3SJKA 3EAJA 1O34A 4ASUD 4CHAC 2FOHA 1P04A 1HAYB 3A83A 1H9LB 5E0GA 1EATA 1AIXH 1LHGH 4CR9A 5JYIA 2KCPA 1C4V2 1GDUA 1O3BA 2B7DH 2Z6BD 4Y8ZA 3GCTF 3B9FH 1BMFD 1MH0A 3RXUA 5B6LA 2OP9A 3NK8A 4B2CA 3DSPA 1MBMA 3SI4H 1IQGA 4NZLA 3ENSB 3CNRA 1GBDA 1Y5BT 1L4ZA 3MMGA 3KQEA 5K0HA 4TWWA 1SQOA 2AMDA 3SGBE 5JBCS 4X6PA 5C0UA 1C5VA 2Z94A 1HNEE 1C9TA 5FPSA 3BN9A 3BTGE 4NGAH 5GCHF 5EXNA 2ZECA 4J2YB 1VZQH 3IITA 1KXCA 1GBIA 1GHBF 3D49H 3SQEE 2AGGX 3FKSD 4IS5A 8ESTE 1UTKA 1AO5A 2I6QA 2ZGXH 2VWOA 3MYWA 9LPRA 4JYVH 4UFGH 3A82A 3TNSA 4D7GA 1NRPH 4Q4LA 1K1NA 1ANBA 2VWMA 2GMTC 1BTWA 1FI8A 3GY2A 1HRTH 2OTVA 3TH4H 2ZDKA 1SQAA 5EJLA 1Z1IA 1K1PA 1O2KA 1E38B 2Z9JA 3T5FH 2BB4A 4ZXYH 5JB8S 1HBTH 1HAZB 9ESTA 1O3KA 1A4WH 1Y3WA 1UK4A 2YNBA 1ETSH 1GBAA 2JJ1D 1O3GA 3TJUA 3VXEH 2ZHWH 1ZRKA 1TOCB 3N99A 1LVBA 2Y6TA 4XBBA 1FN8A 3PLKA 1GJCB 1ELAA 1ESAA 3C27B 1TNJA 1P06A 1VGCB 2R3UA 1AZZA 3URCA 2WV5A 1F92A 2Z3CA 1OWHA 1T4VH 1RGQA 2FYRA 1AGJA 3SGQE 4AFZA 4YT7H 5F03A 1GG6B 3ZYEA 4WH6A 3PYHA 1JXPA 1P12E 6CHAC 1O3DA 4ISNA 3GYMA 1S85A 1UW7A 3M7TA 4ZCNA 3RXFA 1A3EH 2QE7D 2J94A 1SGCA 1C1PA 1OP8A 4QT8C 1NC6A 3RXHA 4GPGA 1O3HA 1UTMA 1MTNC 2NU1E 2ZDNA 1JWTA 5EPNA 3P8OA 2XC4A 3QWCH 1MU6B 1D3DB 2VIVA 5ESBA 1TNKA 1Z8GA 3E3TA 3MTYA 2P95A 2BM2A 1O5EH 4D9RA 3D62A 3K6YA 1RJXB 4VGCB 1NFXA 3TITA 3UWIA 2AGEX 3GCOA 4B71A 3P6ZB 1ESTA 1TLDA 1Y59T 3KEEA 4JK5A 2ZPQA 3FN8A 1HV7A 1S82A 1BBRH 1GG6C 2ZU3A 1FONA 5F8XA 4DGJA 3SN8A 2QGRA 1GGDC 2H9EH 1O5BB
chains in the Genus database with same CATH topology
2FO9A 3LKWA 4FUHA 1LTOA 4OS4A 1C2GA 5FHTA 2AEIH 3Q3KA 2WPMS 1XUJA 2SGDE 5EQSA 1QBNA 3AAUA 3HK6B 3U9AH 1GBMA 1O2IA 1AKSA 1JBUH 4WH8A 1C5UA 3R0FA 1DUEA 1DY8A 1LPZB 2BDYA 1HDTH 3O8DA 3PMBB 4YLUA 3UQOA 8LPRA 1ABIH 2ZHQH 1P2MA 1O2YA 3SHAH 3EDXB 2WPLS 1TQ0B 1V2WT 1DX5M 2FOAA 3TU7H 4BTIB 1GI3A 1EB2A 4AGKA 1FPCH 1EOLA 3SW2B 2ZQ2A 4CRDA 3ZVDA 1VITF 1O2PA 2P3TB 2WUBA 3GDUA 1NRQH 1WOFA 1HCGA 2ZEBA 1C5LH 1BTYA 5SGAE 1WTHD 3OX7U 4LOYH 3ZV9A 1FY5A 3FVFB 4R8TB 5FX6A 2O9QA 1O2HA 5DKMA 1WCZA 1GI7B 3STJA 3SU0A 3BV9B 1BRCE 2FMJA 1BQYA 3ZZ8A 4FXGH 1C5OH 2OINA 1ZHRA 3ESTA 2ZWLH 1EZQA 3GCHB 1EPTA 2GZ7A 1NU9A 1YP9A 1E37B 1GBKA 2EC9H 3O8CA 4NSVA 2FIRH 1VITG 2Q6DA 1NROH 1D6WA 4FU9A 2QA9E 4MPVA 1C5NH 3BTFE 4ABIA 2UUYA 3RXQA 3VEQB 2G4UA 4XE4A 1QHRB 1G37A 1DWCH 1GJ6A 1O5FH 1AY6H 4NSYA 5EW2H 1XVOA 3I78A 2GT7A 1S6HA 1ZHMA 2VGCC 2A7HA 3GY4A 5C5NA 4Y76A 3RU4E 3MU4A 2HNTE 2XYAA 1EAIA 4XBCA 1Z8JB 4CR5A 2LPRA 3QN7A 2CJIA 3GY6A 3S9AA 3ATWA 5DP3A 4F49A 2GVFA 2QXHA 1PQ7A 5K7RA 5EGMA 3GCHC 3LGVA 2CF9H 4WY3A 2VIPA 1LO6A 2ANYA 1FZZA 3IWMA 3NZIA 2ZI2H 3SUGA 1EXFA 1NFUA 4UFEH 2FODA 1A46H 3MHWU 2H9TH 2XRCA 1O2VA 3RXBA 2A4GA 2XCFA 4WVPE 2ODQA 1P0SH 2R9PA 4UFDH 5ESTE 5GDSH 3WY8A 1WQVH 4U32A 1QJ7B 1T8NA 2QXJA 3VGCB 1SMFE 2ZCHP 2Q6GA 1THPB 1V2ST 1K2I1 2JETB 4F4OC 1HAXB 1KDQA 1JIRA 4K1SA 1TRNA 2BD9A 3EYDA 1T8LA 3M7UA 3TNTA 1W7GH 2BOKA 3UIRA 4SGBE 1ANCA 1GMDG 3QTVH 2P8OB 1UCYH 4Z0KA 2R3YA 2FLRH 1EAWA 1PQ5A 4NWKA 5A0AE 4JZEH 1FAKH 4OS5A 1G3CA 1QJ1B 2J2UA 4Y79A 2C93B 3LH3A 1DM4B 5DP5A 3A7ZA 1Y5AT 4IMZA 1LDTT 5LH8A 4NIWA 4KGAA 2ODYB 1P3EA 1L1JA 3MNCA 1INCA 5L2YH 1O2SA 3U8OH 1C1RA 1YKTA 1ELFA 2QXIA 1XMNB 3QTOH 5JDUB 3E6PH 3RDZA 2JETC 1ZTKA 2WV4A 1IHTH 2BX3A 2BD8A 2F9BH 3PLBA 3MU8A 4H4FA 1CGHA 1O5AB 1AE8H 1MCTA 1LKBA 3KL6A 4NIYA 3QGJA 1GI8B 1YLDA 1WV7H 4X8UH 3MU0A 3SV8A 3UWJH 3OSYA 4O3UA 2Z3EA 2ZC9H 4NIXA 1DSUA 3L6PA 1DY9A 1AQ7A 1KXAA 1MBQA 4FUJA 1KXBA 3U98H 3TJNA 2Z9IA 3E0PB 1SOZA 1NY22 3CS0A 4Y8YA 3D65E 4INHA 1SGRE 2EI6A 1GJDB 1WTGH 2OUAA 4WMDA 1J8AA 1BTHH 1C1TA 1B7XB 1YBWA 1FUJA 1TBQH 2ZU2A 4TYDA 2VWLA 1IQEA 1OS8A 3RM2H 1SI5H 2TBSA 2CXVA 3NKKA 1K1LA 2A1DB 1CO7E 4MNXA 2V35A 4FUEA 3BG8A 5DP7A 5CHAB 1MMJN 5LPEA 1AWHB 3RXKA 4B73A 4A92A 4A1TA 3RM0H 3HGNA 1BTZA 5F8TA 1MAYA 1D3PB 4ABAA 1XUIA 5PTPA 1AN1E 5IYTA 5CMXH 1MTNB 1NTPA 2ODPA 4NG9H 1O38A 2HVXA 4XFQA 1F5LA 1O37A 1W3CA 1ZPBA 3PMAB 2W3KA 1AMHA 1S5SA 4X6NA 2FOBA 1TMUH 1SLUB 1A5IA 3E91A 2B9LA 2F9PA 1NO9H 1C1VH 1O3CA 1G3EA 2TGDA 1HUTH 2G00A 3GY8A 3OU0A 1JOUB 4GHQA 5CHAC 3DD2H 3UOPA 1CU1A 1G2LA 2ZG0H 4X1PU 1IAUA 1IQHA 1PYTD 1E34B 1CT0E 1QURH 1OOKB 2AS9A 5DP6A 1S0QA 1OWDA 3V13A 2SGEE 1YPHC 1O39A 4FUBA 3UNQA 2GZ9A 5GJ4B 1ZRBA 3TGKE 4GCHF 1GMCG 1LHFH 3T25A 2ZTXA 2RA3A 2NU0E 3LPRA 2Z9KA 4GAWA 2ZHFH 1TX8A 1QB9A 1J14A 3RXIA 3GOVB 5E2PA 2UWOA 2HRVA 1EUFA 4ZMAH 1CT4E 1XUFA 3ZVEA 1NU7B 3U8TH 4DW2U 8GCHG 2BLWA 1W0ZU 2H1UA 3A89A 1J17T 1AE5A 1NT1A 2ZU4A 2QAAA 1K21H 5T6FA 4INLA 5LPRA 2A4OA 1OWEA 1UCYK 2VNTA 2BXUH 3SZNA 1B0EA 1SHHB 1UK2A 4HFPB 2IOTA 2C90B 3VB6A 1XVMA 4YOIA 1Z1JA 5HXFA 3PTNA 2ANKH 1NRRH 5L30H 1YC0A 1TPSA 2BOHB 1CGJE 1T7CA 1XXFA 4ASHA 1MTWA 3MOCA 1THRH 1TA2A 1AHTH 2UWPA 2QC2A 1RTKA 2PWXA 3ZVFA 2OCVB 4UD9H 1C2EA 2HOBA 1ZHPA 2GCHG 1PPHE 3ZZ4A 1C1MA 1KSNA 1J16A 1AVGH 3F9FA 1J9CH 1HJ9A 3F9GA 1SFQB 5FCKA 4FUGA 1HYLA 2BDIA 1S81A 1K1OA 1UVOA 1GBLA 2EI7A 2ZNKH 2AIQA 3A80A 2CGAA 1HAVA 3LGTA 4X8TH 2GZ8A 1S83A 4I32A 2F9VA 4SGAE 2RG3A 4JZDH 3EQ0H 2FX4A 2VVCA 5TJXA 4YOGA 2D2DA 1F0RA 2BD7A 1H8IH 3HATH 1GMDF 4ISLA 4Y0ZE 3BTHE 3LH1A 2BX4A 1SGPE 4RKOB 2PR3A 3QZRA 1ZPZA 3VB7A 2J34A 1BBRK 1YPKH 1MUEB 2VINA 1GWAA 4FU8A 4JZ1A 4H6SB 4JK6A 3RC6A 4NFEA 3CENA 2P93A 3PTBA 4MPXA 1WQSA 3KNXA 2ZPRA 4MG3A 1YCPM 2QF0A 1SSXA 4GVUA 4X6MA 4X1QU 5E0HA 3SORA 1O3OA 3P8NA 5AFYH 2O8WA 3TK6A 1W14U 1ZMNA 1GI4A 3U1JB 3SOSA 4HZHA 3G01A 2FDAA 1L1GA 1HAOH 2DUCA 1PQ8A 4OS1A 1E0FD 3OYPA 4FUDA 1BTPA 2ZGHA 3ODFA 4FUIA 1OPHB 4YESB 1HAVB 2FOEA 1B5GH 1TBRH 1A5HA 2VIQA 1CBWC 2H6MA 1O3AA 1KIGH 1VJAU 1G32B 1K9OE 2RDLA 4OGYA 4R0IA 3BTDE 4K3JA 1ZSJA 2FLBH 1A0LA 3M61U 5BRRE 5HYOA 4AGJA 2THFB 2WPJS 5ETXA 1D3QB 1DICA 4AX9H 3R3GB 2ZQ1A 1F0SA 1ZTLA 1N8OC 1FMGA 1C2LA 1L2EA 1V2RT 4JCNA 1DUAA 1K1MA 4X1NU 2FI5E 1UVSH 1SGQE 4KTUA 3RLYH 2ZFPH 3ZVCA 1YPEH 4B1TA 1BTXA 3CS7A 1TBZH 3KHVA 3MFJA 1RFNA 4ABDA 4TY6A 3RMOH 5I25A 3DA9B 5FX5A 1RS0A 1TNHA 3FZDA 1RIWB 2RCEA 3SJIA 1AUTC 3ZZ5A 1PPGE 3T29A 1Y3XA 2DE9A 2G81E 3BEFB 4ZKSU 1IQFA 2BZAA 5HM9A 3MNBA 2XBYA 4WXIA 5C1UA 2ZFQH 1G3BA 1GJAB 1PPFE 2ZP0H 1SHYA 1EJAA 2ZPSA 1QJ6B 1DPOA 1MQ6A 1NESE 1QL9A 1P9UA 1SVPA 2C3SA 1SGNE 1QRZA 1EZUC 1BB0B 4FUCA 1AZ8A 2ZTYA 4MVNA 1YPGH 1BJVA 1TNIA 2A45B 2FI3E 2UWLA 5J4QA 5DG6A 3QGNB 3SV2H 2TGPZ 3V7TA 4AN7A 1C5WB 4A1VA 5DP8A 2BLVA 2ZKSA 2D1JA 2Y5FA 3VGCC 2YOLA 1EQ9A 1DLKB 3MO9A 3F6UH 3SI3H 3RU4T 1Z71A 2PKSC 1GHXH 2TRMA 3M5OA 3LGUA 3ZZCA 3MO6A 3EA8A 4K5ZA 5FBIA 4JZFH 1Q3XA 1TGNA 1P9SA 4AYYB 5EW1H 2PTCE 2CMYA 4Y8XA 3SNCA 3V3MA 2QN5T 2PTNA 5E0JA 4ZHLU 1AU8A 3FP6E 3RP2A 1KY9A 2HNTC 1P03A 1PYTC 2BD3A 2XTTB 1V2KT 4DVAU 2VIDA 1HLTH 2ALVA 2FTMA 2OQUA 2O8UA 4CRCA 2G4TA 1FNIA 1EB1H 1HJ8A 4CREA 1N6YA 4A6LA 3ITIA 1V2UT 3F1SB 1GHAF 2K1QA 1JRTA 1C5RA 4IC5A 1IQMA 3ZZAA 1ABJH 3LOXA 3SU6A 2W7SA 1BRUP 1A1RA 1DFPA 4WMFA 2ZFRH 2GV7A 3P8GA 4DY7B 1TMBH 1V6DA 1LQDB 5AHGH 3DT0H 3VFEA 3SUFA 4NWLA 3HKIB 2BVSH 1CBWB 3PV4A 4ABHA 5HMAA 1GHVH 2PUQH 4CRGA 2XC5A 2FOFA 2GCTC 1TWXB 2VB0A 3DFLA 4WWYA 1F7ZA 1OWKA 2BY6X 1BBRE 4YM9A 1O5GH 1F5RA 1SGDE 3KIDU 1EJMA 3QX5H 2FX6A 4LXBH 1ETTH 1N1LA 5ABWA 1FLEE 2NU4E 5AFZH 3M5LA 1HPGA 1QQUA 3SHCH 3L3TA 3MU5A 1L0ZA 3ZYDA 1D9IA 3ZV8A 3SV6A 1SL3A 2C8YB 4DCDA 3P17H 2BDBA 4BNRA 4CRBA 2GX4A 5BPEA 4ZHMU 2FEQH 4AFQA 5C67A 1BDAA 3HK3B 4O3TA 3O8BA 1C5YB 2KAIA 1GJ7B 1NRSH 3UUZA 1GDNA 1MD8A 1V2NT 2VIOA 3ATKA 3KN2A 4X0WU 4YTAA 2ANMH 2O8MA 1YGCH 2TGAA 3LONA 4D9QA 1QFKH 2FI4E 1V2OT 4CBNA 1UVUH 1W7XH 2G55A 2FTLE 1W10U 2A2QH 2SGQE 3RXJA 6GCHF 1CA8B 2AYWA 1ARCA 3ZZ7A 1MTSA 2ZFFH 1JRSA 1EJNA 1GI9B 2J95A 2SGPE 3PB1E 3M5MA 4BXSA 1WBGB 1G3DA 2EEKA 1CE5A 1DWEH 3LC5A 4Q80A 2BYAX 2R2WU 3RU4D 2OXSA 4K1TA 3RXSA 4ISHH 2Y5GA 2P59A 2BVXH 1DE7H 2F9OA 4D7FA 1TMTH 4K8YA 1O2ZA 2F9NA 2ZHEH 5A8YA 3SJ9A 4O9VA 1GI0A 1Y3UA 1AB9B 1TIOA 1O3MA 3O8RA 1OWIA 3RXVA 2ZGCA 2EA3A 3A8AA 4O97A 1OKXA 2PSYA 4NFFA 3ELAH 3BTWE 3A8BA 1BMNH 4UFFH 3UR6A 1O2GH 4B74A 1DWDH 1YPMH 1OXGA 2YNAA 2ZDVH 1T31A 5AF9H 2HPPH 1TX7A 2XWAA 1X7AC 4Y0YE 3S9CA 3TK9A 2STAE 1PPCE 4RSPA 4I33A 3GYLB 1A0HB 4A7IB 4U30A 1UK3A 2UUKB 2P3UB 1RTLA 1P01A 2XBWA 4AORA 1QRWA 1AUJA 1QBOA 3EA9A 1C5QA 4B76A 1AB9C 1UHBA 1BCUH 3A88A 5T3HA 3RMNH 4ZKOU 1D6RA 1UTLM 2J38A 1GI1A 1GBTA 3PROA 1EPTB 1TNGA 4TWYA 3MH6A 1S6FA 1H8DH 4MPUA 1PPZA 1FIWA 1BA8B 3TK5A 4BANB 1E35B 2AMPA 1P2OA 1ANEA 8GCHF 2J92A 2OC7A 3PMHB 1NS3A 2QV1A 1Z6JH 2UUJB 4FVBA 2FS8A 1GHBG 5GXPA 2QF3A 1IQLA 1MTUA 3Q3YA 2V3HH 2WINI 1RRKA 3F9HA 1O5DH 2O8TA 3AW1A 3KGPA 5F8ZA 1LPGB 2D8WA 1EAXA 2FYQA 5DP9A 1QB6A 5LPFA 3FAOA 1ELBA 4ABBA 5A0CA 2A2XH 3PWBA 1KXDA 3Q76A 3LGYA 1NFYA 1ZYOA 1H9IE 4YLQH 4BTUB 2JH6D 3OY6U 1AKSB 2WYGA 1O5CB 1O32A 1Z8IB 3A7TA 2ZA5A 1ZMLA 2FM2A 1BUIA 4D76A 2BTCE 1HB0B 2I6SA 3V12A 1TB6H 1IQKA 4NIVA 3Q77A 1UTNA 1WYKA 3C1KA 3F9EA 1K22H 4KELA 2BMGB 1ZZZA 1HJAB 4HI3A 3DUXH 1TRMA 2D26C 4AG2A 5FAHA 1ID5H 1LHCH 2FZZA 3M5NA 1GGDB 3ATMA 3SV9A 5EQQA 1CHGA 2CV3A 1GDQA 4IN2A 1QY6A 2HALA 2ULLA 3KF2A 1C5SA 1H1BA 1C2IA 1YCPK 1ACBE 1SGFA 4WMEA 3BF6H 1KLIH 3S69A 1BHXB 4Q7YA 4CBOA 1EP5A 4I8KA 4TY7A 4YT6H 5C20A 1ELDE 4I8JA 2C8ZB 3SU1A 2GP9B 3TJVA 4AB9A 4ZKNU 2JKHA 2A31A 2PW8H 2OLGA 1P57B 1T4UH 3F68H 3RXDA 4K1EA 2VVVA 1O2XA 3RXCA 5GWZA 1CA0C 1RXPA 3E0NB 2VH0A 1RTFB 3BEIB 5FXLA 4JYUH 2GD4B 2H5DA 1C4U2 1NPMA 1O2UA 1RIWC 3A81A 1L1NA 1KYNA 3BTEE 2AMQA 2C4FH 1LCYA 1GJ8B 2XBXA 3S0NA 1MKXH 1C9PA 4Q2KA 3RC4A 3I77A 2GTBA 3ZVGA 4H6TA 3BTKE 4X2VA 3T2NA 5LGOA 2GCTB 2A4RA 1TONA 2W7UA 2ZF0H 2V6NA 1LVMA 1MKWK 5A09A 1C5TA