1ANDA

Anionic trypsin mutant with arg 96 replaced by his
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDHKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANIONIC TRYPSIN
publication title Structure of an engineered, metal-actuated switch in trypsin.
pubmed doi rcsb
source organism Rattus rattus
molecule tags Serine protease
total genus 50
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1994-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1andA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1andA02
1O2IA 3I78A 1FY4A 4PROA 1WBGB 1VITH 4JCNA 1HIAB 1LKAA 1DICA 5DP9A 3DHKH 2P3UB 1SFQB 2KAIB 1KXAA 3P70B 4A1XA 1TALA 4NZQA 3UNSA 1KXCA 1XKAC 2C4FH 2SGQE 5LPEA 1HAVB 4A6LA 5F8TA 3B23B 1AN1E 2F9OA 1TNIA 2XNIA 2O8LA 1ZTJA 3TJOA 1HAPH 1DPOA 2GDDA 4TY7A 1MKXH 3UOPA 4Q7YA 1ESBA 1QY6A 3EDXB 4AB8A 2HPQH 1V2WT 4CRDA 4KP0A 1UVTH 2F9BH 1AVXA 4A1VA 2PSXA 1GJ5H 1TGBA 5C1UA 1RS0A 2J38A 2C3SA 2ZCLP 1UVUH 4FXGH 5EQQA 1HGTH 5EQRA 1MKWH 4ZKNU 2XTTB 1PPGE 1LHEH 1ZOMA 2I6QA 4CRFA 2NU1E 4CRCA 4JK5A 4FUBA 5AVDA 1KY9A 1P8VC 1GMDF 4WY3A 3NUMA 1MTNB 3LDXH 2FOHA 2D1JA 1ETRH 1F0RA 4ABEA 4O3UA 3GY7A 1NRSH 2EI6A 3T26A 3M3SA 1S81A 4HZHA 3RM2H 2H1UA 4MVNA 1DWBH 1O2JA 2ZGHA 1B5GH 3LJJA 3RC5A 2G5NA 1P0SH 4WF8A 3RXTA 3RXPA 3SUDA 3F9EA 3IG6B 4DOQA 1TQ7B 3OTJE 3P8FA 1G3DA 1W7XH 1GHZA 1ZJDA 1BITA 1OP2A 3EA7A 4H4FA 3BSQA 3LT3A 1JOUB 4OS6A 4FUHA 1QR3E 2BVXH 1LHFH 1HJ9A 2Z3EA 1BJVA 3A84A 1AFQC 2SGPE 3NKKA 4CH8B 3SW2B 1HAXB 1EB1H 1THPB 1NFYA 2FTLE 4X6OA 1MUEB 2EI7A 4KTSA 2VIQA 3SQEE 1BTYA 1Y59T 2BY6X 3IWMA 1QL7A 3VGCB 3LH3A 4I33A 3UOUA 1HUTH 1AO5A 1V2VT 3RMNH 2XXLA 3TK6A 2VGCB 1C9PA 3RU4T 4D76A 1ZSLA 1A0LA 1LCYA 2PTNA 5EXLA 1W0ZU 2FI5E 2HALA 1LVYA 3AAUA 4FUCA 1BRBE 3M7QA 3QGNB 1YPKH 2STAE 4SGAE 1FJSA 1RGQA 1LQEA 1M9UA 1VJAU 3D65E 2ZU2A 1EAXA 1UTMA 3HK6B 2XCFA 3S9AA 3DT0H 1AVWA 2ZDMA 1CT2E 4XBBA 1MU8B 3HPTB 2D2DA 4X0WU 1AU8A 1P04A 3BTME 1HFDA 2FI4E 1IQJA 3OU0A 1YF4A 3H5CB 1O33A 4BXSA 3EA8A 2VH0A 3U1IB 4DCDA 1DOJA 2ZG0H 3ATMA 2Z3CA 1TRYA 3VPKA 4UONA 2B7DH 3VB5A 2FOMB 1LKBA 1SPJA 4K2YA 2YNBA 1TNHA 3ZZCA 2HOBA 3E91A 4J1YA 1BBRH 1VZQH 1T32A 1HAYB 3LGYA 4QT8C 3BG8A 1AY6H 2OBOA 2AMDA 3O8BA 1OS8A 2ZO3H 2J94A 4RKOB 3B8JA 2BQ7B 1ZSKA 1UO6A 2F9UA 3GCHC 3NWUA 3A7TA 5HM2A 1O35A 4A7IB 1CQQA 1OWHA 1FIZA 4KELA 3LGVA 1FIWA 4B74A 3VFEA 1K1OA 2GMTC 2J34A 1GMCF 1PQ5A 2B9LA 3VXFH 3L6PA 1ZMJA 2AMQA 2TIOA 3MU0A 1S84A 2BMGB 2QCYA 2R2WU 2BD9A 4UFFH 5GIBA 3R0FA 1Q2WA 1C5UA 5LPRA 1VGCB 2VU8E 4B76A 1ANCA 1BJUA 3KF2A 2LNCA 5AFZH 4XDEA 4Y8YA 5A0BA 2V0BA 2PGQB 2BDIA 4WH8A 4NGAH 1FN8A 4F49A 5DK1A 3K2UA 3AVZA 3SGAE 1EZXC 2NU4E 3P95A 1E0FD 1BTPA 1ELTA 1W8BH 5EODA 1MD7A 3K6YA 4KTUA 1C2KA 4OGYA 1EX3A 1UHBA 3RDZA 1HCGA 2FOBA 4U01A 1O2GH 4Y10E 4YZUA 1J9CH 5GCHG 1GHBG 4ISNA 1KXFA 8ESTE 3I77A 3M36A 2O8WA 2FWWA 1QA0A 1C9TA 5EW2H 1TOCB 1P2IA 3ZV9A 1GBTA 3RXDA 4VGCC 1GI8B 1GHYH 1HLTH 1MQ5A 4TY6A 4X1QU 5DP5A 3KHVA 1QRWA 3S7HB 4FU8A 5HMAA 5ABWA 5I25A 2G4TA 1C1VH 1ETSH 1GMHF 3M7UA 1Z8GA 3AW1A 4ABFA 1ZMNA 1KLTA 1D9IA 4DG4A 1KYNA 1E34B 1SGPE 3A88A 3V13A 1TGTA 2XW9A 2OP9A 1V2UT 4ISHH 5FBEA 1DXPA 2ZU3A 3FP6E 5FPSA 1GL0E 3RXQA 1O2TA 3BTDE 1VR1H 1OOKB 2BLQA 4AN7A 3VB3A 1C5TA 2FLRH 1O3AA 4CREA 2FS9A 3D62A 5A8YA 5CMXH 1CE5A 1O2YA 5GJ4B 3PMJA 1EOLA 2QY0B 1MBMA 3GYMA 4DIIH 2P8OB 1C1QA 3TNSA 4JYTA 1RRKA 1YCPH 1O2XA 3MNSA 2VWNA 1DUAA 4OS4A 2PTCE 4ZMAH 1VJ9U 3SHAH 1O2VA 1C5PA 1W14U 1B7XB 2JETC 4X2VA 3K9XB 5EG4A 3RXOA 1BB0B 1ANDA 3MU5A 1QCPA 3RXRA 1GGDC 2YOLA 4YLUA 1WSSH 3RXJA 5J4QA 1SGNE 1IQKA 1FY3A 6CHAB 5C1YA 1BTUA 1O3KA 3QTVH 1L4ZA 3UQOA 1SQOA 4XOJA 4LK4A 2VNTA 4IN1A 1BUIA 1C5LH 1DITH 2VIDA 2QXGA 1EAWA 2G4UA 1ANEA 2J9NA 2ZDVH 4F4OC 4GHTA 2AIQA 4X8SH 3QLPH 3AAVA 4NA7A 1KXBA 4D9QA 2ZC9H 3LIWA 4GUXA 1S5SA 1U6QA 2BDYA 2H5CA 4IBLH 1X7AC 1T8LA 1P09A 5C1XA 1J8AA 4LXBH 1TBRH 4M7GA 1C2HA 1UTNA 2ZECA 1VITF 1SGIB 5TCCA 2OQ5A 5C5NA 4DT7B 1HIAA 1EAIA 1LPKB 1YKTA 4JK6A 1AZZA 1RD3B 5C2ZA 1F0UA 1LPGB 1IOEA 2ODYB 5K7RA 1EB2A 1AI8H 1CO7E 1QA7A 3SV2H 1O5GH 3ZVAA 2BZAA 4UDWH 2OINA 1SI5H 1OWJA 1O5BB 5AF9H 2OC7A 3ZZ5A 4SGBE 1O34A 1MTSA 2VVUA 4D7GA 3CS0A 2FOFA 3KEEA 1Q31A 1Z6JH 4K60A 1MBQA 4MNVA 1XMNB 3PYHA 4OS1A 1IQNA 3SV8A 1C4V2 1C2IA 1QGFA 1A3BH 3ZZAA 1GWAA 5FAHA 1KLIH 1HB0B 4IMQA 2IOTA 2ZHWH 2OBQA 3ZVBA 2ZDKA 3O8CA 3E6PH 1N8OB 1C2MA 1TA6A 3EYDA 2FOAA 3PM3A 2CF9H 3GDSA 1EASA 5I46H 1RFNA 1O3CA 5A09A 2R9PA 1TFXA 2FTMA 2OLGA 5LPFA 1F0SA 2IJOB 2Z9JA 1LPZB 4INLA 2JH6D 2XYAA 1MTVA 1HXEH 1XXDA 3UQVA 1UTJA 3BTHE 5E2OA 2PW8H 1TWXB 2BXUH 4X8VH 1UCYK 2V6NA 3A7XA 2H9EH 1SVPA 3A85A 2VIOA 2NU2E 4BANB 5ESTE 1F0TA 1LTOA 2ZTZA 1L2EA 1DX5M 1ZYOA 2SGEE 2WV4A 1TNJA 1OXGA 5T3HA 1BMMH 3BIVH 1A61H 4A1TA 1JIMA 5T6GA 3PTNA 4AFQA 6GCHG 1K22H 2EEKA 1SFIA 4X6NA 3QTOH 4YO9A 4NIXA 1ETTH 1ELBA 1SL3A 6LPRA 1O2MA 1A46H 2BLVA 4GCHF 2ZEBA 4OS5A 1YLCA 4UD9H 1THSH 3M5OA 1GHAF 1QQ4A 1SG8B 1A5GH 2O8MA 1PPCE 3UY9A 1N6YA 4E7RG 2FI3E 3BG4B 1QB1A 1T4UH 2WPHS 3HK3B 2ZGJA 1TABE 1UTOA 2BX4A 3L33A 1UTKA 1FAXA 3GY2A 1ZPCA 1O3OA 2UUYA 1LQDB 5FPTA 3GOVB 1K28D 1QIXB 4INKA 3GY4A 1K1PA 3G01A 5J4SA 1TPSA 1LMWB 2OC8A 4A92A 3MH4A 9ESTA 1AMHA 3UREA 3TGJE 1O3FA 4UFDH 1ELEE 3QK1A 1IQMA 3S9CA 1Z7KA 3A7WA 2IN2A 4XFQA 1GBLA 1YYY1 4LZ1H 2ODPA 3V7TA 2WUBA 2LPRA 4MNWA 2CHAB 1ZPZA 1SGTA 1PPHE 1HRTH 1DANH 3A81A 1SOTA 1AWHB 3S69A 3RLWH 2A7CA 1C5XB 4TWYA 1EP6A 1WV7H 1HAOH 1GI9B 1WOFA 1BTZA 1C5OH 1QL8A 1P3EA 1ELGA 3FP7E 3S7KB 1CA0B 4BAOB 2TRMA 4CBOA 2A4OA 2F3CE 1C1TA 1ESTA 3P8NA 3D49H 3SU0A 4ABHA 1Z8JB 1O3MA 1C4U2 2VIVA 3MU4A 1V2ST 1C1WH 3UNRA 4GPGA 3MNBA 1CHGA 1GHWH 2EI8A 1GBCA 1CGHA 1GI2A 3M37A 3D23A 1YPHE 3HGNA 1XVMA 4ASHA 1UMAH 2GTBA 1IHSH 1K1JA 1DM4B 1FZZA 1D3TB 3HGPA 3VB7A 2XC0A 1K1IA 1FN6A 2BD5A 2AGEX 2NWNA 2W3KA 1ACBE 1C5YB 3MOCA 2OXSA 4JZEH 2FMJA 4Q7ZA 4X1NU 3SU2A 4AG2A 4B2AA 1J16A 2SNWA 3F9GA 2C90B 1O2KA 2ZCKP 5CHAC 1NRRH 4YM9A 3QZRA 1H1BA 1ESAA 3PLPA 4NA9H 1A4WH 1V2NT 4WMFA 1WAYB 1OWKA 4IS5A 2C8XB 2FYRA 1HPGA 4Y6DA 8KME2 3QGJA 2H9HA 5HYOA 2GCTC 1MAXA 5F8ZA 4MQAA 1GI5A 3PO1C 1HAIH 7LPRA 2FXRA 4ISIH 2W7UA 1ZSJA 3HKJB 2PGBB 1Y5AT 1O5AB 2C8WB 3TITA 1P3CA 4FUFA 3A86A 3ATWA 1RTKA 5GWZA 3WY8A 4HI3A 2HVXA 3P6ZB 4ZROA 3QO6A 4Q80A 1WCZA 1DXWA 5FHTA 3RXVA 1G3CA 2BLWA 3FP8E 3AASA 3UR6A 2B8OH 4B2CA 3KQDA 3KL6A 4O3TA 3OYPA 4IW4E 1EUFA 1KXEA 1A5IA 3CS7A 5C3NA 2GZ8A 3OY5U 3LOXA 2QXHA 2FDAA 2BX3A 3H7TA 2ZHQH 3F6UH 2J2UA 1DUEA 3F9FA 4FUEA 1FPHH 1AUTC 2QF3A 1TE0A 1OWDA 1EJAA 1Y5UT 1SLUB 1ZGVA 2C8ZB 3Q3KA 1O2UA 2EC9H 4RKJB 4FUDA 1GBIA 1OSSA 1SB1H 2HRVA 5TCAA 4I7YH 2WPJS 4Y0YE 1E38B 3KN2A 2XC5A 3M3TA 4AORA 4NG9H 3A82A 1FUJA 3RXKA 1FY5A 3ZVCA 1S82A 1GCDA 5A2MH 2W5EA 2Y7XA 4NCYA 3EGKH 1JMOH 1SSXA 3U98H 3ZYDA 2FS8A 2HNTE 1XUGA 3LGIA 3PB1E 2GMTB 1P03A 3C1KA 3TIUA 1C2JA 1O3EA 3MMGA 3QX5H 3Q00A 1JIRA 2GCHF 1K2I1 4MG3A 8LPRA 3KQCA 2ASUB 3Q3YA 2Y5HA 9LPRA 2ZTXA 1DT2A 1DFPA 3RM0H 1JXPA 3ZZ9A 1DWEH 1BHXB 5C67A 2Z9LA 1GG6C 1SGRE 2BD3A 3QDZB 3LPRA 2UUJB 1EOJA 1GVLA 3ZZ8A 1GBAA 1D3DB 3ZZ4A 4WJG2 2W7SA 4DURA 1FY8E 3ZVGA 3M35A 1INCA 1GJ4H 2WPIS 3GCTF 3SNEA 4BTUB 2ZHFH 2AMPA 1J14A 3JZ1B 1O39A 4XE4A 3T5FH 2ZA5A 1T7CA 1O2OA 1O2WA 1Y3VA 2Q6DA 3RXIA 1MTNC 2PKAA 1D4PB 1A7SA 1Y3XA 5IDKA 2FODA 1XX9A 4YT6H 1C5VA 4MDSA 4D7FA 5JB9S 2ZTYA 1XVOA 2ZIQH 2CN0H 4KKDA 2WYGA 3F1SB 5LH8A 1K1LA 1XM1A 2AERH 1CHOF 2QF0A 4VGCB 4Z6AH 4O9VA 2G52A 1IQHA 2RA0A 3SV9A 2RA3A 2WPKS 3A8DA 1AKSB 1SOZA 1GDQA 4TYDA 1DY8A 5T6FA 2FOEA 5E0HA 1O2NA 1GL1A 1NTPA 2C8YB 1A3EH 2FM2A 1G9IE 2PUQH 1ARBA 1TBQH 1WQSA 1CBWB 3E0PB 1UK3A 1EP5A 2AS9A 3SQHE 4UEHH 2A2QH 1P2JA 3VGCC 1YPEH 2P94A 4CRBA 3KIDU 2VGCC 1GBMA 1FXYA 1ZTKA 2BOHB 4MPWA 5C20A 7ESTE 1IQFA 1PQAA 4BAQB 4Y7BA 3SUEA 1DE7H 5JBTA 1H8IH 5T6DA 1BDAA 4AFSA 2FOCA 3KQBA 1PQ8A 3SBKA 1QBOA 1DVAH 1GJCB 3ATLA 3LKWA 4X1RU 2ZGBH 4JZFH 4Y79A 7KMEH 1AIXH 2R3UA 2G00A 3BTGE 1BRAA 5JB8S 1K1MA 2FPZA 3U69H 3LC5A 1AZ8A 1MD8A 4BAHB 4DVAU 1ZR0A 1YLDA 1H4WA 4I8HA 4YESB 4B73A 1OKXA 1RIWC 1J15A 1TAWA 3K65B 1TPPA 1LVMA 1Z71A 1C5MD 2XBVA 5B6OA 3ZZ6A 1LHCH 2F9PA 4RSPA 3ZZ7A 1UK4A 3FFGA 1TGNA 3LONA 2SNVA 3VB4A 4A5TS 1TQ0B 4UE7H 4ZKSU 3FAOA 1PPEE 2UUFB 3URCA 2QGRA 2XWBI 1ARCA 1QURH 2UWLA 1WUNH 3ZYEA 4E05H 3ELAH 3P8OA 4TPIZ 1Y8TA 1GJ8B 1GMDG 1AVGH 1W13U 3ZZ3A 1GBEA 4GHQA 1VGCC 3QUMP 3HATH 1D6RA 1TNKA 2GZ7A 1S0RA 5GXPA 1PYTD 1PQ7A 1S6FA 1ZHRA 1SGFA 4YOIA 3EE0B 1C2LA 1YGCH 2CJIA 2UWPA 3V12A 3ZVDA 2VIPA 2GT7A 1ELCA 3ZZBA 5TJXA 4CRGA 3MNCA 1UTLM 1V2PT 5JBAS 3U8TH 4UFEH 2Q1JA 1MU6B 1C1PA 2GT8A 3RMLH 1SGCA 1ZHMA 4DIHH 1YC0A 4AX9H 3LH1A 1G2MA 3T29A 1ZGIA 1ZTLA 3SI3H 1P9SA 1FPCH 2HGTH 2K1QA 4AYYB 3LJOA 1MMJN 2A0QB 5IYTA 2A4GA 2PLXA 2W3IA 1KLJH 2PUXB 3RU4E 1HAZB 3RXHA 5JBBS 1EPTB 1IQEA 2P3TB 4AG1A 1BT7A 3URDA 3BF6H 2ZFQH 3BTQE 1L1GA 1WQVH 2BDGA 4J2YB 2AGIX 3U8RH 4UFGH 4MTBA 2BM2A 4IC6A 2PKAB 4KTCA 1UCYE 2PWXA 4LOYH 2F9VA 4DY7B 5JYIA 2Y5FA 5EPNA 1HV7A 5F03A 1CT0E 1QRZA 1MKXK 4WMEA 1C2DA 1V6DA 4BAMB 1XUHA 1ZPBA 2F91A 1BMNH 3KCGH 3MTYA 2DE8A 1NC6A 1FLEE 2P93A 3BEIB 1Z1IA 4HTCH 1QFKH 3QWCH 3NZIA 5A8ZA 3BTEE 2OQUA 1YM0A 1F5RA 3MU1A 1GCTC 4IMZA 1MKWK 2BTCE 2NU0E 2QV1A 3OY6U 3SU3A 2ZQ1A 4YT7H 2P8OC 3SO3A 1HJAB 4ZXXH 1EAUA 5L6NH 3TGIE 3UFAA 1TMBH 5JPMH 4U2WA 1GDNA 1Z8RA 1P05A 1BTWA 1A2CH 1HAHH 3AW0A 2BY7X 4BXWA 3BTKE 2WPMS 3RXAA 3SNBA 1MZAA 1NROH 4TWWA 5DP3A 4B1TA 3GCNA 1OYQA 1VCWA 1GI6A 1O2RA 1GMCG 1GHVH 4FU7A 1SQAA 3T2NA 1OWEA 1BBRE 1LHGH 1T8NA 1EZUC 3I29A 2CGAA 2BHGA 2FX4A 1OP8A 1EATA 3E3TA 2BB4A 2VWOA 1AB9B 1Z8IB 1CT4E 1V2TT 3PLKA 2BQWB 5A8XA 2BY5X 3ITIA 4B2BA 3O8RA 2BQ6B 2ALVA 3MH6A 3TH4H 1O2ZA 2QA9E 2OUAA 2ZFPH 3H7OA 2D8WA 2XBWA 3NPSA 3SNAA 3GYLB 1O5DH 1NO9H 1ZLRA 2BVSH 1C2FA 3Q3XA 1V2QT 1G30B 1SGFG 1SGEE 3TJUA 4ZKRU 2ZZUH 3VXEH 3SJKA 2ODQA 4ZH8A 1C2GA 1MZDA 3GICB 3UIRA 1CSOE 1V2KT 4I8KA 1DS2E 2BDHA 2A4RA 3LC3A 4XBDA 3PV4A 4K3JA 4CHAB 1W2KH 3RXSA 2FO9A 3EAJA 2QIQA 3E8LA 1G2LA 5E8EH 2FIRH 1SLXB 3GY8A 4ABJA 1LO6A 4E7NA 2Y82A 1QBVH 1H8DH 3Q77A 1FDPA 1SR5C 5PTPA 1EXFA 2ALPA 3SJOA 1NFXA 3E16B 3RC4A 5DP8A 4NWLA 1GJBB 1NM6A 1W10U 1GMHG 2R0KA 3A7VA 1CU1A 1FY1A 1H9HE 1DWDH 2G51A 4ABIA 2JKHA 4K1EA 3KNXA 3A80A 1NT1A 4OS2A 4ZHAA 1E37B 4IC5A 3L3TA 4MPUA 3KQEA 1OX1A 3V0XA 1O3JA 1HNEE 4CBNA 4K8YA 4X1PU 1GBDA 2A7JA 1QB6A 1BBRK 3T62A 1GBBA 1V2OT 2SGDE 1O3BA 1QL9A 5H4IB 3RMMH 4ISLA 1YPMH 1BTHH 1RTFB 1QQUA 2GZ9A 2VH6A 2VIWA 4I8LA 4MPVA 5FCRA 2VWMA 3KGPA 3TLOA 1TLDA 2BD7A 4AGKA 4MNXA 3GDUA 2GCTB 1HXFH 4R8TB 4THNH 2ZU4A 1OP0A 3PO1B 5BPEA 1BOQA 1C5QA 3LGUA 1AFEH 1T4VH 3MO3A 2G8TA 2PR3A 1W12U 4CRAA 4NWKA 1AKSA 4ZKOU 2SGAA 1ABJH 1TBZH 1BRCE 4GSOA 2BLOA 3RXEA 2A32A 2Z6BD 1E35B 1QNJA 3PROA 1CGJE 2BXTH 1GI0A 3SJ8A 1PPFE 4MNYA 3B9FH 3TJNA 4BNRA 1UVOA 4K8BA 3RXCA 3TU7H 2ZI2H 1DSUA 3NCLA 1P57B 4H6SB 5DP4A 3TH2H 1K21H 1NESE 4BTIB 1NS3A 2ZP0H 1H9LB 1G32B 5L2YH 2A5KA 1C4Y2 3M3VA 1F5KU 1O3PB 2AGGX 2GV7A 2TGAA 3A8BA 5EPYA 3M5MA 3BN9A 3BG4C 1XUJA 2HNTC 2THFB 2ZPRA 1GHXH 1AFQB 1XKBC 5K0HA 1MQ6A 4NSVA 4I31A 1C5WB 4OS7A 1VITG 5GCHF 5E2PA 3N7OA 1GHBF 2QXJA 3PMHB 3ESTA 2Z7FE 2BD2A 3V3MA 1P2NA 2PKSC 2FESH 2GX4A 2ZDNA 3DA9B 1O3GA 3M5LA 1QRXA 5F6MA 3FANA 1O2LA 4XBCA 1TNGA 1O5FH 2B5TB 5EXNA 1SLVB 3BTTE 2WV5A 1F5LA 4NSYA 3RXUA 4CH2B 8GCHG 2CHAC 1O3DA 1XUFA 3MH7A 1NFWA 1YPJH 1LHDH 2TGDA 4WMDA 4X1SU 3UTUH 3BV9B 4X8UH 3PWCA 2OC0A 1GG6B 5AFYH 2GV6A 3GY6A 1IQIA 3T27A 1VCPA 2J4IA 4WVPE 4H6TA 3U8OH 2R3YA 2M5TA 4LZ4B 3GISB 1FAKH 1CA0C 1ABIH 3W95A 2CF8H 1MTUA 3DFJA 4ZHMU 1MCVA 1ZJKA 4JMYA 1NU9A 4IGDA 3M7TA 4D9RA 1P06A 1NY22 2RG3A 1QJ1B 4X2WA 4ISOA 5DP7A 2F83A 1A5HA 2DUCA 3EQ0H 3UNQA 4Z0KA 4B71A 1YCPK 3BEFB 3RXLA 4Y8ZA 1AWFH 2ZFRH 1ZZZA 1FQ3A 1PYTC 2Y81A 3MU8A 2Y6TA 1EJNA 2ZGCA 3M5NA 1B0EA 2CXVA 3GCHB 4MPXA 4WXVA 3SORA 1D3QB 2XRCA 1N1LA 1QTFA 1O30A 3R3GB 1WU1A 2W26A 2QYIA 2WYJA 5GPIB 5JDUB 4ESTE 1SQTA 2A31A 5GDSH 3A7ZA 5FBIA 1DY9A 1GJ9B 3RLYH 1SLWB 1IHTH 2SGFE 3MNXA 3PTBA 1UCYH 3SUFA 1C2EA 3TPIZ 2O8TA 3QN7A 1BRUP 2XBXA 4Y71A 4Y11E 2ZU5A 3UUZA 3A8CA 2CMYA 1BMLA 2OCVB 1BA8B 1TNLA 1O36A 3ZZDA 2I6SA 1WTGH 1HYLA 4GCHG 2BDCA 6ESTA 1EPTA 4YLQH 2J92A 1A0JA 1ANBA 2V3HH 4AZ2B 1O2PA 1P12E 1GHAG 2ULLA 4GLYA 1P2MA 2XCNA 4U30A 2XC4A 2VVVA 4BTTB 1TPOA 1WTHD 1XXFA 1SHYA 7GCHG 2ZDLA 4K1TA 1HDTH 5DJ7A 1GJAB 1UJ1A 1YBWA 4X2XA 1AGJA 1C5SA 1C1MA 2VINA 2WINI 1ZRBA 3TGKE 3SUGA 1WYKA 1NRQH 3ATKA 3UWIA 4FVBA 1VCQA 4Y7AA 1V2RT 1QJ6B 4GVUA 1SGDE 4JZDH 1ORFA 3LU9B 4GAWA 1P01A 2P59A 4WH6A 3TJVA 1PJPA 2UUKB 2RCEA 1A1RA 1RIWB 3E0NB 2ZFFH 1IQGA 3LGTA 1V2LT 2AIPA 2GDEH 5FX6A 2BD8A 4RN6A 3SU1A 1FONA 3MWIU 1GI7B 4X6MA 1UTPA 1O2QA 2GD4B 2XWAA 2GVFA 1B0FA 1O38A 1Q3XA 1P10A 3ZVEA 1HBTH 3E1XB 2ILNA 1K1NA 1O3LA 1ZRKA 3SNCA 1EZSC 1RXPA 4ABBA 2EA3A 3FZZA 1GI4A 2PSYA 1CVWH 3RMOH 2AYWA 1O3IA 1Y3WA 1P2QA 1CA8B 1DSTA 3BTWE 3Q76A 3P8GA 1GJ7B 1O32A 1SC8U 2HNTF 1KSNA 4NFFA 5F8XA 1MH0A 1C5NH 4FUIA 2ZQ2A 3STJA 4NFEA 3SOSA 2OD3B 3P17H 4BOHA 5ETXA 1NRNH 3E90B 1KDQA 3DFLA 3MO9A 3ATIA 3A8AA 4JYUH 2JETB 1TGSZ 1GVZA 2Q6FA 2WPLS 5C5OA 4NIWA 4Y76A 1EJMA 5ESBA 2BDBA 3SN8A 4YOGA 1TRNA 2PHBA 1YPLH 1BMAA 5JBCS 1OYTH 3TK9A 2HLCA 3SJIA 1GGDB 1GI3A 2FP7B 1QB9A 2VB0A 3RC6A 2O9QA 1G3EA 3O8DA 6GCHF 1G36A 4WXIA 2H2ZA 2F9NA 2A45B 1GPZA 1A0HB 4AGJA 1W7GH 2ZPQA 1L1NA 1O3HA 2FZZA 1SHHB 1EZQA 4OGXA 1Y3UA 2Z94A 5EOKA 2BZ6H 4K5ZA 2A2XH 2A5IA 1SBWA 1RTLA 4ABGA 2VJ1A 1L0ZA 1O2HA 2Z9GA 3FZDA 1BTXA 1S83A 5HGGA 3OX7U 3SV6A 1C5ZB 1CBWC 3RXGA 1BIOA 2QC2A 4ZAEA 2H9TH 2YNAA 1GJ6A 3SU5A 3W94A 3RUOA 1TMTH 1O2SA 1TONA 2DE9A 4FVDA 1MCTA 2VVCA 1KTSB 3SU6A 3M61U 1JWTA 3RXFA 1TX8A 2STBE 1YP9A 1FMGA 2P3FH 3PMAB 3TNTA 3MH5A 2AH4X 1G3BA 1GCTB 2ZFTA 4H42U 5BRRE 1S6HA 2BY8X 1Z1JA 3UPEA 1QBNA 5A0AE 2ZCHP 3S9BA 4NA8A 1GJDB 2GKVE 3SJ9A 1UVSH 1C1RA 5G4BA 5LGOA 2B0FA 1QHRB 1LVOA 1ZHPA 3MI4A 1GBFA 3U9AH 5DPAA 3IITA 1ELFA 1ELDE 3S0NA 5E0GA 2FX6A 1AE5A 5FXLA 3UWJH 4O97A 2VWLA 5EXMA 1MAYA 2FYQA 2GCHG 1W11U 2ANYA 4MLFB 1O3NA 1PPZA 3P92A 4FUGA 1EKBB 1TIOA 5FX5A 1NN6A 1C1UH 3BTFE 2GP9B 1P2KA 1E36B 1F92A 2IPHA 3OSYA 1F2SE 2ZFSA 2A4QA 1TGCA 3A7YA 5HM9A 4NIVA 4E06H 2ESTE 4IN2A 1UK2A 4X6PA 3SV7A 1Y3YA 3JZ2B 4XSKU 2ZDAH 2TGTA 1KXDA 1NFUA 1XUIA 1BQYA 3GCTG 1N6XA 4K69A 4O03A 5DG6A 4INHA 4I8JA 1L4DA 2ANWA 2XBYA 3RP2A 1O37A 3K6ZA 2JH0D 5HXFA 2KAIA 1SMFE 2QN5T 2ZPSA 2D26C 1O5CB 4YOJA 1V2JT 1F7ZA 2QAAA 2OTVA 1HAVA 1FV9A 2G81E 4HGCA 2FEQH 1JBUH 2Y80A 3HKIB 4D8NA 2UWOA 4CR9A 1CGIE 1K9OE 3PLBA 1TPAE 1CHOG 1ID5H 2HWLB 4DJZB 3GDVA 3PMBB 1IQLA 1J17T 1PFXC 1THRH 8GCHF 1TX6A 1GBKA 1LDTT 2PFEA 2ZKSA 1ELVA 4AFUA 1V3XA 2ZHEH 4AOQA 6CHAC 1QJ7B 3A89A 2ZWLH 2PV9B 5FCKA 5EU8A 5AHGH 4DW2U 3PWBA 1KTTB 1ZMLA 4YTAA 1BHXF 4FUJA 2G5VA 1SGQE 1KDQB 5DKMA 3RXMA 1O5EH 3DD2H 2WUCA 3GCOA 4BAKB 1Y5BT 4KGAA 1HAGE 4R0IA 2TBSA 3VB6A 1AHTH 1ELAA 4WWYA 2Z3DA 1EPTC 3A83A 4HFPB 2FOGA 1MTWA 2A5AA 1TYNA 1XUKA 1TMUH 1O31A 2Y5GA 3CP7A 4NZLA 2BY9X 1S0QA 2TPIZ 2R2MB 2Z9KA 1UHBB 1P02A 1G37A 3TVJB 1D3PB 3SHCH 1D6WA 1YCPM 1AD8H 4Q2KA 3RU4D 1AUJA 4ZHLU 3F9HA 1GVKB 2Z9IA 2ZGXH 2BD4A 1OWIA 1GI1A 1TB6H 1LVBA 2JH5D 3BIUH 3TK5A 3SZNA 1YPHC 3TH3H 1EQ9A 3STIA 4Y8XA 4Y0ZE 2TGPZ 1NPMA 1KIGH 1JRTA 4I8GA 2Y7ZA 4B75A 5L2ZH 3SGQE 1TX7A 4AFZA 4ABAA 4U32A 1Z6EA 2H5DA 4X2YA 2ZF0H 3U1JB 2J95A 4AB9A 1W3CA 5DP6A 5EGMA 1OPHB 1NZQH 3T28A 2ANMH 2A7HA 5SGAE 1T8MA 1HJ8A 1HJAC 3FVFB 3QZQA 1JRSA 4ABDA 3MYWA 3VEQB 1DDJA 2FLBH 2ZNKH 2C93B 1C1NA 1FNIA 2SFAA 1P2OA 3ZVFA 4DGJA 2Q6GA 1DLEA 2AFQB 5CHAB 1GDUA 4K1SA 2CV3A 1YPGH 2ANKH 1W0YH 3RXBA 1N8OC 1T8OA 3MHWU 3ZV8A 1BCUH 7GCHF 3SI4H 4I32A 2P16A 3A87A 1RJXB 1T31A 1TRMA 2BVRH 3ODFA 1GBJA 3LGWA 2QXIA 3MFJA 1DLKB 5E0JA 2PKSB 5EQSA 3BEUA 3CENA 1P11E 1TOMH 5A0CA 2V35A 3ENSB 1H9IE 4JZIA 2RDLA 3MO6A 1AB9C 4X8TH 1UVPA 2A1DB 4AYVB 2NU3E 5EW1H 1V2MT 3NXPA 5DO4H 4FU9A 3T25A 1AE8H 3SGBE 2BDAA 2ZU1A 4JZ1A 3SU4A 1NU7B 3UR9A 1S85A 4NIYA 2BYAX 3DUXH 1TA2A 1C5RA 1IAUA 1P9UA 4JYVH 3GY3A 5DGJA 2P95A 2O8UA 2G55A 2OC1A 4CR5A 1AQ7A 2AEIH 1NRPH 5L30H 1GBHA 1SGYE 1C1OA 2H6MA 3C27B 2ZHDA 3SNDA 3ODDA 4ZXYH 1L1JA 3NK8A 4CHAC 1DWCH 2HPPH 1UTQA 4Q7XA 2V3OH 5FPYA 5CE1A 2R0LA 2BOKA 4TPYA 3F68H 1C1SA 1FI8A 1O0DH 4ZUHA 1BZXE 1PPBH 2GGVB 3GY5A 3EA9A
chains in the Genus database with same CATH superfamily
1O2IA 3I78A 1FY4A 4PROA 1WBGB 1VITH 2W6JD 4JCNA 1HIAB 1LKAA 1DICA 5DP9A 3DHKH 2P3UB 1SFQB 2KAIB 3AK5A 1KXAA 3P70B 4A1XA 1TALA 4NZQA 3UNSA 1KXCA 1XKAC 2C4FH 2SGQE 5LPEA 1HAVB 4A6LA 5F8TA 3B23B 1AN1E 2F9OA 1TNIA 2XNIA 2O8LA 1ZTJA 3TJOA 1HAPH 1DPOA 2GDDA 4HG6A 4TY7A 1MKXH 3UOPA 4Q7YA 1ESBA 1QY6A 3EDXB 4AB8A 2HPQH 1V2WT 4CRDA 4KP0A 5KECA 1UVTH 2F9BH 1AVXA 4A1VA 2PSXA 2WPDD 1GJ5H 4TSFD 1TGBA 5C1UA 1RS0A 2J38A 2C3SA 2ZCLP 1UVUH 4FXGH 5EQQA 1HGTH 5EQRA 1MKWH 4ZKNU 2XTTB 1PPGE 1LHEH 1ZOMA 2KFWA 2I6QA 4CRFA 2NU1E 4CRCA 4JK5A 4FUBA 5AVDA 1KY9A 1KMHB 1P8VC 1GMDF 4WY3A 3NUMA 1MTNB 3LDXH 2FOHA 2D1JA 1ETRH 1F0RA 4ABEA 4O3UA 3GY7A 1NRSH 2EI6A 3T26A 3M3SA 1S81A 4HZHA 3RM2H 2H1UA 4MVNA 1DWBH 1O2JA 2ZGHA 1B5GH 3LJJA 3RC5A 3FO8D 2G5NA 1P0SH 4WF8A 3RXTA 3RXPA 3SUDA 3F9EA 3IG6B 4DOQA 1TQ7B 3OTJE 3P8FA 1G3DA 1W7XH 1GHZA 1ZJDA 1BITA 1OP2A 3EA7A 4H4FA 3BSQA 3LT3A 1JOUB 4OS6A 4FUHA 1QR3E 2BVXH 1LHFH 1HJ9A 1W0JD 2Z3EA 1OHHD 1BJVA 3A84A 1AFQC 2SGPE 3NKKA 4CH8B 3SW2B 1HAXB 1EB1H 1THPB 1NFYA 2FTLE 4X6OA 1MUEB 2EI7A 4KTSA 2VIQA 3SQEE 1BTYA 1Y59T 2BY6X 5HKKD 3IWMA 2KCPA 1QL7A 3VGCB 3LH3A 4I33A 3UOUA 1HUTH 1AO5A 1V2VT 3RMNH 2XXLA 3TK6A 2VGCB 1C9PA 3RU4T 4D76A 1ZSLA 1A0LA 1LCYA 2PTNA 5EXLA 1W0ZU 1E1QD 2FI5E 2HALA 1LVYA 3AAUA 3NRLA 4FUCA 2L74A 1BRBE 3M7QA 3QGNB 1YPKH 2STAE 4SGAE 1FJSA 1RGQA 1LQEA 1M9UA 1VJAU 1NBME 3D65E 2ZU2A 1EAXA 1UTMA 3HK6B 2XCFA 3S9AA 3DT0H 1AVWA 2ZDMA 1CT2E 4XBBA 1MU8B 3HPTB 2D2DA 4X0WU 1AU8A 1P04A 3BTME 4XD7D 1HFDA 2FI4E 1IQJA 3OU0A 1YF4A 3H5CB 1O33A 4BXSA 3EA8A 2VH0A 3U1IB 4DCDA 5CDFE 1DOJA 2EY4C 2ZG0H 3ATMA 2Z3CA 1TRYA 3VPKA 4UONA 2B7DH 1YLNA 3VB5A 2FOMB 1LKBA 1SPJA 4K2YA 2YNBA 1TNHA 3ZZCA 2HOBA 2CK3D 3E91A 4J1YA 1BBRH 1VZQH 1T32A 1UW7A 1HAYB 3LGYA 4QT8C 3BG8A 1AY6H 2OBOA 2AMDA 3O8BA 1OS8A 2ZO3H 2J94A 4RKOB 3B8JA 2BQ7B 1ZSKA 3DCLA 1UO6A 2F9UA 3GCHC 3NWUA 3A7TA 5HM2A 1O35A 4A7IB 1CQQA 1OWHA 1FIZA 4KELA 3LGVA 1FIWA 4B74A 3VFEA 1K1OA 2GMTC 2J34A 1GMCF 1PQ5A 2B9LA 3VXFH 3L6PA 1ZMJA 2AMQA 2TIOA 3MU0A 1S84A 2BMGB 2QCYA 2R2WU 2BD9A 4UFFH 5GIBA 3R0FA 1Q2WA 1C5UA 5LPRA 1VGCB 2VU8E 4B76A 1ANCA 1BJUA 3KF2A 2LNCA 5AFZH 4XDEA 4Y8YA 5A0BA 2V0BA 5KEDA 2PGQB 2BDIA 4WH8A 4NGAH 3H09A 1FN8A 4F49A 5DK1A 3K2UA 5KGOA 3AVZA 3SGAE 1EZXC 2NU4E 3P95A 1E0FD 1BTPA 1ELTA 1W8BH 5EODA 1MD7A 3K6YA 4KTUA 1C2KA 4OGYA 1EX3A 1UHBA 3RDZA 1HCGA 2FOBA 4U01A 1O2GH 4Y10E 4YZUA 1J9CH 5GCHG 1GHBG 4ISNA 1KXFA 8ESTE 3I77A 3M36A 2O8WA 2FWWA 1QA0A 1C9TA 4M9FA 5EW2H 1TOCB 1P2IA 3ZV9A 1GBTA 3RXDA 4VGCC 1GI8B 1GHYH 1HLTH 1MQ5A 4TY6A 4X1QU 5DP5A 2KR7A 3KHVA 4RT0A 1QRWA 3S7HB 4FU8A 5HMAA 5ABWA 5I25A 2G4TA 1C1VH 1ETSH 1GMHF 3M7UA 1Z8GA 3AW1A 4ABFA 1ZMNA 1KLTA 4Z1MD 1D9IA 4DG4A 1KYNA 1E34B 1SGPE 3A88A 3V13A 1TGTA 2XW9A 2OP9A 1V2UT 4ISHH 5FBEA 1DXPA 2ZU3A 3FP6E 5FPSA 1GL0E 3RXQA 1O2TA 3BTDE 1VR1H 1OOKB 2BLQA 4AN7A 3VB3A 1C5TA 2FLRH 1O3AA 4CREA 4FETA 2FS9A 3D62A 5A8YA 5CMXH 2XNDD 1CE5A 1O2YA 5GJ4B 3PMJA 2JIZD 1EOLA 2QY0B 1MBMA 2WZQA 3GYMA 4DIIH 2P8OB 1C1QA 3TNSA 4JYTA 1RRKA 1YCPH 1O2XA 3MNSA 2VWNA 1DUAA 4OS4A 2PTCE 4ZMAH 1VJ9U 3SHAH 1O2VA 1C5PA 1W14U 1B7XB 2JETC 4X2VA 3K9XB 5EG4A 2WHXA 3RXOA 1BB0B 1ANDA 3MU5A 2J97A 1QCPA 3RXRA 1GGDC 2YOLA 4YLUA 5EIYA 1WSSH 3RXJA 5J4QA 1SGNE 1IQKA 1FY3A 6CHAB 5C1YA 1BTUA 1O3KA 3QTVH 1L4ZA 3UQOA 1SQOA 4XOJA 4LK4A 2VNTA 4IN1A 1BUIA 1C5LH 1DITH 2VIDA 2QXGA 1EAWA 2G4UA 1ANEA 5DN6D 2J9NA 2ZDVH 4F4OC 1SKYE 4GHTA 2AIQA 4X8SH 3QLPH 3AAVA 4NA7A 1KXBA 4D9QA 3PV2A 2ZC9H 3LIWA 4GUXA 1S5SA 1U6QA 2BDYA 2H5CA 4IBLH 1X7AC 1T8LA 1P09A 5C1XA 1J8AA 4LXBH 1TBRH 4M7GA 1C2HA 1UTNA 2ZECA 1VITF 1SGIB 5TCCA 2OQ5A 5C5NA 4DT7B 1HIAA 1H8ED 1EAIA 1LPKB 1YKTA 4JK6A 1AZZA 3F3BA 1RD3B 5C2ZA 1F0UA 1LPGB 1IOEA 1S6LA 2ODYB 5K7RA 5B6LA 1EB2A 1AI8H 1CO7E 1QA7A 3SV2H 2HVYB 1O5GH 3ZVAA 2BZAA 2KZ4A 4UDWH 2OINA 1SI5H 1OWJA 1O5BB 5AF9H 2OC7A 3ZZ5A 4SGBE 1O34A 1MTSA 2VVUA 4D7GA 3CS0A 2FOFA 3KEEA 1Q31A 1Z6JH 4K60A 1MBQA 4MNVA 1XMNB 3PYHA 4OS1A 1IQNA 3SV8A 1C4V2 5CHBA 1C2IA 1QGFA 1A3BH 3ZZAA 1GWAA 5FAHA 1KLIH 1HB0B 4IMQA 3UAIC 2IOTA 2ZHWH 2OBQA 3ZVBA 2ZDKA 3O8CA 3E6PH 1N8OB 2WV9A 1C2MA 1TA6A 3EYDA 2FOAA 3PM3A 2CF9H 3GDSA 3KYFA 1EASA 5I46H 1RFNA 1O3CA 5A09A 2R9PA 1TFXA 2FTMA 2OLGA 3CNRA 5LPFA 2K8IA 1F0SA 2IJOB 2Z9JA 1LPZB 4INLA 2JH6D 2XYAA 1MTVA 1HXEH 1XXDA 3UQVA 1UTJA 3BTHE 5E2OA 2PW8H 1TWXB 2BXUH 4X8VH 1UCYK 2V6NA 3A7XA 2H9EH 4ACAA 1SVPA 1QZ8A 3A85A 4F48B 2VIOA 1EFRD 2NU2E 4BANB 5ESTE 1F0TA 4ZCNA 1LTOA 2ZTZA 1L2EA 1DX5M 1ZYOA 2SGEE 2WV4A 1TNJA 1OXGA 5T3HA 1BMMH 3BIVH 1A61H 4A1TA 1JIMA 5T6GA 3PTNA 4AFQA 6GCHG 1K22H 2EEKA 1SFIA 4X6NA 3QTOH 4YO9A 4NIXA 1ETTH 1ELBA 1SL3A 6LPRA 1O2MA 1A46H 2BLVA 4GCHF 3ZIAD 2ZEBA 4OS5A 1YLCA 4UD9H 1THSH 3M5OA 1GHAF 1QQ4A 1SG8B 1A5GH 2O8MA 1PPCE 3UY9A 1N6YA 4E7RG 2FI3E 3BG4B 1QB1A 1T4UH 2WPHS 3HK3B 2ZGJA 1TABE 1UTOA 2BX4A 3L33A 1UTKA 1FAXA 3GY2A 1ZPCA 1O3OA 2UUYA 1LQDB 5FPTA 3GOVB 1K28D 1QIXB 4INKA 3GY4A 1K1PA 3G01A 5J4SA 1TPSA 1LMWB 2OC8A 4A92A 3MH4A 9ESTA 1AMHA 3UREA 3TGJE 1O3FA 4UFDH 1ELEE 3QK1A 1IQMA 3S9CA 1Z7KA 3A7WA 2IN2A 4XFQA 1GBLA 1YYY1 4LZ1H 2ODPA 2YMSD 2WUBA 3V7TA 2LPRA 4MNWA 2CHAB 1ZPZA 1SGTA 1PPHE 1HRTH 1DANH 2WSSD 1SOTA 3A81A 1AWHB 3S69A 3RLWH 2A7CA 1C5XB 4TWYA 1EP6A 1WV7H 1HAOH 1GI9B 1WOFA 4B6EA 1BTZA 1C5OH 1QL8A 1P3EA 1ELGA 3FP7E 3S7KB 1CA0B 4BAOB 2TRMA 4CBOA 2A4OA 2F3CE 1C1TA 1ESTA 3P8NA 3D49H 3SU0A 4ABHA 1Z8JB 3OAAD 1VKYA 2AHME 1WXRA 1O3MA 1C4U2 2VIVA 3MU4A 1V2ST 1C1WH 3UNRA 4GPGA 3MNBA 1CHGA 1GHWH 2EI8A 1GBCA 1CGHA 1GI2A 3SYJA 3M37A 3D23A 1YPHE 3HGNA 1XVMA 4ASHA 1UMAH 2GTBA 1IHSH 1K1JA 1DM4B 1FZZA 1D3TB 3HGPA 3VB7A 2XC0A 1K1IA 1FN6A 2BD5A 2AGEX 2NWNA 2W3KA 1ACBE 2J98B 1C5YB 3MOCA 2OXSA 4JZEH 2FMJA 4Q7ZA 3FKSD 4X1NU 3SU2A 4AG2A 4B2AA 1J16A 2SNWA 3F9GA 2C90B 1O2KA 2ZCKP 5CHAC 1NRRH 4YM9A 3QZRA 1H1BA 1ESAA 3PLPA 4ACBA 4NA9H 1A4WH 1V2NT 4WMFA 1WAYB 1OWKA 2EQNA 4IS5A 2C8XB 2FYRA 1HPGA 4Y6DA 8KME2 3QGJA 2H9HA 5HYOA 2GCTC 1MAXA 5F8ZA 4MQAA 1GI5A 3PO1C 1HAIH 3WWFA 7LPRA 2FXRA 4ISIH 2QF5A 2W7UA 1ZSJA 3HKJB 2PGBB 1Y5AT 1O5AB 2C8WB 3TITA 1K0HA 1P3CA 4FUFA 3A86A 3ATWA 2GJGA 1RTKA 2RDEA 3WY8A 5GWZA 4HI3A 2HVXA 3P6ZB 4ZROA 3QO6A 4Q80A 1WCZA 1DXWA 5FHTA 3RXVA 1G3CA 2BLWA 3FP8E 3AASA 2V7QD 3UR6A 2B8OH 4B2CA 3KQDA 3KL6A 4O3TA 3OYPA 4IW4E 1EUFA 1KXEA 1A5IA 3CS7A 5C3NA 3SZEA 2GZ8A 3OY5U 3LOXA 2QXHA 2FDAA 2BX3A 3H7TA 2ZHQH 3F6UH 2J2UA 1DUEA 3F9FA 4FUEA 1FPHH 1AUTC 2QF3A 1TE0A 1OWDA 3VG8A 1EJAA 1Y5UT 1COWD 1SLUB 1ZGVA 2C8ZB 3Q3KA 1O2UA 2EC9H 4RKJB 4FUDA 1GBIA 1OSSA 1SB1H 2HRVA 5TCAA 4I7YH 2WPJS 4Y0YE 1E38B 3KN2A 2XC5A 3M3TA 4AORA 4NG9H 3A82A 1FUJA 3RXKA 1FY5A 3ZVCA 1S82A 1GCDA 5A2MH 2W5EA 2Y7XA 4NCYA 3EGKH 1JMOH 1SSXA 5GNDA 3U98H 2FS8A 2HNTE 3ZYDA 1XUGA 3LGIA 3PB1E 2GMTB 1P03A 3C1KA 3TIUA 1C2JA 1O3EA 3MMGA 3QX5H 3Q00A 1JIRA 2GCHF 5HIYA 1K2I1 4MG3A 8LPRA 3KQCA 2ASUB 3Q3YA 2Y5HA 9LPRA 5IK2D 2ZTXA 1DT2A 1DFPA 3RM0H 1JXPA 3ZZ9A 1DWEH 1BHXB 5C67A 3EE7A 2Z9LA 1GG6C 1SGRE 2BD3A 3QDZB 3LPRA 2UUJB 1EOJA 1GVLA 3ZZ8A 1GBAA 1D3DB 3ZZ4A 4WJG2 2W7SA 4DURA 1FY8E 3ZVGA 3M35A 1INCA 1GJ4H 2WPIS 3GCTF 3SNEA 4BTUB 2ZHFH 2AMPA 1J14A 3JZ1B 1O39A 4XE4A 3T5FH 2ZA5A 1T7CA 1O2OA 1O2WA 1Y3VA 2Q6DA 3RXIA 1MTNC 2PKAA 1D4PB 1A7SA 1Y3XA 5IDKA 2FODA 4B6FA 1XX9A 4YT6H 1C5VA 4MDSA 4D7FA 5JB9S 2ZTYA 1XVOA 2ZIQH 2QE7D 2CN0H 4KKDA 2WYGA 3F1SB 2IPQX 5LH8A 1K1LA 1XM1A 2AERH 1CHOF 2QF0A 4VGCB 4Z6AH 4O9VA 3OE7D 2G52A 1IQHA 2RA0A 3SV9A 2RA3A 2WPKS 3A8DA 1AKSB 1SOZA 1GDQA 1H8HD 4TYDA 1DY8A 5T6FA 2FOEA 5E0HA 1O2NA 1GL1A 1NTPA 2C8YB 1A3EH 2FM2A 1G9IE 2PUQH 1ARBA 1TBQH 1WQSA 1CBWB 3E0PB 1UK3A 1EP5A 2AS9A 3SQHE 4UEHH 2A2QH 1P2JA 3VGCC 1YPEH 2P94A 4CRBA 3KIDU 2VGCC 1GBMA 1YY3A 1FXYA 1ZTKA 2BOHB 4MPWA 5C20A 7ESTE 1IQFA 1PQAA 4BAQB 4Y7BA 3SUEA 1DE7H 5JBTA 1H8IH 5T6DA 1BDAA 3PRDA 4AFSA 2FOCA 3KQBA 1PQ8A 3SBKA 1QBOA 1DVAH 1GJCB 3ATLA 3LKWA 4X1RU 2ZGBH 2LELA 4JZFH 4Y79A 7KMEH 1AIXH 2R3UA 2G00A 3BTGE 1BRAA 5JB8S 1NBMD 1K1MA 2FPZA 3U69H 3LC5A 1AZ8A 4Q63A 1MD8A 4BAHB 4DVAU 1ZR0A 1YLDA 1H4WA 4I8HA 4YESB 4B73A 3PV5A 1OKXA 1RIWC 1J15A 1TAWA 3K65B 1TPPA 1LVMA 1Z71A 1C5MD 2XBVA 5B6OA 3ZZ6A 1LHCH 2F9PA 4RSPA 3ZZ7A 1UK4A 3FFGA 1TGNA 3LONA 2SNVA 3VB4A 4A5TS 1TQ0B 4UE7H 4ZKSU 3FAOA 1PPEE 2UUFB 3URCA 2QGRA 5DSFA 2XWBI 1ARCA 1QURH 2UWLA 1FX0B 1WUNH 3ZYEA 4E05H 3ELAH 3P8OA 4TPIZ 1Y8TA 1GJ8B 1GMDG 1AVGH 1W13U 3ZZ3A 1GBEA 4GHQA 1VGCC 3QUMP 3HATH 1D6RA 1TNKA 2GZ7A 1S0RA 5GXPA 1PYTD 1PQ7A 1S6FA 1ZHRA 4XRNA 1SGFA 4YOIA 3EE0B 1C2LA 1YGCH 2YMSC 2CJIA 2UWPA 5FL7D 3V12A 3ZVDA 2VIPA 2GT7A 1ELCA 3ZZBA 5TJXA 2XOKD 4CRGA 3MNCA 1UTLM 1V2PT 5JBAS 3U8TH 4UFEH 2Q1JA 1MU6B 1C1PA 2GT8A 3RMLH 1SGCA 1ZHMA 4DIHH 1YC0A 4AX9H 3LH1A 1G2MA 3T29A 1ZGIA 1ZTLA 3SI3H 1P9SA 1FPCH 2HGTH 2K1QA 3F2HA 4AYYB 3LJOA 1MMJN 2A0QB 5IYTA 2A4GA 2PLXA 2W3IA 1KLJH 2PUXB 3RU4E 1HAZB 3UB0A 3RXHA 5JBBS 1EPTB 1IQEA 2P3TB 4AG1A 1BT7A 3URDA 3BF6H 2ZFQH 3BTQE 1L1GA 1WQVH 2BDGA 4J2YB 2AGIX 3U8RH 4UFGH 4MTBA 2BM2A 4IC6A 2PKAB 4KTCA 1UCYE 2PWXA 4LOYH 2F9VA 4DY7B 5JYIA 2Y5FA 5EPNA 1HV7A 5F03A 1CT0E 1QRZA 2J98A 1MKXK 4WMEA 2V3MA 1C2DA 1V6DA 4BAMB 1XUHA 1ZPBA 2F91A 1BMNH 3KCGH 3MTYA 2DE8A 1NC6A 1FLEE 2P93A 3BEIB 1Z1IA 4HTCH 1QFKH 3QWCH 3NZIA 5A8ZA 3BTEE 2OQUA 1YM0A 1F5RA 3MU1A 1GCTC 4IMZA 1MKWK 2BTCE 2NU0E 2QV1A 3OY6U 3SU3A 2ZQ1A 4YT7H 2P8OC 3SO3A 1HJAB 4ZXXH 1EAUA 5L6NH 3TGIE 3UFAA 1TMBH 5JPMH 4U2WA 1GDNA 1Z8RA 1P05A 4FOUC 1BTWA 1A2CH 1HAHH 3AW0A 2BY7X 4BXWA 3BTKE 2F4LA 2WPMS 3RXAA 3SNBA 1MZAA 1NROH 4TWWA 5DP3A 4B1TA 3GCNA 1OYQA 1VCWA 1GI6A 2KCOA 1GMCG 1GHVH 1O2RA 4FU7A 1SQAA 2JJ2D 3T2NA 1MABB 1WDIA 1OWEA 1BBRE 1LHGH 1T8NA 1EZUC 3I29A 2CGAA 2BHGA 2FX4A 1OP8A 1EATA 3E3TA 2BB4A 2VWOA 1AB9B 1Z8IB 1CT4E 1V2TT 3PLKA 2BQWB 5A8XA 2BY5X 3ITIA 4B2BA 1YWUA 2BQ6B 3O8RA 2ALVA 3MH6A 3TH4H 1O2ZA 2QA9E 2OUAA 2ZFPH 3H7OA 2D8WA 2XBWA 3NPSA 3SNAA 3OEED 3GYLB 1O5DH 1NO9H 1ZLRA 2BVSH 1C2FA 3Q3XA 1V2QT 1G30B 1SGFG 1SGEE 3TJUA 4ZKRU 2ZZUH 3VXEH 3SJKA 2ODQA 4ZH8A 1C2GA 1MZDA 3GICB 3UIRA 1CSOE 1V2KT 4I8KA 1DS2E 2BDHA 2A4RA 3LC3A 4XBDA 3PV4A 2J5UA 3KYGA 4K3JA 4CHAB 1W2KH 3RXSA 2FO9A 3EAJA 2QIQA 3E8LA 1G2LA 5E8EH 2FIRH 1SLXB 3GY8A 4ABJA 1LO6A 4E7NA 2Y82A 1QBVH 1H8DH 3Q77A 1FDPA 1SR5C 5PTPA 1EXFA 2ALPA 3SJOA 1NFXA 3E16B 3RC4A 5DP8A 4NWLA 1GJBB 1NM6A 1W10U 1GMHG 2R0KA 3A7VA 1CU1A 1FY1A 1H9HE 1DWDH 2G51A 4ABIA 2JKHA 5C0UA 4K1EA 3KNXA 3A80A 1NT1A 4OS2A 4ZHAA 3GS9A 1E37B 4IC5A 3L3TA 4MPUA 3KQEA 1OX1A 3V0XA 1O3JA 1HNEE 4CBNA 4K8YA 4X1PU 1GBDA 2A7JA 1QB6A 1BBRK 3T62A 1GBBA 1V2OT 2SGDE 3OEHD 1O3BA 1QL9A 5H4IB 3RMMH 4ISLA 1YPMH 1BTHH 1RTFB 1QQUA 2GZ9A 4P02A 2VH6A 2VIWA 4I8LA 4MPVA 5FCRA 2VWMA 3KGPA 3TLOA 1TLDA 2BD7A 4AGKA 4MNXA 3GDUA 2GCTB 1HXFH 4R8TB 4THNH 5EJLA 2ZU4A 1OP0A 3N7EA 3PO1B 5BPEA 1BOQA 1C5QA 2LP6A 2PP6A 3LGUA 1AFEH 1T4VH 3MO3A 2G8TA 2PR3A 1W12U 4CRAA 4NWKA 1AKSA 4ZKOU 2SGAA 2RFKC 1ABJH 1TBZH 1BRCE 4GSOA 2BLOA 3RXEA 2A32A 2Z6BD 1E35B 1QNJA 3PROA 1CGJE 3WWBA 2BXTH 1GI0A 3SJ8A 1PPFE 4MNYA 3B9FH 3TJNA 4BNRA 1UVOA 4K8BA 3RXCA 3TU7H 2ZI2H 1DSUA 3NCLA 1P57B 3DSOA 4H6SB 5DP4A 3TH2H 1K21H 1NESE 4BTIB 1NS3A 5F53A 2ZP0H 1H9LB 1G32B 5L2YH 2A5KA 1C4Y2 3M3VA 1F5KU 1O3PB 2AGGX 2GV7A 2TGAA 3A8BA 5EPYA 3M5MA 3BN9A 3BG4C 1XUJA 2HNTC 2THFB 2KX4A 5C17A 2ZPRA 1GHXH 1AFQB 1XKBC 5K0HA 1MQ6A 4NSVA 4I31A 1C5WB 4OS7A 1VITG 5GCHF 5E2PA 3N7OA 1GHBF 2QXJA 2VBCA 3PMHB 5EJ1A 3ESTA 2Z7FE 2BD2A 3V3MA 1P2NA 2PKSC 2FESH 2GX4A 2ZDNA 3DA9B 1O3GA 3M5LA 1QRXA 5EJZA 5F6MA 3FANA 1O2LA 4XBCA 1TNGA 1O5FH 2QF4A 2W6ID 2B5TB 5EXNA 1SLVB 3BTTE 2WV5A 2K0QA 1F5LA 2HLDD 4NSYA 3RXUA 4CH2B 8GCHG 2CHAC 1O3DA 1XUFA 3MH7A 1NFWA 1YPJH 5T1VA 1LHDH 2TGDA 4WMDA 4X1SU 3UTUH 3BV9B 4X8UH 3PWCA 2OC0A 1GG6B 5AFYH 2GV6A 3GY6A 1IQIA 3T27A 1VCPA 2J4IA 4WVPE 3F0PA 4H6TA 3U8OH 2R3YA 2M5TA 4LZ4B 3GISB 1FAKH 1CA0C 1ABIH 3W95A 2CF8H 1MTUA 3DFJA 4ZHMU 1MCVA 1ZJKA 4JMYA 1NU9A 4IGDA 3M7TA 4D9RA 1P06A 1NY22 2RG3A 1QJ1B 4X2WA 4ISOA 5DP7A 2F83A 1A5HA 2DUCA 3EQ0H 3UNQA 4Z0KA 4B71A 1YCPK 3BEFB 3RXLA 4Y8ZA 1AWFH 2ZFRH 1ZZZA 1FQ3A 4YXWD 1PYTC 2Y81A 3MU8A 2KCYA 2Y6TA 1EJNA 2ZGCA 3M5NA 1B0EA 2CXVA 3GCHB 4MPXA 4WXVA 3SORA 1D3QB 2XRCA 1N1LA 1QTFA 1O30A 3R3GB 1WU1A 2W26A 2QYIA 2WYJA 5GPIB 5JDUB 4ESTE 1SQTA 2A31A 5GDSH 3A7ZA 5FBIA 1DY9A 1GJ9B 3RLYH 1SLWB 1IHTH 2M2AA 2SGFE 3MNXA 3PTBA 1UCYH 3SUFA 1C2EA 3TPIZ 5C94A 2O8TA 3QN7A 1BRUP 2XBXA 4Y71A 4Y11E 2ZU5A 3UUZA 3A8CA 2CMYA 1BMLA 5HIZA 2OCVB 1BA8B 3WW7A 1TNLA 1O36A 3ZZDA 2I6SA 1WTGH 1HYLA 1BMFD 4GCHG 2BDCA 6ESTA 1EPTA 4YLQH 2J92A 1A0JA 1ANBA 2V3HH 4AZ2B 1O2PA 1P12E 4RT1A 1GHAG 2ULLA 4GLYA 1P2MA 2XCNA 4U30A 2XC4A 2VVVA 4BTTB 1TPOA 1WTHD 1XXFA 1SHYA 7GCHG 2ZDLA 4K1TA 1HDTH 5DJ7A 1GJAB 1UJ1A 1YBWA 4X2XA 1AGJA 1SQRA 2KCAA 1C5SA 1C1MA 2VINA 2WINI 1ZRBA 3TGKE 3SUGA 1WYKA 1NRQH 3ATKA 3UWIA 4FVBA 1VCQA 4Y7AA 1V2RT 1QJ6B 4GVUA 1SGDE 4JZDH 1ORFA 3LU9B 2IJD1 4GAWA 1P01A 2P59A 4WH6A 3TJVA 1PJPA 2UUKB 2RCEA 1A1RA 1RIWB 3E0NB 2ZFFH 1IQGA 3LGTA 1V2LT 2AIPA 2GDEH 5FX6A 2BD8A 4RN6A 3SU1A 1FONA 3MWIU 1GI7B 4X6MA 1UTPA 1O2QA 2GD4B 2XWAA 2GVFA 1B0FA 1O38A 1Q3XA 1P10A 3ZVEA 1HBTH 3E1XB 2ILNA 1K1NA 1O3LA 1ZRKA 3SNCA 1EZSC 4DT4A 1RXPA 4ABBA 2EA3A 3FZZA 1GI4A 2PSYA 1CVWH 3RMOH 2AYWA 1O3IA 1Y3WA 1P2QA 1CA8B 1DSTA 3BTWE 3Q76A 3P8GA 1GJ7B 1O32A 1SC8U 2HNTF 1KSNA 4NFFA 5F8XA 2OK5A 1MH0A 1C5NH 4FUIA 2ZQ2A 3STJA 3N99A 4NFEA 3SOSA 2OD3B 3P17H 4BOHA 5ETXA 1NRNH 3E90B 1KDQA 3DFLA 3MO9A 3ATIA 3A8AA 4JYUH 2YMSB 2JETB 1TGSZ 1GVZA 2Q6FA 2WPLS 5C5OA 4NIWA 4Y76A 1EJMA 5ESBA 2BDBA 3SN8A 4YOGA 1TRNA 2PHBA 1YPLH 4OM9A 4I86A 1BMAA 5JBCS 1OYTH 3TK9A 2HLCA 3SJIA 1GGDB 1GI3A 2FP7B 1QB9A 2VB0A 3RC6A 2O9QA 1G3EA 3O8DA 6GCHF 1G36A 4WXIA 2H2ZA 2F9NA 2A45B 1GPZA 1A0HB 4AGJA 1W7GH 2ZPQA 1L1NA 1O3HA 2FZZA 1SHHB 1EZQA 4OGXA 3DSGA 1Y3UA 1E1RD 2Z94A 5EOKA 2BZ6H 4K5ZA 2A2XH 2A5IA 1SBWA 1RTLA 4ABGA 2KM0A 2VJ1A 1L0ZA 1O2HA 2Z9GA 3FZDA 1BTXA 1S83A 5HGGA 3F0OA 3OX7U 3SV6A 1C5ZB 2L6OA 1CBWC 4AC9A 3RXGA 1BIOA 2QC2A 4ZAEA 2H9TH 2YNAA 1GJ6A 3SU5A 3W94A 3RUOA 1TMTH 1O2SA 1TONA 2DE9A 4FVDA 1MCTA 2VVCA 1KTSB 3SU6A 3M61U 1JWTA 3RXFA 1TX8A 3U28C 2STBE 1YP9A 1FMGA 2P3FH 3PMAB 3TNTA 3MH5A 2AH4X 1G3BA 1GCTB 2ZFTA 4H42U 5BRRE 1S6HA 2BY8X 1Z1JA 3UPEA 1QBNA 5A0AE 2ZCHP 3S9BA 4NA8A 1GJDB 2GKVE 3SJ9A 1UVSH 1C1RA 5G4BA 5LGOA 2B0FA 3DSPA 1QHRB 1LVOA 1ZHPA 3MI4A 1GBFA 3U9AH 5DPAA 3IITA 1ELFA 1ELDE 3S0NA 5E0GA 2FX6A 1AE5A 5FXLA 2F43B 3UWJH 4O97A 2VWLA 5EXMA 1MAYA 2FYQA 2GCHG 1W11U 2ANYA 4MLFB 1E79D 1O3NA 1PPZA 3P92A 4FUGA 1EKBB 1TIOA 5FX5A 1NN6A 1C1UH 3BTFE 2GP9B 1P2KA 1E36B 1F92A 2IPHA 3OSYA 1F2SE 2ZFSA 2A4QA 1TGCA 3A7YA 5HM9A 4NIVA 4E06H 2ESTE 4IN2A 1UK2A 4X6PA 3SV7A 1Y3YA 3JZ2B 4XSKU 2ZDAH 2TGTA 1KXDA 1NFUA 1XUIA 1BQYA 3GCTG 1N6XA 4K69A 4O03A 5DG6A 4INHA 4I8JA 1L4DA 2ANWA 2XBYA 3RP2A 1O37A 3K6ZA 2JH0D 5HXFA 2KAIA 1SMFE 2QN5T 2ZPSA 2D26C 1O5CB 4YOJA 1V2JT 1F7ZA 2QAAA 2OTVA 1HAVA 1FV9A 2G81E 4HGCA 4RI0A 2FEQH 1JBUH 2Y80A 3HKIB 4D8NA 2UWOA 4CR9A 1CGIE 1K9OE 3PLBA 1TPAE 1CHOG 1ID5H 2HWLB 4DJZB 3GDVA 3PMBB 1IQLA 1J17T 1PFXC 1THRH 8GCHF 1TX6A 1GBKA 1LDTT 4P00A 2PFEA 2ZKSA 1ELVA 4AFUA 1V3XA 2ZHEH 4AOQA 4ASUD 3PRBA 6CHAC 3F2FA 4F55A 1QJ7B 3A89A 2ZWLH 2PV9B 5FCKA 5EU8A 3FOAA 5AHGH 4DW2U 3PWBA 1KTTB 1ZMLA 4YTAA 1BHXF 4FUJA 2G5VA 1SGQE 1KDQB 5DKMA 3RXMA 1O5EH 2JDID 3DD2H 2WUCA 3GCOA 4BAKB 1Y5BT 4KGAA 1HAGE 4R0IA 2TBSA 3VB6A 1AHTH 1ELAA 4WWYA 2Z3DA 1EPTC 3A83A 5C0TA 4HFPB 2FOGA 1MTWA 2A5AA 1TYNA 1XUKA 1TMUH 1O31A 2Y5GA 1W0KD 3CP7A 4NZLA 2BY9X 1S0QA 3FN8A 2TPIZ 2R2MB 2Z9KA 1UHBB 1P02A 1G37A 3N7DA 3TVJB 1D3PB 3SHCH 1D6WA 3OFND 1YCPM 1AD8H 4Q2KA 3RU4D 1AUJA 4ZHLU 3F9HA 1GVKB 2Z9IA 2ZGXH 2BD4A 1OWIA 1GI1A 1TB6H 1LVBA 2JH5D 3BIUH 3TK5A 3SZNA 1YPHC 3TH3H 1EQ9A 3F2GA 3STIA 4Y8XA 4Y0ZE 2TGPZ 1NPMA 1KIGH 1JRTA 4I8GA 2Y7ZA 4B75A 5L2ZH 3SGQE 1TX7A 4AFZA 4ABAA 4U32A 1Z6EA 2H5DA 2JJ1D 4X2YA 4TT3D 2ZF0H 3U1JB 2J95A 4AB9A 1W3CA 5DP6A 5EGMA 1OPHB 1NZQH 3OTPA 3T28A 2ANMH 2A7HA 5SGAE 1T8MA 1HJ8A 1HJAC 3FVFB 3QZQA 1JRSA 4ABDA 3MYWA 3VEQB 1DDJA 2FLBH 2ZNKH 2C93B 1C1NA 1FNIA 2SFAA 1P2OA 3ZVFA 4DGJA 2Q6GA 1DLEA 2AFQB 5CHAB 1GDUA 4K1SA 2CV3A 1YPGH 2ANKH 1W0YH 3RXBA 1N8OC 1T8OA 3MHWU 3ZV8A 1BCUH 7GCHF 3SI4H 4I32A 2P16A 3A87A 1RJXB 1T31A 1TRMA 2BVRH 3ODFA 1GBJA 3LGWA 2QXIA 3MFJA 1DLKB 5E0JA 2PKSB 5EQSA 3BEUA 3CENA 1P11E 1TOMH 5A0CA 3KQ5A 2V35A 3ENSB 1H9IE 4JZIA 2RDLA 3MO6A 1AB9C 4X8TH 1UVPA 2A1DB 4AYVB 2NU3E 5EW1H 1V2MT 3NXPA 5DO4H 4FU9A 3T25A 1AE8H 3SGBE 2BDAA 2ZU1A 4JZ1A 3SU4A 1NU7B 3UR9A 1S85A 4NIYA 2BYAX 3DUXH 1TA2A 1C5RA 1IAUA 1P9UA 4JYVH 3GY3A 5DGJA 2P95A 2O8UA 2G55A 2OC1A 4CR5A 1AQ7A 2AEIH 1NRPH 5L30H 1GBHA 1SGYE 1C1OA 2H6MA 4Q4LA 3C27B 2ZHDA 3SNDA 3ODDA 4ZXYH 1L1JA 3NK8A 3MQKC 4CHAC 1DWCH 2HPPH 1UTQA 4Q7XA 2V3OH 5FPYA 3W1EA 5CE1A 2R0LA 2BOKA 4TPYA 3F68H 1C1SA 1FI8A 1O0DH 4ZUHA 1BZXE 1PPBH 2GGVB 3GY5A 3EA9A
chains in the Genus database with same CATH topology
1O2IA 3I78A 1FY4A 4PROA 1WBGB 1VITH 4JCNA 1HIAB 1LKAA 1DICA 5DP9A 3DHKH 2P3UB 1SFQB 2KAIB 1KXAA 3P70B 4A1XA 1TALA 4NZQA 3UNSA 1KXCA 1XKAC 2C4FH 2SGQE 5LPEA 1HAVB 4A6LA 5F8TA 3B23B 1AN1E 2F9OA 1TNIA 2XNIA 2O8LA 1ZTJA 3TJOA 1HAPH 1DPOA 2GDDA 4TY7A 1MKXH 3UOPA 4Q7YA 1ESBA 1QY6A 3EDXB 4AB8A 2HPQH 1V2WT 4CRDA 4KP0A 1UVTH 2F9BH 1AVXA 4A1VA 2PSXA 1GJ5H 1TGBA 5C1UA 1RS0A 2J38A 2C3SA 2ZCLP 1UVUH 4FXGH 5EQQA 1HGTH 5EQRA 1MKWH 4ZKNU 2XTTB 1PPGE 1LHEH 1ZOMA 2I6QA 4CRFA 2NU1E 4CRCA 4JK5A 4FUBA 5AVDA 1KY9A 1P8VC 1GMDF 4WY3A 3NUMA 1MTNB 3LDXH 2FOHA 2D1JA 1ETRH 1F0RA 4ABEA 4O3UA 3GY7A 1NRSH 2EI6A 3T26A 3M3SA 1S81A 4HZHA 3RM2H 2H1UA 4MVNA 1DWBH 1O2JA 2ZGHA 1B5GH 3LJJA 3RC5A 2G5NA 1P0SH 4WF8A 3RXTA 3RXPA 3SUDA 3F9EA 3IG6B 4DOQA 1TQ7B 3OTJE 3P8FA 1G3DA 1W7XH 1GHZA 1ZJDA 1BITA 1OP2A 3EA7A 4H4FA 3BSQA 3LT3A 1JOUB 4OS6A 4FUHA 1QR3E 2BVXH 1LHFH 1HJ9A 2Z3EA 1BJVA 3A84A 1AFQC 2SGPE 3NKKA 4CH8B 3SW2B 1HAXB 1EB1H 1THPB 1NFYA 2FTLE 4X6OA 1MUEB 2EI7A 4KTSA 2VIQA 3SQEE 1BTYA 1Y59T 2BY6X 3IWMA 1QL7A 3VGCB 3LH3A 4I33A 3UOUA 1HUTH 1AO5A 1V2VT 3RMNH 2XXLA 3TK6A 2VGCB 1C9PA 3RU4T 4D76A 1ZSLA 1A0LA 1LCYA 2PTNA 5EXLA 1W0ZU 2FI5E 2HALA 1LVYA 3AAUA 4FUCA 1BRBE 3M7QA 3QGNB 1YPKH 2STAE 4SGAE 1FJSA 1RGQA 1LQEA 1M9UA 1VJAU 3D65E 2ZU2A 1EAXA 1UTMA 3HK6B 2XCFA 3S9AA 3DT0H 1AVWA 2ZDMA 1CT2E 4XBBA 1MU8B 3HPTB 2D2DA 4X0WU 1AU8A 1P04A 3BTME 1HFDA 2FI4E 1IQJA 3OU0A 1YF4A 3H5CB 1O33A 4BXSA 3EA8A 2VH0A 3U1IB 4DCDA 1DOJA 2ZG0H 3ATMA 2Z3CA 1TRYA 3VPKA 4UONA 2B7DH 3VB5A 2FOMB 1LKBA 1SPJA 4K2YA 2YNBA 1TNHA 3ZZCA 2HOBA 3E91A 4J1YA 1BBRH 1VZQH 1T32A 1HAYB 3LGYA 4QT8C 3BG8A 1AY6H 2OBOA 2AMDA 3O8BA 1OS8A 2ZO3H 2J94A 4RKOB 3B8JA 2BQ7B 1ZSKA 1UO6A 2F9UA 3GCHC 3NWUA 3A7TA 5HM2A 1O35A 4A7IB 1CQQA 1OWHA 1FIZA 4KELA 3LGVA 1FIWA 4B74A 3VFEA 1K1OA 2GMTC 2J34A 1GMCF 1PQ5A 2B9LA 3VXFH 3L6PA 1ZMJA 2AMQA 2TIOA 3MU0A 1S84A 2BMGB 2QCYA 2R2WU 2BD9A 4UFFH 5GIBA 3R0FA 1Q2WA 1C5UA 5LPRA 1VGCB 2VU8E 4B76A 1ANCA 1BJUA 3KF2A 2LNCA 5AFZH 4XDEA 4Y8YA 5A0BA 2V0BA 2PGQB 2BDIA 4WH8A 4NGAH 1FN8A 4F49A 5DK1A 3K2UA 3AVZA 3SGAE 1EZXC 2NU4E 3P95A 1E0FD 1BTPA 1ELTA 1W8BH 5EODA 1MD7A 3K6YA 4KTUA 1C2KA 4OGYA 1EX3A 1UHBA 3RDZA 1HCGA 2FOBA 4U01A 1O2GH 4Y10E 4YZUA 1J9CH 5GCHG 1GHBG 4ISNA 1KXFA 8ESTE 3I77A 3M36A 2O8WA 2FWWA 1QA0A 1C9TA 5EW2H 1TOCB 1P2IA 3ZV9A 1GBTA 3RXDA 4VGCC 1GI8B 1GHYH 1HLTH 1MQ5A 4TY6A 4X1QU 5DP5A 3KHVA 1QRWA 3S7HB 4FU8A 5HMAA 5ABWA 5I25A 2G4TA 1C1VH 1ETSH 1GMHF 3M7UA 1Z8GA 3AW1A 4ABFA 1ZMNA 1KLTA 1D9IA 4DG4A 1KYNA 1E34B 1SGPE 3A88A 3V13A 1TGTA 2XW9A 2OP9A 1V2UT 4ISHH 5FBEA 1DXPA 2ZU3A 3FP6E 5FPSA 1GL0E 3RXQA 1O2TA 3BTDE 1VR1H 1OOKB 2BLQA 4AN7A 3VB3A 1C5TA 2FLRH 1O3AA 4CREA 2FS9A 3D62A 5A8YA 5CMXH 1CE5A 1O2YA 5GJ4B 3PMJA 1EOLA 2QY0B 1MBMA 3GYMA 4DIIH 2P8OB 1C1QA 3TNSA 4JYTA 1RRKA 1YCPH 1O2XA 3MNSA 2VWNA 1DUAA 4OS4A 2PTCE 4ZMAH 1VJ9U 3SHAH 1O2VA 1C5PA 1W14U 1B7XB 2JETC 4X2VA 3K9XB 5EG4A 3RXOA 1BB0B 1ANDA 3MU5A 1QCPA 3RXRA 1GGDC 2YOLA 4YLUA 1WSSH 3RXJA 5J4QA 1SGNE 1IQKA 1FY3A 6CHAB 5C1YA 1BTUA 1O3KA 3QTVH 1L4ZA 3UQOA 1SQOA 4XOJA 4LK4A 2VNTA 4IN1A 1BUIA 1C5LH 1DITH 2VIDA 2QXGA 1EAWA 2G4UA 1ANEA 2J9NA 2ZDVH 4F4OC 4GHTA 2AIQA 4X8SH 3QLPH 3AAVA 4NA7A 1KXBA 4D9QA 2ZC9H 3LIWA 4GUXA 1S5SA 1U6QA 2BDYA 2H5CA 4IBLH 1X7AC 1T8LA 1P09A 5C1XA 1J8AA 4LXBH 1TBRH 4M7GA 1C2HA 1UTNA 2ZECA 1VITF 1SGIB 5TCCA 2OQ5A 5C5NA 4DT7B 1HIAA 1EAIA 1LPKB 1YKTA 4JK6A 1AZZA 1RD3B 5C2ZA 1F0UA 1LPGB 1IOEA 2ODYB 5K7RA 1EB2A 1AI8H 1CO7E 1QA7A 3SV2H 1O5GH 3ZVAA 2BZAA 4UDWH 2OINA 1SI5H 1OWJA 1O5BB 5AF9H 2OC7A 3ZZ5A 4SGBE 1O34A 1MTSA 2VVUA 4D7GA 3CS0A 2FOFA 3KEEA 1Q31A 1Z6JH 4K60A 1MBQA 4MNVA 1XMNB 3PYHA 4OS1A 1IQNA 3SV8A 1C4V2 1C2IA 1QGFA 1A3BH 3ZZAA 1GWAA 5FAHA 1KLIH 1HB0B 4IMQA 2IOTA 2ZHWH 2OBQA 3ZVBA 2ZDKA 3O8CA 3E6PH 1N8OB 1C2MA 1TA6A 3EYDA 2FOAA 3PM3A 2CF9H 3GDSA 1EASA 5I46H 1RFNA 1O3CA 5A09A 2R9PA 1TFXA 2FTMA 2OLGA 5LPFA 1F0SA 2IJOB 2Z9JA 1LPZB 4INLA 2JH6D 2XYAA 1MTVA 1HXEH 1XXDA 3UQVA 1UTJA 3BTHE 5E2OA 2PW8H 1TWXB 2BXUH 4X8VH 1UCYK 2V6NA 3A7XA 2H9EH 1SVPA 3A85A 2VIOA 2NU2E 4BANB 5ESTE 1F0TA 1LTOA 2ZTZA 1L2EA 1DX5M 1ZYOA 2SGEE 2WV4A 1TNJA 1OXGA 5T3HA 1BMMH 3BIVH 1A61H 4A1TA 1JIMA 5T6GA 3PTNA 4AFQA 6GCHG 1K22H 2EEKA 1SFIA 4X6NA 3QTOH 4YO9A 4NIXA 1ETTH 1ELBA 1SL3A 6LPRA 1O2MA 1A46H 2BLVA 4GCHF 2ZEBA 4OS5A 1YLCA 4UD9H 1THSH 3M5OA 1GHAF 1QQ4A 1SG8B 1A5GH 2O8MA 1PPCE 3UY9A 1N6YA 4E7RG 2FI3E 3BG4B 1QB1A 1T4UH 2WPHS 3HK3B 2ZGJA 1TABE 1UTOA 2BX4A 3L33A 1UTKA 1FAXA 3GY2A 1ZPCA 1O3OA 2UUYA 1LQDB 5FPTA 3GOVB 1K28D 1QIXB 4INKA 3GY4A 1K1PA 3G01A 5J4SA 1TPSA 1LMWB 2OC8A 4A92A 3MH4A 9ESTA 1AMHA 3UREA 3TGJE 1O3FA 4UFDH 1ELEE 3QK1A 1IQMA 3S9CA 1Z7KA 3A7WA 2IN2A 4XFQA 1GBLA 1YYY1 4LZ1H 2ODPA 3V7TA 2WUBA 2LPRA 4MNWA 2CHAB 1ZPZA 1SGTA 1PPHE 1HRTH 1DANH 3A81A 1SOTA 1AWHB 3S69A 3RLWH 2A7CA 1C5XB 4TWYA 1EP6A 1WV7H 1HAOH 1GI9B 1WOFA 1BTZA 1C5OH 1QL8A 1P3EA 1ELGA 3FP7E 3S7KB 1CA0B 4BAOB 2TRMA 4CBOA 2A4OA 2F3CE 1C1TA 1ESTA 3P8NA 3D49H 3SU0A 4ABHA 1Z8JB 1O3MA 1C4U2 2VIVA 3MU4A 1V2ST 1C1WH 3UNRA 4GPGA 3MNBA 1CHGA 1GHWH 2EI8A 1GBCA 1CGHA 1GI2A 3M37A 3D23A 1YPHE 3HGNA 1XVMA 4ASHA 1UMAH 2GTBA 1IHSH 1K1JA 1DM4B 1FZZA 1D3TB 3HGPA 3VB7A 2XC0A 1K1IA 1FN6A 2BD5A 2AGEX 2NWNA 2W3KA 1ACBE 1C5YB 3MOCA 2OXSA 4JZEH 2FMJA 4Q7ZA 4X1NU 3SU2A 4AG2A 4B2AA 1J16A 2SNWA 3F9GA 2C90B 1O2KA 2ZCKP 5CHAC 1NRRH 4YM9A 3QZRA 1H1BA 1ESAA 3PLPA 4NA9H 1A4WH 1V2NT 4WMFA 1WAYB 1OWKA 4IS5A 2C8XB 2FYRA 1HPGA 4Y6DA 8KME2 3QGJA 2H9HA 5HYOA 2GCTC 1MAXA 5F8ZA 4MQAA 1GI5A 3PO1C 1HAIH 7LPRA 2FXRA 4ISIH 2W7UA 1ZSJA 3HKJB 2PGBB 1Y5AT 1O5AB 2C8WB 3TITA 1P3CA 4FUFA 3A86A 3ATWA 1RTKA 5GWZA 3WY8A 4HI3A 2HVXA 3P6ZB 4ZROA 3QO6A 4Q80A 1WCZA 1DXWA 5FHTA 3RXVA 1G3CA 2BLWA 3FP8E 3AASA 3UR6A 2B8OH 4B2CA 3KQDA 3KL6A 4O3TA 3OYPA 4IW4E 1EUFA 1KXEA 1A5IA 3CS7A 5C3NA 2GZ8A 3OY5U 3LOXA 2QXHA 2FDAA 2BX3A 3H7TA 2ZHQH 3F6UH 2J2UA 1DUEA 3F9FA 4FUEA 1FPHH 1AUTC 2QF3A 1TE0A 1OWDA 1EJAA 1Y5UT 1SLUB 1ZGVA 2C8ZB 3Q3KA 1O2UA 2EC9H 4RKJB 4FUDA 1GBIA 1OSSA 1SB1H 2HRVA 5TCAA 4I7YH 2WPJS 4Y0YE 1E38B 3KN2A 2XC5A 3M3TA 4AORA 4NG9H 3A82A 1FUJA 3RXKA 1FY5A 3ZVCA 1S82A 1GCDA 5A2MH 2W5EA 2Y7XA 4NCYA 3EGKH 1JMOH 1SSXA 3U98H 3ZYDA 2FS8A 2HNTE 1XUGA 3LGIA 3PB1E 2GMTB 1P03A 3C1KA 3TIUA 1C2JA 1O3EA 3MMGA 3QX5H 3Q00A 1JIRA 2GCHF 1K2I1 4MG3A 8LPRA 3KQCA 2ASUB 3Q3YA 2Y5HA 9LPRA 2ZTXA 1DT2A 1DFPA 3RM0H 1JXPA 3ZZ9A 1DWEH 1BHXB 5C67A 2Z9LA 1GG6C 1SGRE 2BD3A 3QDZB 3LPRA 2UUJB 1EOJA 1GVLA 3ZZ8A 1GBAA 1D3DB 3ZZ4A 4WJG2 2W7SA 4DURA 1FY8E 3ZVGA 3M35A 1INCA 1GJ4H 2WPIS 3GCTF 3SNEA 4BTUB 2ZHFH 2AMPA 1J14A 3JZ1B 1O39A 4XE4A 3T5FH 2ZA5A 1T7CA 1O2OA 1O2WA 1Y3VA 2Q6DA 3RXIA 1MTNC 2PKAA 1D4PB 1A7SA 1Y3XA 5IDKA 2FODA 1XX9A 4YT6H 1C5VA 4MDSA 4D7FA 5JB9S 2ZTYA 1XVOA 2ZIQH 2CN0H 4KKDA 2WYGA 3F1SB 5LH8A 1K1LA 1XM1A 2AERH 1CHOF 2QF0A 4VGCB 4Z6AH 4O9VA 2G52A 1IQHA 2RA0A 3SV9A 2RA3A 2WPKS 3A8DA 1AKSB 1SOZA 1GDQA 4TYDA 1DY8A 5T6FA 2FOEA 5E0HA 1O2NA 1GL1A 1NTPA 2C8YB 1A3EH 2FM2A 1G9IE 2PUQH 1ARBA 1TBQH 1WQSA 1CBWB 3E0PB 1UK3A 1EP5A 2AS9A 3SQHE 4UEHH 2A2QH 1P2JA 3VGCC 1YPEH 2P94A 4CRBA 3KIDU 2VGCC 1GBMA 1FXYA 1ZTKA 2BOHB 4MPWA 5C20A 7ESTE 1IQFA 1PQAA 4BAQB 4Y7BA 3SUEA 1DE7H 5JBTA 1H8IH 5T6DA 1BDAA 4AFSA 2FOCA 3KQBA 1PQ8A 3SBKA 1QBOA 1DVAH 1GJCB 3ATLA 3LKWA 4X1RU 2ZGBH 4JZFH 4Y79A 7KMEH 1AIXH 2R3UA 2G00A 3BTGE 1BRAA 5JB8S 1K1MA 2FPZA 3U69H 3LC5A 1AZ8A 1MD8A 4BAHB 4DVAU 1ZR0A 1YLDA 1H4WA 4I8HA 4YESB 4B73A 1OKXA 1RIWC 1J15A 1TAWA 3K65B 1TPPA 1LVMA 1Z71A 1C5MD 2XBVA 5B6OA 3ZZ6A 1LHCH 2F9PA 4RSPA 3ZZ7A 1UK4A 3FFGA 1TGNA 3LONA 2SNVA 3VB4A 4A5TS 1TQ0B 4UE7H 4ZKSU 3FAOA 1PPEE 2UUFB 3URCA 2QGRA 2XWBI 1ARCA 1QURH 2UWLA 1WUNH 3ZYEA 4E05H 3ELAH 3P8OA 4TPIZ 1Y8TA 1GJ8B 1GMDG 1AVGH 1W13U 3ZZ3A 1GBEA 4GHQA 1VGCC 3QUMP 3HATH 1D6RA 1TNKA 2GZ7A 1S0RA 5GXPA 1PYTD 1PQ7A 1S6FA 1ZHRA 1SGFA 4YOIA 3EE0B 1C2LA 1YGCH 2CJIA 2UWPA 3V12A 3ZVDA 2VIPA 2GT7A 1ELCA 3ZZBA 5TJXA 4CRGA 3MNCA 1UTLM 1V2PT 5JBAS 3U8TH 4UFEH 2Q1JA 1MU6B 1C1PA