1ANDA

Anionic trypsin mutant with arg 96 replaced by his
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDHKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANIONIC TRYPSIN
publication title Structure of an engineered, metal-actuated switch in trypsin.
pubmed doi rcsb
source organism Rattus rattus
molecule tags Serine protease
total genus 50
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1994-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1andA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1andA02
3UNRA 2Y5HA 3MI4A 3S0NA 1P03A 1PPCE 1KYNA 1GHVH 3RXCA 1AU8A 1P0SH 1G9IE 3RU4D 2SGFE 2OQ5A 1IHSH 4X0WU 1HV7A 3MNSA 4I8GA 4TWYA 2HNTC 4JK5A 2BD3A 3SGAE 1AHTH 4INLA 3M3SA 2ZI2H 3RXBA 4ABAA 4Y71A 1B0FA 2PKAB 4YESB 1WV7H 2BD9A 2ZKSA 2YNBA 1QB9A 1TYNA 1YCPK 3BG8A 1G3EA 3Q00A 1OP0A 2JETB 1O3PB 3SNCA 1Z8JB 5B6OA 2ZU4A 4B1TA 1BTHH 1O2TA 2NU3E 5A8YA 3RXIA 3S7KB 1LO6A 1AFQC 1DWBH 1L1JA 4A1XA 1ZRKA 2OBQA 4HI3A 2AYWA 3F9FA 6CHAC 4IN2A 3SNDA 1DX5M 4BTIB 3ZVBA 1QA0A 5DP8A 2ZGHA 2FOEA 2YOLA 4CHAC 2A1DB 1TBZH 2CV3A 3RXEA 4AYYB 1NFXA 1UK2A 4X2WA 2G4TA 2Y5GA 1IOEA 3FZZA 1Z1JA 1TNHA 5EQRA 1GJAB 1ZJKA 2BVSH 1QY6A 2G81E 1W10U 3R3GB 2TGDA 2B5TB 3PTBA 2ZDNA 2ZG0H 2ALVA 1ELGA 1G3CA 3BEFB 5T6GA 1E0FD 3TH3H 1AI8H 1OOKB 5C5OA 2CF8H 1SPJA 1KXBA 1EOJA 1KIGH 3RLWH 3SU3A 2A4RA 4JMYA 2ZECA 1F2SE 4XBCA 1O2VA 1TMTH 2A5KA 2AIPA 2VIOA 1O31A 1D3PB 1QB6A 2OTVA 4ABIA 1KLJH 5GWZA 1RRKA 1IHTH 1Q2WA 4IW4E 4YLQH 1A7SA 3A7VA 3RXVA 2Z6BD 1N8OB 4YLUA 3ZV8A 1IQMA 1O2UA 2GDEH 2ZFRH 2HALA 4YT7H 2FS9A 4NIWA 1OWDA 2B7DH 1WU1A 4UFDH 3BTQE 2LPRA 1Y3UA 1MQ6A 2BDIA 1A0LA 5HM9A 2GZ7A 5EG4A 3IWMA 1SGDE 2GGVB 1JXPA 4XOJA 1HUTH 1E38B 1HAXB 1O2SA 5EXMA 1HJAC 1YGCH 1J17T 1NRQH 1AGJA 2GCHG 1P3CA 2B8OH 3OTJE 1F5LA 1O32A 5L2YH 1WUNH 2BY8X 1IQLA 3MH5A 1Q31A 1A2CH 2EI6A 2PKSB 4X8UH 2XWBI 1O37A 1GVKB 1GBTA 4Y8ZA 1KXFA 1HIAB 3SUGA 1Q3XA 1Y5UT 4JZFH 3A88A 2FOFA 1O3CA 1FAXA 3BTFE 4CRCA 4AG2A 3N7OA 1YC0A 2F9VA 2JETC 1O3DA 4NSVA 5GPIB 4B73A 4OS5A 1QURH 4FVBA 2R2WU 1HAGE 1O2XA 1QGFA 1C5RA 1UK3A 1ESTA 1FJSA 4KTUA 1W13U 1ZOMA 4TY6A 1GJBB 2ZIQH 4XSKU 3STJA 2ZWLH 3TH2H 3TJOA 1ZSKA 1BHXB 1MTNB 5DP7A 3U1IB 3TIUA 2Y82A 2B9LA 1A4WH 4KELA 4B74A 1C1OA 1A46H 3F68H 1W12U 2PSYA 2AGGX 2ALPA 4NA8A 3A8CA 1C5OH 1P9UA 1G37A 3F9GA 2G55A 3M5OA 3QK1A 2A31A 4J1YA 1GHAF 1EJAA 1A3EH 2F9PA 1F0UA 1D9IA 4MNXA 3NPSA 5K0HA 2BY7X 2VIPA 3U8TH 3TLOA 2FI5E 3AW0A 1MKWK 1OPHB 5AVDA 2GVFA 3S7HB 2Y5FA 3FFGA 3TK6A 2XW9A 3QZRA 4Y7BA 1YF4A 3KHVA 2WV5A 4HTCH 3UOPA 1L0ZA 3AVZA 3MHWU 4ZHAA 1HXFH 1SGYE 1ETSH 1H9HE 2FX4A 2O8LA 2PLXA 4LZ1H 1GG6C 2SGEE 2QA9E 1UTNA 5C3NA 2F9NA 2H5CA 2HWLB 4CR9A 1DFPA 2AIQA 1BRCE 1P2OA 2VGCB 3UPEA 1KLTA 2ZHQH 4BXSA 4MPUA 1ZGIA 3SBKA 3RXHA 3A85A 1LHFH 1P9SA 5H4IB 3FANA 1G2MA 1FONA 4AZ2B 3M5MA 1LTOA 1O5FH 2VIWA 3QN7A 1AVGH 4ZHMU 2FTMA 1ZPZA 1THRH 2PKSC 2HVXA 1DWEH 3SU2A 3D62A 4X8VH 1DSTA 1CGHA 1C5WB 3JZ2B 4FUBA 1PPFE 1QRWA 1ZLRA 1NESE 1UVUH 1DANH 4IGDA 2Q6GA 2VWOA 1CHOF 3DD2H 1HCGA 1MZAA 1O5GH 5ETXA 5JB9S 2TRMA 4X6PA 1QR3E 1BT7A 4A6LA 1DWCH 1SG8B 1TMUH 4I8JA 2UUFB 1ZTKA 3H5CB 1T7CA 2BD4A 1TX7A 4MPWA 1BRAA 1ZGVA 2FI4E 1SGCA 4X1QU 1MTNC 1C2LA 2BDYA 1OKXA 2EI8A 3BTGE 4OS7A 2BHGA 3DHKH 4F4OC 3UR6A 4X8TH 4BAQB 1GI1A 3SOSA 2O9QA 1Y3YA 1WTGH 3SJOA 5C1YA 1TLDA 1BB0B 1G30B 2D1JA 5F8XA 4B71A 1BMAA 5A8XA 1EPTC 2XBXA 5A2MH 1AD8H 1UVOA 3GCOA 3PO1B 2A4OA 3RXGA 3ZYDA 1T4VH 2I6QA 5JBAS 1T8MA 1T8LA 2FS8A 2D26C 2BOKA 2OP9A 1V2ST 3BEIB 2HNTF 3UWIA 1PQ8A 1JIRA 3M5NA 3U98H 2FODA 1K22H 3CS0A 5EOKA 1GDUA 1GVLA 1GHBF 3ZZAA 1OYQA 3A84A 3QX5H 4I31A 3P8FA 2CN0H 3UR9A 1P12E 4FU7A 1O3GA 1UCYK 4TY7A 2AMPA 1TX8A 2P3UB 2AEIH 3SNAA 1LHEH 3RXPA 1D3TB 1W3CA 2VGCC 1CT4E 3HKIB 1S0QA 2BLQA 3C27B 1XUFA 4BXWA 1H9LB 2IJOB 2WYJA 1QJ7B 2VB0A 2GV7A 2FWWA 2D8WA 2F83A 3NKKA 4GHTA 2XXLA 4ZKOU 1MCTA 1YPGH 5T3HA 1INCA 1S6HA 1CO7E 1YPJH 2WPLS 3M37A 4CBOA 4GHQA 2Y81A 2PV9B 1MTVA 4Y11E 4NA9H 1QNJA 2UWPA 2H9EH 2FM2A 1GMCG 2AMQA 1CSOE 1RXPA 4Y79A 3V0XA 1UCYE 1VR1H 1J15A 1GI0A 4TWWA 3RLYH 1C1VH 4BOHA 2H9TH 2G5VA 3ITIA 1C2HA 2VH0A 3ODFA 4Y6DA 4NSYA 1YCPH 1UVSH 3MO9A 2V0BA 3BG4C 2ZU1A 1EZSC 2B0FA 2AH4X 1VITH 4YZUA 3S9AA 3MH6A 1AZZA 3MWIU 4FVDA 2P94A 2V35A 2C93B 3A86A 1NT1A 1MTUA 1WCZA 1O3HA 3SV7A 1C5VA 1N6YA 5FBEA 2CHAB 1C1MA 1TRNA 1LDTT 4ISLA 1NFYA 1O30A 4D9QA 2O8MA 2NU4E 1JOUB 4JZIA 3ZVGA 2F9BH 2Z9JA 2C8ZB 1V2TT 1ZMNA 1MD7A 4Q7ZA 2M5TA 1C1TA 3A7XA 1W8BH 1GJ9B 3SI4H 1LVYA 1OXGA 3PLKA 4H42U 4OS6A 3KN2A 3UY9A 1GJ7B 4K8YA 5EODA 4UONA 1O39A 2FI3E 1LHDH 3QGJA 4NWLA 4R0IA 2ZQ1A 4CRBA 1OSSA 3DT0H 4JYUH 2JH0D 2SGDE 2ZF0H 1SSXA 3UREA 2Z7FE 1O3KA 2C90B 2ZFTA 4I8KA 1V2OT 4X6OA 1TGCA 3RXJA 1NU7B 2C8XB 1A5GH 4X1SU 1PPZA 4AYVB 2QAAA 1PYTD 1XUKA 1V2PT 1BTYA 3BIUH 3TH4H 2BD7A 2ZTYA 4K3JA 1SI5H 8GCHF 1C2DA 5EW1H 1AKSA 1QJ1B 4ISNA 1O3OA 5EXLA 4H4FA 2G00A 3GCTG 1QFKH 3P6ZB 3LONA 2W5EA 1O2NA 3P8GA 1TRMA 5DP3A 1FDPA 3PLPA 1BTZA 1C1NA 2BYAX 1TPOA 3MH7A 1K21H 1EASA 3NCLA 1G3BA 1ZPCA 1ZHPA 3QUMP 1DOJA 3M36A 3SU1A 1P11E 1DLEA 4MQAA 1MKXK 3VB3A 3RMOH 3P95A 2OUAA 1Z7KA 1L4DA 1EAXA 1MD8A 3RXLA 1BTWA 1B5GH 5DP9A 3ELAH 5LGOA 2ZTXA 3RM2H 2P59A 2ANYA 1G3DA 1GMDF 1OWIA 1YP9A 3RXMA 1C5YB 2J2UA 4XBBA 3LGIA 3I77A 4FUCA 4DIIH 1L1NA 1RD3B 1BQYA 1O2ZA 2PUQH 2OBOA 2VU8E 1X7AC 3E0NB 4Q80A 1O33A 4NA7A 2A5AA 2BY6X 3MTYA 1VCQA 2BQ6B 2CHAC 3ZVAA 1O2GH 2FOHA 1WOFA 3TPIZ 2V3OH 3BF6H 4AG1A 1UTLM 1GL1A 1AQ7A 1FQ3A 2QF3A 3TK5A 2Z9KA 3SHAH 1BJVA 4FU8A 2VVCA 2ZA5A 3BEUA 3MNBA 1CE5A 1OWEA 7KMEH 4LK4A 3RU4E 5J4QA 5ESBA 1QTFA 3MFJA 1F5RA 1NM6A 4FU9A 1RTLA 3A87A 1BCUH 1MBQA 3ATWA 3LJOA 3PTNA 1HJ8A 3O8RA 1MKWH 1QCPA 1DUAA 3SO3A 1SVPA 5AFYH 4X2XA 3L3TA 2BDAA 1D6RA 3OX7U 3AW1A 2QIQA 5FX5A 2R3UA 4JZDH 1A3BH 5BRRE 1C5ZB 3GY3A 3MYWA 1OWHA 3WY8A 2CMYA 1ANCA 4JYVH 4XE4A 1K1JA 1S83A 2RA3A 4YT6H 4ASHA 4WMDA 2GMTB 2R9PA 1BZXE 1V2NT 4NIVA 1NN6A 1C4V2 1SL3A 4I8LA 4INKA 1K1OA 3M3VA 2BLWA 3VEQB 2OC8A 5K7RA 3BSQA 1NZQH 4NZLA 3FAOA 1LQEA 1H1BA 4JCNA 1HLTH 3LOXA 2FDAA 4A92A 5GCHG 5DGJA 3QWCH 4X8SH 1CVWH 3PWBA 4AORA 4DW2U 5C2ZA 1EKBB 1ESAA 2ZU2A 3EDXB 1EB1H 2WPMS 4AB9A 1ZTLA 1AKSB 2ZGJA 1EAUA 1GBAA 3U8OH 4VGCB 5CHAB 1XM1A 3ODDA 1PPGE 2TBSA 5EXNA 3SUFA 1LMWB 2VH6A 1MAYA 1SLWB 3RXTA 1GHYH 1G36A 5JDUB 1GBDA 2ZFSA 1O0DH 1ZSLA 1KXCA 1VCPA 4BNRA 4GSOA 4ZMAH 2GDDA 1WAYB 3VB4A 4WMFA 1GI4A 1ABJH 3T25A 1HAZB 3U9AH 4UFFH 2UUJB 1W11U 4Y76A 5T6DA 1AVWA 2A45B 3E91A 3VB6A 1W14U 3LGYA 1P2NA 1TNKA 5E2OA 2BLOA 1CT0E 3MO6A 2PHBA 1DUEA 2ODPA 2A4GA 1V2QT 3UQOA 1TGTA 1WQSA 3AAVA 2Q6FA 1UK4A 2OC0A 2G5NA 4E7NA 1GBBA 1S84A 4Q2KA 2EI7A 1ORFA 4CR5A 1CT2E 1C2JA 2BQWB 2FESH 4JZEH 3OSYA 3TJNA 2WUCA 3ZVEA 1LVMA 4UE7H 2AS9A 2H1UA 3SV9A 1GI2A 1RTFB 2F9UA 4FUIA 4D8NA 2TPIZ 1QRZA 1XVMA 1YM0A 3O8BA 1AZ8A 1O2IA 1P8VC 5FBIA 3UWJH 4B75A 3K9XB 1OX1A 4JZ1A 1LKBA 4WH6A 4BANB 1C5NH 1VITF 1HFDA 1DSUA 1YYY1 1XX9A 1FAKH 1QBNA 1RIWB 3B8JA 1O2JA 1TNJA 2THFB 2IN2A 3RDZA 2BDCA 1ZHRA 1A61H 1V2VT 1UCYH 4TPIZ 1UVPA 2ZHFH 1IQKA 1AWFH 1P06A 5GJ4B 2Z94A 2A0QB 2GMTC 4Y0YE 4CH2B 1SR5C 1TNLA 2FOGA 3A7WA 5IYTA 4U2WA 1GMHG 1SGQE 4AFUA 1P04A 3SORA 5C1UA 5EU8A 3EGKH 1ANBA 1PPHE 5C1XA 1C4U2 2XBWA 4WMEA 1HJ9A 7LPRA 5CE1A 2NU2E 3LU9B 2J9NA 1YLDA 3KQDA 5SGAE 1F0SA 4GLYA 1QL7A 5A0BA 1LPKB 1AE5A 4JYTA 1IQHA 4O3UA 2HPQH 1EZQA 3HPTB 2JH5D 1IQFA 3ZVCA 3CS7A 2BDBA 2ZEBA 2R0KA 3E90B 1DICA 2ZDMA 1C2IA 4VGCC 4LXBH 2STAE 5F6MA 1W7XH 2RA0A 3O8CA 1BTUA 1GVZA 4QT8C 2F9OA 4E06H 2J92A 3GY6A 1SMFE 1TABE 1TX6A 2W3IA 2BOHB 1ELAA 3GY7A 3MOCA 3P70B 1T8OA 2ANMH 1O5DH 2A32A 1P2JA 1BDAA 4K8BA 1GJ4H 2VVUA 2NU0E 4WF8A 3S9CA 3DA9B 2ASUB 1VJ9U 2AGIX 3M3TA 3P8OA 1MBMA 1HRTH 1C1SA 1GI7B 3RXKA 3ATIA 4NIYA 3P17H 3S9BA 3OU0A 1A0HB 5DP4A 8ESTE 4YM9A 3GICB 4BTUB 1HXEH 7GCHF 4AGKA 1C2FA 1TAWA 1N8OC 1HGTH 1QHRB 2BD8A 1QB1A 3RXAA 4J2YB 4I32A 5HMAA 2ZCLP 4MNYA 2WUBA 1E37B 2TGPZ 4FXGH 1ZRBA 3KNXA 6GCHG 2XRCA 5J4SA 5F03A 1NRPH 2AFQB 2H9HA 2CXVA 2QYIA 2F3CE 1NPMA 1RIWC 1MAXA 4I33A 4K1EA 1IQGA 1HAHH 1HNEE 2QXGA 1P2QA 3TU7H 4CRAA 1C2MA 3KQCA 4LOYH 1RJXB 2A2QH 1GI5A 3ESTA 4DY7B 1ZPBA 1GWAA 3S69A 3ZZCA 3Q76A 2ZO3H 1F5KU 5FXLA 2UWOA 1ID5H 4DT7B 2FOMB 3KL6A 4THNH 1LQDB 1C5SA 1WQVH 3PROA 1UHBA 5LPFA 1FY8E 2XYAA 2G8TA 1SGTA 3SV8A 1MQ5A 4K1SA 4HZHA 3W94A 2R2MB 1BMLA 3NK8A 3IITA 1ZSJA 3UNSA 1J9CH 2OLGA 3HGPA 3LT3A 1S81A 2GP9B 3EA8A 3PMBB 2ZGBH 2BXUH 1HB0B 4WH8A 4UFGH 4ABHA 1XUIA 2EA3A 1AE8H 2STBE 3I78A 2OD3B 5AHGH 1C5UA 1SC8U 3O8DA 2VVVA 5I46H 1SFQB 4ISOA 1MKXH 2F91A 2EC9H 2LNCA 4YOGA 2DE8A 1T31A 1VGCB 2ILNA 1TOCB 3QZQA 1TIOA 5E2PA 1C9PA 2BB4A 1A5IA 1QL9A 1TA6A 1O3JA 1AWHB 2HPPH 1CHGA 1G32B 1TQ7B 3Q3YA 8LPRA 3UFAA 4CREA 5GDSH 1C2GA 3OYPA 2J4IA 2V6NA 4D7FA 1EUFA 2OXSA 4INHA 3EAJA 2A7CA 3KQEA 1EJNA 1ELFA 2DUCA 5F8ZA 1GJ6A 5A0CA 1GDNA 1GI6A 1PQAA 1HAVA 4AOQA 5E0JA 4KGAA 3A7TA 4ZXYH 1S6FA 2ZDVH 2ZGCA 3A7ZA 1ETRH 2SGAA 1SGEE 4D76A 1TNGA 5EGMA 2H6MA 2UWLA 1MH0A 1YPHE 1NRSH 5DPAA 2BZ6H 1SLVB 1QJ6B 2ZDAH 2G52A 3VGCB 4ZH8A 3BTWE 4WXVA 3V12A 1Z6JH 2PWXA 1FY5A 1EJMA 1J16A 3PV4A 1P3EA 2RG3A 3L6PA 2FYRA 3RUOA 2O8UA 2NWNA 1K1MA 1NFUA 1E36B 1UTJA 4TYDA 1IQEA 2BMGB 1UTMA 2Y7XA 1KXEA 1CQQA 2RDLA 1C5XB 5HM2A 5EPNA 2SGQE 1N6XA 2VIVA 1O3IA 3SUEA 2ZHEH 1C1QA 5EQQA 3ATLA 2OC1A 3T5FH 1ZTJA 3HGNA 3RXSA 4DJZB 1GCDA 1NFWA 4O03A 2BM2A 1GL0E 3E8LA 2IOTA 2PGBB 2Y6TA 1NRRH 2WPJS 5JPMH 2GD4B 3SU6A 3D23A 1C2EA 2JKHA 1EB2A 3AAUA 1TB6H 3GCHB 3RXFA 4LZ4B 1P09A 2C4FH 1V2JT 1P10A 1NROH 1AO5A 1UHBB 3PMHB 4MPXA 2QF0A 1CU1A 4X1NU 1LVBA 2BTCE 3K2UA 3MMGA 4XBDA 1SLUB 1LHGH 4JK6A 3D49H 1QL8A 3SJIA 1O5BB 1XXDA 1GHAG 4WVPE 1DXPA 1NS3A 5HYOA 1VGCC 7ESTE 3PO1C 4IBLH 2HRVA 1AFEH 4K2YA 1PQ7A 4CRGA 1GBEA 2Z9GA 4AFSA 1ELDE 3TNTA 3SJ8A 3RU4T 3JZ1B 4BAMB 3URDA 3V13A 2FTLE 3P8NA 1SOZA 1MMJN 1K1NA 1GJDB 3EE0B 3ZZ8A 1XUGA 3SJKA 1AB9B 2ANKH 1SGNE 1B7XB 4K5ZA 3ZZ3A 4ISHH 3B9FH 2R3YA 4YOJA 4ZUHA 5GXPA 1AN1E 2ZCHP 4UDWH 3F1SB 2FXRA 3A83A 1QA7A 4UFEH 3SNBA 3K6ZA 3TVJB 2Q6DA 1Z8IB 1EZXC 1RS0A 3E0PB 3VB7A 2PTCE 1YPMH 2UUYA 5FCRA 1Y5BT 2ZPQA 1QIXB 3F6UH 3MO3A 1DS2E 3V7TA 3VGCC 3R0FA 3UQVA 4ABFA 2GCHF 3QTOH 3SI3H 1ELTA 1FNIA 1NO9H 2A7JA 3D65E 1FXYA 1ZMLA 4F49A 2UUKB 2WINI 2HGTH 1KSNA 1ZZZA 4AFZA 3GISB 1O3AA 2ODYB 1SHHB 3A8DA 1GHZA 5DK1A 3U8RH 1XKBC 1Z71A 1NU9A 1V2MT 3M7QA 3T27A 1V2RT 2ZU5A 3MU4A 1THSH 3LH3A 2BQ7B 3ATKA 1GMHF 3NZIA 3U1JB 1G2LA 4X1RU 2FO9A 1O3EA 4U01A 1FPHH 3HK6B 1CHOG 1SGFA 3TGJE 1CA8B 5A09A 4UEHH 3EQ0H 1JMOH 1W7GH 2Y80A 1F0TA 3T26A 1W0ZU 1CBWB 4NWKA 2OQUA 2I6SA 1BUIA 3SW2B 1LHCH 1W2KH 5DJ7A 1K1PA 9LPRA 1O2LA 3RMMH 1MTSA 3LDXH 1O2MA 3ZZDA 5A8ZA 4OS2A 5FPTA 3GCHC 2J94A 1HYLA 2GZ9A 1HAPH 1BRBE 4MNWA 4RKOB 5G4BA 4GUXA 5FAHA 2PUXB 3GDUA 3GY5A 1O3MA 2QY0B 3SQHE 1PPBH 3TGKE 1W0YH 4DG4A 2VINA 1C1UH 4B2CA 2JH6D 2QXHA 1DVAH 3M7UA 5T6FA 1MTWA 2GKVE 1O2RA 2PFEA 2GT8A 1GJCB 1UVTH 2Q1JA 1ZMJA 3Q3XA 2VWMA 2O8TA 2BX3A 2BVXH 5ABWA 2WPHS 5ESTE 5E8EH 1AB9C 1O3NA 5JYIA 1C5QA 1TOMH 2GV6A 1GHBG 1GI3A 2XBYA 1WSSH 3PWCA 1SQTA 1UTPA 4XDEA 1D3QB 1C2KA 1O2QA 1Y8TA 4NGAH 3VXEH 3TJUA 3SHCH 1TRYA 3U69H 3SQEE 5HGGA 4NIXA 4MLFB 2W7UA 5FHTA 4DOQA 5JBBS 1TWXB 3LPRA 3VFEA 2A2XH 2FLBH 3M61U 1BHXF 2GTBA 5LPRA 1HAIH 4GCHG 1GBFA 1PPEE 6ESTA 3GDVA 1HJAB 4YTAA 1TQ0B 2XCNA 3UNQA 4XFQA 4X6MA 1N1LA 2BVRH 1LCYA 1AIXH 1ZJDA 3UUZA 1JRTA 3QGNB 4K69A 4KTCA 3Q77A 3GDSA 4Y10E 5TCCA 2ZHWH 5FCKA 2BD5A 4MVNA 1NY22 1CA0B 1O2PA 3RM0H 3RXRA 5BPEA 4A5TS 1O2WA 3FVFB 3MNXA 4DCDA 4FUHA 2W3KA 1V2KT 5LPEA 1TONA 3ZVDA 1TALA 1EZUC 1CGJE 1DY8A 2IPHA 3RC4A 1CBWC 1GBKA 2PR3A 5DO4H 3EA9A 4UD9H 3SGBE 1O3FA 3BTTE 1HPGA 2FX6A 4KP0A 3M5LA 2FOCA 4RN6A 1EPTA 4BTTB 3CENA 1EP5A 1ESBA 2C3SA 3KF2A 4WJG2 2P95A 1EATA 2ZNKH 1BIOA 1SB1H 4ZHLU 4CRDA 1YPHC 2Z9IA 4HGCA 1O36A 3LIWA 4NFEA 5JBTA 1F7ZA 3BTDE 2ZC9H 1P02A 1TBQH 1YKTA 1E35B 3TJVA 1E34B 3FP6E 2A5IA 2PGQB 1M9UA 4OGXA 5FPYA 1DPOA 3K65B 1ZHMA 1UTQA 1JBUH 1A1RA 5AF9H 1L1GA 1GHWH 1FMGA 4BAHB 1A0JA 3PLBA 4NCYA 1EP6A 3RXOA 1F0RA 1JRSA 1KDQA 1DWDH 3F9HA 1GG6B 5TCAA 3ZZ9A 4E05H 2XCFA 1EXFA 4CRFA 1ZR0A 2ULLA 1GI9B 4ZKNU 4DIHH 4A1VA 1A5HA 1C1PA 1GBMA 4E7RG 4A7IB 5JBCS 1FPCH 3GOVB 2A4QA 1J8AA 1BMMH 3ZZ5A 1BBRK 3RP2A 2FLRH 1V3XA 1C4Y2 1ACBE 1FN8A 2J95A 3MH4A 8KME2 2QV1A 3H7TA 2G51A 1ELCA 4FUEA 2FYQA 1SGFG 4O9VA 5C5NA 1RTKA 1O35A 1D3DB 1K9OE 8GCHG 4Y7AA 3RMLH 5IDKA 3UTUH 1Z1IA 2GCTB 1CA0C 1GMCF 2FOBA 4KTSA 1ARCA 2XC4A 1DLKB 4DGJA 2ZP0H 1L2EA 3A80A 3ZZ4A 3PB1E 4B76A 1ABIH 3RXDA 4O3TA 1P2MA 1YCPM 3MNCA 1D4PB 3SZNA 4RKJB 1O38A 2FPZA 2VWLA 1Y59T 5CHAC 4I7YH 1LKAA 3TGIE 1XUJA 4IC5A 1FI8A 1WBGB 1PYTC 1B0EA 1UO6A 1C5PA 4DVAU 1BBRE 3QDZB 3GY8A 2P8OB 2PW8H 3VXFH 1DDJA 4H6TA 3RC5A 1DITH 2SGPE 2BZAA 1EAWA 2ZPRA 3BTKE 2ZQ2A 1GGDB 4NFFA 3W95A 2BLVA 3ATMA 1GMDG 1GJ5H 2FOAA 4CH8B 4IS5A 1EOLA 2TGAA 3M7TA 1MZDA 4BAKB 4X2YA 5EQSA 1H9IE 4HFPB 1BRUP 1P57B 1SFIA 1LPGB 1GDQA 4FUFA 3KEEA 1OP2A 3LKWA 1O2KA 1YPEH 2QXIA 1EPTB 1Z6EA 1O2OA 1AY6H 1IQNA 4IC6A 3SU0A 2ESTE 1H8IH 1RFNA 2A7HA 3SNEA 2ZZUH 1KTTB 2AMDA 1S85A 4BAOB 3BV9B 2QCYA 6LPRA 3GYLB 2J34A 1D6WA 1KTSB 3T2NA 1J14A 5C67A 2C8YB 3GYMA 1ANDA 2ZFQH 1AUJA 1YBWA 1FY1A 1ELEE 1K2I1 3A7YA 4YOIA 1BITA 4R8TB 3LGVA 9ESTA 1XUHA 1CGIE 1TE0A 3LGTA 1BTPA 2XC5A 3A8BA 4WXIA 5E0HA 1XXFA 1EQ9A 4D7GA 1FN6A 3QO6A 4PROA 3F9EA 4K60A 1H4WA 1FY3A 1SGIB 1S5SA 2GX4A 1TMBH 2ZCKP 1KDQB 1SGPE 2WV4A 4YO9A 1Y3VA 2ZGXH 2Z3DA 3LH1A 4X1PU 3GCTF 3SGQE 2XWAA 2XBVA 2PTNA 2FMJA 1OYTH 1SGRE 3QLPH 3BTEE 1MCVA 2ZFPH 4U32A 2OCVB 4Q7XA 3ZZ7A 3DUXH 2GCTC 3SUDA 1NC6A 1PJPA 2BDGA 3ZYEA 3T62A 2RCEA 1OS8A 3K6YA 3HATH 4I8HA 1P05A 5EW2H 1C5MD 2SNVA 2VIDA 4M7GA 4SGAE 3FZDA 1EX3A 3BTME 1K1IA 3B23B 4MPVA 4MDSA 3A89A 1GBHA 2OINA 5I25A 3ZV9A 1QBVH 2P16A 2VWNA 5L30H 1FIWA 2P8OC 2QN5T 2HNTE 1C1RA 1GGDC 1K28D 3HKJB 2P3FH 2Z9LA 3BG4B 4ZXXH 1NRNH 2TGTA 3MU8A 2ZHDA 1TFXA 3EA7A 1C5TA 4B2AA 3SU4A 3A82A 3GCNA 4O97A 1U6QA 5GIBA 3NUMA 3ZZ6A 1XMNB 3A81A 1O5CB 3SV2H 1QQUA 1YPLH 2W7SA 4AGJA 3ZZBA 5A0AE 2AGEX 1Y3WA 4ZKSU 2ZTZA 1YLCA 4X2VA 2FP7B 1GCTB 3PYHA 3KGPA 4OGYA 2V3HH 1SHYA 4SGBE 1SBWA 1GHXH 2CGAA 1HBTH 2ANWA 4AB8A 1DY9A 4Q7YA 3A8AA 1TNIA 2ODQA 1TPPA 5C20A 5LH8A 4AFQA 3RMNH 2C8WB 3BTHE 3E1XB 1OP8A 1T8NA 3SN8A 1O2HA 1WYKA 4WWYA 2ZPSA 2HOBA 1T4UH 3SU5A 1SQAA 1VITG 2VNTA 1UMAH 1ETTH 1AVXA 3QTVH 2H5DA 3PMJA 5CMXH 1GBLA 1KY9A 4GCHF 2G4UA 2H2ZA 1PQ5A 2YNAA 2TIOA 2K1QA 4IN1A 2GZ8A 1C1WH 2QGRA 1JIMA 3NXPA 1V2UT 3OY5U 1BTXA 3H7OA 2BD2A 1THPB 1NTPA 4OS4A 4Y8YA 3URCA 3CP7A 3E6PH 1ZYOA 4MG3A 1TA2A 5F8TA 1DE7H 1FUJA 2EEKA 3HK3B 5GCHF 1TPAE 1ELBA 1V6DA 4Z0KA 1VCWA 1LPZB 3EYDA 1QBOA 2QC2A 2R0LA 5JB8S 1GPZA 1GBCA 1FY4A 1S82A 4ZROA 3LJJA 2SNWA 4IMZA 1HAOH 4Y8XA 1OWJA 4DURA 1GI8B 2HLCA 2O8WA 2KAIA 4CBNA 1O34A 1HAYB 2XC0A 4MNVA 2FIRH 1IAUA 1V2LT 1IQIA 1WTHD 3BIVH 3ENSB 1VZQH 1BA8B 4FUJA 2ZFFH 1O2YA 1O3BA 2Z3EA 1ANEA 4GVUA 5E0GA 1MU6B 1UTKA 2NU1E 1IQJA 3LC3A 3V3MA 1H8DH 3VB5A 1XVOA 1TGNA 1O5EH 4K1TA 3GY4A 5FX6A 1Y3XA 1P01A 1L4ZA 2OC7A 3PMAB 1FIZA 1C9TA 4WY3A 4ZKRU 1BOQA 1SLXB 1GCTC 1XKAC 3ZVFA 7GCHG 1GBIA 2P3TB 3KQBA 1OWKA 1TGSZ 3NWUA 4OS1A 2P93A 2BXTH 1DT2A 2Y7ZA 3GY2A 4KKDA 2D2DA 3UIRA 1Y5AT 3FP7E 2WPKS 1VJAU 2XNIA 2PKAA 2VIQA 4D9RA 1KXDA 1TGBA 1DXWA 1HAVB 4A1TA 2BY5X 1MUEB 3T28A 1UJ1A 4TPYA 3T29A 1V2WT 1T32A 1PFXC 3OY6U 2ZDLA 2WPIS 3G01A 3E3TA 2FEQH 1LVOA 3MU1A 4ABBA 1BJUA 4ABEA 3E16B 3VPKA 3L33A 3LC5A 3PM3A 5FPSA 3LGUA 3RXQA 1C5LH 2XTTB 2GT7A 3SV6A 1BBRH 1Z8RA 4ABDA 4Z6AH 3Q3KA 1FLEE 1F92A 4GAWA 1FV9A 1TBRH 1AFQB 3MU0A 4B2BA 5PTPA 5L2ZH 2BX4A 1SOTA 6CHAB 3LGWA 3STIA 1P2KA 1O3LA 4FUGA 4FUDA 4ZAEA 4ESTE 1BMNH 1QRXA 3MU5A 1Z8GA 2W26A 4CHAB 3C1KA 1K1LA 3TITA 3RC6A 1SQOA 2CF9H 1P2IA 5L6NH 4GPGA 2J38A 3AASA 3IG6B 1FZZA 1YPKH 4AN7A 3TK9A 1RGQA 2PSXA 2VJ1A 4ABJA 5DKMA 1O5AB 5DG6A 4IMQA 5DP5A 5DP6A 2KAIB 5AFZH 3SJ9A 2ZU3A 4RSPA 4H6SB 4X6NA 3DFLA 1ARBA 4MTBA 1QQ4A 1KXAA 2CJIA 1EAIA 2BDHA 5TJXA 4U30A 4ISIH 2DE9A 4NZQA 4ABGA 3P92A 1TPSA 1ELVA 3M35A 3UOUA 1AMHA 1KLIH 1DM4B 1HDTH 1MU8B 3KCGH 2SFAA 3KIDU 3I29A 3DFJA 2AERH 4Y0ZE 2FZZA 1JWTA 3FP8E 4AX9H 3RXUA 1GBJA 1S0RA 2BY9X 3BN9A 4NG9H 3TNSA 5HXFA 2QXJA 1UTOA 5EPYA 2Z3CA 6GCHF 1GJ8B 2ZDKA 1AUTC 1HIAA 2WYGA
chains in the Genus database with same CATH superfamily
3UNRA 2Y5HA 3MI4A 3S0NA 1P03A 1PPCE 1KYNA 1GHVH 3RXCA 1AU8A 4I86A 1P0SH 1G9IE 3RU4D 2SGFE 2OQ5A 1IHSH 4X0WU 1HV7A 3MNSA 4I8GA 4TWYA 2HNTC 4JK5A 2BD3A 3SGAE 1AHTH 4INLA 3M3SA 2ZI2H 2OK5A 3RXBA 4ABAA 4Y71A 1B0FA 2PKAB 4YESB 1WV7H 2BD9A 2ZKSA 2YNBA 1QB9A 3PRDA 1TYNA 1YCPK 3BG8A 1G3EA 2KX4A 3Q00A 1OP0A 2JETB 1O3PB 3SNCA 1Z8JB 5B6OA 2ZU4A 4B1TA 1BTHH 1O2TA 2NU3E 3UAIC 5A8YA 3RXIA 3S7KB 1LO6A 1AFQC 1DWBH 1L1JA 4A1XA 1ZRKA 2OBQA 4HI3A 2AYWA 3F9FA 6CHAC 4IN2A 3H09A 3SNDA 1DX5M 4BTIB 3ZVBA 1QA0A 5DP8A 2ZGHA 2FOEA 2YOLA 4CHAC 2A1DB 1TBZH 2CV3A 3RXEA 4AYYB 1NFXA 1UK2A 4X2WA 2G4TA 2Y5GA 1IOEA 3FZZA 1Z1JA 1TNHA 5EQRA 1GJAB 1ZJKA 2BVSH 1QY6A 2G81E 1NBMD 1W10U 3R3GB 2TGDA 2B5TB 3PTBA 2ZDNA 5EJ1A 2ZG0H 5DSFA 2ALVA 1ELGA 2IPQX 4FETA 1G3CA 3BEFB 5T6GA 1E0FD 2YMSD 3TH3H 1AI8H 1OOKB 3W1EA 5C5OA 2CF8H 1SPJA 1KXBA 1EOJA 3DCLA 1KIGH 3RLWH 3SU3A 2A4RA 3N7EA 2ZECA 1F2SE 4JMYA 4XBCA 1O2VA 1TMTH 2A5KA 2AIPA 2VIOA 1O31A 1D3PB 1QB6A 2OTVA 4ABIA 1KLJH 5GWZA 1RRKA 1IHTH 1Q2WA 4IW4E 4YLQH 1A7SA 3A7VA 3RXVA 2Z6BD 1N8OB 4YLUA 3ZV8A 1IQMA 1O2UA 2GDEH 2ZFRH 2HALA 4YT7H 2FS9A 4NIWA 1OWDA 2B7DH 1WU1A 2KCPA 4UFDH 3BTQE 2LPRA 1Y3UA 1MQ6A 2BDIA 1A0LA 5HM9A 2GZ7A 5EG4A 3IWMA 1SGDE 2GGVB 1JXPA 4XOJA 1HUTH 1E38B 1HAXB 1O2SA 5EXMA 1HJAC 1YGCH 2AHME 1J17T 1NRQH 1AGJA 2GCHG 1P3CA 2B8OH 3OTJE 1F5LA 1O32A 5L2YH 1WUNH 2BY8X 1IQLA 3MH5A 1Q31A 1A2CH 2EI6A 2PKSB 4X8UH 2XWBI 1O37A 1GVKB 1GBTA 4Y8ZA 1KXFA 1HIAB 3SUGA 1Q3XA 1Y5UT 4JZFH 3A88A 2FOFA 1O3CA 1FAXA 3BTFE 4CRCA 4AG2A 3N7OA 1YC0A 2F9VA 2JETC 1O3DA 4NSVA 2J5UA 5GPIB 4B73A 4OS5A 4Q4LA 1QURH 4FVBA 2R2WU 1HAGE 1O2XA 1QGFA 1C5RA 1UK3A 1ESTA 1FJSA 4KTUA 1W13U 1ZOMA 4TY6A 1GJBB 2ZIQH 3EE7A 4XSKU 3STJA 2ZWLH 3TH2H 3TJOA 1ZSKA 1BHXB 1MTNB 5DP7A 3U1IB 3TIUA 2Y82A 2B9LA 1A4WH 4KELA 4B74A 1C1OA 1A46H 3F68H 1W12U 2PSYA 2AGGX 2ALPA 4NA8A 5DN6D 2XNDD 3A8CA 1C5OH 1P9UA 1G37A 3F9GA 2G55A 3M5OA 3QK1A 2A31A 4J1YA 1GHAF 2IJD1 1EJAA 1A3EH 2F9PA 1F0UA 1D9IA 4MNXA 3NPSA 5K0HA 2BY7X 2VIPA 1E1QD 3U8TH 3TLOA 2FI5E 3AW0A 1MKWK 1OPHB 5AVDA 2GVFA 3S7HB 2Y5FA 3FFGA 3TK6A 2XW9A 3QZRA 4Y7BA 1YF4A 3KHVA 2WV5A 4HTCH 3UOPA 1L0ZA 3AVZA 3MHWU 4ZHAA 1HXFH 1SGYE 1ETSH 1H9HE 2FX4A 2O8LA 2PLXA 4LZ1H 1GG6C 2SGEE 2QA9E 1UTNA 5C3NA 2F9NA 2H5CA 2HWLB 4CR9A 1DFPA 2AIQA 1BRCE 1P2OA 2VGCB 3UPEA 1KLTA 2ZHQH 4BXSA 4MPUA 1ZGIA 3SBKA 3RXHA 3A85A 1LHFH 1P9SA 5H4IB 3FANA 1G2MA 1FONA 2YMSB 3F3BA 4AZ2B 3M5MA 1LTOA 1O5FH 2VIWA 3QN7A 1AVGH 4ZHMU 2FTMA 1ZPZA 1THRH 2PKSC 2HVXA 1DWEH 3SU2A 3NRLA 3D62A 4X8VH 1DSTA 1E1RD 1CGHA 1C5WB 3JZ2B 4FUBA 1PPFE 1QRWA 1ZLRA 1NESE 1UVUH 1DANH 4IGDA 2Q6GA 2VWOA 1CHOF 3DD2H 1HCGA 5EJZA 1MZAA 1O5GH 5ETXA 2L74A 5JB9S 2TRMA 4X6PA 1QR3E 1BT7A 4A6LA 1DWCH 1SG8B 1TMUH 4I8JA 2UUFB 3PV5A 1ZTKA 3H5CB 1T7CA 2BD4A 1TX7A 4MPWA 1BRAA 1ZGVA 2FI4E 1SGCA 4X1QU 1MTNC 1C2LA 2BDYA 1OKXA 2EI8A 3BTGE 4OS7A 2BHGA 3DHKH 2PP6A 4F4OC 3UR6A 4X8TH 4BAQB 1GI1A 3SOSA 2O9QA 1Y3YA 1WTGH 3SJOA 5C1YA 1TLDA 1BB0B 1G30B 2D1JA 5F8XA 4B71A 1BMAA 5A8XA 1EPTC 2XBXA 5A2MH 1AD8H 1UVOA 3GCOA 3PO1B 2A4OA 3RXGA 3ZYDA 1T4VH 2I6QA 3PV2A 5JBAS 1T8MA 2FS8A 1T8LA 1KMHB 2D26C 2BOKA 2OP9A 1V2ST 3BEIB 2HNTF 3UWIA 1PQ8A 1JIRA 3M5NA 2HVYB 3U98H 2FODA 1K22H 3CS0A 5EOKA 1GDUA 1GVLA 1GHBF 3ZZAA 1OYQA 3A84A 3QX5H 4I31A 3P8FA 2CN0H 3UR9A 1P12E 4FU7A 1O3GA 1UCYK 4TY7A 2AMPA 1TX8A 2P3UB 2AEIH 3SNAA 1LHEH 3RXPA 1D3TB 1W3CA 3U28C 2VGCC 1CT4E 3HKIB 1S0QA 2BLQA 3C27B 1XUFA 4BXWA 1H9LB 2IJOB 2WYJA 1QJ7B 2VB0A 2GV7A 2FWWA 2D8WA 2F83A 3NKKA 4GHTA 2XXLA 1QZ8A 2YMSC 4ZKOU 1MCTA 1YPGH 5T3HA 2RDEA 1INCA 1S6HA 2RFKC 3FKSD 1CO7E 1YPJH 2WPLS 3M37A 4CBOA 4GHQA 2Y81A 2PV9B 1MTVA 4Y11E 4NA9H 1QNJA 2UWPA 2H9EH 2FM2A 1GMCG 2AMQA 1CSOE 5GNDA 1RXPA 4Y79A 3V0XA 1UCYE 1VR1H 1J15A 1GI0A 4TWWA 3RLYH 1C1VH 4BOHA 2H9TH 2G5VA 3ITIA 1C2HA 2VH0A 3ODFA 4Y6DA 4NSYA 1YCPH 3SYJA 1UVSH 3MO9A 2V0BA 3BG4C 2CK3D 2ZU1A 1EZSC 2B0FA 2AH4X 1VITH 4Z1MD 4YZUA 3S9AA 3MH6A 3WW7A 1AZZA 3MWIU 3SZEA 4FVDA 2P94A 2V35A 2C93B 3A86A 1NT1A 1COWD 1MTUA 1WCZA 1O3HA 3SV7A 1C5VA 1N6YA 5FBEA 2CHAB 1C1MA 1TRNA 1LDTT 4ISLA 1NFYA 1O30A 4D9QA 2O8MA 2NU4E 1JOUB 4JZIA 3ZVGA 2F9BH 2Z9JA 2C8ZB 1V2TT 1ZMNA 1MD7A 4Q7ZA 2M5TA 1C1TA 3A7XA 2L6OA 1W8BH 1GJ9B 3SI4H 1LVYA 1OXGA 3PLKA 4H42U 4OS6A 3KN2A 3UY9A 1GJ7B 4K8YA 5EODA 4UONA 1O39A 2FI3E 1LHDH 3QGJA 4NWLA 4R0IA 2ZQ1A 4ACAA 4CRBA 1OSSA 3DT0H 4JYUH 1OHHD 2JH0D 2SGDE 2ZF0H 1SSXA 3UREA 2Z7FE 1O3KA 3WWFA 2C90B 2ZFTA 4I8KA 1V2OT 4X6OA 1TGCA 3RXJA 1NU7B 2C8XB 1A5GH 4X1SU 1PPZA 4AYVB 2QAAA 1PYTD 1XUKA 1V2PT 1BTYA 3BIUH 4YXWD 3TH4H 2BD7A 2ZTYA 4K3JA 1SI5H 8GCHF 1C2DA 5EW1H 1AKSA 1QJ1B 4ISNA 1O3OA 5EXLA 4H4FA 2G00A 1FX0B 1QFKH 3GCTG 3P6ZB 3LONA 2W5EA 1O2NA 3P8GA 1TRMA 5DP3A 1FDPA 3PLPA 2LELA 1BTZA 1C1NA 2BYAX 1TPOA 3MH7A 1K21H 1EASA 3NCLA 1G3BA 1ZPCA 1ZHPA 3QUMP 1DOJA 3M36A 3SU1A 1P11E 1DLEA 4MQAA 3AK5A 1MKXK 3VB3A 3RMOH 3P95A 2OUAA 1Z7KA 1L4DA 1EAXA 1MD8A 3RXLA 1BTWA 3F0OA 1B5GH 5DP9A 3ELAH 5LGOA 2ZTXA 3RM2H 1SKYE 2P59A 2ANYA 1G3DA 1GMDF 1OWIA 1YP9A 3RXMA 1C5YB 2J2UA 2W6ID 4XBBA 3LGIA 3I77A 2EY4C 4FUCA 4DIIH 1L1NA 1RD3B 1BQYA 1O2ZA 2PUQH 2OBOA 2VU8E 1X7AC 3E0NB 4Q80A 1O33A 4NA7A 2A5AA 2BY6X 3MTYA 1VCQA 2BQ6B 2CHAC 3ZVAA 1O2GH 2FOHA 1WOFA 3TPIZ 2V3OH 3BF6H 4AG1A 1UTLM 1GL1A 1AQ7A 1FQ3A 2QF3A 3TK5A 2Z9KA 3SHAH 1BJVA 4FU8A 2VVCA 2ZA5A 3BEUA 1YY3A 3MNBA 1CE5A 1OWEA 7KMEH 4LK4A 3RU4E 5J4QA 5ESBA 1QTFA 2KCOA 3MFJA 1F5RA 1NM6A 1EFRD 4FU9A 1RTLA 3A87A 1BCUH 1MBQA 3ATWA 3LJOA 3PTNA 1HJ8A 3O8RA 1MKWH 1QCPA 1DUAA 3SO3A 1SVPA 5AFYH 4X2XA 3L3TA 2BDAA 1D6RA 3OX7U 3AW1A 2QIQA 5FX5A 2R3UA 4JZDH 1A3BH 5BRRE 1C5ZB 3GY3A 3MYWA 1OWHA 3WY8A 2CMYA 1ANCA 4JYVH 4OM9A 4XE4A 1K1JA 1S83A 2RA3A 4YT6H 4ASHA 4WMDA 2GMTB 2R9PA 1BZXE 1V2NT 4NIVA 1NN6A 1C4V2 1SL3A 4I8LA 4INKA 1K1OA 3M3VA 2BLWA 3VEQB 2OC8A 5K7RA 3BSQA 4RT1A 1NZQH 4NZLA 3FAOA 1LQEA 1H1BA 4JCNA 1HLTH 3LOXA 2FDAA 3F2GA 5EIYA 4A92A 5GCHG 2WHXA 1NBME 5DGJA 3QWCH 4X8SH 1CVWH 3KYFA 3PWBA 4AORA 4DW2U 5C2ZA 1EKBB 1ESAA 2ZU2A 3EDXB 1EB1H 2WPMS 4AB9A 1ZTLA 1AKSB 2ZGJA 1EAUA 1GBAA 3U8OH 4VGCB 5CHAB 1VKYA 1XM1A 3ODDA 1PPGE 2TBSA 5EXNA 3SUFA 1LMWB 2VH6A 1MAYA 1SLWB 3RXTA 1GHYH 1G36A 5JDUB 1GBDA 2ZFSA 1O0DH 1ZSLA 1KXCA 1VCPA 4BNRA 4GSOA 4ZMAH 2GDDA 1WAYB 3VB4A 4WMFA 1GI4A 1ABJH 2JJ2D 2WV9A 3T25A 1HAZB 1WXRA 3U9AH 4UFFH 2UUJB 1W11U 4Y76A 5T6DA 1AVWA 2A45B 3E91A 3VB6A 1W14U 3LGYA 1P2NA 1TNKA 5E2OA 2BLOA 1CT0E 3MO6A 2PHBA 1DUEA 2ODPA 2A4GA 1V2QT 3UQOA 1TGTA 1WQSA 3AAVA 2Q6FA 1UK4A 2OC0A 2G5NA 4E7NA 1GBBA 1S84A 4Q2KA 2EI7A 1ORFA 4CR5A 1CT2E 1C2JA 2BQWB 2FESH 4JZEH 3OSYA 3TJNA 2WUCA 3ZVEA 1LVMA 4UE7H 2AS9A 2H1UA 2KZ4A 3SV9A 1GI2A 1RTFB 2F9UA 4FUIA 4D8NA 2TPIZ 1QRZA 1XVMA 1YM0A 3GS9A 1AZ8A 1O2IA 1P8VC 3O8BA 5FBIA 3UWJH 4B75A 3K9XB 1OX1A 4JZ1A 4P00A 1LKBA 4WH6A 4BANB 1C5NH 1VITF 1HFDA 1DSUA 5KEDA 1YYY1 1XX9A 1FAKH 1QBNA 1RIWB 3B8JA 1O2JA 1TNJA 2THFB 2IN2A 3RDZA 2BDCA 1ZHRA 1A61H 1V2VT 1UCYH 4TPIZ 1UVPA 2ZHFH 1IQKA 1AWFH 1P06A 5GJ4B 2Z94A 2A0QB 2GMTC 4Y0YE 4CH2B 1SR5C 1TNLA 2FOGA 3A7WA 5IYTA 4U2WA 1GMHG 1SGQE 4AFUA 1P04A 3SORA 5C1UA 5EU8A 3EGKH 1ANBA 1PPHE 5C1XA 1C4U2 2XBWA 4WMEA 1HJ9A 7LPRA 5CE1A 2NU2E 3LU9B 2J9NA 1YLDA 3KQDA 5SGAE 1F0SA 4GLYA 1QL7A 2KM0A 5A0BA 1LPKB 1AE5A 4JYTA 1IQHA 4O3UA 2HPQH 1EZQA 3HPTB 2JH5D 1IQFA 3ZVCA 3CS7A 2BDBA 2ZEBA 2R0KA 3E90B 1DICA 2ZDMA 1C2IA 4VGCC 4LXBH 2STAE 5F6MA 1W7XH 2RA0A 3O8CA 1BTUA 1GVZA 4QT8C 2F9OA 4E06H 2J92A 3GY6A 1SMFE 1TABE 1TX6A 2W3IA 2BOHB 1ELAA 3GY7A 3MOCA 3P70B 1T8OA 2ANMH 1O5DH 2A32A 1P2JA 4ZCNA 1BDAA 4K8BA 1GJ4H 2VVUA 2NU0E 4WF8A 3S9CA 3FOAA 2KFWA 3DA9B 2ASUB 2K0QA 1VJ9U 2AGIX 3M3TA 3OEHD 3P8OA 1MBMA 1HRTH 1C1SA 1GI7B 3RXKA 3ATIA 4NIYA 3P17H 2V3MA 1H8HD 3S9BA 3OU0A 1A0HB 5DP4A 8ESTE 4YM9A 3GICB 4BTUB 1HXEH 7GCHF 4AGKA 1C2FA 1TAWA 1N8OC 1HGTH 1QHRB 2BD8A 1QB1A 3RXAA 4J2YB 4I32A 5HMAA 1W0JD 2ZCLP 4MNYA 5HKKD 2WUBA 1E37B 2TGPZ 4FXGH 1ZRBA 3KNXA 6GCHG 2XRCA 5J4SA 5F03A 1NRPH 2AFQB 2H9HA 5CDFE 2CXVA 2QYIA 2F3CE 1NPMA 1RIWC 1MAXA 4I33A 4K1EA 1IQGA 1HAHH 1HNEE 2QXGA 1P2QA 5FL7D 3TU7H 4CRAA 1C2MA 3KQCA 4LOYH 1RJXB 2A2QH 1GI5A 3ESTA 4DY7B 1ZPBA 1GWAA 3S69A 3ZZCA 3Q76A 3VG8A 2ZO3H 1F5KU 5FXLA 2UWOA 1ID5H 4DT7B 2FOMB 3KL6A 4THNH 1LQDB 1C5SA 1WQVH 3PROA 1UHBA 5LPFA 1FY8E 2XYAA 5B6LA 2G8TA 1SGTA 3SV8A 1H8ED 1MQ5A 4K1SA 4HZHA 3W94A 2R2MB 1BMLA 3NK8A 3IITA 1ZSJA 3UNSA 1J9CH 2OLGA 3HGPA 3LT3A 1S81A 2GP9B 3EA8A 3PMBB 2ZGBH 2BXUH 1HB0B 4WH8A 4UFGH 4ABHA 1XUIA 2EA3A 1AE8H 2STBE 3I78A 2OD3B 5AHGH 1C5UA 1SC8U 3O8DA 2VVVA 5I46H 1SFQB 4ISOA 1MKXH 2F91A 2EC9H 2LNCA 4YOGA 2DE8A 1T31A 1VGCB 2ILNA 4P02A 1TOCB 2KR7A 3QZQA 1TIOA 5E2PA 1C9PA 2BB4A 1A5IA 1QL9A 1TA6A 1O3JA 1AWHB 2HPPH 1CHGA 1G32B 1TQ7B 3Q3YA 8LPRA 3UFAA 4CREA 5GDSH 1C2GA 3OYPA 2J4IA 2V6NA 4D7FA 1EUFA 2OXSA 4INHA 3EAJA 2A7CA 5HIYA 4FOUC 3KQEA 1EJNA 1ELFA 2DUCA 5F8ZA 1GJ6A 5A0CA 1GDNA 3N99A 1GI6A 1PQAA 1YWUA 1HAVA 4AOQA 5E0JA 4KGAA 3A7TA 4ZXYH 1S6FA 2ZDVH 2ZGCA 3A7ZA 1ETRH 2SGAA 1YLNA 1SGEE 4D76A 1TNGA 5EGMA 2H6MA 2UWLA 1MH0A 1YPHE 1NRSH 5DPAA 2BZ6H 1SLVB 1QJ6B 2ZDAH 2JDID 2G52A 3VGCB 4ZH8A 3BTWE 4WXVA 3V12A 5C17A 1Z6JH 2PWXA 1FY5A 1EJMA 1J16A 3DSPA 3PV4A 1P3EA 2RG3A 3L6PA 2FYRA 3RUOA 2O8UA 2NWNA 1K1MA 1NFUA 1E36B 1UTJA 4TYDA 3OFND 1IQEA 2BMGB 1UTMA 2Y7XA 1KXEA 1CQQA 2QE7D 2RDLA 1C5XB 5HM2A 5EPNA 2SGQE 1N6XA 2VIVA 1O3IA 3SUEA 2ZHEH 1C1QA 5EQQA 3FO8D 3ATLA 2OC1A 3T5FH 1ZTJA 3HGNA 3RXSA 4DJZB 1GCDA 1NFWA 4O03A 2BM2A 1GL0E 3E8LA 2IOTA 2PGBB 2Y6TA 1NRRH 2WPJS 5JPMH 2GD4B 3SU6A 3D23A 1C2EA 1UW7A 2JKHA 1EB2A 3AAUA 1TB6H 3GCHB 3RXFA 4LZ4B 1P09A 2C4FH 1V2JT 2XOKD 1P10A 1NROH 1AO5A 1UHBB 3PMHB 4MPXA 2QF0A 5KGOA 1CU1A 4X1NU 1LVBA 2BTCE 3K2UA 3MMGA 4XBDA 1SLUB 1LHGH 4JK6A 3D49H 1QL8A 3SJIA 1O5BB 1XXDA 1GHAG 4WVPE 1DXPA 1NS3A 5HYOA 1VGCC 7ESTE 3PO1C 4IBLH 2HRVA 1AFEH 4K2YA 1PQ7A 4CRGA 1GBEA 3N7DA 2Z9GA 4AFSA 1ELDE 3TNTA 3SJ8A 3RU4T 3JZ1B 4BAMB 3URDA 3V13A 2FTLE 3P8NA 1SOZA 1MMJN 1K1NA 1GJDB 3EE0B 3ZZ8A 1XUGA 3SJKA 1AB9B 2ANKH 1SGNE 1B7XB 4K5ZA 3ZZ3A 4ISHH 3B9FH 2R3YA 4YOJA 4ZUHA 5GXPA 1AN1E 2ZCHP 4UDWH 3F1SB 2FXRA 3A83A 1QA7A 4UFEH 3SNBA 3FN8A 3K6ZA 3TVJB 2Q6DA 1Z8IB 1EZXC 1RS0A 3E0PB 3VB7A 2PTCE 1YPMH 2KCAA 2UUYA 5FCRA 1Y5BT 2ZPQA 1QIXB 3F6UH 3MO3A 1DS2E 2W6JD 3V7TA 3VGCC 3R0FA 3UQVA 4ABFA 2GCHF 3QTOH 3SI3H 1ELTA 1FNIA 1NO9H 2A7JA 3D65E 2VBCA 1FXYA 1ZMLA 4F49A 2UUKB 2WINI 2HGTH 1KSNA 1ZZZA 4AFZA 3GISB 1O3AA 2ODYB 1SHHB 3A8DA 1GHZA 5DK1A 3U8RH 1XKBC 1Z71A 1NU9A 1V2MT 3M7QA 3T27A 1V2RT 2ZU5A 3MU4A 1THSH 3LH3A 2BQ7B 3ATKA 1GMHF 3NZIA 3U1JB 1G2LA 4X1RU 2FO9A 1O3EA 4U01A 1FPHH 3HK6B 1CHOG 1SGFA 3TGJE 1CA8B 5A09A 4UEHH 3EQ0H 1JMOH 1W7GH 2Y80A 1F0TA 3T26A 1W0ZU 1CBWB 4NWKA 2OQUA 2I6SA 1BUIA 3SW2B 1LHCH 1W2KH 5DJ7A 1K1PA 3UB0A 9LPRA 1O2LA 3RMMH 1MTSA 3LDXH 1O2MA 3ZZDA 5A8ZA 4OS2A 5FPTA 4ACBA 3GCHC 2J94A 1HYLA 1SQRA 2GZ9A 1HAPH 1BRBE 2F4LA 4MNWA 4RKOB 5G4BA 4GUXA 5FAHA 4B6EA 2PUXB 3GDUA 3GY5A 1O3MA 2QY0B 3SQHE 1PPBH 3TGKE 1W0YH 4DG4A 2VINA 1C1UH 4B2CA 2JH6D 2QXHA 1DVAH 3M7UA 5T6FA 1MTWA 2GKVE 1O2RA 2PFEA 2GT8A 1GJCB 1UVTH 2Q1JA 1ZMJA 3Q3XA 2VWMA 2O8TA 2BX3A 5T1VA 5IK2D 2BVXH 4F55A 5ABWA 2WPHS 5ESTE 5E8EH 1AB9C 1O3NA 5JYIA 1C5QA 1TOMH 2GV6A 1GHBG 1GI3A 2XBYA 1WSSH 3PWCA 1SQTA 1UTPA 4XDEA 1D3QB 1C2KA 1O2QA 1Y8TA 4NGAH 3VXEH 3TJUA 3SHCH 1TRYA 3U69H 3SQEE 5HGGA 4NIXA 4MLFB 2W7UA 5FHTA 4DOQA 5JBBS 1TWXB 3LPRA 3VFEA 2A2XH 2FLBH 3DSOA 3M61U 1BHXF 2GTBA 5KECA 5LPRA 1HAIH 4GCHG 1GBFA 1PPEE 6ESTA 3GDVA 1HJAB 4YTAA 1TQ0B 2XCNA 3UNQA 4XFQA 4X6MA 1N1LA 2BVRH 1LCYA 1AIXH 1ZJDA 3UUZA 1JRTA 3QGNB 4K69A 4KTCA 3Q77A 3GDSA 4Y10E 5TCCA 2ZHWH 5FCKA 2BD5A 4MVNA 1NY22 1CA0B 2F43B 1O2PA 3OAAD 3RM0H 3RXRA 5BPEA 4A5TS 1O2WA 3FVFB 3MNXA 4DCDA 4FUHA 2W3KA 1V2KT 5LPEA 1TONA 2KCYA 3ZVDA 1TALA 1EZUC 1CGJE 1DY8A 4F48B 2IPHA 3RC4A 2V7QD 5C94A 1CBWC 1GBKA 2PR3A 5DO4H 3EA9A 4UD9H 3SGBE 1O3FA 3BTTE 1HPGA 2FX6A 4KP0A 3M5LA 2JIZD 2FOCA 4RN6A 1EPTA 4BTTB 3F0PA 3CENA 1EP5A 1ESBA 2C3SA 3KF2A 4WJG2 2P95A 1MABB 1EATA 2ZNKH 1BIOA 1SB1H 4ZHLU 4CRDA 1K0HA 1YPHC 2Z9IA 4HGCA 1O36A 3LIWA 4NFEA 5JBTA 1F7ZA 3BTDE 2ZC9H 1P02A 1TBQH 1YKTA 1E35B 3TJVA 1E34B 3FP6E 2A5IA 2PGQB 1M9UA 4OGXA 5FPYA 1DPOA 3K65B 1ZHMA 4XD7D 1UTQA 1JBUH 1A1RA 5AF9H 1L1GA 1GHWH 1FMGA 4BAHB 1A0JA 3PLBA 4NCYA 1EP6A 3RXOA 1F0RA 1JRSA 1KDQA 1DWDH 3F9HA 1GG6B 4RT0A 5TCAA 3ZZ9A 4E05H 2XCFA 1EXFA 4CRFA 3ZIAD 4M9FA 1ZR0A 2ULLA 1GI9B 4ZKNU 4DIHH 4A1VA 1A5HA 1C1PA 1GBMA 4E7RG 4A7IB 5JBCS 1FPCH 3GOVB 2A4QA 1J8AA 1BMMH 1W0KD 3ZZ5A 1BBRK 3RP2A 2FLRH 1V3XA 1C4Y2 2WZQA 1ACBE 1FN8A 2J95A 3MH4A 8KME2 2QV1A 3H7TA 2G51A 1ELCA 4FUEA 2FYQA 1SGFG 4O9VA 5C5NA 1RTKA 1O35A 1D3DB 1K9OE 8GCHG 4Y7AA 3RMLH 5IDKA 3UTUH 1Z1IA 2GCTB 1CA0C 2EQNA 1GMCF 2FOBA 4KTSA 1ARCA 2XC4A 1DLKB 4DGJA 2ZP0H 1L2EA 3A80A 3ZZ4A 3PB1E 4B76A 1ABIH 3RXDA 4O3TA 1P2MA 1YCPM 3MNCA 1D4PB 3SZNA 4RKJB 1O38A 2FPZA 2VWLA 1Y59T 5CHAC 4I7YH 1LKAA 3TGIE 1XUJA 4IC5A 1FI8A 1WBGB 1PYTC 1B0EA 1UO6A 1C5PA 4DVAU 1BBRE 3QDZB 3GY8A 2P8OB 2PW8H 3VXFH 1DDJA 4H6TA 3RC5A 1DITH 2SGPE 2BZAA 1EAWA 2ZPRA 3BTKE 2ZQ2A 1GGDB 4NFFA 3W95A 2BLVA 3ATMA 1GMDG 1GJ5H 2FOAA 4CH8B 4IS5A 1EOLA 2TGAA 3M7TA 1MZDA 4BAKB 4X2YA 5EQSA 1H9IE 4HFPB 1BRUP 1P57B 1SFIA 1LPGB 1GDQA 4FUFA 3KEEA 1OP2A 3LKWA 1O2KA 1YPEH 2QXIA 1EPTB 1Z6EA 1O2OA 1AY6H 1IQNA 4IC6A 3SU0A 2ESTE 1H8IH 1RFNA 2A7HA 4HG6A 3SNEA 2ZZUH 1KTTB 2AMDA 1S85A 2HLDD 4BAOB 3BV9B 2QCYA 4B6FA 3GYLB 6LPRA 2J34A 1D6WA 1KTSB 5EJLA 3T2NA 1J14A 4TSFD 5C67A 2C8YB 3GYMA 1ANDA 2ZFQH 1AUJA 3OE7D 1YBWA 1FY1A 1ELEE 1K2I1 3A7YA 4YOIA 3MQKC 1BITA 4R8TB 3LGVA 9ESTA 1XUHA 1CGIE 1TE0A 3LGTA 1BTPA 2XC5A 3A8BA 4WXIA 5E0HA 1XXFA 1EQ9A 4D7GA 1FN6A 3QO6A 4PROA 3F9EA 4K60A 1H4WA 1FY3A 1SGIB 1S5SA 2GX4A 1TMBH 2ZCKP 1KDQB 1SGPE 2WV4A 4YO9A 1Y3VA 2ZGXH 2Z3DA 3LH1A 3PRBA 4X1PU 3GCTF 3SGQE 2XWAA 2XBVA 2PTNA 4XRNA 2FMJA 1OYTH 1SGRE 3QLPH 3BTEE 1MCVA 2ZFPH 4U32A 2OCVB 4Q7XA 3ZZ7A 3DUXH 2GCTC 3SUDA 1NC6A 1PJPA 2BDGA 3ZYEA 3T62A 2RCEA 1OS8A 3K6YA 3HATH 4I8HA 1P05A 5EW2H 1C5MD 2SNVA 2VIDA 4M7GA 4SGAE 3FZDA 1EX3A 3BTME 1K1IA 3B23B 4MPVA 4MDSA 3A89A 1GBHA 2OINA 5I25A 3ZV9A 1QBVH 2P16A 2VWNA 5L30H 1FIWA 2P8OC 2QN5T 4Q63A 3F2HA 2HNTE 1C1RA 1GGDC 1K28D 3HKJB 2P3FH 2Z9LA 3BG4B 4ZXXH 1NRNH 2TGTA 3MU8A 2ZHDA 1TFXA 3EA7A 2QF4A 1C5TA 4B2AA 3SU4A 3A82A 5F53A 3GCNA 4O97A 1U6QA 5GIBA 3NUMA 3ZZ6A 1XMNB 3A81A 1O5CB 3SV2H 1QQUA 1YPLH 2W7SA 4AGJA 3ZZBA 5A0AE 2WPDD 2AGEX 1Y3WA 4ZKSU 2ZTZA 1YLCA 4X2VA 2FP7B 1GCTB 3PYHA 3KGPA 4OGYA 2V3HH 1SHYA 4SGBE 3F2FA 1SBWA 1GHXH 2CGAA 1HBTH 2ANWA 4AB8A 1DY9A 4Q7YA 3A8AA 1TNIA 2ODQA 1TPPA 5C20A 5LH8A 4AFQA 3RMNH 2C8WB 3BTHE 3E1XB 1OP8A 1T8NA 3SN8A 1O2HA 1WYKA 4WWYA 2ZPSA 2HOBA 1T4UH 3SU5A 1SQAA 1VITG 2VNTA 1UMAH 1ETTH 1AVXA 3QTVH 2H5DA 3PMJA 5CMXH 1GBLA 1KY9A 4GCHF 2G4UA 2H2ZA 1PQ5A 2YNAA 2TIOA 3DSGA 2K1QA 4IN1A 2J98A 2GZ8A 1C1WH 2QGRA 1JIMA 3NXPA 1S6LA 1V2UT 3OY5U 1BTXA 3H7OA 2BD2A 1THPB 1NTPA 4OS4A 4Y8YA 3URCA 3CP7A 3E6PH 1ZYOA 4MG3A 1TA2A 5F8TA 1DE7H 1FUJA 2EEKA 3HK3B 5GCHF 1TPAE 1ELBA 1V6DA 4Z0KA 1VCWA 1LPZB 3EYDA 1QBOA 4DT4A 2QC2A 2R0LA 5JB8S 1GPZA 1GBCA 1FY4A 5C0UA 1S82A 2WSSD 4ZROA 3LJJA 2SNWA 4IMZA 5HIZA 1HAOH 4Y8XA 1OWJA 4DURA 1GI8B 2HLCA 2O8WA 2KAIA 4CBNA 1O34A 1HAYB 2XC0A 4MNVA 2FIRH 1IAUA 4AC9A 1V2LT 1IQIA 3WWBA 2LP6A 2QF5A 4TT3D 1WTHD 3BIVH 3ENSB 1VZQH 1BA8B 4FUJA 2ZFFH 1O2YA 1O3BA 2Z3EA 1ANEA 4GVUA 5E0GA 1MU6B 1UTKA 2NU1E 1IQJA 3LC3A 3V3MA 1H8DH 3VB5A 1XVOA 1TGNA 1O5EH 4K1TA 3GY4A 3CNRA 5FX6A 1Y3XA 1P01A 1L4ZA 2OC7A 3PMAB 1FIZA 1BMFD 1C9TA 4WY3A 4ZKRU 1BOQA 3OTPA 1SLXB 1GCTC 1XKAC 3ZVFA 7GCHG 1GBIA 2P3TB 3KQBA 1OWKA 1TGSZ 3NWUA 4OS1A 2P93A 2BXTH 1DT2A 2Y7ZA 3GY2A 4KKDA 2D2DA 3UIRA 1Y5AT 3FP7E 2WPKS 1VJAU 2XNIA 2PKAA 2VIQA 4D9RA 1KXDA 1TGBA 1DXWA 1HAVB 4A1TA 2BY5X 1MUEB 3T28A 1UJ1A 4TPYA 3T29A 1V2WT 2JJ1D 1T32A 1PFXC 3OY6U 2ZDLA 2WPIS 3G01A 3E3TA 2FEQH 1LVOA 2GJGA 3MU1A 5CHBA 4ABBA 1BJUA 4ABEA 3E16B 3VPKA 3L33A 3LC5A 3PM3A 5FPSA 3LGUA 3RXQA 1C5LH 2XTTB 2GT7A 3SV6A 3KYGA 1E79D 1BBRH 1Z8RA 4ABDA 4Z6AH 3Q3KA 1FLEE 1F92A 2K8IA 4GAWA 1FV9A 1TBRH 1AFQB 2J98B 3MU0A 4B2BA 5PTPA 5L2ZH 2BX4A 1SOTA 6CHAB 3LGWA 3STIA 1P2KA 1O3LA 4FUGA 4FUDA 4ZAEA 4ESTE 1BMNH 1QRXA 3MU5A 1Z8GA 2W26A 4CHAB 3C1KA 1K1LA 3TITA 3RC6A 1SQOA 2CF9H 1P2IA 5L6NH 4GPGA 2J38A 3AASA 3IG6B 1FZZA 1YPKH 4AN7A 3TK9A 1RGQA 2PSXA 2VJ1A 4ABJA 5DKMA 1O5AB 5DG6A 4IMQA 5DP5A 5DP6A 2KAIB 5AFZH 5C0TA 3SJ9A 2ZU3A 4RSPA 4H6SB 4X6NA 3DFLA 1ARBA 4MTBA 1WDIA 1QQ4A 1KXAA 2J97A 2CJIA 1EAIA 2BDHA 2M2AA 4U30A 5TJXA 4ISIH 2DE9A 3KQ5A 4NZQA 4ABGA 3P92A 1TPSA 4ASUD 1ELVA 3M35A 3OEED 3UOUA 1AMHA 1KLIH 1DM4B 1HDTH 1MU8B 3KCGH 2SFAA 3KIDU 3I29A 3DFJA 2AERH 4Y0ZE 2FZZA 1JWTA 3FP8E 4AX9H 3RXUA 1GBJA 1S0RA 2BY9X 3BN9A 4NG9H 3TNSA 5HXFA 2QXJA 1UTOA 5EPYA 2Z3CA 6GCHF 4RI0A 1GJ8B 2ZDKA 1AUTC 1HIAA 2WYGA
chains in the Genus database with same CATH topology
3UNRA 2Y5HA 3MI4A 3S0NA 1P03A 1PPCE 1KYNA 1GHVH 3RXCA 1AU8A 1P0SH 1G9IE 3RU4D 2SGFE 2OQ5A 1IHSH 4X0WU 1HV7A 3MNSA 4I8GA 4TWYA 2HNTC 4JK5A 2BD3A 3SGAE 1AHTH 4INLA 3M3SA 2ZI2H 3RXBA 4ABAA 4Y71A 1B0FA 2PKAB 4YESB 1WV7H 2BD9A 2ZKSA 2YNBA 1QB9A 1TYNA 1YCPK 3BG8A 1G3EA 3Q00A 1OP0A 2JETB 1O3PB 3SNCA 1Z8JB 5B6OA 2ZU4A 4B1TA 1BTHH 1O2TA 2NU3E 5A8YA 3RXIA 3S7KB 1LO6A 1AFQC 1DWBH 1L1JA 4A1XA 1ZRKA 2OBQA 4HI3A 2AYWA 3F9FA 6CHAC 4IN2A 3SNDA 1DX5M 4BTIB 3ZVBA 1QA0A 5DP8A 2ZGHA 2FOEA 2YOLA 4CHAC 2A1DB 1TBZH 2CV3A 3RXEA 4AYYB 1NFXA 1UK2A 4X2WA 2G4TA 2Y5GA 1IOEA 3FZZA 1Z1JA 1TNHA 5EQRA 1GJAB 1ZJKA 2BVSH 1QY6A 2G81E 1W10U 3R3GB 2TGDA 2B5TB 3PTBA 2ZDNA 2ZG0H 2ALVA 1ELGA 1G3CA 3BEFB 5T6GA 1E0FD 3TH3H 1AI8H 1OOKB 5C5OA 2CF8H 1SPJA 1KXBA 1EOJA 1KIGH 3RLWH 3SU3A 2A4RA 4JMYA 2ZECA 1F2SE 4XBCA 1O2VA 1TMTH 2A5KA 2AIPA 2VIOA 1O31A 1D3PB 1QB6A 2OTVA 4ABIA 1KLJH 5GWZA 1RRKA 1IHTH 1Q2WA 4IW4E 4YLQH 1A7SA 3A7VA 3RXVA 2Z6BD 1N8OB 4YLUA 3ZV8A 1IQMA 1O2UA 2GDEH 2ZFRH 2HALA 4YT7H 2FS9A 4NIWA 1OWDA 2B7DH 1WU1A 4UFDH 3BTQE 2LPRA 1Y3UA 1MQ6A 2BDIA 1A0LA 5HM9A 2GZ7A 5EG4A 3IWMA 1SGDE 2GGVB 1JXPA 4XOJA 1HUTH 1E38B 1HAXB 1O2SA 5EXMA 1HJAC 1YGCH 1J17T 1NRQH 1AGJA 2GCHG 1P3CA 2B8OH 3OTJE 1F5LA 1O32A 5L2YH 1WUNH 2BY8X 1IQLA 3MH5A 1Q31A 1A2CH 2EI6A 2PKSB 4X8UH 2XWBI 1O37A 1GVKB 1GBTA 4Y8ZA 1KXFA 1HIAB 3SUGA 1Q3XA 1Y5UT 4JZFH 3A88A 2FOFA 1O3CA 1FAXA 3BTFE 4CRCA 4AG2A 3N7OA 1YC0A 2F9VA 2JETC 1O3DA 4NSVA 5GPIB 4B73A 4OS5A 1QURH 4FVBA 2R2WU 1HAGE 1O2XA 1QGFA 1C5RA 1UK3A 1ESTA 1FJSA 4KTUA 1W13U 1ZOMA 4TY6A 1GJBB 2ZIQH 4XSKU 3STJA 2ZWLH 3TH2H 3TJOA 1ZSKA 1BHXB 1MTNB 5DP7A 3U1IB 3TIUA 2Y82A 2B9LA 1A4WH 4KELA 4B74A 1C1OA 1A46H 3F68H 1W12U 2PSYA 2AGGX 2ALPA 4NA8A 3A8CA 1C5OH 1P9UA 1G37A 3F9GA 2G55A 3M5OA 3QK1A 2A31A 4J1YA 1GHAF 1EJAA 1A3EH 2F9PA 1F0UA 1D9IA 4MNXA 3NPSA 5K0HA 2BY7X 2VIPA 3U8TH 3TLOA 2FI5E 3AW0A 1MKWK 1OPHB 5AVDA 2GVFA 3S7HB 2Y5FA 3FFGA 3TK6A 2XW9A 3QZRA 4Y7BA 1YF4A 3KHVA 2WV5A 4HTCH 3UOPA 1L0ZA 3AVZA 3MHWU 4ZHAA 1HXFH 1SGYE 1ETSH 1H9HE 2FX4A 2O8LA 2PLXA 4LZ1H 1GG6C 2SGEE 2QA9E 1UTNA 5C3NA 2F9NA 2H5CA 2HWLB 4CR9A 1DFPA 2AIQA 1BRCE 1P2OA 2VGCB 3UPEA 1KLTA 2ZHQH 4BXSA 4MPUA 1ZGIA 3SBKA 3RXHA 3A85A 1LHFH 1P9SA 5H4IB 3FANA 1G2MA 1FONA 4AZ2B 3M5MA 1LTOA 1O5FH 2VIWA 3QN7A 1AVGH 4ZHMU 2FTMA 1ZPZA 1THRH 2PKSC 2HVXA 1DWEH 3SU2A 3D62A 4X8VH 1DSTA 1CGHA 1C5WB 3JZ2B 4FUBA 1PPFE 1QRWA 1ZLRA 1NESE 1UVUH 1DANH 4IGDA 2Q6GA 2VWOA 1CHOF 3DD2H 1HCGA 1MZAA 1O5GH 5ETXA 5JB9S 2TRMA 4X6PA 1QR3E 1BT7A 4A6LA 1DWCH 1SG8B 1TMUH 4I8JA 2UUFB 1ZTKA 3H5CB 1T7CA 2BD4A 1TX7A 4MPWA 1BRAA 1ZGVA 2FI4E 1SGCA 4X1QU 1MTNC 1C2LA 2BDYA 1OKXA 2EI8A 3BTGE 4OS7A 2BHGA 3DHKH 4F4OC 3UR6A 4X8TH 4BAQB 1GI1A 3SOSA 2O9QA 1Y3YA 1WTGH 3SJOA 5C1YA 1TLDA 1BB0B 1G30B 2D1JA 5F8XA 4B71A 1BMAA 5A8XA 1EPTC 2XBXA 5A2MH 1AD8H 1UVOA 3GCOA 3PO1B 2A4OA 3RXGA 3ZYDA 1T4VH 2I6QA 5JBAS 1T8MA 1T8LA 2FS8A 2D26C 2BOKA 2OP9A 1V2ST 3BEIB 2HNTF 3UWIA 1PQ8A 1JIRA 3M5NA 3U98H 2FODA 1K22H 3CS0A 5EOKA 1GDUA 1GVLA 1GHBF 3ZZAA 1OYQA 3A84A 3QX5H 4I31A 3P8FA 2CN0H 3UR9A 1P12E 4FU7A 1O3GA 1UCYK 4TY7A 2AMPA 1TX8A 2P3UB 2AEIH 3SNAA 1LHEH 3RXPA 1D3TB 1W3CA 2VGCC 1CT4E 3HKIB 1S0QA 2BLQA 3C27B 1XUFA 4BXWA 1H9LB 2IJOB 2WYJA 1QJ7B 2VB0A 2GV7A 2FWWA 2D8WA 2F83A 3NKKA 4GHTA 2XXLA 4ZKOU 1MCTA 1YPGH 5T3HA 1INCA 1S6HA 1CO7E 1YPJH 2WPLS 3M37A 4CBOA 4GHQA 2Y81A 2PV9B 1MTVA 4Y11E 4NA9H 1QNJA 2UWPA 2H9EH 2FM2A 1GMCG 2AMQA 1CSOE 1RXPA 4Y79A 3V0XA 1UCYE 1VR1H 1J15A 1GI0A 4TWWA 3RLYH 1C1VH 4BOHA 2H9TH 2G5VA 3ITIA 1C2HA 2VH0A 3ODFA 4Y6DA 4NSYA 1YCPH 1UVSH 3MO9A 2V0BA 3BG4C 2ZU1A 1EZSC 2B0FA 2AH4X 1VITH 4YZUA 3S9AA 3MH6A 1AZZA 3MWIU 4FVDA 2P94A 2V35A 2C93B 3A86A 1NT1A 1MTUA 1WCZA 1O3HA 3SV7A 1C5VA 1N6YA 5FBEA 2CHAB 1C1MA 1TRNA 1LDTT 4ISLA 1NFYA 1O30A 4D9QA 2O8MA 2NU4E 1JOUB 4JZIA 3ZVGA 2F9BH 2Z9JA 2C8ZB 1V2TT 1ZMNA 1MD7A 4Q7ZA 2M5TA 1C1TA 3A7XA 1W8BH 1GJ9B 3SI4H 1LVYA 1OXGA 3PLKA 4H42U 4OS6A 3KN2A 3UY9A 1GJ7B 4K8YA 5EODA 4UONA 1O39A 2FI3E 1LHDH 3QGJA 4NWLA 4R0IA 2ZQ1A 4CRBA 1OSSA 3DT0H 4JYUH 2JH0D 2SGDE 2ZF0H 1SSXA 3UREA 2Z7FE 1O3KA 2C90B 2ZFTA 4I8KA 1V2OT 4X6OA 1TGCA 3RXJA 1NU7B 2C8XB 1A5GH 4X1SU 1PPZA 4AYVB 2QAAA 1PYTD 1XUKA 1V2PT 1BTYA 3BIUH 3TH4H 2BD7A 2ZTYA 4K3JA 1SI5H 8GCHF 1C2DA 5EW1H 1AKSA 1QJ1B 4ISNA 1O3OA 5EXLA 4H4FA 2G00A 3GCTG 1QFKH 3P6ZB 3LONA 2W5EA 1O2NA 3P8GA 1TRMA 5DP3A 1FDPA 3PLPA 1BTZA 1C1NA 2BYAX 1TPOA 3MH7A 1K21H 1EASA 3NCLA 1G3BA 1ZPCA 1ZHPA 3QUMP 1DOJA 3M36A 3SU1A 1P11E 1DLEA 4MQAA 1MKXK 3VB3A 3RMOH 3P95A 2OUAA 1Z7KA 1L4DA 1EAXA 1MD8A 3RXLA 1BTWA 1B5GH 5DP9A 3ELAH 5LGOA 2ZTXA 3RM2H 2P59A 2ANYA 1G3DA 1GMDF 1OWIA 1YP9A 3RXMA 1C5YB 2J2UA 4XBBA 3LGIA 3I77A 4FUCA 4DIIH 1L1NA 1RD3B 1BQYA 1O2ZA 2PUQH 2OBOA 2VU8E 1X7AC 3E0NB 4Q80A 1O33A 4NA7A 2A5AA 2BY6X 3MTYA 1VCQA 2BQ6B 2CHAC 3ZVAA 1O2GH 2FOHA 1WOFA 3TPIZ 2V3OH 3BF6H 4AG1A 1UTLM 1GL1A 1AQ7A 1FQ3A 2QF3A 3TK5A 2Z9KA 3SHAH 1BJVA 4FU8A 2VVCA 2ZA5A 3BEUA 3MNBA 1CE5A 1OWEA 7KMEH 4LK4A 3RU4E 5J4QA 5ESBA 1QTFA 3MFJA 1F5RA 1NM6A 4FU9A 1RTLA 3A87A 1BCUH 1MBQA 3ATWA 3LJOA 3PTNA 1HJ8A 3O8RA 1MKWH 1QCPA 1DUAA 3SO3A 1SVPA 5AFYH 4X2XA 3L3TA 2BDAA 1D6RA 3OX7U 3AW1A 2QIQA 5FX5A 2R3UA 4JZDH 1A3BH 5BRRE 1C5ZB 3GY3A 3MYWA 1OWHA 3WY8A 2CMYA 1ANCA 4JYVH 4XE4A 1K1JA 1S83A 2RA3A 4YT6H 4ASHA 4WMDA 2GMTB 2R9PA 1BZXE 1V2NT 4NIVA 1NN6A 1C4V2 1SL3A 4I8LA 4INKA 1K1OA 3M3VA 2BLWA 3VEQB 2OC8A 5K7RA 3BSQA 1NZQH 4NZLA 3FAOA 1LQEA 1H1BA 4JCNA 1HLTH 3LOXA 2FDAA 4A92A 5GCHG 5DGJA 3QWCH 4X8SH 1CVWH 3PWBA 4AORA 4DW2U 5C2ZA 1EKBB 1ESAA 2ZU2A 3EDXB 1EB1H 2WPMS 4AB9A 1ZTLA 1AKSB 2ZGJA 1EAUA 1GBAA 3U8OH 4VGCB 5CHAB 1XM1A 3ODDA 1PPGE 2TBSA 5EXNA 3SUFA 1LMWB 2VH6A 1MAYA 1SLWB 3RXTA 1GHYH 1G36A 5JDUB 1GBDA 2ZFSA 1O0DH 1ZSLA 1KXCA 1VCPA 4BNRA 4GSOA 4ZMAH 2GDDA 1WAYB 3VB4A 4WMFA 1GI4A 1ABJH 3T25A 1HAZB 3U9AH 4UFFH 2UUJB 1W11U 4Y76A 5T6DA 1AVWA 2A45B 3E91A 3VB6A 1W14U 3LGYA 1P2NA 1TNKA 5E2OA 2BLOA 1CT0E 3MO6A 2PHBA 1DUEA 2ODPA 2A4GA 1V2QT 3UQOA 1TGTA 1WQSA 3AAVA 2Q6FA 1UK4A 2OC0A 2G5NA 4E7NA 1GBBA 1S84A 4Q2KA 2EI7A 1ORFA 4CR5A 1CT2E 1C2JA 2BQWB 2FESH 4JZEH 3OSYA 3TJNA 2WUCA 3ZVEA 1LVMA 4UE7H 2AS9A 2H1UA 3SV9A 1GI2A 1RTFB 2F9UA 4FUIA 4D8NA 2TPIZ 1QRZA 1XVMA 1YM0A 3O8BA 1AZ8A 1O2IA 1P8VC 5FBIA 3UWJH 4B75A 3K9XB 1OX1A 4JZ1A 1LKBA 4WH6A 4BANB 1C5NH 1VITF 1HFDA 1DSUA 1YYY1 1XX9A 1FAKH 1QBNA 1RIWB 3B8JA 1O2JA 1TNJA 2THFB 2IN2A 3RDZA 2BDCA 1ZHRA 1A61H 1V2VT 1UCYH 4TPIZ 1UVPA 2ZHFH 1IQKA 1AWFH 1P06A 5GJ4B 2Z94A 2A0QB 2GMTC 4Y0YE 4CH2B 1SR5C 1TNLA 2FOGA 3A7WA 5IYTA 4U2WA 1GMHG 1SGQE 4AFUA 1P04A 3SORA 5C1UA 5EU8A 3EGKH 1ANBA 1PPHE 5C1XA 1C4U2 2XBWA 4WMEA 1HJ9A 7LPRA 5CE1A 2NU2E 3LU9B 2J9NA 1YLDA 3KQDA 5SGAE 1F0SA 4GLYA 1QL7A 5A0BA 1LPKB 1AE5A 4JYTA 1IQHA 4O3UA 2HPQH 1EZQA 3HPTB 2JH5D 1IQFA 3ZVCA 3CS7A 2BDBA 2ZEBA 2R0KA 3E90B 1DICA 2ZDMA 1C2IA 4VGCC 4LXBH 2STAE 5F6MA 1W7XH 2RA0A 3O8CA 1BTUA 1GVZA 4QT8C 2F9OA 4E06H 2J92A 3GY6A 1SMFE 1TABE 1TX6A 2W3IA 2BOHB 1ELAA 3GY7A 3MOCA 3P70B 1T8OA 2ANMH 1O5DH 2A32A 1P2JA 1BDAA 4K8BA 1GJ4H 2VVUA 2NU0E 4WF8A 3S9CA 3DA9B 2ASUB 1VJ9U 2AGIX 3M3TA 3P8OA 1MBMA 1HRTH 1C1SA 1GI7B 3RXKA 3ATIA 4NIYA 3P17H 3S9BA 3OU0A 1A0HB 5DP4A 8ESTE 4YM9A 3GICB 4BTUB 1HXEH 7GCHF 4AGKA 1C2FA 1TAWA 1N8OC 1HGTH 1QHRB 2BD8A 1QB1A 3RXAA 4J2YB 4I32A 5HMAA 2ZCLP 4MNYA 2WUBA 1E37B 2TGPZ 4FXGH 1ZRBA 3KNXA 6GCHG 2XRCA 5J4SA 5F03A 1NRPH 2AFQB 2H9HA 2CXVA 2QYIA 2F3CE 1NPMA 1RIWC 1MAXA 4I33A 4K1EA 1IQGA 1HAHH 1HNEE 2QXGA 1P2QA 3TU7H 4CRAA 1C2MA 3KQCA 4LOYH 1RJXB 2A2QH 1GI5A 3ESTA 4DY7B 1ZPBA 1GWAA 3S69A 3ZZCA 3Q76A 2ZO3H 1F5KU 5FXLA 2UWOA 1ID5H 4DT7B 2FOMB 3KL6A 4THNH 1LQDB 1C5SA 1WQVH 3PROA 1UHBA 5LPFA 1FY8E 2XYAA 2G8TA 1SGTA 3SV8A 1MQ5A 4K1SA 4HZHA 3W94A 2R2MB 1BMLA 3NK8A 3IITA 1ZSJA 3UNSA 1J9CH 2OLGA 3HGPA 3LT3A 1S81A 2GP9B 3EA8A 3PMBB 2ZGBH 2BXUH 1HB0B 4WH8A 4UFGH 4ABHA 1XUIA 2EA3A 1AE8H 2STBE 3I78A 2OD3B 5AHGH 1C5UA 1SC8U 3O8DA 2VVVA 5I46H 1SFQB 4ISOA 1MKXH 2F91A 2EC9H 2LNCA 4YOGA