7ESTE

Interaction of the peptide cf3-leu-ala-nh-c6h4-cf3(tfla) with porcine pancreatic elastase. x-ray studies at 1.8 angstroms
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interaction of the peptide CF3-Leu-Ala-NH-C6H4-CF3 (TFLA) with porcine pancreatic elastase. X-ray studies at 1.8 A.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ELASTASE
total genus 55
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1990-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 7estE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 7estE01
3T26A 1TPOA 1TPSA 2RCEA 3Q3YA 4X8VH 2WV5A 1C1VH 2BD8A 3VEQB 3A7TA 2XYAA 3ZVAA 1P12E 4TPIZ 1MD8A 4CRFA 3LIWA 1OYTH 1T8NA 1LHDH 1EAWA 1L2EA 2IOTA 2PW8H 2GT8A 1O3FA 1XVMA 2GV6A 1O3GA 1O2NA 1FY1A 1WU1A 2FOGA 3UR9A 2H6MA 1ZHRA 1SGQE 2ZCHP 4ZROA 2PV9B 2BMGB 1C2LA 1V2UT 2O8WA 3FP8E 3QTOH 4YESB 3FZZA 1ABJH 1GCTC 2Z9LA 3T5FH 2BY6X 2PKAA 3P8FA 3TNSA 5AFZH 2G4UA 4O03A 4UFFH 4ZXXH 1TRYA 1GDQA 1UMAH 2CN0H 4MG3A 1Q3XA 1K1IA 1G3BA 4YZUA 1MMJN 1DX5M 3PTNA 1H1BA 3RP2A 1DXPA 2NU0E 1SGYE 4DG4A 4YT7H 1UTKA 3ZZ8A 1BHXB 1HLTH 3UPEA 2JH5D 3NCLA 1PPEE 1YP9A 4H6SB 4Y0YE 1ELCA 1GPZA 4ABJA 1HFDA 2ANKH 4JYVH 3A7XA 4ABBA 1C9PA 1HNEE 4X6MA 4X6NA 1MTWA 1HJ8A 1E34B 1K21H 2FI4E 4IBLH 2ODYB 4I7YH 3Q3KA 1O39A 2FI5E 3EAJA 1NO9H 1D3DB 2F9PA 2BXTH 3BG4C 3AAVA 1EQ9A 2R3UA 1W13U 4ESTE 1DWCH 5JDUB 3URCA 4DIIH 1C5MD 3RXMA 4YLQH 3ZZ3A 1D6WA 3ATLA 1O2IA 1AHTH 8KME2 2Y80A 4K69A 1C5OH 1GHBF 2HPQH 3RMLH 4Q80A 3A89A 1QQ4A 3HK3B 5CHAB 1W14U 1G2MA 2VH6A 1BRUP 3M61U 1MD7A 2A4OA 1MUEB 3M5LA 4A1VA 1HUTH 2FS8A 2O8UA 3MNCA 1CO7E 3NK8A 3EE0B 4B1TA 2XW9A 4Q7YA 2ZDLA 1VCPA 2ZGBH 4UFEH 2A5IA 2GCTC 1QA0A 4U2WA 4UD9H 4MTBA 3SBKA 2XTTB 4KTSA 2KAIB 4NZQA 2PHBA 5HGGA 1ETRH 1AFEH 1O2TA 1TMTH 2QC2A 1GMDF 1ZGIA 1KYNA 2W3IA 2UUFB 1EASA 4OS5A 3HATH 4RKJB 1O2VA 2BX4A 1BA8B 4CR9A 1P2IA 3DD2H 1NFUA 1KTSB 2ZDNA 4YM9A 3F1SB 4A5TS 1AFQC 1QA7A 1KLTA 1BT7A 1ANEA 2VINA 3PYHA 1A0JA 2JETC 4AGKA 4Y8YA 2ZC9H 1SGTA 2G4TA 1WTHD 3RU4T 4HGCA 2BDYA 1J8AA 1DUEA 1UHBB 2ZTYA 3MNSA 2GDEH 4WVPE 3STIA 2RDLA 2QN5T 6CHAC 1BJVA 1WTGH 1V2KT 3S7KB 1C5WB 2GTBA 4THNH 4I32A 4IN2A 1GCDA 2BD5A 1BZXE 1BTUA 1GJ9B 2ZFTA 1BUIA 1KXAA 1H9LB 2QIQA 1OOKB 2M5TA 1EAUA 4MPXA 1S0QA 2D26C 1P10A 2FOHA 4IS5A 2P3UB 1B0FA 1J15A 1BRCE 3W94A 2FOMB 2CMYA 4GUXA 5C5OA 2O8TA 4WY3A 4Y7AA 3VB3A 4IC5A 5AHGH 4Y0ZE 2A4QA 2A2QH 1F0SA 1S0RA 1J14A 2BYAX 3Q77A 1GG6C 1T7CA 1C2KA 3S9BA 4Y71A 1C5PA 1YGCH 3UQOA 1G37A 2H9EH 1B5GH 1C5RA 1NM6A 1XVOA 1GBMA 2AEIH 2SNWA 3SGAE 3RC6A 5PTPA 1SQTA 1SHYA 2PTCE 3PMBB 4MPUA 4AZ2B 4A7IB 3PM3A 1GHVH 1H9HE 1O3AA 1DWBH 2BB4A 2PR3A 2XBVA 1P11E 3ZZAA 4JZDH 5EOKA 1P2QA 1HBTH 2Y7ZA 1MU6B 2ZGXH 1GHBG 1UTOA 1W2KH 4TYDA 4UONA 3UOPA 2BVXH 2BHGA 5JB8S 2BD3A 2BDBA 3GY7A 1OKXA 1VZQH 3S0NA 1FY3A 1ZPCA 1UTPA 1SMFE 3F9EA 4ABFA 2ZHWH 1SL3A 3OSYA 3M3SA 4ZAEA 5DP6A 4A6LA 1GI8B 1LHCH 1MTSA 2HALA 5C5NA 1K28D 1PYTC 1HAGE 3DFJA 1XUKA 1QQUA 1QB1A 5DO4H 1OWEA 1O3IA 1QJ6B 2V3OH 1GMDG 1C5NH 1O31A 2GD4B 4FUFA 5JBCS 1TGBA 2TGTA 4BTTB 1SQAA 1E38B 1V6DA 2A45B 3TVJB 1XUFA 3SNCA 1S82A 2HRVA 5CMXH 1VITF 2YNBA 4JZFH 1NRNH 1CBWB 1TGSZ 5C67A 2BTCE 3C1KA 3RMNH 1DLEA 1A0HB 4LOYH 5BPEA 1KXDA 1HJAC 1GJCB 2G55A 1Y3XA 2ZHDA 3ZZ5A 3MU4A 3EQ0H 2F9BH 3VFEA 1LKBA 1BBRE 2VWLA 2GCTB 1O2HA 3GDUA 1BMLA 5C2ZA 1ZLRA 3BEFB 1FV9A 3M35A 3LGTA 4AB8A 2B9LA 4GVUA 1XXDA 3A7ZA 2HNTE 3L33A 2ANMH 4ABHA 1JOUB 3RXAA 1Z7KA 2QYIA 1A4WH 1FPHH 3MTYA 4AFZA 3LKWA 3ESTA 1NESE 1SC8U 1JIRA 2OC1A 2TGPZ 4Y79A 1BQYA 3O8CA 3LJOA 1Q2WA 4DJZB 1X7AC 4HI3A 2C8YB 1EZSC 3RXJA 2OLGA 1A3BH 1FXYA 1UVUH 1SGFA 2HPPH 3ZVGA 4DVAU 2J94A 2GP9B 4DGJA 1O32A 1YYY1 3M5OA 1O3PB 3QK1A 3SU2A 3TPIZ 1EB2A 1DITH 1A7SA 1MTVA 1FZZA 1AE8H 2AGGX 3RXDA 1IQMA 1K1OA 3QTVH 1CGHA 1V2RT 2AGIX 4CBNA 1YPEH 1TMUH 3VPKA 3C27B 4DY7B 2GX4A 1TABE 1QFKH 2P16A 4O3UA 1BTWA 1YC0A 3ELAH 3TH4H 1Z6JH 2GMTC 1QURH 1UHBA 1KDQB 1XUHA 2BQ7B 1C1OA 1ZSJA 3A86A 3DHKH 4BANB 3KL6A 3LC3A 3TU7H 1Q31A 1EUFA 2SGPE 1HRTH 1NRRH 1D3TB 2PUQH 4MLFB 5LGOA 2PSYA 4B2AA 2WPKS 4X1PU 1EJAA 3URDA 1BDAA 1PPFE 2ESTE 5ESTE 4I8LA 1XX9A 4Z6AH 1MZDA 3NWUA 1QRXA 1YCPH 4IMQA 4XSKU 1QY6A 3U98H 3UY9A 1DSUA 2V6NA 2XRCA 1DVAH 2G51A 4D76A 3SU4A 2CV3A 1MTUA 3GY3A 2Y5GA 2FOFA 3P70B 2GGVB 2W5EA 1LHGH 3KHVA 4HFPB 3ZVEA 1GL0E 5H4IB 4FUGA 1O3MA 2JH0D 1GBDA 3O8BA 5HM9A 1P05A 4I31A 4VGCB 1DLKB 1L1JA 1C1RA 1NT1A 2FTMA 1KLIH 3FZDA 1GJBB 1V2QT 1ZMNA 3OY6U 3TGJE 2G5VA 2ZU1A 3SHCH 4Y6DA 4AN7A 2J38A 5FCKA 4GSOA 5HYOA 1P01A 2VH0A 2ZECA 1G3DA 2D2DA 2PUXB 3A83A 3P17H 1AO5A 2B5TB 2H9HA 3BTQE 1GHXH 2GDDA 2BVSH 1F5LA 2J95A 4AFSA 5ESBA 1TRMA 3LGWA 4K2YA 3GYMA 3PV4A 1L4DA 1O2LA 1UVOA 5FX5A 2PGQB 2OXSA 1ELBA 1UVSH 1C1UH 1O34A 3RXEA 1FY8E 1FY5A 1GJ8B 1C1WH 3K6ZA 1TRNA 1HAPH 1NRSH 1CVWH 1K1JA 1SGPE 4JZEH 1ELFA 5A0CA 1Y5UT 2SGQE 3E0NB 3PMAB 4MNXA 3MNXA 3F9HA 2AIQA 3E6PH 1FMGA 3QWCH 1O37A 2ZFFH 3ODDA 5A0BA 1O2WA 4ZHLU 1BTXA 3Q3XA 1D3QB 1V2PT 1OS8A 3BEUA 2PKSB 2ZNKH 3BTGE 1GG6B 2OP9A 1QBOA 4WJG2 3VB7A 4JCNA 2BZAA 2P59A 1AKSA 1SFQB 4BOHA 4OGXA 4H6TA 3RC4A 2R0LA 5DG6A 4B2BA 2Z3DA 2AYWA 1KIGH 4NIWA 4TY6A 1NPMA 1DOJA 3UFAA 1QCPA 3PMHB 2ZPQA 4LZ4B 1EATA 2NU2E 3NXPA 2QF3A 4Y8XA 1BBRH 3UNSA 5GWZA 2VIVA 7KMEH 4CRBA 1GHAF 1W8BH 1ELEE 4GHQA 1TGNA 1GJ6A 2AGEX 5GPIB 1DS2E 4J1YA 1IQJA 3EA9A 1OP2A 3PWCA 4XOJA 1VR1H 1F92A 2JETB 1TA6A 1YLCA 2ZO3H 1WUNH 3BTKE 3GCOA 1C5QA 1MH0A 3SGQE 1O3JA 1ARCA 2G5NA 1AY6H 1DDJA 3H7OA 4FU8A 4WH8A 1FN6A 1YLDA 4TWYA 5T3HA 4UDWH 1BTZA 3TJUA 1GBTA 4NG9H 3UQVA 4NIXA 1V2VT 4BAQB 3KNXA 3SNBA 3TH2H 5F8XA 1UTJA 3QO6A 1QTFA 2HNTF 1AVWA 1BMMH 2YNAA 4MVNA 4KKDA 1JRTA 1AN1E 4NCYA 1C5ZB 2WPLS 2TIOA 6GCHG 1H8IH 1CGJE 1ACBE 2LPRA 2BOKA 2OC8A 2THFB 1CE5A 6LPRA 2ZQ2A 3O8DA 1FLEE 1DANH 4NZLA 1XM1A 1GI5A 1O5AB 1KDQA 1OXGA 5GDSH 1CT0E 3OU0A 3BTEE 4LK4A 3V3MA 1EOLA 1GBLA 4A92A 5A8ZA 2FDAA 1TGTA 2VB0A 3LH1A 1EZXC 1P3CA 2VIQA 3QGJA 2QV1A 1Y5AT 2XCFA 1WYKA 3ZVFA 1AVGH 2FM2A 1QB9A 2UUKB 1A3EH 3V13A 3SNDA 2WUBA 3LT3A 2EI7A 4DURA 5DP9A 5DKMA 4AYVB 1BMNH 3EYDA 1C1SA 4X1SU 2VVVA 1L4ZA 1QJ1B 1C2FA 2W3KA 2YOLA 3VB4A 4D7GA 4YT6H 1H8DH 1K22H 1O5DH 3MU5A 1NRQH 3QUMP 4WMFA 3UNQA 3KCGH 2FESH 2XNIA 3SHAH 1WQSA 1KXBA 1JRSA 1AQ7A 1QL9A 4OS2A 4FUJA 4MPWA 2XCNA 1PPZA 5BRRE 1SGEE 1DE7H 1TX8A 1CA8B 8GCHG 1TNJA 2OC7A 1YPKH 4ISNA 1UK3A 3GISB 3HGPA 2VGCB 4QT8C 1LKAA 1ZYOA 1ELVA 2H2ZA 3RDZA 3K6YA 4GHTA 3DFLA 5DK1A 3SW2B 3ZZDA 1UCYH 3QZQA 2ALPA 2ZG0H 5JPMH 3LPRA 4I8JA 3S9AA 4AG2A 2ZU2A 2Y5FA 1J9CH 2XC4A 3G01A 4ZUHA 1IOEA 4D7FA 3TGKE 4JK5A 1PQ8A 2A0QB 1PPCE 1ID5H 1N1LA 1O2XA 1SGFG 2A5KA 1ZPZA 3GCHB 4INKA 3U8TH 3UIRA 1UTQA 1TE0A 3GCHC 1MU8B 5CE1A 2Z7FE 1MAYA 1O3CA 1QJ7B 3ATWA 2C8XB 2RG3A 1Z8JB 2BY5X 4FUBA 5EQQA 3RMOH 3MO3A 1O3KA 2BD7A 1LQEA 2IN2A 4JZ1A 1GVKB 1FQ3A 1JWTA 1AGJA 1TNLA 1THRH 6GCHF 2NU1E 1BTPA 5HXFA 5C1UA 3S7HB 3BIVH 1IQGA 3U9AH 4K3JA 2FEQH 1BITA 3MH6A 4E7RG 3PMJA 3GY2A 4CH8B 2P93A 2AMDA 1C1MA 1TNHA 3BEIB 3CENA 4K1SA 1WSSH 1NN6A 1C2JA 3SUGA 5A09A 1HAXB 3V7TA 2KAIA 3UTUH 3E16B 2JKHA 3F9FA 4OS7A 4MNYA 1C5YB 1F2SE 1DICA 3BTWE 3FP6E 3GY5A 1HAVB 4K1EA 3RMMH 1MTNC 4LXBH 1UTNA 2XXLA 1GBCA 1RFNA 1KSNA 1ELTA 4Z0KA 1BB0B 5EW1H 3BG4B 1GL1A 4E06H 5K7RA 3M3VA 4E7NA 1MTNB 1W7GH 1PJPA 1TGCA 1Z6EA 1P06A 3B23B 1GBJA 3RXVA 3PO1C 1OP0A 1Y3YA 3A7YA 3IWMA 1O2UA 2P8OB 3ITIA 1AU8A 1CT4E 1FY4A 2ZP0H 1TLDA 2Q6FA 3KQDA 2SGDE 2ZGHA 2PWXA 2Y82A 4X8UH 4AX9H 1B7XB 3MI4A 3ZZ6A 4FXGH 2F3CE 2A4RA 3LU9B 3BTTE 2OQ5A 1ZRKA 2Z3CA 3RLYH 2C4FH 2J34A 5J4QA 1O0DH 4H4FA 3VB6A 2DE8A 1V2NT 3MO9A 3ZVBA 1LPZB 1NZQH 5FCRA 2BDCA 1KY9A 3PTBA 1CT2E 2BX3A 1TPPA 2JH6D 2ZDMA 3SUEA 4ZKRU 3U1IB 1QL8A 1IQHA 4KTCA 1HYLA 3DA9B 1MKWH 3LGYA 3MO6A 1RTKA 5G4BA 1DWDH 4B74A 1LCYA 3P92A 3GDSA 1ABIH 3M3TA 1NFWA 2O8LA 1C2EA 1YPGH 1GBEA 1JIMA 1TPAE 2ZCLP 2CF9H 1XUJA 1TIOA 1NU9A 1GHAG 2FP7B 2BDHA 1O3LA 1V2ST 1V3XA 1GMHG 3N7OA 2OD3B 1S83A 4O3TA 1T8MA 4AG1A 4TPYA 1C2GA 3HGNA 2DUCA 3RXFA 1ESAA 1TYNA 3UUZA 1BOQA 1IHSH 1O2MA 1V2MT 1ZMLA 3TJOA 2EI6A 2F9UA 5TJXA 1SSXA 2F91A 1L1NA 1GVLA 3UOUA 3FFGA 1LPGB 1FPCH 1UO6A 2ZFRH 3UWIA 4NA7A 4NA8A 1GDUA 2Q6GA 3T28A 3RXOA 1GVZA 3RXUA 3MWIU 1A61H 1F0TA 5I46H 3CS7A 2UUYA 1NRPH 1AE5A 2BVRH 4MNWA 5L6NH 4BTUB 1QL7A 1P9UA 1GBHA 1Z8GA 1DM4B 1AWFH 1GJ4H 1YPJH 4X6PA 1C2HA 3MFJA 4X2WA 1QGFA 1EPTB 2ZZUH 1LO6A 4NSYA 5LPFA 2ILNA 1V2OT 4FUDA 3B8JA 8GCHF 3P95A 2GMTB 2OBOA 1A5HA 2XWBI 3MH4A 1Y3WA 3F68H 4GAWA 3AW0A 3QGNB 1Y5BT 1GJAB 4YOJA 1EAIA 4AORA 1ORFA 3E3TA 3LGVA 1GBIA 3KF2A 3TK9A 1TFXA 1GI6A 1ZSKA 2Z9IA 3E0PB 3H5CB 3MMGA 2Z9JA 3T27A 4X1NU 1AVXA 4TWWA 1LVOA 2BZ6H 5F03A 4R8TB 1O3OA 2AH4X 1NFXA 1P04A 3D23A 1CU1A 4WXIA 4B73A 4NWLA 3I77A 3AW1A 1LVMA 2WPHS 1O3BA 1VGCB 4X8TH 4NFFA 3SJIA 1EOJA 1UK2A 1Y59T 2WV4A 1GBFA 5EQSA 1T8LA 5LH8A 1WBGB 1AIXH 2VWOA 4JYUH 2A32A 3A8BA 3TNTA 5LPEA 2FOBA 2FOEA 1NROH 4NFEA 2F9NA 3SQHE 5DP3A 3NUMA 1P2MA 1GI9B 1A46H 4GCHG 1ZSLA 3BSQA 2P3TB 3K2UA 2VIOA 3KQBA 2K1QA 4Y10E 4SGBE 1W11U 2J9NA 3SZNA 2H5CA 1GJ7B 4KELA 4BAKB 4KGAA 1B0EA 2GCHG 1YPHE 5ABWA 2BLWA 1AUTC 3HK6B 2ZFQH 3MH7A 1AWHB 1AFQB 1FAKH 2IJOB 5SGAE 4FUCA 1HV7A 2FYRA 1QBVH 4DW2U 1O3DA 3TJVA 3ZZCA 2ZHQH 5AVDA 2FIRH 1N8OB 1O3HA 1D3PB 2CHAC 1FI8A 3MH5A 4WMDA 1OYQA 1ZJDA 5C20A 2EI8A 4D9QA 1HCGA 2FTLE 3U8OH 3QX5H 4NGAH 4BAOB 2HGTH 1INCA 1LVYA 2ZA5A 3M7TA 3RM0H 3UNRA 2FX4A 5EXLA 4X2XA 4ZKSU 3NPSA 1VCWA 3TK6A 1ZZZA 3SI3H 1TONA 3RXQA 3RU4E 2R0KA 2OC0A 3LJJA 2OBQA 1JBUH 1MQ5A 1MZAA 1LDTT 1AD8H 1G32B 1PPBH 4NWKA 1C9TA 4U32A 2H1UA 1O30A 2VIWA 1F5KU 2ZU3A 1Z8RA 1PQAA 2A7JA 3SU0A 4BXWA 2ZIQH 4Y76A 2ALVA 2ZCKP 3FP7E 3GOVB 4FUHA 4FVBA 4B2CA 1N8OC 2OUAA 1ESTA 2A4GA 3GY8A 3RXLA 1S81A 1GMCG 2VIPA 2ZTZA 1AUJA 2GT7A 3EGKH 3ZZ7A 1W12U 1G3CA 3GCTF 1BRAA 1OWDA 1O5EH 5E0GA 4ABAA 1A1RA 2Z3EA 2CXVA 5EODA 2BOHB 4CHAC 4AGJA 1O2QA 2RA0A 3MOCA 2QF0A 3MHWU 2A5AA 5F8TA 4FU7A 5E2OA 3SO3A 4CREA 1RS0A 2Y6TA 5GXPA 1HAVA 1DPOA 4I33A 5DP7A 2QAAA 2BD2A 3M7QA 1C5SA 1ESBA 1UCYE 2G8TA 3BTHE 4E05H 1ZPBA 2WPIS 4Y7BA 3RXTA 1LVBA 4B76A 2O8MA 3KQCA 1PFXC 1ZRBA 1AB9B 3ZV9A 1IQLA 3ZYDA 2GZ8A 4YOGA 4FU9A 4IMZA 3M5NA 3CP7A 3SJ9A 4XFQA 1VGCC 3RLWH 3LGIA 2BQ6B 5FPSA 4ABDA 3LGUA 1EXFA 3S9CA 1WQVH 1O2YA 1K1MA 1A5IA 1EKBB 4CRDA 2SNVA 5EU8A 2C3SA 2ODPA 1CHGA 1P2NA 1PPGE 3ODFA 1TA2A 1UTMA 3R3GB 4K60A 1WAYB 4ZKOU 3SU3A 6ESTA 1EZQA 4ZHMU 1EX3A 1BTYA 2Q6DA 1LQDB 3TIUA 4BXSA 3MU1A 2H5DA 4GPGA 1DSTA 1O2SA 5DP4A 3FVFB 4ZMAH 2D1JA 5E8EH 1T4UH 1D6RA 2G81E 3LOXA 2OTVA 3JZ1B 5C1YA 2FOAA 1XMNB 1JXPA 2C90B 4UFDH 2W7UA 4XBDA 1FAXA 2VVCA 1P03A 4YOIA 2G00A 4KTUA 1MKWK 1RIWC 5L2ZH 1GI4A 4CRAA 5JBAS 3F6UH 5EW2H 1BCUH 4CRCA 1C1PA 1GBKA 2AMQA 1P02A 1W0ZU 4CRGA 3LDXH 1UVTH 3AVZA 1NU7B 1TNGA 5EXMA 1AKSB 2QY0B 2W7SA 3SV8A 1LHEH 1VJ9U 1N6XA 3U69H 1CA0C 1G3EA 3PROA 1CGIE 1N6YA 1SLVB 1NS3A 1O38A 1C2IA 3L6PA 1K1LA 2QXIA 2XBXA 1KLJH 2ZPSA 3ZYEA 1F5RA 1W7XH 1T32A 2QXGA 3VB5A 3E90B 2HVXA 1F0UA 5J4SA 2I6QA 5EPYA 3SUFA 1EJNA 4D9RA 4Y8ZA 1OP8A 2ZU4A 3SU6A 4JK6A 3BG8A 1S5SA 4I8GA 3I78A 3PB1E 1F0RA 2FS9A 4NIVA 4MNVA 2WPJS 2B0FA 1TBQH 3RXPA 2AERH 3TK5A 3T29A 1LTOA 4WWYA 2EEKA 1SHHB 2BY8X 1ELDE 2AS9A 3QZRA 2J2UA 2QGRA 2C8WB 2Z6BD 3GICB 3SV6A 3U1JB 2FWWA 1O2ZA 2A31A 3F9GA 9LPRA 2BLOA 2ZDAH 2PLXA 2Y7XA 4AFUA 3E8LA 1FONA 2SGFE 1QRWA 1ZGVA 1VJAU 2PFEA 1IQNA 2VWMA 1NTPA 4HZHA 4O97A 1GMHF 1P9SA 3ZV8A 2ZEBA 2AFQB 3PO1B 1F7ZA 3ATKA 2ZWLH 2G52A 1PQ7A 1BRBE 2O9QA 2FZZA 1P2KA 3PLKA 1H9IE 1QB6A 3MYWA 1GBBA 1ZTJA 5F8ZA 3RXGA 1DXWA 1UTLM 3IG6B 3A87A 3D65E 1T8OA 2BY9X 1ZR0A 4ZH8A 1VCQA 3A8AA 2P94A 2GVFA 3PWBA 4X1QU 3SUDA 4XBBA 1XKBC 7GCHF 3W95A 4HTCH 2HNTC 1HAOH 1YBWA 1SLXB 2R3YA 1SGDE 5JBBS 1SFIA 3O8RA 1GGDB 1ZHMA 1AZ8A 1IQFA 3SU1A 1RIWB 4DT7B 2CJIA 1TQ0B 3SJOA 2QXHA 2PKSC 2HWLB 4X1RU 2A2XH 4ZKNU 2ULLA 4AB9A 4RN6A 1TX7A 4BAMB 4K1TA 1HAYB 3KIDU 1P8VC 3OYPA 1GJDB 4FVDA 1KXEA 5L30H 2PGBB 1THPB 3S69A 2VVUA 1ZOMA 2GZ9A 8ESTE 3EDXB 1ZHPA 3ZVCA 2UWLA 1P09A 3M36A 5DPAA 1SPJA 1BHXF 3QDZB 4A1TA 1E0FD 2IPHA 2ZDVH 3RU4D 5FX6A 1Z1IA 2DE9A 2ZI2H 3TJNA 2Q1JA 1AZZA 1J17T 1UVPA 3SNEA 3MU0A 5FBEA 3T62A 5LPRA 3AASA 1C1NA 5JBTA 2W26A 1OSSA 4X2VA 1OPHB 3SGBE 5DJ7A 2EA3A 5A8YA 7LPRA 2ZDKA 4CBOA 1P57B 1TBRH 2VGCC 2ZU5A 5GCHG 1SGIB 1ZJKA 1CA0B 1O5GH 1DY8A 1OWHA 1FN8A 3AAUA 3VGCB 5F6MA 1RD3B 6CHAB 5EQRA 1SGRE 1V2LT 5CHAC 2AMPA 1YPHC 1XUIA 1EB1H 1SG8B 1TOMH 2CF8H 1O2KA 1KXFA 2ZGJA 1HDTH 3PLBA 4K8BA 2ODQA 2ZGCA 3U8RH 1YM0A 3SJ8A 4DCDA 1J16A 4K8YA 3NKKA 1K2I1 1RTFB 4D8NA 4OGYA 1GI0A 2FMJA 3RXSA 4AFQA 5EXNA 1SVPA 2Z9GA 4MDSA 3SOSA 1C4U2 2UWOA 5C1XA 2RA3A 1V2WT 2CGAA 1O35A 2FO9A 7ESTE 5AFYH 2BM2A 3GY4A 1PYTD 1CQQA 4ZHAA 3ZZ9A 1NFYA 1EPTC 1TAWA 1VITH 2BDAA 3EA7A 4IGDA 3Q00A 1TMBH 3P8GA 2GV7A 1TX6A 1THSH 2WYJA 3SORA 1UCYK 3WY8A 3BV9B 5E0HA 3SQEE 1O3NA 3LONA 4Y11E 1LHFH 2SFAA 4NSVA 4IC6A 2WPMS 7GCHG 3RUOA 4KP0A 4MPVA 1YPLH 1O33A 1D9IA 1ANDA 4X6OA 3K9XB 1VITG 2TRMA 1MBQA 4ABIA 4AYYB 2B7DH 3D49H 2R2MB 2VWNA 1H4WA 4VGCC 1XXFA 1V2TT 5E2PA 4Q2KA 5C3NA 2ZHEH 3SV7A 1G9IE 5T6DA 1YCPM 1TB6H 5AF9H 2VU8E 1GCTB 1QBNA 1E36B 3IITA 2NWNA 1GJ5H 1CBWC 2FX6A 5TCAA 2NU3E 2Z9KA 1QIXB 4MQAA 4R0IA 1YCPK 2BXUH 1FIWA 3DUXH 5IYTA 1AI8H 3E91A 1RTLA 5I25A 1HPGA 3KQEA 1ARBA 1OWIA 2XC5A 2FLBH 4ABGA 5DGJA 1SB1H 1XUGA 5FXLA 4IW4E 2A1DB 3QLPH 3DT0H 1O5CB 4RKOB 5GCHF 1AB9C 3A80A 1G2LA 1GI7B 1MKXK 1ETSH 4Q7XA 3RXHA 4BTIB 1OX1A 1W0YH 2C8ZB 3A82A 1S85A 1S84A 1C1QA 2F9OA 2OINA 1EJMA 2TPIZ 2ASUB 4LZ1H 1M9UA 1W3CA 1XKAC 3QN7A 2FOCA 4YLUA 3K65B 1GHWH 2ZF0H 4WXVA 4J2YB 2WUCA 5FPYA 4CHAB 1WCZA 5T6FA 2FPZA 1IQIA 1SOTA 1LMWB 4JZIA 3LC5A 4WMEA 3BTDE 4FUEA 3NZIA 3EA8A 3A7VA 1P0SH 3A7WA 1HGTH 3GCTG 1T31A 2J92A 3SNAA 2ZHFH 3GCNA 3M5MA 1S6FA 1FJSA 4CR5A 2H9TH 5FPTA 3ATIA 1HJ9A 3TITA 2C93B 1MCVA 1GI2A 2UUJB 4O9VA 3L3TA 1C5UA 1UJ1A 4BNRA 2ANYA 2Y81A 4WH6A 2GCHF 1NC6A 5T6GA 4X2YA 4PROA 2R2WU 1O36A 1TQ7B 2WINI 1C4V2 5E0JA 1GWAA 1O2JA 1SLWB 2FODA 1PQ5A 1HXFH 1CHOG 1O2RA 2GKVE 1ANBA 5L2YH 5FAHA 1GI3A 1ZTKA 1T4VH 3RXRA 3RM2H 1O5FH 2BD9A 1SQOA 3VGCC 3T2NA 5IDKA 4XDEA 1KXCA 1IAUA 3ENSB 1FDPA 2XC0A 2ANWA 1TOCB 1L1GA 1MCTA 3VXEH 1K1PA 4ISOA 3RXBA 4ZXYH 3GY6A 3BTME 3FAOA 3HPTB 1C5VA 5DP8A 5ETXA 1YF4A 1ELGA 5EGMA 1C5LH 2V35A 1WV7H 4F4OC 1EP5A 1OWKA 1SBWA 1K9OE 1E37B 1O2PA 1U6QA 2BDGA 2J4IA 3UREA 2PKAB 3BTFE 3M7UA 1HJAB 1Z8IB 1JMOH 4DOQA 3P8NA 2PSXA 4NA9H 2A7CA 2QA9E 1GDNA 1EZUC 5HMAA 2VIDA 2QXJA 1SR5C 3T25A 3M37A 1RGQA 1DY9A 2BLQA 4OS1A 1V2JT 8LPRA 1A2CH 3A81A 3A88A 1Z1JA 2FYQA 3SN8A 1SGCA 3KGPA 1C2DA 2I6SA 1GHYH 4SGAE 1C5TA 3TH3H 3UWJH 1RXPA 4UE7H 5HM2A 1G30B 2BLVA 1HIAB 1P3EA 2FI3E 3GDVA 1HAHH 1MBMA 2BY7X 5A2MH 2SGAA 3E1XB 1QNJA 3KN2A 4XBCA 4M7GA 4NIYA 1UK4A 2XBYA 2ZTXA 4RSPA 3KEEA 5FBIA 3P8OA 1GGDC 3TGIE 3P6ZB 1HAZB 2ZPRA 1LPKB 3SU5A 5EPNA 3BIUH 3H7TA 1IQKA 1CSOE 1DUAA 2ZFPH 1K1NA 1GBAA 5FHTA 2FLRH 4GLYA 4I8HA 4CH2B 1C4Y2 2UWPA 1RJXB 1OWJA 4ISIH 2P95A 2QCYA 1HIAA 3RXKA 4INHA 3BF6H 1TNIA 2P3FH 1IQEA 2R9PA 2WYGA 4WF8A 2Z94A 4U30A 1ETTH 3V0XA 1C5XB 3JZ2B 5EG4A 1EPTA 4ISHH 1D4PB 3OY5U 1HAIH 3VXFH 3HKIB 2D8WA 1O5BB 1YKTA 2CHAB 1FIZA 4TY7A 1A0LA 1EAXA 3STJA 1CHOF 1IHTH 1HB0B 4UEHH 1ZMJA 1C1TA 4X0WU 5TCCA 3SJKA 1GHZA 3SV2H 1GMCF 1EP6A 1L0ZA 3FANA 5JB9S 4IN1A 1DFPA 3A8DA 3SV9A 2TGDA 4H42U 1TBZH 2STAE 4OS6A 3ZZ4A 3SI4H 9ESTA 3BN9A 5A8XA 5GJ4B 1YPMH 1SGNE 1ZTLA 5B6OA 2AIPA 1MQ6A 2SGEE 1C2MA 3OX7U 2STBE 2TBSA 5GIBA 5DP5A 1Y3VA 2GZ7A 4A1XA 2A7HA 2OCVB 1KTTB 1G36A 5JYIA 4DIHH 2F9VA 4XE4A 4U01A 1PPHE 4JYTA 4YTAA 2V3HH 1S6HA 4OS4A 3ZVDA 4AOQA 1SLUB 4ABEA 4BAHB 2XBWA 3OTJE 1BMAA 4K5ZA 1QHRB 2P8OC 2TGAA 3HKJB 1TNKA 2Y5HA 3I29A 1SOZA 2F83A 1E35B 3A85A 3B9FH 1Y3UA 4FUIA 5K0HA 1QR3E 2V0BA 2OQUA 2PTNA 1P2JA 1SI5H 4UFGH 2EC9H 4YO9A 4ASHA 1NY22 2HLCA 3TLOA 4F49A 1BIOA 1HXEH 2HOBA 4B75A 1FNIA 3MU8A 1BTHH 2ZKSA 3A84A 3CS0A 1QRZA 1BBRK 4I8KA 3V12A 3MNBA 4JMYA 4B71A 1P2OA 2FXRA 4GCHF 4ISLA 3D62A 4X8SH 1BJUA 1Y8TA 1GI1A 2BD4A 2B8OH 2NU4E 3Q76A 1ANCA 5A0AE 1FUJA 1O3EA 2VNTA 4INLA 1AMHA 3PLPA 2BQWB 3GYLB 1O2OA 2LNCA 1DT2A 2VJ1A 1A5GH 1MKXH 3ATMA 3RXCA 3UR6A 1DWEH 2ZFSA 1W10U 1O2GH 1RRKA 2XWAA 3ZZBA 3A8CA 3RC5A 4Q7ZA 1Z71A 1WOFA 3R0FA 1ELAA 3RXIA 2ZQ1A 1TALA 1MAXA 3LH3A 2BDIA 1TWXB
chains in the Genus database with same CATH superfamily
3T26A 1TPOA 1TPSA 2RCEA 3Q3YA 4X8VH 2WV5A 1C1VH 2BD8A 3VEQB 3A7TA 2XYAA 3ZVAA 1P12E 4TPIZ 1MD8A 4CRFA 3LIWA 1OYTH 1T8NA 1LHDH 1EAWA 1L2EA 2IOTA 2PW8H 2GT8A 1O3FA 1XVMA 2GV6A 1O3GA 1O2NA 2V3MA 1FY1A 1WU1A 2FOGA 3UR9A 2H6MA 1ZHRA 1SGQE 2ZCHP 4ZROA 2PV9B 3WWBA 2BMGB 1C2LA 1V2UT 2O8WA 3FP8E 3QTOH 4YESB 3FZZA 1ABJH 1GCTC 2Z9LA 3T5FH 2BY6X 2PKAA 3P8FA 4XD7D 3TNSA 5AFZH 2G4UA 4O03A 4UFFH 4ZXXH 1TRYA 3UB0A 1GDQA 1UMAH 2CN0H 1K0HA 4MG3A 2J98B 1Q3XA 1K1IA 1G3BA 4YZUA 1MMJN 2L6OA 1DX5M 3PTNA 1H1BA 3RP2A 1YLNA 1DXPA 2NU0E 1SGYE 4DG4A 4YT7H 1UTKA 1WDIA 3ZZ8A 1BHXB 1HLTH 3UPEA 2JH5D 3NCLA 1PPEE 1YP9A 4H6SB 4Y0YE 1ELCA 3SZEA 1GPZA 4ABJA 1HFDA 2ANKH 4JYVH 3A7XA 4ABBA 1C9PA 1HNEE 3N99A 4X6MA 4X6NA 1MTWA 1HJ8A 1E34B 1K21H 1NBMD 2FI4E 4IBLH 2ODYB 4I7YH 3Q3KA 1O39A 2FI5E 3EAJA 1NO9H 1D3DB 2F9PA 2BXTH 3BG4C 3AAVA 1EQ9A 2KFWA 1W13U 2R3UA 4ESTE 1DWCH 5JDUB 3URCA 4DIIH 1C5MD 3RXMA 4YLQH 3ZZ3A 1D6WA 3ATLA 1O2IA 1AHTH 3DCLA 8KME2 2Y80A 4K69A 1C5OH 2XOKD 1GHBF 2HPQH 3RMLH 2JJ2D 4Q80A 3A89A 1QQ4A 3HK3B 5CHAB 1W14U 1G2MA 2VH6A 1BRUP 3M61U 1MD7A 2A4OA 1MUEB 3M5LA 4A1VA 1HUTH 2FS8A 2O8UA 3MNCA 5KGOA 1CO7E 3NK8A 3EE0B 4B1TA 2XW9A 4Q7YA 2ZDLA 1VCPA 2ZGBH 4UFEH 2A5IA 2GCTC 1QA0A 4U2WA 4UD9H 4MTBA 3SBKA 2XTTB 4KTSA 2KAIB 4NZQA 2PHBA 5HGGA 1ETRH 1AFEH 1O2TA 1TMTH 2QC2A 1GMDF 1ZGIA 1KYNA 2W3IA 2UUFB 1EASA 4OS5A 3HATH 4RKJB 1O2VA 1KMHB 2BX4A 1BA8B 4CR9A 1P2IA 3DD2H 1NFUA 1H8HD 1KTSB 2ZDNA 4YM9A 3F1SB 4A5TS 1AFQC 1QA7A 1KLTA 1BT7A 1ANEA 2VINA 3KYFA 3PYHA 1A0JA 2JETC 4AGKA 4Y8YA 2ZC9H 1SGTA 2G4TA 5DSFA 1WTHD 3RU4T 4HGCA 2BDYA 1J8AA 1DUEA 1UHBB 2ZTYA 3MNSA 2GDEH 4WVPE 3STIA 2RDLA 2QN5T 6CHAC 1BJVA 1WTGH 1V2KT 3S7KB 1C5WB 2GTBA 4THNH 4I32A 4IN2A 1GCDA 2BD5A 1BZXE 1BTUA 1GJ9B 2YMSC 2ZFTA 1BUIA 1KXAA 1H9LB 2QIQA 1OOKB 2M5TA 1EAUA 4MPXA 1S0QA 2D26C 1P10A 2FOHA 4IS5A 2P3UB 1B0FA 1J15A 1BRCE 3W94A 2FOMB 2JIZD 2CMYA 4GUXA 5C5OA 2O8TA 4WY3A 4Y7AA 3VB3A 4IC5A 5AHGH 4Y0ZE 2A4QA 2A2QH 1F0SA 1S0RA 1J14A 2BYAX 3Q77A 1S6LA 1GG6C 1T7CA 1C2KA 3S9BA 4Y71A 1C5PA 1YGCH 3UQOA 1G37A 2H9EH 1B5GH 1C5RA 1NM6A 1XVOA 3MQKC 1GBMA 2AEIH 1SKYE 2SNWA 3SGAE 3RC6A 5PTPA 1SQTA 1SHYA 2PTCE 3PMBB 4MPUA 4AZ2B 4A7IB 3PM3A 1GHVH 1H9HE 1O3AA 1DWBH 2BB4A 2PR3A 2XBVA 1WXRA 1P11E 3ZZAA 4JZDH 5EOKA 1P2QA 1HBTH 2Y7ZA 1MU6B 2ZGXH 1GHBG 1UTOA 1W2KH 4TYDA 4RT1A 4UONA 3UOPA 2BVXH 2BHGA 5JB8S 2BD3A 2BDBA 3GY7A 1OKXA 1VZQH 3S0NA 1FY3A 1ZPCA 1UTPA 1SMFE 3F9EA 4ABFA 2ZHWH 1SL3A 2RDEA 3OSYA 3PRBA 3M3SA 4ZAEA 5DP6A 4A6LA 1GI8B 1LHCH 2L74A 3KYGA 1MTSA 2HALA 5C5NA 1K28D 1PYTC 3FO8D 1HAGE 2KZ4A 3DFJA 1XUKA 1QQUA 1QB1A 5DO4H 1OWEA 1O3IA 2QF4A 1QJ6B 2V3OH 1GMDG 1C5NH 1O31A 2GD4B 4FUFA 4F48B 5JBCS 1TGBA 3NRLA 2TGTA 4BTTB 1SQAA 1E38B 1V6DA 2A45B 3TVJB 1XUFA 3SNCA 1S82A 2HRVA 5CMXH 1VITF 2YNBA 4JZFH 1NRNH 1CBWB 2PP6A 1TGSZ 5C67A 2BTCE 3C1KA 3RMNH 1DLEA 1A0HB 4LOYH 5BPEA 3W1EA 1KXDA 1HJAC 1GJCB 2G55A 1Y3XA 2ZHDA 3ZZ5A 3MU4A 3EQ0H 2F9BH 3VFEA 1LKBA 1BBRE 2VWLA 2VBCA 2GCTB 1O2HA 3GDUA 1BMLA 5C2ZA 1ZLRA 3BEFB 1FV9A 3M35A 3LGTA 4AB8A 2B9LA 4GVUA 1MABB 1XXDA 3A7ZA 2HNTE 3L33A 2ANMH 4ABHA 1JOUB 3RXAA 1Z7KA 2QYIA 1A4WH 1FPHH 3MTYA 4AFZA 3LKWA 3ESTA 1NESE 1SC8U 1JIRA 2OC1A 2TGPZ 4Y79A 1BQYA 3O8CA 3LJOA 1Q2WA 4DJZB 1X7AC 4HI3A 2C8YB 4P02A 1EZSC 3RXJA 2OLGA 1A3BH 1FXYA 1UVUH 1SGFA 2HPPH 3ZVGA 5CDFE 4DVAU 2J94A 2GP9B 4DGJA 1O32A 1YYY1 3M5OA 1O3PB 3QK1A 3SU2A 3TPIZ 1EB2A 1DITH 1A7SA 1MTVA 1FZZA 3H09A 1AE8H 2AGGX 1EFRD 3RXDA 1IQMA 1K1OA 3QTVH 1CGHA 1V2RT 2AGIX 4CBNA 1YPEH 1TMUH 3VPKA 3C27B 4DY7B 2GX4A 1TABE 1QFKH 2P16A 4O3UA 1BTWA 1YC0A 5EJLA 3ELAH 3TH4H 1Z6JH 2GMTC 1QURH 1UHBA 1KDQB 1XUHA 2BQ7B 1C1OA 1ZSJA 3A86A 3DHKH 4BANB 3KL6A 3LC3A 4ACBA 3TU7H 1Q31A 1EUFA 2KR7A 2SGPE 1HRTH 1NRRH 4ACAA 1D3TB 2PUQH 4MLFB 5LGOA 2PSYA 4B2AA 2WPKS 1H8ED 4X1PU 1EJAA 3URDA 1BDAA 1PPFE 2GJGA 2ESTE 1W0JD 5ESTE 4I8LA 1XX9A 4Z6AH 1MZDA 3NWUA 1QRXA 1YCPH 4IMQA 4XSKU 1QY6A 3U98H 3UY9A 1DSUA 2V6NA 2XRCA 1DVAH 2G51A 4D76A 3SU4A 2CV3A 1MTUA 3GY3A 2Y5GA 2FOFA 3P70B 2GGVB 4I86A 2W5EA 1LHGH 3KHVA 4HFPB 3ZVEA 1GL0E 5H4IB 4FUGA 1O3MA 2JH0D 1GBDA 3O8BA 5HM9A 1P05A 4I31A 4VGCB 1DLKB 1L1JA 1C1RA 1NT1A 2FTMA 1KLIH 3FZDA 1GJBB 1V2QT 1ZMNA 3OY6U 3TGJE 2G5VA 2ZU1A 3SHCH 4Y6DA 2XNDD 4AN7A 2J38A 5FCKA 4GSOA 5HYOA 1P01A 3EE7A 2VH0A 2ZECA 1G3DA 2D2DA 2PUXB 3A83A 3P17H 1AO5A 2B5TB 2H9HA 3BTQE 1GHXH 1SQRA 2GDDA 2BVSH 1F5LA 2J95A 4AFSA 5ESBA 1TRMA 3LGWA 4K2YA 3GYMA 3PV4A 1L4DA 1O2LA 1UVOA 3F2FA 5FX5A 2PGQB 2OXSA 1ELBA 1UVSH 1C1UH 1O34A 3RXEA 1FY8E 1FY5A 1GJ8B 1C1WH 1W0KD 3K6ZA 1TRNA 1HAPH 1NRSH 1CVWH 3OE7D 2KCPA 1K1JA 1SGPE 4JZEH 1ELFA 5A0CA 1E79D 1Y5UT 2SGQE 3E0NB 3PMAB 4MNXA 3MNXA 3F9HA 5F53A 2AIQA 3E6PH 1FMGA 3QWCH 1O37A 2ZFFH 4B6FA 3ODDA 5A0BA 1O2WA 2V7QD 4ZHLU 1BTXA 3Q3XA 1D3QB 1V2PT 1OS8A 3BEUA 4B6EA 2PKSB 2ZNKH 3BTGE 1GG6B 4DT4A 2OP9A 1QBOA 4WJG2 3VB7A 4JCNA 2BZAA 2P59A 1AKSA 1SFQB 4BOHA 4OGXA 4H6TA 3RC4A 2R0LA 5DG6A 4B2BA 2Z3DA 2AYWA 5EIYA 1KIGH 4NIWA 4TY6A 1NPMA 1DOJA 3UFAA 1QCPA 3PMHB 2ZPQA 4LZ4B 1EATA 2NU2E 1NBME 3NXPA 2QF3A 4Y8XA 1BBRH 3UNSA 5GWZA 2VIVA 7KMEH 4CRBA 1GHAF 1W8BH 1ELEE 4TT3D 4GHQA 1TGNA 1GJ6A 2AGEX 5GPIB 1DS2E 4J1YA 1IQJA 3EA9A 1OP2A 3PWCA 4XOJA 1VR1H 1F92A 2JETB 1TA6A 1YLCA 2ZO3H 1WUNH 5HIYA 3BTKE 3GCOA 1C5QA 1MH0A 3SGQE 1O3JA 1ARCA 2G5NA 1AY6H 1DDJA 3H7OA 4FU8A 4WH8A 1FN6A 1YLDA 3F0PA 4TWYA 5T3HA 4UDWH 1BTZA 3TJUA 1GBTA 4NG9H 3UQVA 4NIXA 1V2VT 4BAQB 3KNXA 3SNBA 3TH2H 5F8XA 1UTJA 3QO6A 1QTFA 2HNTF 1AVWA 1BMMH 2YNAA 4MVNA 4KKDA 1JRTA 1AN1E 4NCYA 1C5ZB 2WPLS 2TIOA 6GCHG 1H8IH 1CGJE 1ACBE 2LPRA 2BOKA 2OC8A 2CK3D 2THFB 1CE5A 4FETA 6LPRA 2ZQ2A 3O8DA 1FLEE 1DANH 4NZLA 1XM1A 1GI5A 1O5AB 1KDQA 1OXGA 5GDSH 1CT0E 3OU0A 3BTEE 4LK4A 3V3MA 1EOLA 1GBLA 4A92A 5A8ZA 2FDAA 1TGTA 2VB0A 3LH1A 1EZXC 1P3CA 2VIQA 3U28C 3QGJA 2QV1A 3FOAA 1Y5AT 2XCFA 1WYKA 3ZVFA 3OAAD 1AVGH 2FM2A 1QB9A 2UUKB 1A3EH 3V13A 3SNDA 2WUBA 3LT3A 2EI7A 4DURA 3DSGA 5DP9A 5DKMA 4AYVB 1BMNH 3EYDA 1C1SA 4X1SU 2VVVA 3OFND 1L4ZA 1QJ1B 3F3BA 1C2FA 2W3KA 2YOLA 3VB4A 4D7GA 4YT6H 2KCYA 1H8DH 1K22H 1O5DH 3MU5A 1NRQH 3QUMP 4WMFA 3UNQA 3KCGH 2FESH 2KCAA 2XNIA 3SHAH 1WQSA 1KXBA 1JRSA 1AQ7A 1QL9A 4OS2A 4FUJA 4MPWA 4YXWD 2XCNA 1PPZA 5BRRE 1SGEE 1DE7H 1TX8A 1CA8B 8GCHG 1TNJA 2OC7A 1YPKH 3N7EA 2EY4C 4ISNA 1UK3A 3GISB 3HGPA 2VGCB 4QT8C 1LKAA 1ZYOA 5C0TA 1ELVA 2H2ZA 3RDZA 3K6YA 2F43B 4GHTA 3DFLA 5DK1A 3SW2B 3ZZDA 1UCYH 3QZQA 2ALPA 2ZG0H 5JPMH 3LPRA 4I8JA 3S9AA 4AG2A 2ZU2A 2Y5FA 1J9CH 2XC4A 3G01A 4ZUHA 1IOEA 4D7FA 3TGKE 4JK5A 2J5UA 1PQ8A 2A0QB 1PPCE 1ID5H 1N1LA 1O2XA 1SGFG 2A5KA 1ZPZA 3GCHB 4INKA 3U8TH 3UIRA 1UTQA 1TE0A 3GCHC 1MU8B 5CE1A 2Z7FE 1MAYA 1O3CA 1QJ7B 3ATWA 2C8XB 2RG3A 1Z8JB 2BY5X 4FUBA 5EQQA 3RMOH 3MO3A 1O3KA 2BD7A 1LQEA 2IN2A 4JZ1A 1GVKB 1FQ3A 1JWTA 1AGJA 1TNLA 1THRH 6GCHF 2NU1E 1BTPA 5HXFA 5C1UA 3PV5A 3S7HB 3BIVH 2IPQX 1IQGA 2HLDD 3U9AH 4K3JA 2FEQH 1BITA 3MH6A 4E7RG 3PMJA 3GY2A 2RFKC 4CH8B 2P93A 2AMDA 1C1MA 1TNHA 3BEIB 3CENA 4K1SA 1WSSH 1NN6A 1C2JA 3SUGA 5A09A 1HAXB 3V7TA 2KAIA 3UTUH 3E16B 2JKHA 3F9FA 4OS7A 2HVYB 4MNYA 1C5YB 1F2SE 1DICA 3BTWE 3FP6E 3GY5A 1HAVB 4K1EA 3RMMH 1MTNC 4LXBH 1UTNA 2XXLA 1GBCA 1RFNA 1KSNA 1ELTA 4Z0KA 1BB0B 5EW1H 3BG4B 1GL1A 4E06H 5K7RA 3M3VA 4E7NA 1MTNB 1W7GH 1PJPA 1TGCA 1Z6EA 3GS9A 1P06A 3B23B 1GBJA 3RXVA 3PO1C 1OP0A 1Y3YA 3A7YA 3IWMA 1O2UA 2P8OB 3ITIA 1AU8A 1CT4E 1FY4A 2ZP0H 1TLDA 2Q6FA 3KQDA 2SGDE 2ZGHA 2PWXA 2Y82A 4X8UH 4AX9H 1B7XB 3MI4A 2WZQA 3ZZ6A 4FXGH 2F3CE 2A4RA 3LU9B 3BTTE 2OQ5A 1ZRKA 2Z3CA 3RLYH 2C4FH 2J34A 5J4QA 1O0DH 4H4FA 4ASUD 3VB6A 2DE8A 1V2NT 3MO9A 3ZVBA 1LPZB 1NZQH 5FCRA 2BDCA 1KY9A 3PTBA 1CT2E 2BX3A 1TPPA 2JH6D 2ZDMA 3SUEA 4ZKRU 3U1IB 1QL8A 1IQHA 4KTCA 1HYLA 3DA9B 1MKWH 3LGYA 3MO6A 1RTKA 5G4BA 1DWDH 4B74A 1LCYA 3P92A 3GDSA 1ABIH 3M3TA 1NFWA 2O8LA 1C2EA 1YPGH 1GBEA 1JIMA 1TPAE 2ZCLP 2CF9H 1XUJA 1TIOA 1NU9A 1GHAG 2FP7B 2BDHA 1O3LA 1V2ST 1V3XA 1GMHG 3N7OA 2OD3B 1S83A 4O3TA 1T8MA 4AG1A 4TPYA 1C2GA 3HGNA 2DUCA 3RXFA 1ESAA 1TYNA 3UUZA 1BOQA 1IHSH 1O2MA 1V2MT 1ZMLA 3TJOA 2EI6A 2F9UA 5TJXA 1SSXA 2F91A 1L1NA 1GVLA 3UOUA 3FFGA 1LPGB 1FPCH 1UO6A 2ZFRH 3UWIA 4NA7A 4NA8A 1GDUA 2Q6GA 3T28A 3RXOA 1GVZA 3RXUA 3MWIU 1A61H 1F0TA 4TSFD 5I46H 3CS7A 2UUYA 1NRPH 1AE5A 2BVRH 2KX4A 3FN8A 4MNWA 5L6NH 4BTUB 1QL7A 1P9UA 2WV9A 1GBHA 1Z8GA 1DM4B 1AWFH 1GJ4H 1YPJH 4X6PA 1C2HA 3MFJA 4X2WA 1QGFA 4F55A 1EPTB 2ZZUH 1LO6A 4NSYA 5LPFA 2ILNA 1V2OT 4FUDA 3B8JA 8GCHF 3P95A 2GMTB 2OBOA 1A5HA 2XWBI 3MH4A 2JJ1D 1Y3WA 3F68H 4GAWA 3AW0A 3QGNB 1Y5BT 2OK5A 1GJAB 4YOJA 1EAIA 4AORA 1ORFA 3E3TA 3LGVA 1GBIA 3KF2A 3TK9A 1TFXA 1GI6A 3PV2A 1ZSKA 2Z9IA 3E0PB 3H5CB 3MMGA 2Z9JA 3T27A 4X1NU 1AVXA 4TWWA 1LVOA 2BZ6H 5F03A 5C94A 4R8TB 1O3OA 2AH4X 1NFXA 1P04A 3D23A 1CU1A 4WXIA 4B73A 4NWLA 3I77A 3DSOA 3AK5A 3AW1A 1LVMA 2WPHS 1O3BA 1VGCB 4X8TH 4NFFA 3SJIA 1EOJA 3OEED 1UK2A 1Y59T 2WV4A 1GBFA 5EQSA 1T8LA 5LH8A 1WBGB 1AIXH 2VWOA 4JYUH 2A32A 3A8BA 3TNTA 5LPEA 2FOBA 2FOEA 1NROH 4NFEA 2F9NA 3SQHE 5DP3A 3NUMA 1P2MA 1GI9B 3F2GA 1A46H 4GCHG 5KECA 1ZSLA 3BSQA 2P3TB 3K2UA 2VIOA 3KQBA 2K1QA 4Y10E 4SGBE 1W11U 2J9NA 3SZNA 2H5CA 1GJ7B 4KELA 4BAKB 4KGAA 1B0EA 2GCHG 1YPHE 5ABWA 2BLWA 3KQ5A 1AUTC 3HK6B 2ZFQH 3MH7A 1AWHB 1AFQB 3N7DA 1FAKH 2IJOB 5SGAE 4FUCA 5C17A 1HV7A 2FYRA 1QBVH 4DW2U 1O3DA 3TJVA 3ZZCA 2ZHQH 5AVDA 2FIRH 1N8OB 1O3HA 1D3PB 2CHAC 1FI8A 3MH5A 4WMDA 1OYQA 1ZJDA 5C20A 2EI8A 3WWFA 4D9QA 1HCGA 2FTLE 3U8OH 3QX5H 4NGAH 5B6LA 4BAOB 2HGTH 1INCA 1LVYA 2ZA5A 3M7TA 3RM0H 3UNRA 2FX4A 5EXLA 4X2XA 4ZKSU 3NPSA 1VCWA 3TK6A 1ZZZA 3SI3H 1TONA 2M2AA 3RXQA 3RU4E 2R0KA 2OC0A 3LJJA 2OBQA 1JBUH 1MQ5A 1MZAA 1LDTT 1AD8H 1G32B 1PPBH 4NWKA 1C9TA 4U32A 2H1UA 1O30A 3VG8A 2VIWA 1F5KU 2ZU3A 1Z8RA 1PQAA 2A7JA 3SU0A 4BXWA 2ZIQH 4Y76A 2ALVA 2ZCKP 3FP7E 3GOVB 4FUHA 4FVBA 4B2CA 1N8OC 2OUAA 1ESTA 2A4GA 3GY8A 3RXLA 1S81A 1GMCG 2VIPA 2ZTZA 1AUJA 2GT7A 3EGKH 3ZZ7A 1W12U 1G3CA 3GCTF 1FX0B 1BRAA 1OWDA 1O5EH 5E0GA 1BMFD 4ABAA 1A1RA 2Z3EA 2CXVA 5FL7D 5EODA 2BOHB 4CHAC 4AGJA 1O2QA 2AHME 2RA0A 3MOCA 2QF0A 3MHWU 2A5AA 5F8TA 4FU7A 5E2OA 3SO3A 4CREA 1RS0A 2Y6TA 5GXPA 1HAVA 1DPOA 4I33A 5DP7A 2QAAA 2BD2A 3M7QA 1C5SA 1ESBA 1UCYE 2G8TA 3BTHE 4E05H 1ZPBA 2WPIS 4Y7BA 2YMSB 3RXTA 1LVBA 4Q4LA 4B76A 2O8MA 2J98A 3KQCA 1PFXC 1ZRBA 1AB9B 3ZV9A 1IQLA 3ZYDA 2GZ8A 4YOGA 4FU9A 4IMZA 3M5NA 3CP7A 3SJ9A 4XFQA 1VGCC 3RLWH 3LGIA 2BQ6B 5FPSA 4ABDA 3LGUA 1EXFA 3S9CA 2W6JD 1WQVH 1O2YA 1K1MA 1A5IA 1EKBB 5T1VA 4CRDA 2SNVA 5EU8A 2C3SA 2ODPA 1CHGA 1P2NA 1PPGE 3ODFA 1TA2A 1UTMA 3R3GB 4OM9A 4K60A 1WAYB 4ZKOU 3SU3A 6ESTA 1EZQA 4ZHMU 1EX3A 1BTYA 2Q6DA 1LQDB 3TIUA 4BXSA 3MU1A 3OTPA 2H5DA 4GPGA 1DSTA 1O2SA 5DP4A 3FVFB 4ZMAH 2D1JA 5E8EH 1T4UH 1D6RA 2G81E 3LOXA 1OHHD 2OTVA 3JZ1B 5C1YA 2FOAA 1XMNB 1JXPA 2C90B 2LELA 4UFDH 2W7UA 4RT0A 1E1QD 4XBDA 1FAXA 2VVCA 2KCOA 1P03A 4YOIA 2G00A 4KTUA 1MKWK 1RIWC 5L2ZH 1GI4A 4CRAA 5JBAS 3F6UH 5EW2H 1BCUH 4CRCA 1C1PA 1GBKA 2AMQA 1P02A 1W0ZU 5GNDA 3LDXH 4CRGA 1UVTH 3AVZA 1VKYA 1NU7B 1TNGA 5EXMA 1AKSB 2QY0B 2W7SA 3SV8A 1LHEH 4FOUC 1VJ9U 1N6XA 3U69H 1CA0C 1G3EA 3PROA 1CGIE 1N6YA 1SLVB 1NS3A 1O38A 1C2IA 3L6PA 1K1LA 2QXIA 2XBXA 1KLJH 2ZPSA 3ZYEA 1F5RA 1W7XH 1T32A 2QXGA 3VB5A 3E90B 2HVXA 2K0QA 1F0UA 5J4SA 2I6QA 5EPYA 3SUFA 1EJNA 4D9RA 4Y8ZA 1OP8A 2ZU4A 3SU6A 2KM0A 4JK6A 3BG8A 1S5SA 4I8GA 3I78A 3PB1E 1F0RA 2FS9A 4NIVA 4MNVA 3ZIAD 2WPJS 2B0FA 1TBQH 3RXPA 2AERH 3TK5A 3T29A 1LTOA 4WWYA 2EEKA 1SHHB 2BY8X 2YMSD 1ELDE 2AS9A 3QZRA 2J2UA 2QGRA 2C8WB 2Z6BD 3GICB 3SV6A 3U1JB 2FWWA 4AC9A 2K8IA 1O2ZA 2A31A 3F9GA 9LPRA 2BLOA 2ZDAH 2PLXA 2Y7XA 4AFUA 3E8LA 1FONA 2SGFE 3FKSD 1QRWA 1ZGVA 1VJAU 2PFEA 1IQNA 2VWMA 1NTPA 4HZHA 4M9FA 4O97A 1GMHF 1P9SA 3ZV8A 2ZEBA 2AFQB 3PO1B 1F7ZA 3ATKA 2ZWLH 2G52A 1PQ7A 1BRBE 2O9QA 2FZZA 1P2KA 3PLKA 1H9IE 1QB6A 3MYWA 1GBBA 2IJD1 1ZTJA 5F8ZA 1QZ8A 3RXGA 1DXWA 1UTLM 3IG6B 3A87A 3D65E 1T8OA 2BY9X 1ZR0A 4ZH8A 1VCQA 3A8AA 2P94A 2GVFA 3PWBA 4X1QU 3SUDA 4XBBA 1XKBC 7GCHF 3W95A 4HTCH 2HNTC 1HAOH 1YBWA 1SLXB 2R3YA 2WPDD 1UW7A 1SGDE 5JBBS 1SFIA 3O8RA 1GGDB 1ZHMA 1AZ8A 1IQFA 3SU1A 5HIZA 2QE7D 1RIWB 4DT7B 2CJIA 1TQ0B 3SJOA 2QXHA 2PKSC 2HWLB 4X1RU 2A2XH 4ZKNU 2ULLA 4AB9A 4RN6A 1TX7A 4BAMB 4K1TA 1HAYB 3KIDU 1P8VC 3OYPA 1GJDB 4FVDA 1KXEA 4HG6A 5L30H 2PGBB 2EQNA 3SYJA 1THPB 3S69A 2VVUA 1ZOMA 2GZ9A 8ESTE 3EDXB 1ZHPA 3ZVCA 2UWLA 1P09A 3M36A 5DPAA 1SPJA 1BHXF 3QDZB 4A1TA 1E0FD 2IPHA 2ZDVH 3RU4D 5FX6A 1Z1IA 2DE9A 2WSSD 2ZI2H 3TJNA 2Q1JA 1AZZA 1J17T 1UVPA 3SNEA 2JDID 3MU0A 5FBEA 3T62A 5LPRA 3AASA 1C1NA 5JBTA 2W26A 1OSSA 4X2VA 1OPHB 3SGBE 5DJ7A 2EA3A 5A8YA 7LPRA 2ZDKA 4CBOA 5KEDA 1P57B 1TBRH 2VGCC 2ZU5A 5GCHG 1SGIB 1ZJKA 1CA0B 1O5GH 1DY8A 1OWHA 1FN8A 3AAUA 3VGCB 5F6MA 1RD3B 6CHAB 5EQRA 1SGRE 1V2LT 5CHAC 2AMPA 1YPHC 1XUIA 1EB1H 1SG8B 1TOMH 2CF8H 1O2KA 1KXFA 2ZGJA 1HDTH 3PLBA 4K8BA 2ODQA 2ZGCA 3U8RH 1YM0A 1COWD 3SJ8A 4DCDA 1J16A 4P00A 4K8YA 3NKKA 2QF5A 1K2I1 1RTFB 4D8NA 4OGYA 1GI0A 2FMJA 3RXSA 4AFQA 5EJZA 5EXNA 1SVPA 2Z9GA 4MDSA 3SOSA 1C4U2 2UWOA 5C1XA 2RA3A 1V2WT 2CGAA 1O35A 2FO9A 7ESTE 5AFYH 2BM2A 3GY4A 1PYTD 1CQQA 4ZHAA 3ZZ9A 1NFYA 1EPTC 1TAWA 1VITH 2BDAA 3EA7A 4IGDA 2WHXA 3Q00A 1TMBH 3P8GA 2GV7A 1TX6A 1THSH 2WYJA 3SORA 1UCYK 3WY8A 3BV9B 5E0HA 3SQEE 1O3NA 3LONA 4Y11E 1LHFH 2SFAA 4NSVA 5DN6D 4IC6A 2WPMS 7GCHG 3RUOA 4KP0A 4MPVA 1YPLH 5IK2D 1O33A 3WW7A 1D9IA 1ANDA 4X6OA 3K9XB 1VITG 2TRMA 1MBQA 4ABIA 4AYYB 2B7DH 3D49H 2R2MB 2VWNA 1H4WA 4VGCC 1XXFA 1V2TT 5E2PA 4Q2KA 5C3NA 2ZHEH 3SV7A 1G9IE 5T6DA 1YCPM 1TB6H 5AF9H 2F4LA 2VU8E 1GCTB 1QBNA 1E36B 3IITA 2NWNA 1GJ5H 1CBWC 2FX6A 5TCAA 2NU3E 2Z9KA 1QIXB 4MQAA 4R0IA 1YCPK 2BXUH 1FIWA 3DUXH 5IYTA 1AI8H 3E91A 1RTLA 5I25A 1HPGA 3KQEA 1ARBA 1OWIA 2XC5A 4RI0A 2FLBH 4ABGA 5DGJA 1SB1H 1XUGA 5FXLA 4IW4E 2A1DB 3QLPH 3DT0H 1O5CB 4RKOB 5GCHF 1AB9C 3A80A 1G2LA 1GI7B 1MKXK 1ETSH 4Q7XA 3RXHA 4BTIB 1OX1A 4Z1MD 1W0YH 2C8ZB 3A82A 1S85A 1S84A 1C1QA 2F9OA 2OINA 1EJMA 2TPIZ 2ASUB 4LZ1H 5HKKD 1M9UA 5EJ1A 1W3CA 1XKAC 3QN7A 1E1RD 2FOCA 4YLUA 3K65B 1GHWH 2ZF0H 4WXVA 4J2YB 2WUCA 5FPYA 4CHAB 1WCZA 5T6FA 2FPZA 1IQIA 1SOTA 1LMWB 4JZIA 3LC5A 4WMEA 3BTDE 4FUEA 3NZIA 3EA8A 3A7VA 1P0SH 3A7WA 1HGTH 3GCTG 1T31A 2J92A 3SNAA 2ZHFH 2LP6A 3GCNA 3M5MA 1S6FA 4XRNA 1FJSA 4CR5A 2H9TH 5FPTA 3ATIA 1HJ9A 3TITA 2C93B 1MCVA 1GI2A 2UUJB 4O9VA 3L3TA 1C5UA 1UJ1A 4BNRA 2ANYA 2Y81A 4WH6A 2GCHF 1NC6A 5T6GA 4X2YA 4PROA 2R2WU 1O36A 1TQ7B 2WINI 1C4V2 5E0JA 1GWAA 1O2JA 1SLWB 2FODA 1PQ5A 1HXFH 1CHOG 1O2RA 2GKVE 1ANBA 4ZCNA 5L2YH 5FAHA 1GI3A 1ZTKA 1T4VH 3RXRA 3RM2H 1O5FH 2BD9A 1SQOA 3VGCC 3T2NA 5IDKA 4XDEA 1KXCA 1IAUA 3ENSB 1FDPA 2XC0A 2ANWA 1TOCB 1L1GA 1MCTA 3VXEH 1K1PA 4ISOA 3RXBA 4ZXYH 3GY6A 3BTME 3FAOA 3HPTB 1C5VA 5DP8A 5ETXA 1YF4A 1ELGA 5EGMA 1C5LH 2V35A 1WV7H 4F4OC 1EP5A 1OWKA 1SBWA 1K9OE 1E37B 1O2PA 1U6QA 2BDGA 2J4IA 3UREA 2PKAB 3BTFE 3M7UA 1HJAB 1Z8IB 1JMOH 4DOQA 3P8NA 2PSXA 4NA9H 2A7CA 3PRDA 2QA9E 1GDNA 1EZUC 5HMAA 2VIDA 2QXJA 1SR5C 3T25A 3M37A 1RGQA 3OEHD 1DY9A 2BLQA 4OS1A 1V2JT 8LPRA 1A2CH 3A81A 3A88A 1Z1JA 2FYQA 3SN8A 1SGCA 3KGPA 1C2DA 2I6SA 1GHYH 4SGAE 1C5TA 3TH3H 3UWJH 3F2HA 1RXPA 4UE7H 5HM2A 1G30B 2BLVA 1HIAB 1P3EA 2FI3E 3GDVA 1HAHH 1MBMA 2BY7X 5A2MH 2SGAA 3E1XB 1QNJA 3KN2A 4XBCA 4M7GA 4NIYA 1UK4A 2XBYA 2ZTXA 4RSPA 3KEEA 5FBIA 3P8OA 1GGDC 3TGIE 3P6ZB 1HAZB 2ZPRA 1LPKB 3SU5A 5EPNA 3BIUH 3H7TA 1IQKA 1CSOE 1DUAA 2ZFPH 1K1NA 1GBAA 5FHTA 2FLRH 4GLYA 4I8HA 4CH2B 1C4Y2 2UWPA 1RJXB 1OWJA 2W6ID 4ISIH 2P95A 2QCYA 1HIAA 1YWUA 3RXKA 4INHA 3BF6H 1TNIA 2P3FH 1IQEA 2R9PA 2WYGA 4WF8A 2Z94A 4U30A 5CHBA 1ETTH 3V0XA 1C5XB 4Q63A 3JZ2B 5EG4A 1EPTA 4ISHH 1D4PB 3OY5U 1HAIH 3VXFH 3HKIB 2D8WA 1O5BB 1YKTA 2CHAB 1FIZA 3F0OA 4TY7A 1A0LA 1EAXA 3STJA 1CHOF 1IHTH 1HB0B 4UEHH 3UAIC 1ZMJA 1C1TA 4X0WU 5TCCA 3SJKA 1GHZA 3SV2H 1GMCF 1EP6A 1L0ZA 3FANA 5JB9S 4IN1A 1DFPA 3A8DA 3SV9A 2TGDA 4H42U 1TBZH 2STAE 4OS6A 3ZZ4A 3SI4H 9ESTA 3BN9A 5A8XA 5GJ4B 1YPMH 1SGNE 1ZTLA 5B6OA 2AIPA 1MQ6A 2SGEE 1C2MA 3OX7U 2STBE 2TBSA 5GIBA 5DP5A 1Y3VA 2GZ7A 4A1XA 2A7HA 2OCVB 1KTTB 1G36A 5JYIA 4DIHH 1YY3A 2F9VA 3CNRA 4XE4A 4U01A 1PPHE 4JYTA 4YTAA 2V3HH 1S6HA 4OS4A 3ZVDA 4AOQA 1SLUB 4ABEA 4BAHB 2XBWA 3OTJE 1BMAA 4K5ZA 1QHRB 2P8OC 2TGAA 3HKJB 1TNKA 2Y5HA 3I29A 1SOZA 2F83A 1E35B 3A85A 3B9FH 1Y3UA 4FUIA 5K0HA 1QR3E 2V0BA 2OQUA 2PTNA 1P2JA 1SI5H 4UFGH 2EC9H 4YO9A 4ASHA 1NY22 2HLCA 3TLOA 4F49A 1BIOA 1HXEH 2HOBA 4B75A 1FNIA 3MU8A 1BTHH 2ZKSA 3A84A 3CS0A 1QRZA 1BBRK 4I8KA 3V12A 3MNBA 4JMYA 4B71A 1P2OA 2FXRA 4GCHF 4ISLA 3D62A 4X8SH 1BJUA 1Y8TA 1GI1A 2NU4E 2BD4A 2B8OH 3Q76A 1ANCA 5A0AE 1FUJA 1O3EA 2VNTA 4INLA 1AMHA 3PLPA 2BQWB 3GYLB 1O2OA 2LNCA 1DT2A 2VJ1A 1A5GH 1MKXH 3ATMA 3RXCA 3UR6A 1DWEH 2ZFSA 1W10U 1O2GH 1RRKA 2XWAA 3ZZBA 2J97A 3A8CA 3RC5A 5C0UA 4Q7ZA 1Z71A 1WOFA 3R0FA 1ELAA 3RXIA 2ZQ1A 1TALA 1MAXA 3LH3A 2BDIA 3DSPA 1TWXB
chains in the Genus database with same CATH topology
3T26A 1TPOA 1TPSA 2RCEA 3Q3YA 4X8VH 2WV5A 1C1VH 2BD8A 3VEQB 3A7TA 2XYAA 3ZVAA 1P12E 4TPIZ 1MD8A 4CRFA 3LIWA 1OYTH 1T8NA 1LHDH 1EAWA 1L2EA 2IOTA 2PW8H 2GT8A 1O3FA 1XVMA 2GV6A 1O3GA 1O2NA 1FY1A 1WU1A 2FOGA 3UR9A 2H6MA 1ZHRA 1SGQE 2ZCHP 4ZROA 2PV9B 2BMGB 1C2LA 1V2UT 2O8WA 3FP8E 3QTOH 4YESB 3FZZA 1ABJH 1GCTC 2Z9LA 3T5FH 2BY6X 2PKAA 3P8FA 3TNSA 5AFZH 2G4UA 4O03A 4UFFH 4ZXXH 1TRYA 1GDQA 1UMAH 2CN0H 4MG3A 1Q3XA 1K1IA 1G3BA 4YZUA 1MMJN 1DX5M 3PTNA 1H1BA 3RP2A 1DXPA 2NU0E 1SGYE 4DG4A 4YT7H 1UTKA 3ZZ8A 1BHXB 1HLTH 3UPEA 2JH5D 3NCLA 1PPEE 1YP9A 4H6SB 4Y0YE 1ELCA 1GPZA 4ABJA 1HFDA 2ANKH 4JYVH 3A7XA 4ABBA 1C9PA 1HNEE 4X6MA 4X6NA 1MTWA 1HJ8A 1E34B 1K21H 2FI4E 4IBLH 2ODYB 4I7YH 3Q3KA 1O39A 2FI5E 3EAJA 1NO9H 1D3DB 2F9PA 2BXTH 3BG4C 3AAVA 1EQ9A 2R3UA 1W13U 4ESTE 1DWCH 5JDUB 3URCA 4DIIH 1C5MD 3RXMA 4YLQH 3ZZ3A 1D6WA 3ATLA 1O2IA 1AHTH 8KME2 2Y80A 4K69A 1C5OH 1GHBF 2HPQH 3RMLH 4Q80A 3A89A 1QQ4A 3HK3B 5CHAB 1W14U 1G2MA 2VH6A 1BRUP 3M61U 1MD7A 2A4OA 1MUEB 3M5LA 4A1VA 1HUTH 2FS8A 2O8UA 3MNCA 1CO7E 3NK8A 3EE0B 4B1TA 2XW9A 4Q7YA 2ZDLA 1VCPA 2ZGBH 4UFEH 2A5IA 2GCTC 1QA0A 4U2WA 4UD9H 4MTBA 3SBKA 2XTTB 4KTSA 2KAIB 4NZQA 2PHBA 5HGGA 1ETRH 1AFEH 1O2TA 1TMTH 2QC2A 1GMDF 1ZGIA 1KYNA 2W3IA 2UUFB 1EASA 4OS5A 3HATH 4RKJB 1O2VA 2BX4A 1BA8B 4CR9A 1P2IA 3DD2H 1NFUA 1KTSB 2ZDNA 4YM9A 3F1SB 4A5TS 1AFQC 1QA7A 1KLTA 1BT7A 1ANEA 2VINA 3PYHA 1A0JA 2JETC 4AGKA 4Y8YA 2ZC9H 1SGTA 2G4TA 1WTHD 3RU4T 4HGCA 2BDYA 1J8AA 1DUEA 1UHBB 2ZTYA 3MNSA 2GDEH 4WVPE 3STIA 2RDLA 2QN5T 6CHAC 1BJVA 1WTGH 1V2KT 3S7KB 1C5WB 2GTBA 4THNH 4I32A 4IN2A 1GCDA 2BD5A 1BZXE 1BTUA 1GJ9B 2ZFTA 1BUIA 1KXAA 1H9LB 2QIQA 1OOKB 2M5TA 1EAUA 4MPXA 1S0QA 2D26C 1P10A 2FOHA 4IS5A 2P3UB 1B0FA 1J15A 1BRCE 3W94A 2FOMB 2CMYA 4GUXA 5C5OA 2O8TA 4WY3A 4Y7AA 3VB3A 4IC5A 5AHGH 4Y0ZE 2A4QA 2A2QH 1F0SA 1S0RA 1J14A 2BYAX 3Q77A 1GG6C 1T7CA 1C2KA 3S9BA 4Y71A 1C5PA 1YGCH 3UQOA 1G37A 2H9EH 1B5GH 1C5RA 1NM6A 1XVOA 1GBMA 2AEIH 2SNWA 3SGAE 3RC6A 5PTPA 1SQTA 1SHYA 2PTCE 3PMBB 4MPUA 4AZ2B 4A7IB 3PM3A 1GHVH 1H9HE 1O3AA 1DWBH 2BB4A 2PR3A 2XBVA 1P11E 3ZZAA 4JZDH 5EOKA 1P2QA 1HBTH 2Y7ZA 1MU6B 2ZGXH 1GHBG 1UTOA 1W2KH 4TYDA 4UONA 3UOPA 2BVXH 2BHGA 5JB8S 2BD3A 2BDBA 3GY7A 1OKXA 1VZQH 3S0NA 1FY3A 1ZPCA 1UTPA 1SMFE 3F9EA 4ABFA 2ZHWH 1SL3A 3OSYA 3M3SA 4ZAEA 5DP6A 4A6LA 1GI8B 1LHCH 1MTSA 2HALA 5C5NA 1K28D 1PYTC 1HAGE 3DFJA 1XUKA 1QQUA 1QB1A 5DO4H 1OWEA 1O3IA 1QJ6B 2V3OH 1GMDG 1C5NH 1O31A 2GD4B 4FUFA 5JBCS 1TGBA 2TGTA 4BTTB 1SQAA 1E38B 1V6DA 2A45B 3TVJB 1XUFA 3SNCA 1S82A 2HRVA 5CMXH 1VITF 2YNBA 4JZFH 1NRNH 1CBWB 1TGSZ 5C67A 2BTCE 3C1KA 3RMNH 1DLEA 1A0HB 4LOYH 5BPEA 1KXDA 1HJAC 1GJCB 2G55A 1Y3XA 2ZHDA 3ZZ5A 3MU4A 3EQ0H 2F9BH 3VFEA 1LKBA 1BBRE 2VWLA 2GCTB 1O2HA 3GDUA 1BMLA 5C2ZA 1ZLRA 3BEFB 1FV9A 3M35A 3LGTA 4AB8A 2B9LA 4GVUA 1XXDA 3A7ZA 2HNTE 3L33A 2ANMH 4ABHA 1JOUB 3RXAA 1Z7KA 2QYIA 1A4WH 1FPHH 3MTYA 4AFZA 3LKWA 3ESTA 1NESE 1SC8U 1JIRA 2OC1A 2TGPZ 4Y79A 1BQYA 3O8CA 3LJOA 1Q2WA 4DJZB 1X7AC 4HI3A 2C8YB 1EZSC 3RXJA 2OLGA 1A3BH 1FXYA 1UVUH 1SGFA 2HPPH 3ZVGA 4DVAU 2J94A 2GP9B 4DGJA 1O32A 1YYY1 3M5OA 1O3PB 3QK1A 3SU2A 3TPIZ 1EB2A 1DITH 1A7SA 1MTVA 1FZZA 1AE8H 2AGGX 3RXDA 1IQMA 1K1OA 3QTVH 1CGHA 1V2RT 2AGIX 4CBNA 1YPEH 1TMUH 3VPKA 3C27B 4DY7B 2GX4A 1TABE 1QFKH 2P16A 4O3UA 1BTWA 1YC0A 3ELAH 3TH4H 1Z6JH 2GMTC 1QURH 1UHBA 1KDQB 1XUHA 2BQ7B 1C1OA 1ZSJA 3A86A 3DHKH 4BANB 3KL6A 3LC3A 3TU7H 1Q31A 1EUFA 2SGPE 1HRTH 1NRRH 1D3TB 2PUQH 4MLFB 5LGOA 2PSYA 4B2AA 2WPKS 4X1PU 1EJAA 3URDA 1BDAA 1PPFE 2ESTE 5ESTE 4I8LA 1XX9A 4Z6AH 1MZDA 3NWUA 1QRXA 1YCPH 4IMQA 4XSKU 1QY6A 3U98H 3UY9A 1DSUA 2V6NA 2XRCA 1DVAH 2G51A 4D76A 3SU4A 2CV3A 1MTUA 3GY3A 2Y5GA 2FOFA 3P70B 2GGVB 2W5EA 1LHGH 3KHVA 4HFPB 3ZVEA 1GL0E 5H4IB 4FUGA 1O3MA 2JH0D 1GBDA 3O8BA 5HM9A 1P05A 4I31A 4VGCB 1DLKB 1L1JA 1C1RA 1NT1A 2FTMA 1KLIH 3FZDA 1GJBB 1V2QT 1ZMNA 3OY6U 3TGJE 2G5VA 2ZU1A 3SHCH 4Y6DA 4AN7A 2J38A 5FCKA 4GSOA 5HYOA 1P01A 2VH0A 2ZECA 1G3DA 2D2DA 2PUXB 3A83A 3P17H 1AO5A 2B5TB 2H9HA 3BTQE 1GHXH 2GDDA 2BVSH 1F5LA 2J95A 4AFSA 5ESBA 1TRMA 3LGWA 4K2YA 3GYMA 3PV4A 1L4DA 1O2LA 1UVOA 5FX5A 2PGQB 2OXSA 1ELBA 1UVSH 1C1UH 1O34A 3RXEA 1FY8E 1FY5A 1GJ8B 1C1WH 3K6ZA 1TRNA 1HAPH 1NRSH 1CVWH 1K1JA 1SGPE 4JZEH 1ELFA 5A0CA 1Y5UT 2SGQE 3E0NB 3PMAB 4MNXA 3MNXA 3F9HA 2AIQA 3E6PH 1FMGA 3QWCH 1O37A 2ZFFH 3ODDA 5A0BA 1O2WA 4ZHLU 1BTXA 3Q3XA 1D3QB 1V2PT 1OS8A 3BEUA 2PKSB 2ZNKH 3BTGE 1GG6B 2OP9A 1QBOA 4WJG2 3VB7A 4JCNA 2BZAA 2P59A 1AKSA 1SFQB 4BOHA 4OGXA 4H6TA 3RC4A 2R0LA 5DG6A 4B2BA 2Z3DA 2AYWA 1KIGH 4NIWA 4TY6A 1NPMA 1DOJA 3UFAA 1QCPA 3PMHB 2ZPQA 4LZ4B 1EATA 2NU2E 3NXPA 2QF3A 4Y8XA 1BBRH 3UNSA 5GWZA 2VIVA 7KMEH 4CRBA 1GHAF 1W8BH 1ELEE 4GHQA 1TGNA 1GJ6A 2AGEX 5GPIB 1DS2E 4J1YA 1IQJA 3EA9A 1OP2A 3PWCA 4XOJA 1VR1H 1F92A 2JETB 1TA6A 1YLCA 2ZO3H 1WUNH 3BTKE 3GCOA 1C5QA 1MH0A 3SGQE 1O3JA 1ARCA 2G5NA 1AY6H 1DDJA 3H7OA 4FU8A 4WH8A 1FN6A 1YLDA 4TWYA 5T3HA 4UDWH 1BTZA 3TJUA 1GBTA 4NG9H 3UQVA 4NIXA 1V2VT 4BAQB 3KNXA 3SNBA 3TH2H 5F8XA 1UTJA 3QO6A 1QTFA 2HNTF 1AVWA 1BMMH 2YNAA 4MVNA 4KKDA 1JRTA 1AN1E 4NCYA 1C5ZB 2WPLS 2TIOA 6GCHG 1H8IH 1CGJE 1ACBE 2LPRA 2BOKA 2OC8A 2THFB 1CE5A 6LPRA 2ZQ2A 3O8DA 1FLEE 1DANH 4NZLA 1XM1A 1GI5A 1O5AB 1KDQA 1OXGA 5GDSH 1CT0E 3OU0A 3BTEE 4LK4A 3V3MA 1EOLA 1GBLA 4A92A 5A8ZA 2FDAA 1TGTA 2VB0A 3LH1A 1EZXC 1P3CA 2VIQA 3QGJA 2QV1A 1Y5AT 2XCFA 1WYKA 3ZVFA 1AVGH 2FM2A 1QB9A 2UUKB 1A3EH 3V13A 3SNDA 2WUBA 3LT3A 2EI7A 4DURA 5DP9A 5DKMA 4AYVB 1BMNH 3EYDA 1C1SA 4X1SU 2VVVA 1L4ZA 1QJ1B 1C2FA 2W3KA 2YOLA 3VB4A 4D7GA 4YT6H 1H8DH 1K22H 1O5DH 3MU5A 1NRQH 3QUMP 4WMFA 3UNQA 3KCGH 2FESH 2XNIA 3SHAH 1WQSA 1KXBA 1JRSA 1AQ7A 1QL9A 4OS2A 4FUJA 4MPWA 2XCNA 1PPZA 5BRRE 1SGEE 1DE7H 1TX8A 1CA8B 8GCHG 1TNJA 2OC7A 1YPKH 4ISNA 1UK3A 3GISB 3HGPA 2VGCB 4QT8C 1LKAA 1ZYOA 1ELVA 2H2ZA 3RDZA 3K6YA 4GHTA 3DFLA 5DK1A 3SW2B 3ZZDA 1UCYH 3QZQA 2ALPA 2ZG0H 5JPMH 3LPRA 4I8JA 3S9AA 4AG2A 2ZU2A 2Y5FA 1J9CH 2XC4A 3G01A 4ZUHA 1IOEA 4D7FA 3TGKE 4JK5A 1PQ8A 2A0QB 1PPCE 1ID5H 1N1LA 1O2XA 1SGFG 2A5KA 1ZPZA 3GCHB 4INKA 3U8TH 3UIRA 1UTQA 1TE0A 3GCHC 1MU8B 5CE1A 2Z7FE 1MAYA 1O3CA 1QJ7B 3ATWA 2C8XB 2RG3A 1Z8JB 2BY5X 4FUBA 5EQQA 3RMOH 3MO3A 1O3KA 2BD7A 1LQEA 2IN2A 4JZ1A 1GVKB 1FQ3A 1JWTA 1AGJA 1TNLA 1THRH 6GCHF 2NU1E 1BTPA 5HXFA 5C1UA 3S7HB 3BIVH 1IQGA 3U9AH 4K3JA 2FEQH 1BITA 3MH6A 4E7RG 3PMJA 3GY2A 4CH8B 2P93A 2AMDA 1C1MA 1TNHA 3BEIB 3CENA 4K1SA 1WSSH 1NN6A 1C2JA 3SUGA 5A09A 1HAXB 3V7TA 2KAIA 3UTUH 3E16B 2JKHA 3F9FA 4OS7A 4MNYA 1C5YB 1F2SE 1DICA 3BTWE 3FP6E 3GY5A 1HAVB 4K1EA 3RMMH 1MTNC 4LXBH 1UTNA 2XXLA 1GBCA 1RFNA 1KSNA 1ELTA 4Z0KA 1BB0B 5EW1H 3BG4B 1GL1A 4E06H 5K7RA 3M3VA 4E7NA 1MTNB 1W7GH 1PJPA 1TGCA 1Z6EA 1P06A 3B23B 1GBJA 3RXVA 3PO1C 1OP0A 1Y3YA 3A7YA 3IWMA 1O2UA 2P8OB 3ITIA 1AU8A 1CT4E 1FY4A 2ZP0H 1TLDA 2Q6FA 3KQDA 2SGDE 2ZGHA 2PWXA 2Y82A 4X8UH 4AX9H 1B7XB 3MI4A 3ZZ6A 4FXGH 2F3CE 2A4RA 3LU9B 3BTTE 2OQ5A 1ZRKA 2Z3CA 3RLYH 2C4FH 2J34A 5J4QA 1O0DH 4H4FA 3VB6A 2DE8A 1V2NT 3MO9A 3ZVBA 1LPZB 1NZQH 5FCRA 2BDCA 1KY9A 3PTBA 1CT2E 2BX3A 1TPPA 2JH6D 2ZDMA 3SUEA 4ZKRU 3U1IB 1QL8A 1IQHA 4KTCA 1HYLA 3DA9B 1MKWH 3LGYA 3MO6A 1RTKA 5G4BA 1DWDH 4B74A 1LCYA 3P92A 3GDSA 1ABIH 3M3TA 1NFWA 2O8LA 1C2EA 1YPGH 1GBEA 1JIMA 1TPAE 2ZCLP 2CF9H 1XUJA 1TIOA 1NU9A 1GHAG 2FP7B 2BDHA 1O3LA 1V2ST 1V3XA 1GMHG 3N7OA 2OD3B 1S83A 4O3TA 1T8MA 4AG1A 4TPYA 1C2GA 3HGNA 2DUCA 3RXFA 1ESAA 1TYNA 3UUZA 1BOQA 1IHSH 1O2MA 1V2MT 1ZMLA 3TJOA 2EI6A 2F9UA 5TJXA 1SSXA 2F91A 1L1NA 1GVLA 3UOUA 3FFGA 1LPGB 1FPCH 1UO6A 2ZFRH 3UWIA 4NA7A 4NA8A 1GDUA 2Q6GA 3T28A 3RXOA 1GVZA 3RXUA 3MWIU 1A61H 1F0TA 5I46H 3CS7A 2UUYA 1NRPH 1AE5A 2BVRH 4MNWA 5L6NH 4BTUB 1QL7A 1P9UA 1GBHA 1Z8GA 1DM4B 1AWFH 1GJ4H 1YPJH 4X6PA 1C2HA 3MFJA 4X2WA 1QGFA 1EPTB 2ZZUH 1LO6A 4NSYA 5LPFA 2ILNA 1V2OT 4FUDA 3B8JA 8GCHF 3P95A 2GMTB 2OBOA 1A5HA 2XWBI 3MH4A 1Y3WA 3F68H 4GAWA 3AW0A 3QGNB 1Y5BT 1GJAB 4YOJA 1EAIA 4AORA 1ORFA 3E3TA 3LGVA 1GBIA 3KF2A 3TK9A 1TFXA 1GI6A 1ZSKA 2Z9IA