1ANDA

Anionic trypsin mutant with arg 96 replaced by his
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDHKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Serine protease
molecule keywords ANIONIC TRYPSIN
publication title Structure of an engineered, metal-actuated switch in trypsin.
pubmed doi rcsb
source organism Rattus rattus
total genus 50
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1994-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1andA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1andA02
2J34A 1LO6A 4AB8A 1GHXH 3CS7A 3BEUA 2O8MA 3L6PA 2HNTF 1PPCE 1C5ZB 3ZVAA 1DE7H 1G3EA 5DP6A 1O3EA 3K2UA 4WWYA 2PTCE 1AVXA 3SU5A 1GBTA 2HPQH 5ESBA 2GV7A 1GBDA 1GL0E 2BD4A 1AFQB 1QCPA 1QB9A 4X8SH 1IQEA 1LHCH 3UWJH 1HDTH 3RXHA 1JXPA 2CMYA 1L4ZA 2Y80A 4Y8YA 2BDYA 3RDZA 1SGDE 3E90B 3GCOA 1KXFA 1C5RA 2JKHA 4E7RG 1YCPH 1AKSB 1HAYB 2XC4A 1D3DB 4I8HA 2WV4A 1DY9A 4GCHF 3MH7A 1EZSC 3MNXA 2WPKS 1Y8TA 2VVUA 1C5WB 2VJ1A 1MTWA 2DUCA 3W95A 2ZF0H 1QIXB 2FOMB 3KL6A 1BMMH 2ZDNA 3GCHC 1SGNE 2SGPE 1KLIH 4ZXXH 5HXFA 4MDSA 3ZYDA 3QDZB 1DWDH 1YYY1 3SV2H 2P8OB 1HAIH 3SZNA 1LPGB 4K69A 1HAXB 8KME2 1LVOA 3HK6B 1M9UA 2AFQB 2NWNA 1A5GH 2QGRA 1SLXB 3OX7U 1NROH 4NA7A 2HLCA 1GG6B 1KLTA 2D2DA 2BDHA 4BAMB 3GISB 2ZPSA 3I77A 1GJ4H 2H5CA 2VU8E 4I7YH 2TGTA 1G2MA 4XOJA 1KIGH 3H7OA 3V3MA 4O3TA 1MTSA 1RIWB 2ZGXH 4AZ2B 1BBRH 1BCUH 1LVYA 3A8BA 4TY7A 8GCHG 1P09A 1LHGH 1LVMA 1EOJA 3GY3A 1HRTH 1MTNB 1GJDB 4AG1A 2STAE 3QWCH 3MH6A 1G9IE 2ZQ1A 1CA0B 2VVCA 1XUIA 4Y71A 1FJSA 3B8JA 3LGWA 1TMUH 1CBWC 3MO9A 2JH5D 3SW2B 3UNSA 1GBBA 3VFEA 1ANDA 1AQ7A 3FFGA 2ANWA 3AAVA 2LNCA 2G81E 1NM6A 2CGAA 1HNEE 4MLFB 1BA8B 2A0QB 3BF6H 2XCNA 3V13A 4AOQA 1UMAH 2XBXA 2CF8H 1OPHB 1Y3YA 3SNBA 2SNWA 4Y11E 2VIWA 3U9AH 4A6LA 4CBNA 1SHHB 1TQ0B 1VCQA 2GDDA 2P59A 1YPKH 4TPIZ 4I8LA 1O3OA 3HGNA 4NIYA 1O2NA 1GVLA 1T8OA 2D8WA 3ZVFA 1AI8H 2OLGA 1Z6EA 1FY4A 3QGNB 5EQSA 4ABHA 4OGYA 1Z8JB 2F83A 4D9RA 1DM4B 2FZZA 2QV1A 3B23B 2BD7A 4I33A 3M3SA 4X1SU 3LIWA 5DP4A 1C5NH 1FIZA 1TMTH 2HGTH 3BV9B 4TWYA 1VR1H 2Y5FA 5DG6A 4IS5A 2ZFQH 4AFZA 4ISLA 1XVOA 3HATH 3P17H 2AS9A 4X6PA 4NIVA 3GY4A 3STIA 3SU0A 1DPOA 3SI3H 1DLKB 1BMNH 2PTNA 2A2XH 3M5MA 3SNEA 4TWWA 1A2CH 1BTXA 1E36B 5BPEA 2SNVA 5C5NA 2ZG0H 3LDXH 2F9NA 1O2GH 1ZPBA 2FPZA 1O36A 3VXFH 4LOYH 1GDUA 5FX5A 1FY5A 4OS4A 2R9PA 1C2EA 2XWBI 3SI4H 1J16A 1LKBA 1VITG 4HGCA 2VWLA 5FPYA 4FUCA 3E0PB 1GI7B 5GIBA 1O2ZA 2TRMA 3GY7A 1TGCA 3GYMA 1P3CA 3RU4E 4DGJA 1OKXA 3DUXH 3ZZ3A 1HJ9A 3TK9A 1GBCA 1G3CA 1UTOA 2FMJA 4YOGA 1SI5H 2VGCC 3FP7E 1JOUB 3UR9A 1ZJDA 3VXEH 5TJXA 1XUHA 3LONA 2ZFTA 1BQYA 2ZIQH 4DIIH 2AGGX 1AVWA 1O37A 3RXCA 1YLDA 1QBNA 3ATMA 2SGAA 2VIVA 1SGFA 1A61H 1QQ4A 1IQMA 2C93B 1BMAA 1S82A 4KELA 1O3DA 1AB9B 3V0XA 1EB1H 1BTHH 4FXGH 3I78A 4ZHMU 3T62A 3FZZA 4BAHB 2BXUH 1EQ9A 1AO5A 5ETXA 3GY5A 1O30A 3QK1A 4LZ4B 1C2KA 1S84A 3N7OA 2QIQA 2RG3A 5T6DA 1TRMA 1ZLRA 2HPPH 4KTSA 3UQOA 1ANEA 1PPZA 1K9OE 1RTFB 2QYIA 3RMLH 3EA7A 4VGCC 1KDQB 1O31A 1O5BB 1ZR0A 1MQ5A 5DP3A 3KQEA 1Y5AT 4AFSA 1LQEA 1PPHE 4B74A 3GYLB 3VB4A 2H9HA 1S83A 3A7XA 2ZQ2A 1T32A 3T5FH 4DVAU 3ZZBA 3S69A 1FY3A 2AIPA 1TONA 2O8LA 3TGIE 2SGDE 2FX6A 1EAWA 4IBLH 2PW8H 1O5FH 1THRH 2R2WU 1OWEA 3NPSA 1N8OC 6ESTA 1HV7A 1C1TA 4DCDA 1ZMJA 2GTBA 3RXAA 1O3LA 3TGJE 2FXRA 4K3JA 1WUNH 1F0SA 1K1OA 1CT4E 4MNVA 2GMTC 2ZU4A 2J9NA 2CJIA 4AORA 1O2UA 1YP9A 4CBOA 1XM1A 3OY6U 4IMQA 3ZVDA 1UK2A 4SGAE 3RXVA 2GZ7A 2PSYA 5EU8A 4JMYA 1IQFA 5JDUB 1XVMA 3A85A 4GSOA 3RXUA 3LKWA 1GBHA 1W3CA 3F6UH 3SBKA 3MFJA 1O2IA 4LZ1H 1ABJH 1KXBA 1NRQH 1O3PB 1O2QA 5DK1A 1TBQH 1QA7A 4GHTA 5C2ZA 1OWIA 1QR3E 2G8TA 3RXBA 4ABBA 4X1RU 1W7XH 2XW9A 3ENSB 4OS2A 4NA8A 1TGSZ 3MYWA 4ABFA 3P92A 4CRFA 2VINA 2FTMA 4Y0ZE 1WQVH 1LHDH 2JH6D 5T6GA 1UVUH 3FVFB 2P93A 2ZKSA 5A8YA 1J14A 4Y76A 4Y10E 2AMQA 4UD9H 5FBEA 1THPB 2OQ5A 1AZZA 5L2ZH 5HM2A 2PKAA 1EAXA 1V2MT 2QAAA 3GDSA 1SOTA 1SLUB 5L2YH 3RXGA 1BOQA 1K1JA 4JZ1A 1AHTH 2ZDLA 1V2WT 3GDVA 4AGKA 5LGOA 1P04A 3SHCH 1P3EA 1AWFH 2OC0A 3BTME 4I31A 2HOBA 4WVPE 5ABWA 4MVNA 1DUAA 1ETSH 2O8TA 2ZI2H 3UPEA 1F0RA 1P11E 1IOEA 3D62A 4CRGA 4KTUA 1NRSH 2GDEH 4THNH 1O2OA 2Z94A 3I29A 1FLEE 1Y3WA 1WTHD 4B71A 1NU7B 1O2SA 1E0FD 1Z1JA 4XSKU 2ZHEH 1MZAA 1NC6A 1WV7H 2FI3E 3M5OA 2P95A 1SB1H 1ARCA 1MBQA 5AFZH 1GJ5H 3KQBA 4XBCA 1C5TA 1Z71A 4JZFH 1F92A 2OXSA 3TK6A 4FUBA 5K7RA 4BAQB 2RDLA 1EPTC 3SJ8A 3UNQA 2ZNKH 2ZGCA 1QY6A 2NU4E 4B73A 2FS9A 3A7YA 2BX3A 5A0AE 1RFNA 2D26C 1NTPA 1O5EH 1AKSA 4F4OC 1UHBB 1DSUA 2O9QA 3R3GB 2VB0A 1IHSH 3S9BA 3ZZDA 1GI8B 3KGPA 3TNSA 1LKAA 4WJG2 3MU5A 3PTBA 4H6TA 3RXPA 1OX1A 5FAHA 2WUCA 2A2QH 2BY8X 5FCKA 1LMWB 3U1JB 3HPTB 5JPMH 1P05A 4MNYA 1HXFH 3U8RH 4FUHA 2AERH 2UWOA 1DXWA 4JK6A 3LU9B 1CBWB 4K8YA 3SO3A 4AX9H 1QRXA 3F9HA 3IG6B 1SR5C 2AH4X 4DT7B 5I46H 1EASA 5CE1A 3STJA 4WH8A 1UVSH 4AFQA 4DG4A 1NT1A 1J8AA 2NU2E 3MNCA 3E6PH 1RRKA 2QXIA 1OP2A 3K65B 2A4QA 4Y6DA 4MPWA 1SGQE 1EAIA 1U6QA 3LGYA 5FBIA 1GJBB 1GJAB 5J4QA 4AG2A 5IYTA 1VGCC 1PQ8A 3A8DA 1G3DA 2ODYB 3A84A 2J95A 3UWIA 4JZEH 1DXPA 3GOVB 3TJOA 5J4SA 3ZZ8A 3T2NA 3T26A 1EJMA 5DP8A 1ELBA 4DY7B 1TX8A 3A89A 1T8NA 4CH8B 1KSNA 1T4UH 1GHAF 1NFXA 4RKOB 3RXEA 1F5LA 1YPHC 1TPSA 2WPJS 4YLUA 3SGQE 3DHKH 1YPGH 2RA0A 1W14U 3SV6A 2ZCHP 4O3UA 5DKMA 1ELTA 4X2WA 8ESTE 2V6NA 2B5TB 3EE0B 5JB8S 2CHAC 1SG8B 2UUJB 1GDQA 3RU4D 1KY9A 4B75A 2XYAA 1C2FA 4I8JA 1GJ6A 1JMOH 3LOXA 1OP0A 1OWHA 1QL8A 1MCTA 1C4U2 2BDCA 1J9CH 1GCTB 1IQIA 1KTTB 1BRBE 3ZVCA 2ZGHA 3CS0A 5IDKA 2PKSB 1YPLH 1TPPA 2IPHA 1RD3B 3A8AA 2ZDMA 5C5OA 3A88A 4YO9A 4O03A 1F2SE 3RUOA 4R0IA 3KN2A 3UREA 1C4V2 1NFYA 4TYDA 1TOCB 3FZDA 1K1PA 2F9OA 4XFQA 4IC6A 4U32A 1GJ9B 4NWLA 1WAYB 3ZVEA 1GMCF 1IQJA 4FUDA 5EXLA 2ZGJA 1PPGE 3U1IB 1A0LA 9ESTA 1AZ8A 1O2WA 1L1GA 3QZRA 1YPEH 2Q6GA 1ZMNA 4CR5A 1B0EA 1GHAG 1PQ7A 1EOLA 1NFUA 1C5XB 3LGTA 4NG9H 1LQDB 2GKVE 1BUIA 3IWMA 4UONA 3FAOA 3MO6A 3BG8A 1O2XA 1C1MA 5E0JA 2IJOB 2Y81A 1O2RA 2Y6TA 2ZO3H 4OS1A 1K22H 1FUJA 4FUJA 3BIUH 2STBE 3QO6A 1TB6H 1QJ6B 3KF2A 3E3TA 2GCHG 1YPMH 1SFQB 1BJUA 3BG4C 2J92A 4ABDA 4F49A 2ZDKA 4VGCB 3RXTA 1O38A 3EAJA 1JRTA 2BLQA 3NZIA 1SGFG 1XUKA 1ZTLA 1O5AB 2PGBB 1JIMA 3RLYH 4ZKOU 3Q76A 3TITA 1V2KT 1C1QA 2PHBA 5AF9H 1LVBA 2BQ7B 3T29A 1N8OB 1QJ7B 3OU0A 4JYUH 1SQOA 2W5EA 1TNKA 3S7HB 3KHVA 1NRRH 2ZU5A 1H9IE 3CENA 4CRBA 1HLTH 2GMTB 1L0ZA 5JBTA 1HUTH 1AD8H 2BZ6H 1AUJA 2BX4A 3TGKE 1O2JA 1TQ7B 4RSPA 3FP6E 4H42U 3LJJA 4NZLA 1DT2A 1WU1A 1BRAA 2UUFB 1H9HE 3UFAA 2KAIB 3E8LA 4UFGH 1AMHA 5EXNA 1KDQA 1QRWA 1MH0A 1Y5BT 3RC4A 2FDAA 4OS6A 3DT0H 4HI3A 5F8XA 4QT8C 1BT7A 2G00A 3JZ1B 3UOPA 1F0TA 3SJ9A 4E7NA 1ELFA 3URDA 1XMNB 1SL3A 1TPAE 1C5QA 1CSOE 3PWCA 4WMEA 3RXKA 1V2ST 1E35B 1O3FA 2XBYA 2ZTXA 1CQQA 2VNTA 4LXBH 3RXSA 1O2TA 3M35A 5TCAA 1TBZH 1IQLA 1HYLA 2C8YB 4IN1A 1ARBA 2VH6A 5DP9A 2GCTC 1TNHA 4B2BA 1ZGIA 2ASUB 2NU1E 1AVGH 2ZFRH 3D49H 3Q3KA 3A87A 3TH4H 4D7FA 5BRRE 2ZFFH 3ZZ7A 1AE8H 3PMHB 4X0WU 3EQ0H 3VB3A 2A45B 1L1JA 3T27A 2HNTE 2GZ8A 3SOSA 2ANMH 1TPOA 1XUJA 4GCHG 2QN5T 5LH8A 1B7XB 3TPIZ 1B0FA 2JH0D 1C2GA 2XBWA 1INCA 2BVSH 2M5TA 4WMFA 2XXLA 1GGDB 3TNTA 3ZZ4A 2ZFSA 1LDTT 2J2UA 4FU8A 1ZHMA 2H2ZA 2ZU1A 4D8NA 2ODQA 3P8NA 1A5HA 3P6ZB 1AU8A 5CHAB 3PM3A 1FNIA 3AVZA 1GJ7B 2SGFE 1IQNA 1EKBB 2FI5E 3BTHE 1O35A 3FANA 3BTWE 2R0LA 1HIAB 2I6SA 1C9TA 1GI6A 1TNGA 4ZROA 1UTMA 2H9TH 2HVXA 4CRCA 1LPKB 2HNTC 1O3NA 1ZRKA 4D7GA 4X1NU 3W94A 1CVWH 1HJAB 1UTLM 4AFUA 1BB0B 2HWLB 1G3BA 1GBLA 1SVPA 1TNLA 1OWJA 2PV9B 5GWZA 1XUGA 1GI2A 4KTCA 1A0JA 6CHAC 4WF8A 1ZHRA 6GCHF 3LH1A 1S5SA 1CHOF 1OWDA 1C1PA 1VCWA 3ZZAA 3QUMP 4NGAH 3TVJB 4A5TS 5A09A 3VB5A 5EW1H 1P8VC 4DJZB 3AW1A 2F91A 1S0RA 2ZZUH 3LC5A 1D6RA 3SORA 3GICB 3PV4A 1FPHH 1G2LA 2XBVA 2ZECA 3SNAA 3LH3A 5GDSH 2FYRA 1PPFE 1YF4A 3S9CA 1AN1E 2W3KA 1MUEB 3GY6A 1TGBA 3BTKE 1P0SH 2RCEA 5HGGA 4O9VA 2V3HH 2VWOA 6LPRA 1V2TT 1OYQA 1PFXC 2CV3A 1TE0A 2FIRH 1GBFA 4MPVA 3ZZ6A 2Y7ZA 1QBOA 1EZXC 1EATA 2ULLA 4Y7AA 3SUFA 4A1VA 4XE4A 1VGCB 1C1RA 1HAVA 3SJKA 1QL9A 1MTUA 2F9VA 1FONA 1HPGA 2ZCLP 2A7CA 2OBQA 1O3IA 3KEEA 2NU0E 4Q80A 1RTLA 2BOKA 1K1NA 4AYVB 5C1YA 5L30H 1O33A 4I32A 4BAOB 3O8DA 4X1QU 5FPTA 1YM0A 6GCHG 1NU9A 1CHOG 4Q2KA 1ZOMA 1SQAA 5EG4A 1G30B 1FIWA 2OTVA 1LCYA 3O8CA 1MCVA 1TA2A 3EA9A 2C8WB 2VWMA 4H6SB 2FLBH 2A31A 4X6MA 1WBGB 3SU2A 4Y7BA 1RXPA 4MPXA 2OUAA 1O3KA 4ISIH 1XUFA 2DE9A 3BTFE 3QN7A 1PPEE 2XTTB 1J17T 3VGCB 1ANCA 1SLWB 1TX7A 3ZZ9A 1UCYE 2CHAB 3RXFA 2P3UB 2ILNA 1S85A 1A4WH 2WV5A 3TIUA 1BZXE 4ESTE 4NFEA 4KKDA 1T31A 3ATLA 3EYDA 3ZVBA 1ZPZA 4UFFH 2Z9GA 1O5GH 5HMAA 2OD3B 5EODA 5I25A 1NFWA 3KQDA 2B0FA 2ZP0H 3F68H 1SBWA 2H1UA 3SU6A 5AFYH 1BTZA 2BY6X 3C1KA 1HAOH 1PYTC 1FV9A 2YOLA 1EP6A 2HALA 1G32B 1QGFA 4B1TA 1F0UA 4MQAA 1F7ZA 3RC6A 1SMFE 2BQWB 3UNRA 1T8LA 1YBWA 4B76A 1EZUC 2Y82A 2B8OH 7GCHF 1O2LA 1NS3A 8LPRA 2ALVA 1SHYA 2ZTYA 1ETRH 1Q2WA 3P95A 1PJPA 4WXVA 1Y3UA 1PQAA 5F8ZA 3BIVH 2AGIX 5B6OA 5EW2H 3A7WA 2ALPA 5LPEA 2FP7B 3DD2H 1QURH 3ZV9A 3Q3XA 5T6FA 1UVPA 3BG4B 1NRNH 3BTDE 2BOHB 1TGNA 2WUBA 4XBDA 4K8BA 2P3TB 1O2YA 3RC5A 3BTEE 1ANBA 3PLPA 3DA9B 4D9QA 1HGTH 2A4GA 4MPUA 1O2HA 3RU4T 1O2VA 3A82A 3U98H 4RN6A 2ZHQH 3MU0A 5ESTE 1CHGA 4AGJA 4X8UH 1NESE 2CXVA 1P2JA 1MU8B 3Q00A 1V2LT 2A5KA 2V0BA 3LPRA 1DX5M 1TNIA 2GX4A 1CGHA 3BTGE 3H7TA 3GCHB 4H4FA 5EPYA 5A8ZA 2QCYA 2NU3E 3F1SB 2TGPZ 1ESTA 1EAUA 3RMMH 3URCA 1BTWA 2W3IA 3OSYA 2FI4E 4AYYB 5C3NA 3M3VA 4MNWA 1P2IA 1THSH 2A7JA 4UDWH 1CU1A 4FU9A 1Y59T 4Q7ZA 5F03A 4BTTB 1C5SA 1W0ZU 2BQ6B 3GCNA 2PWXA 4ZHLU 1HAZB 1T4VH 3TU7H 4J1YA 5HM9A 3RXLA 1H8DH 3MO3A 1VJAU 4E05H 2B7DH 1CGJE 4YZUA 3GDUA 1AY6H 2Q6FA 1A46H 3AASA 1W2KH 3D23A 2BZAA 5A2MH 1NN6A 1XXFA 2GT7A 1KXEA 2XNIA 1O3GA 1MAXA 1UO6A 1GJ8B 2BDBA 3KNXA 3HK3B 1N6YA 3O8BA 4NSVA 1P2KA 3HGPA 1L1NA 5EQQA 2FOHA 3RM0H 4J2YB 2AMDA 1P2QA 1V6DA 4NIXA 2Y5GA 1YPHE 2KAIA 1DDJA 2H6MA 1VJ9U 1B5GH 2ZWLH 1JBUH 3P8FA 2FO9A 3MH5A 1GI3A 2UUKB 1AWHB 1UVTH 1TABE 3EA8A 3UY9A 1FPCH 2HRVA 1Z7KA 2PGQB 3BEIB 2G5VA 3VPKA 3UIRA 4CHAC 3SQEE 3G01A 2EEKA 3SJIA 1C2MA 4GAWA 5A0BA 4ABIA 4KP0A 1Z6JH 3UR6A 1E34B 1ABIH 2QXHA 1OSSA 1YKTA 1EX3A 5C1UA 1H9LB 3QX5H 3O8RA 2FESH 5GPIB 1XKAC 1XX9A 1LPZB 1SGPE 4U30A 4I8GA 2BY7X 4NFFA 3OY5U 1W8BH 1O3HA 1O3CA 3E16B 4ASHA 3TH2H 3BTQE 3PMBB 3A7VA 1K1LA 3GY8A 1GWAA 1ZPCA 2Y5HA 1OXGA 2TBSA 1MU6B 1HAPH 1GHYH 2Y7XA 3MNSA 4PROA 4LK4A 1KYNA 2H5DA 1QB6A 2IN2A 2FOAA 2W26A 2ZU3A 2OC8A 5DPAA 1O2KA 4ABJA 3IITA 4AB9A 1GDNA 1K28D 1BBRE 1RJXB 3RXDA 1C5LH 4JZDH 4M7GA 1ZGVA 2F9BH 4MG3A 1EZQA 1H1BA 1UK4A 1A7SA 1AIXH 4INLA 1HIAA 1GBMA 1HAHH 2I6QA 3MU4A 4ZHAA 2R0KA 4K2YA 1QJ1B 4AN7A 3QLPH 2B9LA 3ATWA 1GI1A 2YNAA 1HCGA 1HJ8A 1C1VH 2QXGA 4X2YA 2ZHWH 2O8WA 1SQTA 4IW4E 2EA3A 2Z3DA 2Z9JA 1TWXB 2VGCB 1QNJA 3LT3A 5DO4H 1UTJA 1DLEA 2GT8A 1O5DH 2BB4A 3OTJE 4DOQA 1ZRBA 3V12A 1FN6A 2F9UA 2QF0A 3AW0A 1ZTJA 1XKBC 1C1UH 1UTQA 5C1XA 4HTCH 9LPRA 1SGYE 4CRAA 1A3EH 1GBJA 2ZEBA 1PYTD 1V2VT 4X2XA 5GJ4B 1MMJN 1UCYK 3SNCA 3M61U 3NCLA 4K1EA 2CN0H 2AYWA 3SV8A 1MKWK 3ITIA 1VZQH 3SQHE 2IOTA 3MOCA 3NXPA 3PYHA 4JCNA 1GI4A 3HKIB 1FY8E 1SOZA 1BTYA 2PUXB 2QA9E 3RMOH 5DP7A 1MAYA 4RKJB 2BMGB 4KGAA 4UE7H 1A5IA 1PPBH 2R3UA 2R2MB 1P2OA 5HYOA 3E1XB 1Z8GA 1C1OA 2UUYA 3U8OH 1MD7A 1V2OT 1GHWH 3B9FH 5A0CA 4WY3A 1TOMH 1RTKA 5E0HA 5E2OA 1XXDA 4ZMAH 1W11U 1D3PB 1ZZZA 2PFEA 3GCTF 8GCHF 2GGVB 1P9SA 3TLOA 3A80A 5EGMA 4ZKNU 3RXMA 2BLWA 2WPLS 5GCHF 3MHWU 1BITA 1EXFA 4JYVH 1TRYA 1SGRE 3LGIA 3M7UA 2F9PA 2C3SA 3ZZCA 1A0HB 4NIWA 1BTPA 1L4DA 2OINA 1E38B 3SNDA 3HKJB 4TY6A 3RXIA 1GMCG 5JBAS 1GVKB 4D76A 4ZKRU 3JZ2B 1JWTA 1NRPH 2FOEA 5JBCS 1FDPA 1C2JA 1UTPA 5E8EH 1V2PT 1AGJA 1CO7E 5CMXH 1HBTH 2ZTZA 3MH4A 2A5AA 2QC2A 1O34A 3UUZA 3P8OA 1K2I1 3M5NA 5FHTA 2ANKH 4INHA 2OC7A 1L2EA 2WYGA 2ZHDA 3SJOA 3ATKA 2BD9A 4CR9A 4MNXA 5GXPA 1DITH 1CE5A 4NSYA 1JRSA 5FCRA 4UFDH 4A7IB 1A1RA 1Y5UT 3K6ZA 1SC8U 4INKA 1NZQH 3K6YA 4DW2U 1AE5A 3F9FA 3P70B 1Q31A 2P94A 5DJ7A 3U69H 1MKXK 1W7GH 2BXTH 3GCTG 1IHTH 2BLOA 1FY1A 1GMDF 3A81A 3PROA 1ESAA 1LTOA 1D3QB 3BTTE 5GCHG 3ODFA 4BAKB 2QXJA 1DFPA 5JBBS 2ZCKP 3EDXB 3MMGA 4WXIA 3GY2A 5PTPA 1ACBE 1FXYA 1P01A 2TGAA 4A1TA 4NWKA 2WINI 4ZAEA 1OOKB 3SUDA 1SGIB 1BJVA 1VITF 3PB1E 4DURA 1UTKA 2ODPA 2C4FH 1GHBF 1UK3A 1CT2E 2V35A 1DS2E 3WY8A 4CREA 1FZZA 5G4BA 4Y79A 2EI6A 3A7TA 1EPTB 1TYNA 2FTLE 1HAGE 4IMZA 1QBVH 4B2CA 4GVUA 4BANB 1IQKA 4GPGA 2BLVA 2P16A 2XWAA 1QHRB 1FAXA 3LC3A 4R8TB 1G37A 1P57B 1W12U 4ABGA 2A1DB 1SGTA 4E06H 3MWIU 1YCPK 2FM2A 1YPJH 1CA8B 2DE8A 1C9PA 3SN8A 1FQ3A 1O3AA 2FODA 2BY5X 1DSTA 5AVDA 1V2JT 3M37A 3L33A 4Y8XA 3RXRA 4U2WA 4IGDA 1GMDG 1HB0B 2Z6BD 4YT6H 1ZSLA 1WSSH 2XCFA 4BNRA 2J38A 5H4IB 1F5RA 4K1SA 3VB7A 2JETC 2SGEE 7ESTE 1GPZA 5F8TA 3ZZ5A 1TA6A 2OBOA 2BVXH 1WTGH 3PO1C 1WYKA 1SGEE 2J94A 3CP7A 2VIDA 1DUEA 2ZC9H 1ZYOA 1GCTC 1UHBA 2SGQE 3P8GA 5TCCA 1Y3XA 3H5CB 1DVAH 1K1IA 4ABEA 1D6WA 1G36A 2ZPQA 4CHAB 2PKSC 1TFXA 3L3TA 1FN8A 1GHBG 1IAUA 3SU1A 2ZFPH 3TJVA 1GBKA 4ISOA 1MBMA 3MU8A 1KLJH 1HXEH 5LPFA 3AAUA 4YLQH 1FAKH 1MD8A 4YT7H 1O5CB 4GLYA 5EXMA 4I8KA 2UWLA 1X7AC 3NUMA 3VEQB 1SFIA 4Y8ZA 3MU1A 1DY8A 1BBRK 1V2QT 1W13U 2FOBA 1PQ5A 4BXWA 1TIOA 3PWBA 2OC1A 1GI0A 1V2RT 2WPIS 3LGUA 1VCPA 1ELCA 1P2MA 3BSQA 4BTIB 1TGTA 4ISHH 3KIDU 4X1PU 3BN9A 4TPYA 4X8VH 1Z8IB 2BDAA 2FYQA 2ZA5A 3LJOA 1K1MA 2XC0A 1QB1A 1TALA 5FXLA 2ZHFH 1P06A 1ELDE 4Y0YE 2F3CE 2WPHS 1EB2A 1D3TB 2CF9H 2THFB 1ID5H 2VIQA 1AFQC 3RMNH 2G5NA 3FP8E 2C8XB 1H4WA 1CGIE 2BHGA 1F5KU 1D4PB 3PMJA 2BDGA 3PLKA 4BOHA 1BRUP 3PLBA 2BM2A 1GI9B 3RLWH 1SLVB 2FEQH 2FOGA 2VWNA 4ZKSU 4X2VA 1BMLA 1V2UT 4IN2A 4O97A 2D1JA 4FVDA 2ZU2A 3M7QA 1SSXA 5DGJA 2XRCA 3RXOA 2VVVA 3V7TA 1CT0E 3SGAE 2Z9IA 3S9AA 2FWWA 2RA3A 1C1WH 1OYTH 3K9XB 2Z7FE 1ELGA 1GBEA 4K5ZA 1KXCA 1GJCB 1KXAA 2ZDVH 3F9EA 1W0YH 2A32A 2C8ZB 5C67A 1NY22 2QY0B 2SFAA 2AEIH 2G51A 5E0GA 4ZXYH 2PSXA 2G52A 3RM2H 1WOFA 2UWPA 5FPSA 3SUEA 4NZQA 2VIPA 3R0FA 1SGCA 4WH6A 2P8OC 1Z8RA 3MTYA 2GP9B 3S0NA 1GG6C 2Z9KA 1ZMLA 2Z3CA 2GZ9A 2BDIA 3LGVA 1P10A 1UJ1A 4XDEA 4XBBA 1AFEH 7KMEH 2A7HA 2Q6DA 2BVRH 4FUIA 2WPMS 3UQVA 1ESBA 1EJNA 2VH0A 1RIWC 1O3JA 2Z3EA 3NKKA 5E2PA 4YOIA 2BTCE 2ESTE 4BTUB 1N1LA 4OS5A 2LPRA 4UEHH 2ZGBH 3EGKH 1GVZA 1QRZA 3BEFB 3DFLA 1NO9H 1YCPM 1MTNC 1YC0A 1OP8A 1C5YB 1EUFA 1DOJA 3A83A 1QFKH 1CA0C 2BD5A 3T25A 1S81A 3F9GA 5EOKA 1Z1IA 2ZPRA 1TMBH 3TJUA 4A1XA 1DICA 4FUGA 3NK8A 5FX6A 3Q3YA 2AGEX 1JIRA 1GGDC 4YESB 1O3MA 5LPRA 1J15A 3SGBE 1T8MA 1LHEH 4DIHH 1ORFA 3C27B 3M5LA 1BIOA 7GCHG 1S6FA 1BRCE 4NCYA 1RS0A 1ETTH 1ZJKA 5CHAC 3S7KB 3KCGH 1N6XA 1EP5A 1WCZA 4HZHA 1C5UA 1DANH 4FUFA 1V2NT 2A4RA 5DP5A 2P3FH 1VITH 3TH3H 3ZVGA 2OQUA 3QTOH 4ISNA 3UOUA 1TNJA 1O32A 4Z6AH 1IQHA 4JYTA 1O39A 3VB6A 1HJAC 1GI5A 4BXSA 3SV9A 3E91A 1HFDA 2TGDA 3PMAB 1O0DH 1OS8A 2TPIZ 3RXJA 1UTNA 1AUTC 2G4TA 4YTAA 3SU3A 2GCTB 2PR3A 4YM9A 1QL7A 4FVBA 2YNBA 1C5MD 3UTUH 1IQGA 2A5IA 1TX6A 2G4UA 2A4OA 4JZIA 1BDAA 3SHAH 2ZDAH 2C90B 2BY9X 1V3XA 4ZUHA 1QQUA 1UCYH 1MTVA 4U01A 2O8UA 5A8XA 4MTBA 4B2AA 2EC9H 1HAVB 2VIOA 4NA9H 1MKWH 3A8CA 4ZH8A 1Q3XA 1QA0A 5T3HA 3TK5A 3U8TH 3ZV8A 1C1SA 1DWBH 4A92A 2WYJA 4YOJA 1BHXB 2ANYA 1P03A 3RP2A 4SGBE 1SPJA 3ZYEA 2V3OH 2BD3A 1GBIA 1GBAA 3QTVH 2XC5A 1TBRH 3ELAH 4K60A 2OP9A 1YLCA 2FX4A 4Q7YA 2GV6A 1GHZA 2AMPA 3A7ZA 2W7UA 3T28A 2G55A 2FS8A 2BD2A 1GCDA 2QF3A 4GHQA 3SUGA 4OGXA 3RXQA 3QZQA 1K21H 1MQ6A 3PTNA 1P02A 5JYIA 5SGAE 2J4IA 3A86A 1S0QA 3NWUA 2BYAX 1ELEE 7LPRA 2OCVB 1C2DA 1S6HA 1GMHF 1LHFH 1O2PA 2FOCA 3QGJA 1ZTKA 4X6NA 1C5PA 4Q7XA 1DWEH 5EPNA 6CHAB 3Q77A 1AB9C 2EI8A 4CRDA 3TJNA 4FU7A 1D9IA 3M3TA 5EQRA 3M36A 1C1NA 1ZHPA 1ZSKA 2PLXA 3MNBA 4WMDA 3MI4A 1QTFA 4HFPB 1C2LA 1GL1A 1Y3VA 1NPMA 5K0HA 1WQSA 2BD8A 1T7CA 2TIOA 2W7SA 2Z9LA 1P2NA 1ELVA 4JK5A 2R3YA 2K1QA 4OS7A 2AIQA 2FOFA 1TRNA 1UVOA 3KQCA 3OYPA 5AHGH 2Q1JA 2GCHF 5F6MA 1A3BH 3VGCC 1O3BA 3D65E 1C5OH 3SU4A 1ELAA 1E37B 2JETB 2PUQH 2EI7A 1EPTA 5C20A 1O2MA 4X6OA 4X8TH 5L6NH 1C4Y2 1MZDA 3PO1B 1W10U 3ODDA 1C2HA 1GHVH 1C5VA 1TLDA 1KTSB 4ABAA 3ESTA 1FMGA 4UFEH 1BHXF 1YGCH 1OWKA 1MKXH 4Z0KA 4GUXA 1C2IA 3M7TA 1TAWA 2FLRH 1KXDA 1ZSJA 2PKAB 1P12E 1P9UA 1BTUA 1FI8A 4IC5A 3SV7A 1DWCH 1H8IH 4CH2B 3DFJA 5JB9S 1RGQA 3E0NB 2H9EH 1EJAA 4K1TA 1GMHG 2GD4B 2GVFA 4FUEA 3ATIA
chains in the Genus database with same CATH superfamily
2J34A 1LO6A 4AB8A 1GHXH 3CS7A 2J98A 3BEUA 2O8MA 3L6PA 2HNTF 1PPCE 1C5ZB 3ZVAA 1DE7H 1G3EA 5DP6A 1O3EA 3K2UA 4WWYA 2PTCE 5IK2D 1AVXA 3SU5A 2WV9A 1GBTA 2HPQH 3F2HA 5ESBA 2GV7A 1GBDA 1GL0E 2BD4A 1AFQB 1QCPA 1QB9A 4X8SH 1IQEA 1LHCH 3UWJH 1HDTH 3RXHA 1UW7A 1JXPA 2CMYA 1L4ZA 4F55A 2Y80A 4Y8YA 2BDYA 3RDZA 1SGDE 3E90B 3GCOA 1KXFA 1C5RA 2JKHA 3VG8A 4E7RG 1YCPH 1AKSB 1HAYB 5KECA 2XC4A 1D3DB 4I8HA 2WV4A 1DY9A 4GCHF 3MH7A 1EZSC 3MNXA 2WPKS 1Y8TA 2VVUA 1C5WB 2VJ1A 1MTWA 2F4LA 2DUCA 3W95A 2ZF0H 1QIXB 2FOMB 3KL6A 1BMMH 2ZDNA 3GCHC 1SGNE 2SGPE 1KLIH 4ZXXH 5FL7D 5HXFA 4MDSA 3ZYDA 3QDZB 1DWDH 1YYY1 3SV2H 2P8OB 5KEDA 1HAIH 3SZNA 1LPGB 4K69A 1HAXB 8KME2 3AK5A 1LVOA 3HK6B 1M9UA 2AFQB 2NWNA 1A5GH 2QGRA 1SLXB 3OX7U 1NROH 4NA7A 2HLCA 1GG6B 1KLTA 2D2DA 2BDHA 4BAMB 3GISB 2ZPSA 3I77A 2EQNA 1GJ4H 2H5CA 2VU8E 4I7YH 2TGTA 3F0PA 1G2MA 4XOJA 1KIGH 3H7OA 3V3MA 4O3TA 4FOUC 1MTSA 1RIWB 2ZGXH 4AZ2B 1K0HA 1BBRH 1BCUH 1LVYA 3A8BA 4TY7A 8GCHG 1P09A 1LHGH 1LVMA 1EOJA 3GY3A 1HRTH 1MTNB 1GJDB 4AG1A 2STAE 3QWCH 3MH6A 1G9IE 2ZQ1A 2J97A 1CA0B 2VVCA 1XUIA 4Y71A 1FJSA 3B8JA 3LGWA 1TMUH 1CBWC 3MO9A 2JH5D 3SW2B 3UNSA 1GBBA 3VFEA 1ANDA 1AQ7A 3FFGA 3MQKC 2ANWA 3AAVA 2LNCA 2G81E 1NM6A 2CGAA 1HNEE 2KCPA 4MLFB 1BA8B 2A0QB 3BF6H 2XCNA 3DCLA 3V13A 4AOQA 1UMAH 2XBXA 2CF8H 1OPHB 1Y3YA 3SNBA 2M2AA 2PP6A 2SNWA 4Y11E 2VIWA 3U9AH 4A6LA 4CBNA 2IJD1 1SHHB 1TQ0B 1VCQA 2GDDA 2P59A 1YPKH 4TPIZ 4I8LA 1O3OA 3HGNA 3OTPA 4NIYA 1O2NA 1GVLA 1T8OA 2D8WA 3ZVFA 1AI8H 2OLGA 1Z6EA 5GNDA 1FY4A 3QGNB 5EQSA 4ABHA 4OGYA 1Z8JB 2F83A 4D9RA 1DM4B 2FZZA 2QV1A 3B23B 2BD7A 4I33A 3M3SA 4X1SU 3LIWA 5DP4A 1C5NH 2HVYB 1YWUA 1FIZA 1TMTH 2HGTH 3BV9B 4TWYA 1VR1H 2Y5FA 5DG6A 4IS5A 2ZFQH 4AFZA 4ISLA 1XVOA 3HATH 3P17H 2AS9A 4X6PA 4NIVA 3GY4A 3STIA 3SU0A 1DPOA 3SI3H 1DLKB 1BMNH 2PTNA 2A2XH 3M5MA 3SNEA 4TWWA 1A2CH 1BTXA 1E36B 5BPEA 2SNVA 5C5NA 2ZG0H 3LDXH 2F9NA 1O2GH 1ZPBA 2FPZA 1O36A 3VXFH 4LOYH 1GDUA 5FX5A 1FY5A 4OS4A 2R9PA 1C2EA 2XWBI 3SI4H 1J16A 1LKBA 1VITG 4HGCA 2VWLA 5FPYA 4FUCA 3E0PB 1GI7B 5GIBA 1O2ZA 2TRMA 3GY7A 1TGCA 3GYMA 1P3CA 3RU4E 4DGJA 1OKXA 3DUXH 2IPQX 3ZZ3A 1HJ9A 3TK9A 1GBCA 1G3CA 1UTOA 2FMJA 4YOGA 1SI5H 2VGCC 3FP7E 1JOUB 3UR9A 1ZJDA 2W6JD 3VXEH 5TJXA 1XUHA 3LONA 2ZFTA 1BQYA 2ZIQH 4DIIH 2AGGX 1AVWA 1O37A 3RXCA 1YLDA 1QBNA 3ATMA 2SGAA 2VIVA 1SGFA 1A61H 1QQ4A 1IQMA 2C93B 1BMAA 1S82A 4KELA 1O3DA 1AB9B 3V0XA 1EB1H 1BTHH 4FXGH 3I78A 4ZHMU 3T62A 3FZZA 4BAHB 2BXUH 1EQ9A 1AO5A 5ETXA 3GY5A 1O30A 3QK1A 4LZ4B 1C2KA 1S84A 3N7OA 2QIQA 2RG3A 5T6DA 1TRMA 1ZLRA 3OE7D 2HPPH 4KTSA 3UQOA 1ANEA 1PPZA 1K9OE 1RTFB 2AHME 2QYIA 3RMLH 3EA7A 4VGCC 1KDQB 1O31A 1O5BB 1ZR0A 1MQ5A 5DP3A 3KQEA 1Y5AT 4AFSA 1LQEA 1PPHE 4B74A 3GYLB 3VB4A 2H9HA 1S83A 2XOKD 2ZQ2A 3A7XA 1T32A 3T5FH 4DVAU 3ZZBA 3S69A 1FY3A 2AIPA 1TONA 2L74A 2O8LA 3TGIE 2SGDE 2FX6A 1EAWA 4IBLH 2PW8H 1O5FH 1THRH 2R2WU 1OWEA 3NPSA 1N8OC 6ESTA 1HV7A 1C1TA 4DCDA 1ZMJA 2GTBA 3RXAA 1O3LA 3TGJE 2FXRA 4K3JA 1WUNH 1F0SA 1K1OA 1CT4E 4MNVA 2GMTC 2ZU4A 2J9NA 2CJIA 4AORA 1O2UA 1YP9A 4CBOA 1XM1A 3OY6U 4IMQA 3ZVDA 1UK2A 4SGAE 3RXVA 1OHHD 2GZ7A 2PSYA 5EU8A 4JMYA 1IQFA 5JDUB 1XVMA 3A85A 4GSOA 3RXUA 3LKWA 1GBHA 1W3CA 3F6UH 3KYGA 3MFJA 3SBKA 1O2IA 4LZ1H 1ABJH 1KXBA 1NRQH 1O3PB 1O2QA 5DK1A 1TBQH 1QA7A 4GHTA 5C2ZA 1OWIA 1QR3E 2G8TA 3RXBA 4ABBA 4X1RU 1W7XH 5CHBA 2XW9A 3ENSB 4OS2A 4NA8A 1TGSZ 3MYWA 4ABFA 3P92A 4CRFA 2VINA 2FTMA 4Y0ZE 5C0TA 1WQVH 1LHDH 2JH6D 5T6GA 1UVUH 2EY4C 3FVFB 2P93A 2ZKSA 5A8YA 1J14A 4Y76A 4Y10E 2AMQA 4UD9H 5FBEA 2J5UA 1THPB 2OQ5A 1AZZA 5L2ZH 5HM2A 2PKAA 1EAXA 1V2MT 2QAAA 3GDSA 1SOTA 1SLUB 5L2YH 3RXGA 1BOQA 1K1JA 4JZ1A 1AHTH 2ZDLA 1V2WT 3GDVA 4AGKA 5LGOA 5HIZA 1P04A 2KR7A 3SHCH 1P3EA 1AWFH 2V7QD 2OC0A 3BTME 4I31A 2HOBA 4WVPE 5ABWA 4MVNA 1DUAA 1ETSH 2O8TA 2ZI2H 3UPEA 1F0RA 1P11E 1IOEA 3D62A 4CRGA 4KTUA 1NRSH 2GDEH 4THNH 1O2OA 2Z94A 3I29A 1FLEE 1Y3WA 1WTHD 4B71A 1NU7B 1O2SA 1E0FD 1Z1JA 4XSKU 2ZHEH 1MZAA 1NC6A 1WV7H 2FI3E 3M5OA 2P95A 1SB1H 1ARCA 1MBQA 5AFZH 4F48B 1GJ5H 3KQBA 4XBCA 1C5TA 1Z71A 4JZFH 1F92A 3SYJA 2OXSA 3TK6A 4FUBA 5K7RA 4BAQB 2RDLA 1EPTC 3SJ8A 3UNQA 2ZNKH 2ZGCA 1QY6A 2NU4E 4B73A 2FS9A 3A7YA 2BX3A 5A0AE 1RFNA 2D26C 1NTPA 1O5EH 1AKSA 4F4OC 1UHBB 1DSUA 2O9QA 3R3GB 2VB0A 1IHSH 3S9BA 2KFWA 3ZZDA 1GI8B 3KGPA 3TNSA 1LKAA 4WJG2 3MU5A 3PTBA 4H6TA 3RXPA 2LELA 1OX1A 5FAHA 2WUCA 2A2QH 2BY8X 5FCKA 1LMWB 3U1JB 3HPTB 5JPMH 1P05A 4MNYA 1HXFH 3U8RH 4FUHA 3UAIC 2AERH 2UWOA 1DXWA 4JK6A 3LU9B 1CBWB 4K8YA 3SO3A 4AX9H 1QRXA 2F43B 3F9HA 3IG6B 1SR5C 2AH4X 4DT7B 5I46H 1EASA 5CE1A 3STJA 4WH8A 1UVSH 4AFQA 4DG4A 1NT1A 1J8AA 2NU2E 3MNCA 3E6PH 1RRKA 2QXIA 1OP2A 3K65B 2A4QA 4Y6DA 4MPWA 1SGQE 1EAIA 1U6QA 3LGYA 5FBIA 1GJBB 1GJAB 5J4QA 4AG2A 5IYTA 1VGCC 1PQ8A 3A8DA 1G3DA 2ODYB 2WHXA 3A84A 2J95A 1FX0B 3UWIA 4JZEH 1DXPA 3GOVB 3TJOA 5J4SA 2W6ID 3ZZ8A 3T2NA 3FN8A 3T26A 1EJMA 5DP8A 1ELBA 4DY7B 1TX8A 1WXRA 3A89A 1T8NA 3PRDA 1KSNA 4CH8B 1T4UH 1GHAF 1NFXA 2VBCA 4RKOB 3RXEA 1F5LA 1YPHC 1TPSA 5C0UA 2WPJS 4YLUA 3SGQE 3DHKH 5T1VA 1YPGH 2RA0A 5CDFE 1W14U 3SV6A 2ZCHP 4RT1A 4O3UA 5DKMA 1ELTA 4X2WA 8ESTE 2V6NA 2B5TB 3EE0B 5JB8S 2CHAC 1SG8B 2UUJB 1GDQA 3RU4D 1KY9A 4B75A 2XYAA 1C2FA 4I8JA 1GJ6A 1JMOH 3LOXA 1OP0A 1OWHA 3N7EA 1QL8A 1MCTA 1E1RD 1C4U2 1NBMD 2BDCA 1J9CH 1GCTB 1IQIA 1KTTB 1BRBE 3ZVCA 2ZGHA 3CS0A 5IDKA 2PKSB 1EFRD 1YPLH 1TPPA 2IPHA 4HG6A 1RD3B 3A8AA 2ZDMA 5C5OA 3A88A 4YO9A 1YLNA 4O03A 1F2SE 3RUOA 4R0IA 3KN2A 3UREA 1C4V2 1NFYA 4TYDA 1TOCB 3FZDA 1K1PA 2F9OA 4XFQA 4IC6A 4U32A 1GJ9B 4NWLA 1WAYB 3ZVEA 3CNRA 1GMCF 1IQJA 4FUDA 5EXLA 2ZGJA 1PPGE 3U1IB 1A0LA 9ESTA 1AZ8A 1O2WA 1L1GA 3QZRA 1YPEH 2Q6GA 1ZMNA 4CR5A 1B0EA 1GHAG 2LP6A 1PQ7A 1EOLA 1NFUA 1C5XB 3LGTA 4NG9H 1LQDB 2GKVE 1BUIA 3IWMA 4UONA 3FAOA 3MO6A 3BG8A 1O2XA 1C1MA 5E0JA 2IJOB 2Y81A 1O2RA 2Y6TA 2ZO3H 4OS1A 1K22H 1FUJA 4FUJA 3BIUH 2STBE 3QO6A 1TB6H 1QJ6B 2WPDD 3KF2A 3E3TA 2GCHG 4DT4A 1YPMH 1SFQB 1BJUA 4B6EA 3BG4C 2J92A 4ABDA 4F49A 2ZDKA 4VGCB 3RXTA 1O38A 3EAJA 1JRTA 2BLQA 3NZIA 1SGFG 1XUKA 1ZTLA 1O5AB 2PGBB 1JIMA 3RLYH 4ZKOU 3Q76A 3TITA 1V2KT 1C1QA 2PHBA 5AF9H 3OAAD 1LVBA 2OK5A 1E1QD 2BQ7B 3T29A 1N8OB 1QJ7B 3OU0A 4JYUH 1SQOA 2W5EA 1TNKA 3S7HB 3KHVA 1NRRH 2ZU5A 1H9IE 3CENA 1WDIA 4CRBA 1HLTH 2GMTB 1L0ZA 5JBTA 1HUTH 1AD8H 2BZ6H 1AUJA 2BX4A 3TGKE 1O2JA 1TQ7B 4RSPA 3FP6E 4H42U 3DSGA 3LJJA 4NZLA 1DT2A 1WU1A 1BRAA 2UUFB 1H9HE 3UFAA 2KAIB 3E8LA 4UFGH 1AMHA 5EXNA 1KDQA 1QRWA 1MH0A 1Y5BT 3RC4A 2FDAA 4OS6A 3DT0H 4HI3A 5F8XA 4QT8C 1BT7A 2G00A 3JZ1B 3UOPA 1F0TA 3SJ9A 4E7NA 1ELFA 3URDA 1XMNB 1SL3A 1TPAE 1C5QA 1CSOE 3PWCA 4P00A 4WMEA 3RXKA 1V2ST 1E35B 1O3FA 2XBYA 2ZTXA 1CQQA 2VNTA 4LXBH 3RXSA 1O2TA 3M35A 5TCAA 1TBZH 1IQLA 1HYLA 2C8YB 4IN1A 1ARBA 2KCYA 2VH6A 5DP9A 2GCTC 1TNHA 4B2BA 1ZGIA 2ASUB 2NU1E 1AVGH 2ZFRH 3D49H 3Q3KA 3A87A 3TH4H 4D7FA 5BRRE 2ZFFH 3ZZ7A 1AE8H 3PMHB 4X0WU 3EQ0H 4TT3D 3VB3A 2A45B 3F2FA 1L1JA 3T27A 2HNTE 2GZ8A 3SOSA 2ANMH 1TPOA 1XUJA 4GCHG 2QN5T 5LH8A 1B7XB 3TPIZ 1B0FA 2JH0D 1C2GA 2XBWA 1INCA 2BVSH 2M5TA 5EJZA 4WMFA 2XXLA 1GGDB 3TNTA 3ZZ4A 2ZFSA 1LDTT 2J2UA 4FU8A 5EJLA 1ZHMA 2H2ZA 2ZU1A 3F2GA 4D8NA 2WZQA 4ASUD 2ODQA 3P8NA 1A5HA 3P6ZB 3GS9A 1AU8A 5CHAB 3PM3A 1FNIA 3AVZA 4OM9A 1GJ7B 2SGFE 1IQNA 1EKBB 2FI5E 3BTHE 1O35A 3FANA 3BTWE 2R0LA 1HIAB 2I6SA 1C9TA 1GI6A 1TNGA 4ZROA 1UTMA 2H9TH 2HVXA 4CRCA 1LPKB 2HNTC 1O3NA 1ZRKA 4D7GA 4X1NU 3W94A 1CVWH 1HJAB 1UTLM 4AFUA 1BB0B 2HWLB 1G3BA 1GBLA 1SVPA 1TNLA 1OWJA 2PV9B 5GWZA 1XUGA 1GI2A 4KTCA 1A0JA 6CHAC 4WF8A 1ZHRA 6GCHF 3LH1A 1S5SA 1CHOF 1OWDA 1C1PA 1VCWA 3ZZAA 1QZ8A 3QUMP 4NGAH 3TVJB 5HIYA 4A5TS 5A09A 3VB5A 5EW1H 1P8VC 4DJZB 3AW1A 2F91A 1S0RA 2ZZUH 3LC5A 1D6RA 3SORA 3GICB 3PV4A 1FPHH 1G2LA 2XBVA 2ZECA 3SNAA 3LH3A 5GDSH 2FYRA 1PPFE 1YF4A 3N99A 3S9CA 1AN1E 2W3KA 2J98B 1MUEB 3GY6A 1TGBA 3BTKE 1P0SH 2RCEA 5HGGA 4O9VA 2V3HH 2VWOA 6LPRA 1V2TT 1OYQA 1PFXC 3WWFA 2CV3A 2QE7D 1KMHB 1TE0A 2FIRH 1GBFA 4MPVA 3ZZ6A 1NBME 2KCOA 2YMSC 2Y7ZA 1QBOA 1EZXC 1EATA 2ULLA 4Y7AA 3SUFA 4A1VA 4XE4A 1VGCB 1C1RA 1HAVA 3SJKA 1QL9A 1MTUA 2F9VA 1FONA 1HPGA 2ZCLP 2A7CA 2OBQA 1O3IA 3KEEA 2NU0E 4Q80A 1RTLA 2BOKA 1K1NA 4AYVB 5C1YA 5L30H 1O33A 4I32A 4BAOB 3O8DA 4X1QU 5FPTA 1YM0A 6GCHG 4FETA 4RT0A 1NU9A 1CHOG 4Q2KA 1ZOMA 1SQAA 5EG4A 1G30B 1FIWA 2OTVA 1LCYA 3O8CA 1MCVA 1TA2A 3EA9A 2C8WB 2VWMA 4H6SB 2FLBH 2A31A 4X6MA 1WBGB 3SU2A 4Y7BA 1RXPA 4MPXA 2OUAA 1O3KA 4ISIH 1XUFA 2DE9A 3BTFE 3QN7A 1PPEE 3F0OA 3UB0A 2XTTB 1J17T 3VGCB 1ANCA 1SLWB 1TX7A 3ZZ9A 1UCYE 2CHAB 3RXFA 2P3UB 2ILNA 1S85A 1A4WH 2WV5A 3TIUA 1BZXE 4ESTE 4NFEA 4KKDA 1T31A 3ATLA 3EYDA 3ZVBA 1ZPZA 4UFFH 2Z9GA 2JJ2D 1O5GH 5HMAA 2OD3B 5EODA 5I25A 1NFWA 3KQDA 2B0FA 2ZP0H 3F68H 1SBWA 2H1UA 3SU6A 5AFYH 1BTZA 2BY6X 3C1KA 1HAOH 1PYTC 1FV9A 2YOLA 1EP6A 1W0KD 2HALA 1G32B 1QGFA 4B1TA 1F0UA 4MQAA 1F7ZA 3RC6A 1SMFE 2BQWB 1W0JD 5DN6D 3UNRA 1T8LA 1YBWA 4B76A 1EZUC 2Y82A 2B8OH 7GCHF 1O2LA 1NS3A 5KGOA 8LPRA 2ALVA 1SHYA 2ZTYA 1ETRH 1Q2WA 3P95A 1PJPA 3PV5A 1Y3UA 1PQAA 4WXVA 5F8ZA 3BIVH 2AGIX 5B6OA 5EW2H 3A7WA 2ALPA 5LPEA 2FP7B 3DD2H 1QURH 3ZV9A 1BMFD 3Q3XA 5T6FA 1UVPA 3BG4B 1NRNH 3BTDE 2BOHB 1TGNA 2WUBA 4XBDA 4K8BA 1COWD 2P3TB 1O2YA 4ACBA 3RC5A 3BTEE 1ANBA 3PLPA 3DA9B 4D9QA 1HGTH 2A4GA 4MPUA 1O2HA 3RU4T 1O2VA 3A82A 3U98H 4RN6A 2ZHQH 3MU0A 5ESTE 1CHGA 4AGJA 4X8UH 1NESE 2CXVA 1P2JA 1MU8B 3Q00A 1V2LT 2A5KA 2V0BA 3LPRA 1DX5M 1TNIA 2GX4A 1CGHA 3BTGE 3H7TA 3GCHB 4H4FA 5EPYA 5A8ZA 2QCYA 2NU3E 3F1SB 2TGPZ 1ESTA 1EAUA 3RMMH 3URCA 1BTWA 2W3IA 3OSYA 2FI4E 4AYYB 5C3NA 3M3VA 4MNWA 1P2IA 3SZEA 1THSH 3PV2A 2A7JA 4UDWH 1CU1A 4FU9A 1Y59T 4Q7ZA 3WW7A 5F03A 4BTTB 1C5SA 1W0ZU 2BQ6B 3GCNA 2PWXA 4ZHLU 1HAZB 1T4VH 3TU7H 4J1YA 5HM9A 3RXLA 1H8DH 3MO3A 1VJAU 4E05H 2B7DH 1CGJE 4YZUA 3GDUA 1AY6H 2Q6FA 1A46H 3AASA 1W2KH 3D23A 3EE7A 2BZAA 5A2MH 1NN6A 1XXFA 2GT7A 1KXEA 2XNIA 1O3GA 1SQRA 1MAXA 1UO6A 1GJ8B 2BDBA 3KNXA 3HK3B 1N6YA 3O8BA 4NSVA 1P2KA 3HGPA 1L1NA 5EQQA 2FOHA 3RM0H 4J2YB 2AMDA 1P2QA 1V6DA 4NIXA 2Y5GA 1YPHE 2KAIA 1DDJA 2H6MA 1VJ9U 1B5GH 2ZWLH 1JBUH 3P8FA 2FO9A 3MH5A 1GI3A 2UUKB 1AWHB 1UVTH 1TABE 3EA8A 2GJGA 3UY9A 1FPCH 2HRVA 1Z7KA 2PGQB 3BEIB 2G5VA 3VPKA 3UIRA 4CHAC 3SQEE 3G01A 2EEKA 3SJIA 1C2MA 4GAWA 5A0BA 4ABIA 4KP0A 1Z6JH 3UR6A 1E34B 1ABIH 2QXHA 1OSSA 1YKTA 1EX3A 5C1UA 1H9LB 3QX5H 3O8RA 2JIZD 2FESH 5GPIB 1XKAC 2YMSD 1XX9A 1LPZB 1SGPE 4U30A 4I8GA 1E79D 2BY7X 4NFFA 3OY5U 1W8BH 5B6LA 1O3HA 1O3CA 3E16B 4ASHA 3TH2H 3BTQE 3PMBB 3A7VA 1K1LA 3GY8A 1GWAA 1ZPCA 2Y5HA 1OXGA 2TBSA 1MU6B 1HAPH 1GHYH 2Y7XA 3MNSA 4PROA 4LK4A 1KYNA 2H5DA 1QB6A 2IN2A 2FOAA 2W26A 4P02A 2ZU3A 3OFND 2OC8A 5DPAA 1O2KA 4ABJA 3IITA 4AB9A 1GDNA 1K28D 1BBRE 1RJXB 3RXDA 1C5LH 4JZDH 4M7GA 1ZGVA 2F9BH 4MG3A 1EZQA 1H1BA 1UK4A 1A7SA 2L6OA 1AIXH 4INLA 1HIAA 1GBMA 1HAHH 2I6QA 3MU4A 4ZHAA 2R0KA 4K2YA 1QJ1B 4AN7A 3QLPH 2B9LA 3ATWA 1GI1A 2YNAA 1HCGA 1HJ8A 1C1VH 2QXGA 4X2YA 2KX4A 2ZHWH 2O8WA 1SQTA 4IW4E 2EA3A 2Z3DA 2Z9JA 1TWXB 2VGCB 1QNJA 3LT3A 5DO4H 1UTJA 1DLEA 2YMSB 2GT8A 1O5DH 2BB4A 3OTJE 4DOQA 1ZRBA 3V12A 1FN6A 2F9UA 2QF0A 3AW0A 1ZTJA 1XKBC 1C1UH 1UTQA 5C1XA 4HTCH 9LPRA 1SGYE 5F53A 1A3EH 1GBJA 4CRAA 2ZEBA 1PYTD 1V2VT 4X2XA 5GJ4B 1MMJN 1UCYK 3SNCA 3M61U 3NCLA 4K1EA 5HKKD 2CN0H 2AYWA 3SV8A 1MKWK 3ITIA 1VZQH 3SQHE 2IOTA 3MOCA 3NXPA 3PYHA 4JCNA 1GI4A 3HKIB 1FY8E 1SOZA 3PRBA 1BTYA 2PUXB 2QA9E 3RMOH 5DP7A 1MAYA 2KCAA 4RKJB 2BMGB 4KGAA 4UE7H 4Z1MD 1A5IA 1PPBH 4RI0A 2R3UA 2R2MB 3DSOA 1P2OA 5HYOA 3E1XB 1Z8GA 1C1OA 2UUYA 3U8OH 1MD7A 1V2OT 1GHWH 3B9FH 4ACAA 5A0CA 4WY3A 1TOMH 1RTKA 5E0HA 5E2OA 1XXDA 4ZMAH 1W11U 1D3PB 1ZZZA 2PFEA 3GCTF 8GCHF 2GGVB 1P9SA 3TLOA 3A80A 5EGMA 4ZKNU 3RXMA 2BLWA 2JDID 2WPLS 5GCHF 3MHWU 3NRLA 1BITA 1EXFA 4JYVH 1TRYA 1SGRE 3LGIA 3M7UA 2F9PA 2C3SA 3ZZCA 1A0HB 4NIWA 1BTPA 2QF5A 1L4DA 2OINA 1E38B 3SNDA 3HKJB 4TY6A 3RXIA 1GMCG 5JBAS 1GVKB 4D76A 4ZKRU 3JZ2B 1JWTA 1NRPH 2FOEA 5JBCS 1FDPA 1C2JA 1UTPA 5E8EH 1V2PT 1AGJA 1CO7E 5CMXH 1HBTH 2ZTZA 3FOAA 2A5AA 3MH4A 2QC2A 1O34A 3UUZA 3P8OA 1K2I1 3M5NA 5FHTA 2ANKH 5EJ1A 4INHA 2OC7A 1L2EA 2WYGA 2ZHDA 3SJOA 3ATKA 2BD9A 3H09A 4MNXA 4CR9A 5GXPA 1DITH 1CE5A 4NSYA 1JRSA 5FCRA 4UFDH 2XNDD 4A7IB 1A1RA 1Y5UT 3K6ZA 1SC8U 4INKA 1NZQH 3K6YA 4DW2U 1AE5A 3F9FA 3P70B 1Q31A 2P94A 5DJ7A 3U69H 1MKXK 1W7GH 2BXTH 3GCTG 1IHTH 2BLOA 1FY1A 3N7DA 1GMDF 3A81A 3PROA 1ESAA 1LTOA 1D3QB 3U28C 3BTTE 5GCHG 3ODFA 1VKYA 4BAKB 2QXJA 1DFPA 5JBBS 2ZCKP 3EDXB 3MMGA 4WXIA 3GY2A 5PTPA 1ACBE 3FKSD 1FXYA 1P01A 2TGAA 4ZCNA 4A1TA 4NWKA 2WINI 4ZAEA 1OOKB 3SUDA 1SGIB 1BJVA 1VITF 2KZ4A 3PB1E 4DURA 1UTKA 2ODPA 2C4FH 1GHBF 1UK3A 1CT2E 2V35A 1DS2E 3WY8A 4CREA 1FZZA 5G4BA 4Y79A 2EI6A 3A7TA 1EPTB 1TYNA 2FTLE 1HAGE 4IMZA 1QBVH 4B2CA 4GVUA 4BANB 1IQKA 4GPGA 2BLVA 2P16A 2XWAA 1QHRB 1FAXA 3LC3A 4R8TB 1G37A 1P57B 1W12U 4I86A 4ABGA 2A1DB 1SGTA 4E06H 3MWIU 1YCPK 2KM0A 2FM2A 1YPJH 1CA8B 2DE8A 1C9PA 3SN8A 1FQ3A 1O3AA 2FODA 2QF4A 2BY5X 1DSTA 5AVDA 1V2JT 3M37A 3L33A 4Y8XA 3RXRA 2V3MA 4IGDA 1GMDG 1HB0B 2Z6BD 4U2WA 4YT6H 4YXWD 1ZSLA 1WSSH 2XCFA 4BNRA 2J38A 5H4IB 1F5RA 4K1SA 3VB7A 2JETC 2SGEE 7ESTE 1GPZA 5F8TA 3ZZ5A 1TA6A 2OBOA 2BVXH 1WTGH 3PO1C 4XRNA 1WYKA 1SGEE 2J94A 3CP7A 2VIDA 1S6LA 1DUEA 2ZC9H 1ZYOA 1GCTC 1UHBA 2SGQE 3P8GA 5TCCA 1Y3XA 3H5CB 1DVAH 1K1IA 4ABEA 1D6WA 1G36A 2HLDD 2ZPQA 4CHAB 2PKSC 1TFXA 3L3TA 1FN8A 1GHBG 1IAUA 3SU1A 2ZFPH 3TJVA 1GBKA 4ISOA 1MBMA 3MU8A 1KLJH 1HXEH 5LPFA 3AAUA 4YLQH 1FAKH 1MD8A 4YT7H 1O5CB 4GLYA 5EXMA 4I8KA 2UWLA 1X7AC 3NUMA 3VEQB 1SFIA 4Y8ZA 3MU1A 1DY8A 1BBRK 1V2QT 1W13U 2FOBA 1PQ5A 4BXWA 1TIOA 3PWBA 2OC1A 1GI0A 1V2RT 2WPIS 3LGUA 1VCPA 1ELCA 1P2MA 3BSQA 4BTIB 1TGTA 3FO8D 4ISHH 3KIDU 4X1PU 4Q4LA 3BN9A 4TPYA 4X8VH 1Z8IB 2BDAA 2FYQA 2ZA5A 3LJOA 1K1MA 1MABB 2XC0A 1QB1A 1TALA 5FXLA 4Q63A 2ZHFH 1P06A 1ELDE 4Y0YE 2F3CE 2WPHS 1EB2A 1D3TB 2CF9H 2THFB 3OEED 1ID5H 2VIQA 1AFQC 3RMNH 2G5NA 3FP8E 2C8XB 1H4WA 1CGIE 2BHGA 1F5KU 1D4PB 3PMJA 2BDGA 3PLKA 4BOHA 1BRUP 3PLBA 2BM2A 1GI9B 3RLWH 1SLVB 2FEQH 2FOGA 2VWNA 4ZKSU 4X2VA 1BMLA 1V2UT 4IN2A 4O97A 2D1JA 4FVDA 2ZU2A 3M7QA 1SSXA 5DGJA 2XRCA 3RXOA 2VVVA 3V7TA 1CT0E 3SGAE 2Z9IA 3S9AA 2K0QA 2FWWA 2RA3A 1C1WH 1OYTH 3K9XB 2Z7FE 1ELGA 1GBEA 3DSPA 4K5ZA 1KXCA 1GJCB 1KXAA 3F3BA 2ZDVH 3F9EA 1W0YH 2A32A 2C8ZB 5C67A 1NY22 2QY0B 2SFAA 2AEIH 2G51A 5E0GA 2RDEA 4ZXYH 2PSXA 2G52A 3RM2H 1WOFA 2UWPA 5FPSA 3SUEA 4NZQA 2VIPA 3ZIAD 3R0FA 1SGCA 4WH6A 2P8OC 1Z8RA 3MTYA 2GP9B 4AC9A 3S0NA 1GG6C 2Z9KA 1ZMLA 2Z3CA 2GZ9A 2BDIA 3LGVA 1P10A 1UJ1A 5DSFA 4XDEA 4XBBA 1AFEH 7KMEH 2A7HA 2Q6DA 2BVRH 4FUIA 2WPMS 3UQVA 1ESBA 1EJNA 2VH0A 1RIWC 1O3JA 2Z3EA 3NKKA 5E2PA 4YOIA 2BTCE 2ESTE 4BTUB 1N1LA 4OS5A 2LPRA 4UEHH 2ZGBH 3EGKH 1GVZA 1QRZA 3BEFB 3DFLA 1NO9H 1YCPM 1MTNC 1YC0A 1OP8A 1C5YB 1EUFA 1DOJA 3A83A 1QFKH 1CA0C 2BD5A 3T25A 1S81A 3F9GA 5EOKA 1Z1IA 2ZPRA 4M9FA 3KYFA 1H8ED 1TMBH 4XD7D 3TJUA 4A1XA 1DICA 4FUGA 3NK8A 5FX6A 3Q3YA 2AGEX 1JIRA 1GGDC 4YESB 1O3MA 2JJ1D 5LPRA 1J15A 3SGBE 1T8MA 1LHEH 4DIHH 3W1EA 1ORFA 3C27B 3M5LA 5C94A 1BIOA 7GCHG 1S6FA 1BRCE 4NCYA 1RS0A 1ETTH 1ZJKA 5CHAC 3S7KB 3KCGH 3OEHD 1N6XA 1EP5A 1WCZA 4HZHA 1C5UA 1DANH 2WSSD 4FUFA 1V2NT 2A4RA 5DP5A 2P3FH 1VITH 3TH3H 3ZVGA 2OQUA 3QTOH 4ISNA 3UOUA 1TNJA 1O32A 4Z6AH 1IQHA 4JYTA 1O39A 3VB6A 1HJAC 1GI5A 4BXSA 3SV9A 3E91A 1HFDA 2K8IA 2TGDA 3PMAB 1O0DH 1OS8A 2TPIZ 3RXJA 1UTNA 1AUTC 2G4TA 4YTAA 3SU3A 2GCTB 2PR3A 4YM9A 1QL7A 4FVBA 2YNBA 1C5MD 3UTUH 1IQGA 2A5IA 1TX6A 2G4UA 2A4OA 4JZIA 1BDAA 3SHAH 2ZDAH 2C90B 2BY9X 1V3XA 4ZUHA 1QQUA 1UCYH 3WWBA 1MTVA 4U01A 2O8UA 5A8XA 4MTBA 4B2AA 2CK3D 2EC9H 1HAVB 2VIOA 4NA9H 1MKWH 3A8CA 4ZH8A 1Q3XA 1QA0A 5T3HA 3TK5A 3U8TH 3ZV8A 1C1SA 1DWBH 4A92A 2WYJA 4YOJA 1BHXB 2ANYA 1P03A 3RP2A 4SGBE 1SPJA 3ZYEA 2V3OH 5C17A 2BD3A 1GBIA 1GBAA 3QTVH 2XC5A 1TBRH 3ELAH 4K60A 2OP9A 1YLCA 2FX4A 4Q7YA 2GV6A 1GHZA 1YY3A 2AMPA 3A7ZA 2W7UA 3T28A 4TSFD 2G55A 2FS8A 2BD2A 1GCDA 2QF3A 4GHQA 3SUGA 4OGXA 3RXQA 3QZQA 1K21H 1MQ6A 3PTNA 1P02A 5JYIA 5SGAE 2J4IA 3A86A 1S0QA 3NWUA 2BYAX 1ELEE 7LPRA 2OCVB 1C2DA 2RFKC 1S6HA 1GMHF 1LHFH 1O2PA 2FOCA 3QGJA 1ZTKA 4X6NA 1C5PA 4Q7XA 1DWEH 5EPNA 6CHAB 3Q77A 1AB9C 2EI8A 4CRDA 3TJNA 4FU7A 1D9IA 3M3TA 5EQRA 3M36A 1C1NA 1ZHPA 1ZSKA 2PLXA 3MNBA 4WMDA 3MI4A 1QTFA 4HFPB 1C2LA 1GL1A 1Y3VA 1NPMA 5K0HA 1WQSA 2BD8A 1T7CA 2TIOA 2W7SA 2Z9LA 1P2NA 1ELVA 4JK5A 1SKYE 2R3YA 2K1QA 4OS7A 2AIQA 2FOFA 1TRNA 1UVOA 3KQCA 1H8HD 3OYPA 5AHGH 2Q1JA 2GCHF 5F6MA 1A3BH 3VGCC 1O3BA 3D65E 3KQ5A 1C5OH 3SU4A 1ELAA 1E37B 2JETB 2PUQH 5EIYA 2EI7A 1EPTA 5C20A 1O2MA 4X6OA 4X8TH 5L6NH 1C4Y2 1MZDA 3PO1B 1W10U 3ODDA 1C2HA 1GHVH 1C5VA 1TLDA 1KTSB 4ABAA 3ESTA 1FMGA 4UFEH 1BHXF 1YGCH 1OWKA 1MKXH 4Z0KA 4GUXA 1C2IA 3M7TA 1TAWA 2FLRH 1KXDA 1ZSJA 2PKAB 1P12E 1P9UA 1BTUA 1FI8A 4IC5A 3SV7A 1DWCH 1H8IH 4CH2B 3DFJA 5JB9S 1RGQA 3E0NB 2H9EH 1EJAA 4K1TA 1GMHG 4B6FA 2GD4B 2GVFA 4FUEA 3ATIA
chains in the Genus database with same CATH topology
2J34A 1LO6A 4AB8A 1GHXH 3CS7A 3BEUA 2O8MA 3L6PA 2HNTF 1PPCE 1C5ZB 3ZVAA 1DE7H 1G3EA 5DP6A 1O3EA 3K2UA 4WWYA 2PTCE 1AVXA 3SU5A 1GBTA 2HPQH 5ESBA 2GV7A 1GBDA 1GL0E 2BD4A 1AFQB 1QCPA 1QB9A 4X8SH 1IQEA 1LHCH 3UWJH 1HDTH 3RXHA 1JXPA 2CMYA 1L4ZA 2Y80A 4Y8YA 2BDYA 3RDZA 1SGDE 3E90B 3GCOA 1KXFA 1C5RA 2JKHA 4E7RG 1YCPH 1AKSB 1HAYB 2XC4A 1D3DB 4I8HA 2WV4A 1DY9A 4GCHF 3MH7A 1EZSC 3MNXA 2WPKS 1Y8TA 2VVUA 1C5WB 2VJ1A 1MTWA 2DUCA 3W95A 2ZF0H 1QIXB 2FOMB 3KL6A 1BMMH 2ZDNA 3GCHC 1SGNE 2SGPE 1KLIH 4ZXXH 5HXFA 4MDSA 3ZYDA 3QDZB 1DWDH 1YYY1 3SV2H 2P8OB 1HAIH 3SZNA 1LPGB 4K69A 1HAXB 8KME2 1LVOA 3HK6B 1M9UA 2AFQB 2NWNA 1A5GH 2QGRA 1SLXB 3OX7U 1NROH 4NA7A 2HLCA 1GG6B 1KLTA 2D2DA 2BDHA 4BAMB 3GISB 2ZPSA 3I77A 1GJ4H 2H5CA 2VU8E 4I7YH 2TGTA 1G2MA 4XOJA 1KIGH 3H7OA 3V3MA 4O3TA 1MTSA 1RIWB 2ZGXH 4AZ2B 1BBRH 1BCUH 1LVYA 3A8BA 4TY7A 8GCHG 1P09A 1LHGH 1LVMA 1EOJA 3GY3A 1HRTH 1MTNB 1GJDB 4AG1A 2STAE 3QWCH 3MH6A 1G9IE 2ZQ1A 1CA0B 2VVCA 1XUIA 4Y71A 1FJSA 3B8JA 3LGWA 1TMUH 1CBWC 3MO9A 2JH5D 3SW2B 3UNSA 1GBBA 3VFEA 1ANDA 1AQ7A 3FFGA 2ANWA 3AAVA 2LNCA 2G81E 1NM6A 2CGAA 1HNEE 4MLFB 1BA8B 2A0QB 3BF6H 2XCNA 3V13A 4AOQA 1UMAH 2XBXA 2CF8H 1OPHB 1Y3YA 3SNBA 2SNWA 4Y11E 2VIWA 3U9AH 4A6LA 4CBNA 1SHHB 1TQ0B 1VCQA 2GDDA 2P59A 1YPKH 4TPIZ 4I8LA 1O3OA 3HGNA 4NIYA 1O2NA 1GVLA 1T8OA 2D8WA 3ZVFA 1AI8H 2OLGA 1Z6EA 1FY4A 3QGNB 5EQSA 4ABHA 4OGYA 1Z8JB 2F83A 4D9RA 1DM4B 2FZZA 2QV1A 3B23B 2BD7A 4I33A 3M3SA 4X1SU 3LIWA 5DP4A 1C5NH 1FIZA 1TMTH 2HGTH 3BV9B 4TWYA 1VR1H 2Y5FA 5DG6A 4IS5A 2ZFQH 4AFZA 4ISLA 1XVOA 3HATH 3P17H 2AS9A 4X6PA 4NIVA 3GY4A 3STIA 3SU0A 1DPOA 3SI3H 1DLKB 1BMNH 2PTNA 2A2XH 3M5MA 3SNEA 4TWWA 1A2CH 1BTXA 1E36B 5BPEA 2SNVA 5C5NA 2ZG0H 3LDXH 2F9NA 1O2GH 1ZPBA 2FPZA 1O36A 3VXFH 4LOYH 1GDUA 5FX5A 1FY5A 4OS4A 2R9PA 1C2EA 2XWBI 3SI4H 1J16A 1LKBA 1VITG 4HGCA 2VWLA 5FPYA 4FUCA 3E0PB 1GI7B 5GIBA 1O2ZA 2TRMA 3GY7A 1TGCA 3GYMA 1P3CA 3RU4E 4DGJA 1OKXA 3DUXH 3ZZ3A 1HJ9A 3TK9A 1GBCA 1G3CA 1UTOA 2FMJA 4YOGA 1SI5H 2VGCC 3FP7E 1JOUB 3UR9A 1ZJDA 3VXEH 5TJXA 1XUHA 3LONA 2ZFTA 1BQYA 2ZIQH 4DIIH 2AGGX 1AVWA 1O37A 3RXCA 1YLDA 1QBNA 3ATMA 2SGAA 2VIVA 1SGFA 1A61H 1QQ4A 1IQMA 2C93B 1BMAA 1S82A 4KELA 1O3DA 1AB9B 3V0XA 1EB1H 1BTHH 4FXGH 3I78A 4ZHMU 3T62A 3FZZA 4BAHB 2BXUH 1EQ9A 1AO5A 5ETXA 3GY5A 1O30A 3QK1A 4LZ4B 1C2KA 1S84A 3N7OA 2QIQA 2RG3A 5T6DA 1TRMA 1ZLRA 2HPPH 4KTSA 3UQOA 1ANEA 1PPZA 1K9OE 1RTFB 2QYIA 3RMLH 3EA7A 4VGCC 1KDQB 1O31A 1O5BB 1ZR0A 1MQ5A 5DP3A 3KQEA 1Y5AT 4AFSA 1LQEA 1PPHE 4B74A 3GYLB 3VB4A 2H9HA 1S83A 3A7XA 2ZQ2A 1T32A 3T5FH 4DVAU 3ZZBA 3S69A 1FY3A 2AIPA 1TONA 2O8LA 3TGIE 2SGDE 2FX6A 1EAWA 4IBLH 2PW8H 1O5FH 1THRH 2R2WU 1OWEA 3NPSA 1N8OC 6ESTA 1HV7A 1C1TA 4DCDA 1ZMJA 2GTBA 3RXAA 1O3LA 3TGJE 2FXRA 4K3JA 1WUNH 1F0SA 1K1OA 1CT4E 4MNVA 2GMTC 2ZU4A 2J9NA 2CJIA 4AORA 1O2UA 1YP9A 4CBOA 1XM1A 3OY6U 4IMQA 3ZVDA 1UK2A 4SGAE 3RXVA 2GZ7A 2PSYA 5EU8A 4JMYA 1IQFA 5JDUB 1XVMA 3A85A 4GSOA 3RXUA 3LKWA 1GBHA 1W3CA 3F6UH 3SBKA 3MFJA 1O2IA 4LZ1H 1ABJH 1KXBA 1NRQH 1O3PB 1O2QA 5DK1A 1TBQH 1QA7A 4GHTA 5C2ZA 1OWIA 1QR3E 2G8TA 3RXBA 4ABBA 4X1RU 1W7XH 2XW9A 3ENSB 4OS2A 4NA8A 1TGSZ 3MYWA 4ABFA 3P92A 4CRFA 2VINA 2FTMA 4Y0ZE 1WQVH 1LHDH 2JH6D 5T6GA 1UVUH 3FVFB 2P93A 2ZKSA 5A8YA 1J14A 4Y76A 4Y10E 2AMQA 4UD9H 5FBEA 1THPB 2OQ5A 1AZZA 5L2ZH 5HM2A 2PKAA 1EAXA 1V2MT 2QAAA 3GDSA 1SOTA 1SLUB 5L2YH 3RXGA 1BOQA 1K1JA 4JZ1A 1AHTH 2ZDLA 1V2WT 3GDVA 4AGKA 5LGOA 1P04A 3SHCH 1P3EA 1AWFH 2OC0A 3BTME 4I31A 2HOBA 4WVPE 5ABWA 4MVNA 1DUAA 1ETSH 2O8TA 2ZI2H 3UPEA 1F0RA 1P11E 1IOEA 3D62A 4CRGA 4KTUA 1NRSH 2GDEH 4THNH 1O2OA 2Z94A 3I29A 1FLEE 1Y3WA 1WTHD 4B71A 1NU7B 1O2SA 1E0FD 1Z1JA 4XSKU 2ZHEH 1MZAA 1NC6A 1WV7H 2FI3E 3M5OA 2P95A 1SB1H 1ARCA 1MBQA 5AFZH 1GJ5H 3KQBA 4XBCA 1C5TA 1Z71A 4JZFH 1F92A 2OXSA 3TK6A 4FUBA 5K7RA 4BAQB 2RDLA 1EPTC 3SJ8A 3UNQA 2ZNKH 2ZGCA 1QY6A 2NU4E 4B73A 2FS9A 3A7YA 2BX3A 5A0AE 1RFNA 2D26C 1NTPA 1O5EH 1AKSA 4F4OC 1UHBB 1DSUA 2O9QA 3R3GB 2VB0A 1IHSH 3S9BA 3ZZDA 1GI8B 3KGPA 3TNSA 1LKAA 4WJG2 3MU5A 3PTBA 4H6TA 3RXPA 1OX1A 5FAHA 2WUCA 2A2QH 2BY8X 5FCKA 1LMWB 3U1JB 3HPTB 5JPMH 1P05A 4MNYA 1HXFH 3U8RH 4FUHA 2AERH 2UWOA 1DXWA 4JK6A 3LU9B 1CBWB 4K8YA 3SO3A 4AX9H 1QRXA 3F9HA 3IG6B 1SR5C 2AH4X 4DT7B 5I46H 1EASA 5CE1A 3STJA 4WH8A 1UVSH 4AFQA 4DG4A 1NT1A 1J8AA 2NU2E 3MNCA 3E6PH 1RRKA 2QXIA 1OP2A 3K65B 2A4QA 4Y6DA 4MPWA 1SGQE 1EAIA 1U6QA 3LGYA 5FBIA 1GJBB 1GJAB 5J4QA 4AG2A 5IYTA 1VGCC 1PQ8A 3A8DA 1G3DA 2ODYB 3A84A 2J95A 3UWIA 4JZEH 1DXPA 3GOVB 3TJOA 5J4SA 3ZZ8A 3T2NA 3T26A 1EJMA 5DP8A 1ELBA 4DY7B 1TX8A 3A89A 1T8NA 4CH8B 1KSNA 1T4UH 1GHAF 1NFXA 4RKOB 3RXEA 1F5LA 1YPHC 1TPSA 2WPJS 4YLUA 3SGQE 3DHKH 1YPGH 2RA0A 1W14U 3SV6A 2ZCHP 4O3UA 5DKMA 1ELTA 4X2WA 8ESTE 2V6NA 2B5TB 3EE0B 5JB8S 2CHAC 1SG8B 2UUJB 1GDQA 3RU4D 1KY9A 4B75A 2XYAA 1C2FA 4I8JA 1GJ6A 1JMOH 3LOXA 1OP0A 1OWHA 1QL8A 1MCTA 1C4U2 2BDCA 1J9CH 1GCTB 1IQIA 1KTTB 1BRBE 3ZVCA 2ZGHA 3CS0A 5IDKA 2PKSB 1YPLH 1TPPA 2IPHA 1RD3B 3A8AA 2ZDMA 5C5OA 3A88A 4YO9A 4O03A 1F2SE 3RUOA 4R0IA 3KN2A 3UREA 1C4V2 1NFYA 4TYDA 1TOCB 3FZDA 1K1PA 2F9OA 4XFQA 4IC6A 4U32A 1GJ9B 4NWLA 1WAYB 3ZVEA 1GMCF 1IQJA 4FUDA 5EXLA 2ZGJA 1PPGE 3U1IB 1A0LA 9ESTA 1AZ8A 1O2WA 1L1GA 3QZRA 1YPEH 2Q6GA 1ZMNA 4CR5A 1B0EA 1GHAG 1PQ7A 1EOLA 1NFUA 1C5XB 3LGTA 4NG9H 1LQDB 2GKVE 1BUIA 3IWMA 4UONA 3FAOA 3MO6A 3BG8A 1O2XA 1C1MA 5E0JA 2IJOB 2Y81A 1O2RA 2Y6TA 2ZO3H 4OS1A 1K22H 1FUJA 4FUJA 3BIUH 2STBE 3QO6A 1TB6H 1QJ6B 3KF2A 3E3TA 2GCHG 1YPMH 1SFQB 1BJUA 3BG4C 2J92A 4ABDA 4F49A 2ZDKA 4VGCB 3RXTA 1O38A 3EAJA 1JRTA 2BLQA 3NZIA 1SGFG 1XUKA 1ZTLA 1O5AB 2PGBB 1JIMA 3RLYH 4ZKOU 3Q76A 3TITA 1V2KT 1C1QA 2PHBA 5AF9H 1LVBA 2BQ7B 3T29A 1N8OB 1QJ7B 3OU0A 4JYUH 1SQOA 2W5EA 1TNKA 3S7HB 3KHVA 1NRRH 2ZU5A 1H9IE 3CENA 4CRBA 1HLTH 2GMTB 1L0ZA 5JBTA 1HUTH 1AD8H 2BZ6H 1AUJA 2BX4A 3TGKE 1O2JA 1TQ7B 4RSPA 3FP6E 4H42U 3LJJA 4NZLA 1DT2A 1WU1A 1BRAA 2UUFB 1H9HE 3UFAA 2KAIB 3E8LA 4UFGH 1AMHA 5EXNA 1KDQA 1QRWA 1MH0A 1Y5BT 3RC4A 2FDAA 4OS6A 3DT0H 4HI3A 5F8XA 4QT8C 1BT7A 2G00A 3JZ1B 3UOPA 1F0TA 3SJ9A 4E7NA 1ELFA 3URDA 1XMNB 1SL3A 1TPAE 1C5QA 1CSOE 3PWCA 4WMEA 3RXKA 1V2ST 1E35B 1O3FA 2XBYA 2ZTXA 1CQQA 2VNTA 4LXBH 3RXSA 1O2TA 3M35A 5TCAA 1TBZH 1IQLA 1HYLA 2C8YB 4IN1A 1ARBA 2VH6A 5DP9A 2GCTC 1TNHA 4B2BA 1ZGIA 2ASUB 2NU1E 1AVGH 2ZFRH 3D49H 3Q3KA 3A87A 3TH4H 4D7FA 5BRRE 2ZFFH 3ZZ7A 1AE8H 3PMHB 4X0WU 3EQ0H 3VB3A 2A45B 1L1JA 3T27A 2HNTE 2GZ8A 3SOSA 2ANMH 1TPOA 1XUJA 4GCHG 2QN5T 5LH8A 1B7XB 3TPIZ 1B0FA 2JH0D 1C2GA 2XBWA 1INCA 2BVSH 2M5TA 4WMFA 2XXLA 1GGDB 3TNTA 3ZZ4A 2ZFSA 1LDTT 2J2UA 4FU8A 1ZHMA 2H2ZA 2ZU1A 4D8NA 2ODQA 3P8NA 1A5HA 3P6ZB 1AU8A 5CHAB 3PM3A 1FNIA 3AVZA 1GJ7B 2SGFE 1IQNA 1EKBB 2FI5E 3BTHE 1O35A 3FANA 3BTWE 2R0LA 1HIAB 2I6SA 1C9TA 1GI6A 1TNGA 4ZROA 1UTMA 2H9TH 2HVXA 4CRCA 1LPKB 2HNTC 1O3NA 1ZRKA 4D7GA 4X1NU 3W94A 1CVWH 1HJAB 1UTLM 4AFUA 1BB0B 2HWLB 1G3BA 1GBLA 1SVPA 1TNLA 1OWJA 2PV9B 5GWZA 1XUGA 1GI2A 4KTCA 1A0JA 6CHAC 4WF8A 1ZHRA 6GCHF 3LH1A 1S5SA 1CHOF 1OWDA 1C1PA 1VCWA 3ZZAA 3QUMP 4NGAH 3TVJB 4A5TS 5A09A 3VB5A 5EW1H 1P8VC 4DJZB 3AW1A 2F91A 1S0RA 2ZZUH 3LC5A 1D6RA 3SORA 3GICB 3PV4A 1FPHH 1G2LA 2XBVA 2ZECA 3SNAA 3LH3A 5GDSH 2FYRA 1PPFE 1YF4A 3S9CA 1AN1E 2W3KA 1MUEB 3GY6A 1TGBA 3BTKE 1P0SH 2RCEA 5HGGA 4O9VA 2V3HH 2VWOA 6LPRA 1V2TT 1OYQA 1PFXC 2CV3A 1TE0A 2FIRH 1GBFA 4MPVA 3ZZ6A 2Y7ZA 1QBOA 1EZXC 1EATA 2ULLA 4Y7AA 3SUFA 4A1VA 4XE4A 1VGCB 1C1RA 1HAVA 3SJKA 1QL9A 1MTUA 2F9VA 1FONA 1HPGA 2ZCLP 2A7CA 2OBQA 1O3IA 3KEEA 2NU0E 4Q80A 1RTLA 2BOKA 1K1NA 4AYVB 5C1YA 5L30H 1O33A 4I32A 4BAOB 3O8DA 4X1QU 5FPTA 1YM0A 6GCHG 1NU9A 1CHOG 4Q2KA 1ZOMA 1SQAA 5EG4A 1G30B 1FIWA 2OTVA 1LCYA 3O8CA 1MCVA 1TA2A 3EA9A 2C8WB 2VWMA 4H6SB 2FLBH 2A31A 4X6MA 1WBGB 3SU2A 4Y7BA 1RXPA 4MPXA 2OUAA 1O3KA 4ISIH 1XUFA 2DE9A 3BTFE 3QN7A 1PPEE 2XTTB 1J17T 3VGCB 1ANCA 1SLWB 1TX7A 3ZZ9A 1UCYE 2CHAB 3RXFA 2P3UB 2ILNA 1S85A 1A4WH 2WV5A 3TIUA 1BZXE 4ESTE 4NFEA 4KKDA 1T31A 3ATLA 3EYDA 3ZVBA 1ZPZA 4UFFH 2Z9GA 1O5GH 5HMAA