7ESTE

Interaction of the peptide cf3-leu-ala-nh-c6h4-cf3(tfla) with porcine pancreatic elastase. x-ray studies at 1.8 angstroms
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELASTASE
publication title Interaction of the peptide CF3-Leu-Ala-NH-C6H4-CF3 (TFLA) with porcine pancreatic elastase. X-ray studies at 1.8 A.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1990-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 7estE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 7estE01
3MNCA 2BDBA 1YPMH 1EX3A 1GCDA 3KGPA 2FX6A 3GY8A 3MU5A 2CHAC 2VJ1A 4X6PA 1GMDG 1W0ZU 1ZJDA 4UFFH 5C1YA 1SG8B 1FUJA 2Y5GA 1A3BH 3FAOA 2BM2A 4IC6A 1FQ3A 1TBZH 3A80A 1SMFE 1GMCF 1MAXA 4Y0YE 1ZOMA 1V3XA 2ILNA 2VWMA 2WYGA 1EJMA 1KXAA 4AOQA 3BV9B 4ISOA 3F6UH 1L4DA 1ELDE 1V2TT 2XC4A 2Y7XA 1Y3WA 1VITG 3LH3A 1GI8B 1PPFE 1Y3YA 4NIYA 2FESH 4Y76A 4D76A 1AE8H 4JMYA 5CMXH 2GMTC 1F0UA 1V2QT 2ZPSA 1G3CA 3ZYEA 3SUFA 1KLJH 2H9HA 2ZCHP 3RXAA 1EPTB 2K1QA 3BEUA 2WV5A 3BG4B 1O3NA 1AE5A 1FY4A 3MNSA 4PROA 1FPHH 1NFUA 4FU8A 2BD5A 4H6SB 2J95A 2QXJA 4YT6H 2C8ZB 1GDQA 1HAIH 1QJ7B 1YPKH 3UWIA 1S5SA 1MKWK 5J4SA 2HVXA 1C5LH 1HAXB 4B75A 1CE5A 1QB6A 3BSQA 3K2UA 2AEIH 3TNTA 1TMBH 1UK2A 3QTVH 3RMMH 1ANCA 1LHDH 3RXDA 1IAUA 2Q6DA 1AI8H 1TBRH 1N6YA 1WSSH 3LC3A 1AZZA 2P94A 4BAMB 4B73A 1YPHE 1QGFA 2RG3A 2XCFA 2GV6A 2D2DA 3E0NB 2ZPRA 4BANB 2VIPA 2BY5X 4IN1A 1MKWH 4MPVA 2HOBA 3R0FA 1W2KH 3TITA 2BDAA 1RFNA 2HPPH 4X2VA 1NC6A 2OLGA 1HAYB 2OCVB 3P17H 4SGAE 2AYWA 2TGDA 2Q6FA 2FTMA 1GWAA 2PUXB 4IGDA 2NU0E 4LXBH 4CRDA 2H2ZA 3FZZA 4CREA 2A4OA 2GKVE 3DHKH 3NKKA 1P03A 2AIQA 2ZQ1A 3SGQE 2HWLB 6CHAB 1NM6A 1T32A 2NU3E 4X1QU 2DE8A 1HUTH 8ESTE 1C1MA 2OXSA 3V12A 3SGBE 2FLBH 4F4OC 4JYVH 1C5YB 3RM0H 2EA3A 4AB8A 3A7YA 2FOEA 1GHYH 1TA2A 4KTUA 1YYY1 1WTHD 2WINI 1INCA 3VB3A 2NU4E 4FUCA 4XBCA 4MDSA 1TGSZ 2FOBA 3KQDA 4UONA 5LPRA 3URCA 2OBOA 3JZ2B 4X6OA 1O3PB 1FY1A 1IQIA 2ZZUH 2OINA 1OSSA 3E90B 2XNIA 2Z94A 2PWXA 1GI2A 1HYLA 3R3GB 3SHCH 1ZSKA 1FPCH 5FPSA 3PMBB 2DUCA 1W3CA 4YLQH 1KLIH 4NFFA 1GI3A 3TU7H 3LJJA 4HZHA 3BF6H 3QO6A 2FI5E 1K1IA 2I6SA 1EZXC 1DFPA 1JRTA 4FUJA 1TIOA 1CU1A 1FLEE 3BIUH 1OP8A 1K1OA 1QTFA 2AERH 2BVSH 3T25A 4R0IA 4FUBA 1G3DA 2CMYA 3ATKA 4X2XA 1QQ4A 3MWIU 2VNTA 4UFGH 4D8NA 2A5AA 2TBSA 1SL3A 4O3UA 1BMAA 4BAHB 3SZNA 1Z6JH 5L30H 2G5NA 1W0YH 3SJIA 1EQ9A 3L3TA 2ZKSA 4WMEA 3SNDA 4ESTE 2R9PA 1CT2E 1O2HA 5FBIA 2J2UA 4DJZB 1TRYA 1SGIB 1GI5A 1CHOF 3PLPA 1A61H 5F03A 1GI9B 3VEQB 1HIAA 3BTQE 3OSYA 2ZECA 2ANKH 4O03A 1PQAA 4F49A 3K9XB 4UD9H 3UPEA 3OYPA 3B8JA 3HK6B 3ZVDA 2OC1A 3STJA 3AW0A 1YPHC 3FP8E 2F9VA 3MH4A 3ITIA 2GT7A 1S6FA 7GCHF 1HFDA 2VIVA 2FOGA 3O8DA 3RXKA 4BAOB 1SLVB 1IQGA 3MH7A 1FONA 1Y5BT 1GJAB 3M5NA 1MH0A 2BQ6B 2GCTC 3V7TA 1A7SA 1TNLA 4IN2A 1TQ0B 3KQEA 4NIWA 1BBRK 3P70B 2WV4A 3GY5A 2A0QB 1ESBA 2UUFB 4BAKB 1UVUH 2GMTB 1DY9A 1J17T 1SGPE 4CRAA 1T4UH 4TY7A 2UWPA 3F9HA 3ATIA 3Q3KA 4RN6A 4IS5A 2ZHEH 1TABE 3I77A 2CV3A 1F5KU 2BXTH 1RIWC 1ETRH 3MMGA 3PV4A 3PO1B 3PLKA 2J38A 3S9AA 1MMJN 3AASA 1A46H 1TOMH 3A7WA 5FXLA 1O5BB 1UCYE 4I8GA 4FUIA 2W7SA 3RC4A 1TOCB 4ZAEA 3U8OH 2FP7B 2VVVA 2B9LA 3RXCA 1ETSH 1MU6B 1SPJA 2V3OH 1GJ4H 1GMDF 1VJ9U 1EOLA 4JYTA 2Z9LA 1EUFA 2J92A 3PYHA 2DE9A 3FFGA 2VH0A 4YT7H 1XVMA 4X2WA 4A7IB 4VGCB 1SLXB 3ZZDA 2M5TA 1EP6A 4YESB 3DD2H 1SC8U 1TRNA 1F5LA 3BTEE 3RU4T 3P8NA 1LQEA 2SGAA 4K2YA 5GDSH 1VITF 2I6QA 3T29A 1K2I1 4U01A 5A2MH 2QV1A 1TNJA 1FXYA 1S82A 3KN2A 1GJ9B 3SUEA 1HBTH 3ZVAA 1TNGA 5HM9A 2ZDVH 1P2NA 3ODDA 2UWOA 9ESTA 5GXPA 3QLPH 5DP8A 3VPKA 5T6FA 3BTHE 2AGIX 1ZMJA 3ZV9A 7LPRA 2B7DH 4MNXA 3QGNB 3PLBA 2VIDA 1G3BA 3GY3A 3LC5A 1C4Y2 2BD8A 1ANEA 4X0WU 2SNVA 2BLVA 2H5CA 1G32B 1Z7KA 2FTLE 2KAIA 3MU0A 4OS5A 2B0FA 1MQ6A 1L1JA 2BYAX 2O8UA 1HAZB 4XOJA 5GCHG 4JZ1A 1C2EA 2HLCA 1FAXA 3OY5U 2F3CE 1XUGA 1Z1IA 3V13A 3RXIA 1TPSA 1O35A 1YCPH 1TBQH 3A8AA 4CHAB 4ISHH 3E16B 5T6DA 4WMFA 1QL7A 3RDZA 1TNIA 4NGAH 3TK5A 7KMEH 2R2MB 2FDAA 4X8UH 1W12U 1C2IA 2PSYA 3GICB 3RLWH 3SJOA 1K1PA 1SVPA 2TGTA 1EPTC 4Y71A 3A82A 4JK5A 1MCTA 3BG4C 2FZZA 3U1JB 5JYIA 1B0EA 1IQLA 2ZDMA 1DPOA 2ZFSA 2ZTZA 5JBAS 4B1TA 1DSUA 5T6GA 1EAWA 2J34A 4J2YB 2JKHA 1WV7H 1CBWB 3N7OA 4INKA 4ABDA 1V2KT 1ZRBA 1E38B 2EI8A 4Y10E 2VWNA 3Q77A 1HNEE 2BQ7B 3I29A 1KXCA 5F8TA 5JBBS 1IQHA 1T8OA 1ZPBA 3TGIE 4B2AA 1C2KA 5ESTE 1OWIA 1Q3XA 1O0DH 5J4QA 1LCYA 5EQRA 3UNRA 3KCGH 1SFQB 2R3YA 5EGMA 1IQKA 2AMPA 1P3EA 1YF4A 2BY8X 3SU0A 2QF3A 4INLA 4UDWH 3SV8A 4GCHG 1GBHA 5LPEA 1BOQA 2G00A 3PMAB 1XXFA 4U2WA 3SN8A 1K28D 3LGUA 1AWFH 3W95A 3O8CA 5C20A 3M5LA 4DCDA 3EA8A 4MPXA 4YZUA 4A1XA 4CH2B 2C90B 4FU9A 1S84A 2ZTYA 1DANH 2A5KA 9LPRA 1MBQA 2VU8E 4JK6A 2O9QA 5HMAA 1XUHA 3UQVA 1E34B 1BRUP 4GHTA 5K7RA 1O2RA 2FODA 3SNEA 1NRSH 1RD3B 1DY8A 2GCTB 1GBBA 3GYLB 1NPMA 4YOIA 2XBXA 4WXVA 1P10A 5FX6A 1SSXA 4B74A 2G81E 4WY3A 3RMNH 5E8EH 2ZU5A 3BG8A 4K3JA 1K21H 3FP7E 1AUTC 4K1TA 4Y8XA 1HCGA 1UVTH 3TJVA 1C5VA 2ASUB 2Y6TA 1F2SE 1P11E 5DP7A 2UUKB 4AYVB 1KLTA 1EAIA 3H5CB 1GBTA 1AKSB 1GL0E 1MTUA 1SOZA 3QX5H 3SU4A 1TPAE 1CVWH 3S7KB 1FV9A 3LONA 3PROA 3VB6A 1GPZA 1NU7B 1IHSH 2OQUA 1HAVB 3SNBA 7ESTE 1AVWA 1WAYB 3FP6E 1A5IA 4MNYA 4BTIB 4LZ1H 5C1UA 1NRRH 1GBEA 1MCVA 2XRCA 1HV7A 1QBNA 2STAE 4KTCA 2QGRA 1P09A 2VGCB 3E0PB 1P01A 5IDKA 2ODYB 1EB2A 3UNQA 1QBVH 1J14A 2VIQA 2YNAA 3HPTB 3OU0A 2QY0B 6ESTA 1O3CA 5C5NA 3KIDU 1TGCA 3TH3H 3GY7A 2A5IA 1T8MA 2F9OA 4RKOB 4DW2U 1F0SA 2FOFA 4DT7B 4O9VA 1P0SH 3NZIA 1XKAC 1C1PA 1D6RA 2WUBA 4X8VH 1Y59T 5JBTA 1C2MA 1HJ9A 5SGAE 4D7GA 3ATLA 5E0HA 2BD9A 2QCYA 3PB1E 1FIWA 5FCKA 1GG6C 1UHBA 2ANWA 4AN7A 2SGDE 2PW8H 1SR5C 3PTBA 1C9PA 1C1RA 2P59A 4MPWA 4Q7ZA 1BCUH 2BVXH 4BXSA 1KDQA 2PUQH 1MTNB 3SO3A 1D3QB 1SI5H 2QA9E 1KTTB 4K8YA 1OWHA 2ZGBH 5FPYA 3GY2A 3CENA 1HLTH 1ELCA 1VCPA 1B5GH 2FI3E 2ZHQH 3MU4A 4ABEA 1K9OE 5GIBA 1CA8B 2BZ6H 2CGAA 1PYTC 4NSYA 4ZH8A 3TPIZ 3RXOA 1Q31A 1NRNH 1JMOH 3TJNA 3NPSA 1LHFH 1DT2A 1LKAA 4ZKSU 5AVDA 1YP9A 2Z3DA 3V3MA 2SGFE 3MO6A 1V2ST 1VCWA 1BA8B 1Y3UA 3M61U 5HGGA 3UIRA 1GI6A 2Z9JA 2OQ5A 3GCNA 3P92A 1H8DH 2NU2E 3SU5A 1ZR0A 4LZ4B 3M5OA 1CA0B 1BB0B 1CGIE 6LPRA 1LPGB 1QFKH 4CBOA 4FUDA 1SQOA 2C3SA 4SGBE 3U8TH 1EAUA 4AFQA 3PO1C 1TLDA 3L33A 6GCHG 2PV9B 3QDZB 5GWZA 2BLWA 2ZTXA 2VINA 1GI1A 5CHAB 4MQAA 2BD2A 1H8IH 1GI0A 1G3EA 4GHQA 1SGFA 1VZQH 1UTPA 1MQ5A 4Y0ZE 2XBVA 4WH8A 2IPHA 3FVFB 1IQNA 1VITH 3ZV8A 2ANMH 1LHCH 1MUEB 2A2XH 3ZZ6A 5EXNA 2GP9B 2OUAA 1E35B 2G5VA 5FAHA 4B2BA 1ARCA 3TGJE 2JH0D 1E0FD 1C2GA 1DX5M 2QC2A 4VGCC 1XUIA 1RTLA 1AO5A 5GCHF 4Y11E 1V2NT 5I25A 3KQCA 2A45B 3S69A 1UMAH 3RXPA 4CRCA 3M36A 2GZ8A 2CN0H 3MYWA 2VIWA 4XDEA 3GCTG 1P2IA 3T2NA 1QB1A 2Y5FA 1OYTH 2H5DA 1BJUA 1T7CA 1YPLH 2RA0A 2O8TA 1O2SA 2SGQE 1AD8H 3PWCA 1AGJA 3EA9A 1C2LA 3RU4E 1O33A 2ZU4A 1FNIA 2W5EA 4O97A 2G4TA 1RXPA 3A7TA 1EZSC 1GCTB 4KKDA 3KNXA 1LHGH 3AAUA 4UFEH 1T8LA 2C93B 3M7TA 1OP0A 2ODPA 1GVKB 1G37A 2BX3A 1AFEH 2ALPA 4LOYH 3SJ8A 2PHBA 4CHAC 3ZZCA 3A8DA 1TMUH 1P2QA 2XWBI 1QY6A 1DICA 2BDIA 1DXPA 1V2PT 1TX6A 4GVUA 2JETB 2O8WA 1PPHE 1UTJA 1QQUA 1XX9A 3M3TA 5EQQA 1S6HA 3QK1A 1GBMA 1EZQA 4FXGH 1GHAG 1HAPH 3LIWA 1D3DB 2GTBA 1TRMA 1SGYE 4DY7B 2ZI2H 4GCHF 1WYKA 1EPTA 2XBWA 2BDHA 1IQJA 1UTKA 1WQSA 4B76A 1EKBB 3GOVB 1O34A 5A09A 1P12E 2QXHA 1QL8A 1FZZA 1CBWC 1C2JA 5E2PA 4CH8B 1IQFA 1HXEH 1DITH 1RJXB 3TH2H 1SGCA 3TNSA 3VB4A 2SGEE 3HK3B 2TGPZ 1V2UT 2BDYA 3D65E 1AWHB 1Z71A 1HAOH 4UEHH 1F0RA 1THPB 1KSNA 1RTKA 1OWEA 4FVDA 1V2JT 1JXPA 3EGKH 1O30A 4XSKU 2ZF0H 3DFJA 3A7XA 2BDGA 3MH5A 2PKAB 1GJ8B 3QGJA 1BIOA 3ELAH 4NZQA 2EEKA 1GBCA 4I33A 1W14U 4X8TH 4ABFA 1O3BA 4OGYA 1GG6B 1C5TA 1W10U 3RXQA 1D9IA 1GL1A 1O3OA 4WVPE 3IWMA 1S0QA 1T31A 1SGQE 4Q7XA 4ZUHA 3U9AH 2WPJS 4ABJA 3STIA 3SV7A 1ANBA 2XXLA 1BHXB 2G52A 2Z6BD 2B8OH 5DO4H 1SGFG 1NESE 1GMHG 3VFEA 1BHXF 5AFZH 4GPGA 1W7GH 3PTNA 5C67A 1AFQB 1PJPA 3GCOA 4K1SA 2CF9H 2FI4E 1U6QA 1OXGA 1G30B 1K1JA 1JIRA 4Y79A 1MTSA 3A7VA 4O3TA 3LGIA 1GVZA 1XKBC 3A8CA 5FBEA 4ABHA 4Y8YA 3PMHB 3F9GA 2JH5D 4K69A 2RCEA 3LGVA 1ORFA 1QIXB 1ANDA 2GCHG 1F5RA 1O3LA 1O2IA 4CR9A 3P8FA 1YLDA 4YM9A 4TPIZ 1CSOE 2BY7X 1C5UA 2FYRA 3SU6A 4AG1A 2HNTF 4BXWA 1DSTA 1BBRH 2FXRA 5E2OA 2A2QH 1E37B 1MBMA 2H6MA 1MZAA 2TIOA 3OX7U 3P6ZB 1J15A 1LVOA 2PLXA 3EAJA 2A1DB 1O3MA 1HAHH 2VGCC 1B0FA 1Z8JB 1BRBE 2ZFRH 1S0RA 4GSOA 1SQTA 4KP0A 3UOPA 1G2MA 4AX9H 2H9EH 1RRKA 1C2HA 1AVXA 2FMJA 2TPIZ 4I8HA 1LO6A 2OC8A 4K5ZA 2C8XB 3TVJB 1NU9A 5ETXA 2D26C 1WBGB 1ZRKA 1QCPA 1C1VH 3U98H 4A6LA 1KIGH 1MZDA 1ARBA 2AH4X 4YTAA 3K6YA 1NTPA 1SGDE 3M3SA 3NK8A 4YOJA 1ZJKA 1C1NA 3E6PH 5F8ZA 1LPZB 5C2ZA 1K1MA 4U30A 1XM1A 3RC5A 4RSPA 3SUDA 4IMQA 5DG6A 1AB9B 2GV7A 2LNCA 1SLUB 4IBLH 4K1EA 3SNAA 1QURH 2ALVA 3H7TA 1MTNC 1P8VC 1KXDA 4YO9A 3SOSA 4FUGA 3CP7A 1OPHB 1RGQA 4TYDA 3RU4D 6GCHF 3ATMA 3LGTA 3SV6A 1IOEA 4FUEA 2BXUH 1O3GA 2FWWA 2BD7A 1E36B 2ZIQH 2FOMB 4XBBA 1C9TA 1DLEA 3M5MA 5A8YA 2PGBB 2GDDA 3VGCC 5C1XA 1MTWA 3BTWE 1Z8RA 1ELEE 1C5XB 3LU9B 1W8BH 5EU8A 1AN1E 2O8LA 3A84A 4X1PU 4A1TA 1TGNA 4ABGA 1MD7A 2JH6D 3RMLH 2FX4A 5DP4A 1F7ZA 1BTWA 2P3UB 3C1KA 1O5FH 1QA0A 2UUJB 3ODFA 1ZPCA 1CA0C 4JZEH 2ZFFH 3SQEE 1QBOA 2O8MA 1LVYA 2W3IA 1GBFA 1LDTT 1GBJA 1KXEA 1LTOA 1J8AA 1V2VT 1HJAB 2IJOB 2BDCA 5CHAC 4B71A 1TE0A 4JZDH 3FZDA 1G2LA 2FLRH 1K22H 3RXHA 4I7YH 3RLYH 5DP5A 2QF0A 4CR5A 3ZVGA 4Z6AH 1EAXA 1YPEH 1UCYK 4E06H 1KXFA 4AGKA 2R0KA 4OS4A 3GCTF 2ESTE 1OS8A 1ZSJA 2FYQA 1ZYOA 1ELFA 5T3HA 1O3EA 1LPKB 4ISIH 2W7UA 4NIVA 2ZPQA 3B23B 1OOKB 1GGDC 2Z9IA 2FO9A 3A83A 4ZXYH 3PM3A 3Q3YA 1SGTA 1NT1A 2XWAA 4JZFH 3ZZ3A 5ESBA 4NIXA 3KL6A 4AZ2B 1T8NA 2CXVA 2F9NA 5TCAA 4YOGA 4ZKRU 1WTGH 2YOLA 4WWYA 1WQVH 3TK6A 1AMHA 1FN8A 3A7ZA 4AFSA 1L0ZA 5JB9S 1Y3XA 2CJIA 1TPPA 1C5NH 3Q3XA 3KF2A 1AVGH 1GDNA 1KTSB 1O5CB 3SHAH 1O31A 3U1IB 3NXPA 2G55A 3W94A 3OY6U 2BMGB 4U32A 3SBKA 1O2LA 1DVAH 5F6MA 1KXBA 1GHAF 2IN2A 1T4VH 3QZQA 3VB5A 3ENSB 1C1QA 1A2CH 4AB9A 3BTTE 3VXEH 3SQHE 2ODQA 4OS6A 1GCTC 1TYNA 1O2NA 2V3HH 1QJ6B 1QL9A 1C5OH 2VIOA 4CRBA 1P06A 2WPIS 1FJSA 3ZVCA 1ESTA 2VWOA 3IITA 4X8SH 1TNKA 2FPZA 2ZU3A 1LKBA 2ZGCA 4BAQB 2Y80A 3LPRA 4ZROA 2Q6GA 8KME2 3RXEA 4INHA 2G4UA 1O2PA 2AFQB 2BOKA 3RXRA 1BT7A 3MO3A 4JZIA 1EOJA 3S9CA 5GJ4B 3PWBA 3JZ1B 4TPYA 1PQ8A 2F9BH 2AMDA 2JETC 1ABJH 3OTJE 3HGPA 3D23A 1BMMH 2BD3A 2J94A 1PPCE 2THFB 2AGGX 2IOTA 2XC0A 1P9UA 1S83A 2VWLA 3SW2B 2AS9A 1S81A 1D3TB 3S9BA 2ZHFH 3BEIB 1Y8TA 1VJAU 1C2FA 1C4U2 1BUIA 3GISB 3RXJA 3UWJH 1QB9A 4WMDA 1A4WH 4WJG2 1UJ1A 2RDLA 1NS3A 3D49H 3UQOA 4OS2A 3F68H 4ZMAH 4JYUH 3TK9A 4RKJB 4ZHMU 3S0NA 2QN5T 1THSH 1GMHF 1P2KA 1GHBG 3A87A 3EE0B 5FCRA 2PR3A 3C27B 3GCHB 1ELGA 2FOAA 1DDJA 2YNBA 1FY5A 4FUFA 2UUYA 1BITA 1D3PB 3CS7A 3KQBA 5DPAA 1VCQA 1O2TA 4X1RU 1O2MA 4MNVA 1O2VA 1A0LA 4DIIH 2Y7ZA 4DURA 4ZHLU 5L2YH 2HRVA 2Z9GA 2G8TA 3RXTA 1DWBH 2EI6A 1SFIA 4HGCA 4ISLA 5E0JA 2GCHF 1THRH 1UTLM 3IG6B 2QIQA 2PSXA 3A8BA 1X7AC 5A8ZA 1XUKA 1O5DH 4NA7A 1AHTH 2A4GA 1HJ8A 5HYOA 2BD4A 1TAWA 3NWUA 1C1SA 1FY3A 4Y6DA 1C5MD 1BTXA 4DOQA 1EXFA 2ZFTA 2HPQH 1UTNA 1AFQC 1DWDH 1C5ZB 1ETTH 1GI4A 3VGCB 1YCPM 4H6TA 4OGXA 3RXMA 3A86A 1Z6EA 4X1SU 1BRAA 1HGTH 3ATWA 1LVMA 1O3IA 3ZZ9A 2GDEH 2R0LA 3UR6A 2F9UA 3HGNA 5DP6A 3SGAE 2ZO3H 3Q76A 1C5WB 1ESAA 1AQ7A 1EASA 1V2LT 3B9FH 4ABIA 1GHZA 2R3UA 3HKIB 1NZQH 2STBE 1PPGE 1QJ1B 2HNTC 5DJ7A 3RXSA 5PTPA 4B2CA 2F83A 3RXGA 1UTOA 4WF8A 4DGJA 4ZKOU 1H9IE 1L2EA 4BTTB 2Z7FE 3U8RH 1DUAA 2WUCA 3EYDA 1AKSA 1CQQA 5DK1A 4ASHA 1AU8A 3WY8A 3DA9B 5I46H 2BB4A 1FDPA 1L4ZA 3LT3A 1O2JA 1NROH 2EI7A 2FS9A 3GY6A 3UY9A 1W13U 1O37A 1HAVA 4GLYA 1GGDB 5EXLA 1QHRB 1BDAA 3AW1A 1A5HA 4ABAA 1BZXE 3GYMA 3MHWU 1UTMA 2Z3EA 5L2ZH 1C4V2 1C5RA 1EJNA 3MNXA 5CE1A 1GHVH 1PYTD 2BTCE 1JWTA 1LQDB 1GBLA 1WU1A 3ZZ7A 3P8GA 1G9IE 1O3JA 2VB0A 1SGEE 1F92A 3NUMA 3MI4A 5HM2A 4AGJA 1HIAB 4E7NA 2ZP0H 4J1YA 1H1BA 1SGNE 3D62A 2FIRH 2Z3CA 1V6DA 2PKSB 3LGYA 1KY9A 1C1OA 1AB9C 3HATH 4I8JA 4OS7A 1GDUA 1CGJE 2GD4B 2QXGA 8GCHG 4M7GA 2XYAA 3SJKA 1NRPH 2C8YB 1P02A 3F9FA 5EODA 3MU1A 1TB6H 1L1NA 1UO6A 1C1UH 2A7HA 2ZDAH 1QRXA 3TJOA 1LMWB 4NG9H 4Y7AA 1GJDB 1K1LA 2V35A 3BN9A 4KTSA 1YGCH 5LGOA 1O36A 2C4FH 1P57B 4NZLA 2OD3B 2SNWA 3RMOH 1JIMA 3M35A 4X6MA 3BTFE 1EZUC 2V0BA 2P3TB 4BNRA 1GBDA 1ZGIA 2GZ9A 2A7JA 1M9UA 5A0BA 4CBNA 1BBRE 1O2UA 2ZFQH 3LOXA 3UOUA 4NWKA 2P3FH 3QUMP 3AAVA 1TONA 2ZGJA 1P9SA 1GVLA 5ABWA 4H4FA 1C1WH 1TA6A 3MTYA 1C5SA 2A4QA 4A5TS 1QRZA 4JCNA 3KEEA 2NWNA 1HJAC 2QXIA 2ZFPH 4HI3A 4ZXXH 1S85A 4AORA 5DKMA 5TCCA 2ULLA 2D1JA 1BTUA 3BTME 3KHVA 3SI4H 5EW2H 2VVCA 1TALA 3M3VA 3RC6A 4K8BA 5FX5A 1QNJA 1WUNH 2AGEX 5EG4A 1IQMA 1ACBE 1YKTA 1OWJA 1NFXA 5JBCS 1GJBB 3T28A 2BOHB 1O3FA 1O5EH 1O3DA 3E1XB 3MO9A 5EW1H 1JOUB 4AFUA 1H4WA 2FS8A 2PTCE 1CT0E 1Y5AT 1JRSA 4MTBA 2HALA 1SHHB 5EPNA 2ZHDA 5K0HA 2BZAA 5A0CA 2GGVB 4IMZA 1AIXH 3UUZA 3T5FH 1MKXK 2ZQ2A 1BTPA 3LKWA 3RXVA 2CF8H 1TWXB 5FPTA 2W26A 2WYJA 3P95A 1N8OB 2BHGA 3MOCA 1XUFA 1TGBA 2UWLA 1A5GH 4D9RA 4NCYA 1FI8A 1ID5H 1ZMNA 4K60A 4D9QA 1BTHH 4Y7BA 1Z1JA 1K1NA 3ESTA 2OBQA 5EXMA 1ZLRA 3F9EA 2TGAA 3UFAA 1D6WA 1GJ5H 4TWYA 1NFWA 1MKXH 1GHXH 2ANYA 2PGQB 1DWEH 1FAKH 2CHAB 1RTFB 3EQ0H 2F91A 1BRCE 4X2YA 4AG2A 2D8WA 3ZZ4A 1UK4A 4X1NU 3ZVFA 3RUOA 3I78A 3UNSA 1HAGE 3T62A 1BJVA 2KAIB 1TQ7B 1EJAA 2XTTB 4BOHA 4FU7A 3ZZ5A 1O39A 3SI3H 2FOHA 2PFEA 4DIHH 3A89A 4NFEA 5HXFA 1HRTH 1GHBF 5AFYH 4XFQA 5EOKA 2XBYA 3ZVEA 1VR1H 3TLOA 2QYIA 3VB7A 2EC9H 4FVBA 4ZKNU 3GDSA 5DP3A 1O2XA 1J16A 2ZCKP 1PPEE 3RXLA 1A1RA 1TGTA 2WPHS 3BTDE 1QA7A 1W7XH 3K6ZA 5LH8A 2ZU1A 1DOJA 1GJCB 5EPYA 1C2DA 1NN6A 3QWCH 3DT0H 5E0GA 1HB0B 2P8OC 1XMNB 1Y3VA 2GZ7A 4THNH 4Y8ZA 1DUEA 4DVAU 1HDTH 1GMCG 5GPIB 4QT8C 2ZEBA 1GHWH 3DFLA 3RP2A 2B5TB 3RXBA 1V2WT 1J9CH 1D4PB 1UVPA 1H9HE 1PQ5A 2ZDLA 5A8XA 3ZZ8A 3VXFH 5H4IB 3AVZA 3GCHC 1MU8B 1O5AB 4MG3A 1WOFA 1UVSH 1SGRE 1HXFH 3UTUH 3URDA 1P05A 1W11U 5BPEA 3HKJB 3TJUA 2BLOA 3EDXB 2FOCA 3QTOH 1ZHMA 1QR3E 1O2KA 1ZMLA 3PMJA 3LGWA 4UFDH 2A7CA 2PKAA 3M37A 3M7QA 1FN6A 2Y5HA 3DUXH 3SU1A 2WPLS 2BQWB 3SV9A 3QZRA 1HPGA 3O8BA 1BTZA 1MD8A 1QRWA 2F9PA 2OP9A 1LHEH 1BMLA 1TMTH 1ZHPA 5EQSA 1YC0A 2GT8A 4I8KA 3A88A 1VGCC 1Z8IB 3LDXH 1ZTLA 3UR9A 1SB1H 4NA9H 1EP5A 3QN7A 4NA8A 2SGPE 1PPBH 1O2YA 2SFAA 1XVOA 4MNWA 5A0AE 4GUXA 1A0JA 4NWLA 1N6XA 1ZGVA 2ZU2A 3Q00A 1KYNA 1SBWA 1GJ6A 3BEFB 1P2MA 1YCPK 1SHYA 2A32A 2ZWLH 2PTNA 2ZHWH 3SJ9A 1TPOA 3GDVA 1P3CA 2ZC9H 1O32A 3SU3A 1ELTA 2XW9A 5JB8S 2OC7A 3UREA 1O2WA 3MH6A 1NFYA 1IHTH 5DGJA 4TWWA 2J9NA 1YPGH 3S7HB 5B6OA 4Q80A 4HFPB 1B7XB 3ZVBA 1CT4E 1O38A 3FANA 4YLUA 3V0XA 2H1UA 1DM4B 3E91A 3H7OA 1SQAA 2XC5A 4FUHA 3EA7A 4E7RG 1ELBA 4IC5A 2G51A 1MAYA 1L1GA 1PPZA 1NY22 1YLCA 3A85A 3MU8A 4WH6A 4Q2KA 3SV2H 2P93A 2AIPA 5JPMH 3SU2A 5G4BA 2Z9KA 1P04A 2C8WB 2OC0A 3K65B 1Z8GA 1SOTA 2NU1E 1OYQA 3F1SB 4CRFA 1TX8A 4ZHAA 3SUGA 4H42U 1G36A 4LK4A 8GCHF 1DWCH 1FMGA 5F8XA 1YBWA 2WPMS 2ZGXH 3L6PA 3LH1A 2A31A 1CO7E 1YPJH 1UVOA 4WXIA 1TX7A 5C3NA 2ZDKA 2OTVA 1AUJA 1XXDA 5FHTA 1O3AA 1UCYH 2ZNKH 1O2QA 3U69H 1CGHA 4KGAA 4R8TB 4A92A 2BVRH 3E8LA 2W3KA 3NCLA 1UK3A 4ISNA 3RXFA 3A81A 2ZA5A 1ELAA 1N1LA 1GBAA 1TFXA 1UTQA 1YM0A 2Y81A 4MLFB 3BIVH 1C1TA 1ELVA 2FM2A 5C5OA 1UHBB 1O3KA 4IW4E 2PKSC 4BTUB 2P95A 2VH6A 1NRQH 1JBUH 3TIUA 2P16A 1KDQB 1TNHA 4I31A 5AHGH 2HNTE 1ZPZA 1PFXC 1GBIA 4I32A 8LPRA 2A4RA 2WPKS 2XCNA 3RM2H 1AY6H 2BY9X 1BTYA 3LJOA 1SLWB 4AYYB 1IQEA 3RXUA 2ZG0H 6CHAC 1V2MT 1DS2E 1ZHRA 3ZZBA 2FEQH 3T26A 1DLKB 3G01A 1O3HA 1OP2A 1MTVA 1WCZA 3BTGE 1FY8E 1OWDA 1F0TA 1CHOG 1OX1A 3TH4H 1V2OT 3MNBA 2QAAA 1Y5UT 4E05H 5DP9A 1EB1H 1NO9H 4GAWA 4D7FA 3CS0A 1AZ8A 1P2JA 5JDUB 2V6NA 3M7UA 4UE7H 5AF9H 2BLQA 4XE4A 5BRRE 3O8RA 1PQ7A 4HTCH 2TRMA 1CHGA 4A1VA 5L6NH 5TJXA 4Z0KA 2GX4A 3GDUA 4X6NA 1RIWB 2BX4A 3GY4A 7GCHG 2P8OB 1BQYA 3E3TA 3TGKE 1RS0A 3T27A 3MFJA 3SNCA 2HGTH 1ZSLA 1OWKA 1FIZA 4MPUA 4Q7YA 4OS1A 1C5QA 2ZGHA 1GI7B 1EATA 2ZCLP 1XUJA 4KELA 4ABBA 1A0HB 1C5PA 2VVUA 2RA3A 3BTKE 5LPFA 1H9LB 3ZYDA 1DE7H 2ZDNA 2LPRA 2H9TH 2AMQA 2Y82A 1O2ZA 1O5GH 4NSVA 3P8OA 1Q2WA 1BMNH 1GJ7B 4TY6A 2Q1JA 5IYTA 2J4IA 1A3EH 2GVFA 4CRGA 1ZTKA 4XBDA 1V2RT 1ZTJA 4AFZA 3SORA 1GBKA 1N8OC 2R2WU 2BY6X 1O2OA 4MVNA 1OKXA 1P2OA 4DG4A 1ABIH 1LVBA 1VGCB 1DXWA 4I8LA 1ZZZA 1O2GH 3ZZAA
chains in the Genus database with same CATH superfamily
3MNCA 2BDBA 1YPMH 1EX3A 1GCDA 3KGPA 2FX6A 3GY8A 3MU5A 2CHAC 2VJ1A 4X6PA 1GMDG 1W0ZU 1ZJDA 4UFFH 5C1YA 1SG8B 1FUJA 2Y5GA 1A3BH 3OTPA 3FAOA 2BM2A 1QZ8A 4IC6A 1FQ3A 1TBZH 3A80A 1SMFE 1GMCF 1MAXA 4Y0YE 3PRBA 1ZOMA 1V3XA 2ILNA 2VWMA 2WYGA 1EJMA 3H09A 1KXAA 4AOQA 3BV9B 4ISOA 3F6UH 1L4DA 1ELDE 1V2TT 2XC4A 2Y7XA 1Y3WA 1VITG 3LH3A 1GI8B 1PPFE 1Y3YA 2KCAA 4NIYA 2FESH 4Y76A 4D76A 1AE8H 4JMYA 5CMXH 2GMTC 1F0UA 1V2QT 2ZPSA 1G3CA 3ZYEA 3SUFA 1KLJH 2H9HA 2ZCHP 5DSFA 3RXAA 1EPTB 2K1QA 3BEUA 2WV5A 3BG4B 1O3NA 1AE5A 1FY4A 3MNSA 4PROA 1FPHH 1NFUA 4FU8A 2BD5A 4H6SB 2J95A 2QXJA 4YT6H 2C8ZB 1GDQA 1HAIH 1QJ7B 1YPKH 3UWIA 1S5SA 1MKWK 5J4SA 2HVXA 1C5LH 1HAXB 4B75A 1CE5A 1QB6A 1UW7A 3BSQA 3K2UA 2AEIH 3TNTA 1TMBH 1UK2A 3QTVH 3RMMH 1ANCA 1LHDH 3RXDA 1IAUA 2Q6DA 1AI8H 1TBRH 1N6YA 1WSSH 3LC3A 1AZZA 2P94A 4BAMB 4B73A 1YPHE 1QGFA 5EJLA 2RG3A 2XCFA 2GV6A 2D2DA 3E0NB 4P00A 2ZPRA 4BANB 2VIPA 2BY5X 4IN1A 1MKWH 4MPVA 2HOBA 3R0FA 1W2KH 5HIYA 3TITA 2BDAA 1RFNA 2HPPH 4X2VA 1NC6A 2OLGA 1HAYB 2OCVB 3P17H 4SGAE 2AYWA 2QE7D 2TGDA 2Q6FA 2FTMA 1GWAA 2PUXB 4IGDA 2NU0E 4LXBH 3KQ5A 4CRDA 2H2ZA 3FZZA 4CREA 2A4OA 2GKVE 3DHKH 3NKKA 1P03A 2AIQA 2ZQ1A 3SGQE 2HWLB 6CHAB 1NM6A 1T32A 2NU3E 4X1QU 2DE8A 1HUTH 8ESTE 1C1MA 1BMFD 2OXSA 3V12A 3SGBE 2FLBH 4F4OC 4JYVH 1C5YB 3RM0H 2EA3A 4AB8A 3A7YA 2FOEA 1GHYH 1TA2A 3DSPA 4KTUA 1YYY1 1WTHD 2WINI 1INCA 3VB3A 2NU4E 4FUCA 4XBCA 4MDSA 3F2FA 1TGSZ 2FOBA 3KQDA 4UONA 3FKSD 5LPRA 3URCA 1SKYE 2OBOA 3JZ2B 4X6OA 1O3PB 1FY1A 1IQIA 2ZZUH 2OINA 1OSSA 3E90B 2XNIA 2Z94A 2PWXA 1GI2A 1HYLA 3R3GB 3SHCH 1ZSKA 1FPCH 5FPSA 3PMBB 2DUCA 1W3CA 4YLQH 3F0OA 1KLIH 4NFFA 1GI3A 3TU7H 3LJJA 4HZHA 3BF6H 3QO6A 2FI5E 1K1IA 2I6SA 1EZXC 1DFPA 1JRTA 4DT4A 4FUJA 1TIOA 1CU1A 1FLEE 3BIUH 1OP8A 1K1OA 1QTFA 2AERH 2BVSH 3T25A 4R0IA 1W0KD 4FUBA 1G3DA 4I86A 2CMYA 3ATKA 4X2XA 1QQ4A 3MWIU 2VNTA 4UFGH 4D8NA 2A5AA 2TBSA 1SL3A 4O3UA 1BMAA 4BAHB 3SZNA 1Z6JH 5L30H 2G5NA 1W0YH 3SJIA 1EQ9A 3L3TA 2ZKSA 4WMEA 3SNDA 4ESTE 2R9PA 2HLDD 1CT2E 1O2HA 5FBIA 2J2UA 4DJZB 1TRYA 1SGIB 1GI5A 1CHOF 3PLPA 3WW7A 1COWD 1A61H 5F03A 1GI9B 3VEQB 1HIAA 3BTQE 3OSYA 2ZECA 2ANKH 4O03A 1PQAA 4F49A 3K9XB 4UD9H 3UPEA 3OYPA 3B8JA 3HK6B 3ZVDA 2OC1A 3STJA 2L74A 3AW0A 1YPHC 3FP8E 2F9VA 1YWUA 3MH4A 3ITIA 2GT7A 1S6FA 7GCHF 1HFDA 2VIVA 2FOGA 3F0PA 3O8DA 3RXKA 4BAOB 1SLVB 2QF5A 1IQGA 3MH7A 1FONA 1Y5BT 1GJAB 3M5NA 1MH0A 2BQ6B 2GCTC 3V7TA 1A7SA 1TNLA 3WWFA 4IN2A 1TQ0B 3KQEA 4NIWA 1BBRK 3P70B 2WV4A 3GY5A 2A0QB 1ESBA 2UUFB 4BAKB 1UVUH 2GMTB 1DY9A 1J17T 1SGPE 4CRAA 1T4UH 4TY7A 2UWPA 3F9HA 3ATIA 3Q3KA 4RN6A 4IS5A 2ZHEH 1TABE 3I77A 4AC9A 2CV3A 1F5KU 2BXTH 1RIWC 1ETRH 3MMGA 3PV4A 3PO1B 3PLKA 2J38A 3S9AA 1MMJN 3AASA 1A46H 5KECA 1K0HA 1TOMH 3SZEA 3A7WA 5FXLA 1O5BB 1UCYE 4I8GA 5F53A 4FUIA 2W7SA 3RC4A 1TOCB 4ZAEA 3U8OH 2OK5A 2FP7B 2VVVA 2B9LA 3RXCA 1ETSH 1MU6B 1SPJA 2V7QD 2V3OH 1GJ4H 1GMDF 1VJ9U 1EOLA 3PRDA 4JYTA 2Z9LA 1EUFA 2J92A 1W0JD 3PYHA 2DE9A 3FFGA 2VH0A 4YT7H 1XVMA 2VBCA 4X2WA 4A7IB 4VGCB 1SLXB 3DCLA 3ZZDA 1E79D 2M5TA 1EP6A 4YESB 3DD2H 1SC8U 1TRNA 1F5LA 3BTEE 3RU4T 1EFRD 3P8NA 1LQEA 2SGAA 4K2YA 5GDSH 1VITF 2JDID 2I6QA 3T29A 4Z1MD 1K2I1 4U01A 5A2MH 2QV1A 1TNJA 1FXYA 1S82A 3KN2A 1GJ9B 3SUEA 1HBTH 3ZVAA 1TNGA 5HM9A 2ZDVH 1P2NA 3ODDA 2UWOA 9ESTA 5GXPA 3QLPH 5DP8A 3VPKA 5T6FA 3BTHE 2AGIX 1ZMJA 3ZV9A 7LPRA 2B7DH 4MNXA 4RT0A 3QGNB 3PLBA 2VIDA 1G3BA 3GY3A 3LC5A 1C4Y2 2BD8A 1ANEA 4X0WU 2SNVA 5EIYA 2BLVA 2H5CA 1G32B 1Z7KA 2EY4C 2FTLE 2KAIA 3MU0A 4OS5A 2B0FA 1MQ6A 1L1JA 2BYAX 2O8UA 1HAZB 4XOJA 5GCHG 4JZ1A 1C2EA 2HLCA 1FAXA 3OY5U 2F3CE 1XUGA 1Z1IA 3V13A 3VG8A 3RXIA 1TPSA 2J5UA 1O35A 1YCPH 1TBQH 3A8AA 4CHAB 4ISHH 3E16B 5T6DA 4WMFA 1QL7A 3RDZA 1TNIA 4NGAH 3TK5A 7KMEH 2R2MB 2FDAA 4X8UH 1W12U 1C2IA 2PSYA 3GICB 3RLWH 3SJOA 1K1PA 1SVPA 2TGTA 1EPTC 4Y71A 3A82A 4JK5A 1MCTA 5DN6D 3BG4C 2FZZA 3U1JB 5JYIA 1B0EA 1IQLA 2ZDMA 4XRNA 3UAIC 1DPOA 2ZFSA 2ZTZA 5JBAS 4B1TA 1DSUA 5T6GA 1EAWA 2J34A 4J2YB 2JKHA 1WV7H 1CBWB 3N7OA 4INKA 4ABDA 1V2KT 1ZRBA 1E38B 2EI8A 4Y10E 2VWNA 3Q77A 1HNEE 2BQ7B 5FL7D 3I29A 1KXCA 3N99A 5F8TA 5JBBS 1IQHA 1T8OA 1ZPBA 3TGIE 4B2AA 1C2KA 5ESTE 1OWIA 1Q3XA 1O0DH 5J4QA 1LCYA 5EQRA 3UNRA 3KCGH 1SFQB 2R3YA 5EGMA 1IQKA 2AMPA 1P3EA 1YF4A 2BY8X 3SU0A 2QF3A 4INLA 4UDWH 3SV8A 4GCHG 1GBHA 5LPEA 1BOQA 2G00A 3PMAB 1XXFA 4U2WA 3SN8A 1K28D 3LGUA 1AWFH 3W95A 3O8CA 5C20A 3M5LA 4DCDA 3EA8A 4MPXA 4YZUA 4A1XA 4CH2B 2C90B 2JJ2D 4FU9A 1S84A 2ZTYA 1DANH 2A5KA 9LPRA 1MBQA 2VU8E 4JK6A 2O9QA 5HMAA 1XUHA 3UQVA 1E34B 1BRUP 4GHTA 5K7RA 1O2RA 2FODA 2QF4A 3SNEA 1NRSH 1RD3B 1DY8A 2GCTB 1H8HD 1GBBA 3GYLB 1NPMA 4YOIA 2XBXA 4WXVA 1P10A 5FX6A 1SSXA 4B74A 2G81E 4WY3A 3RMNH 5E8EH 2ZU5A 3BG8A 4K3JA 1K21H 3FP7E 1AUTC 2YMSB 4K1TA 4Y8XA 1HCGA 1UVTH 3TJVA 1C5VA 2ASUB 2Y6TA 1F2SE 1P11E 5DP7A 2UUKB 4AYVB 1KLTA 1EAIA 3H5CB 1GBTA 1WDIA 1AKSB 1GL0E 1MTUA 1SOZA 2J98A 3QX5H 3SU4A 1TPAE 1CVWH 3S7KB 1FV9A 3LONA 3PROA 3VB6A 1GPZA 1NU7B 1IHSH 2OQUA 4TSFD 1HAVB 3SNBA 7ESTE 1AVWA 1WAYB 3FP6E 1A5IA 4MNYA 4BTIB 4LZ1H 5C1UA 1NRRH 1GBEA 1MCVA 2XRCA 1HV7A 1QBNA 2STAE 4KTCA 2QGRA 1P09A 2VGCB 3E0PB 1P01A 5IDKA 2ODYB 5HIZA 1EB2A 3UNQA 1QBVH 1J14A 2VIQA 2YNAA 2JJ1D 3HPTB 3OU0A 2QY0B 6ESTA 1O3CA 5C5NA 3KIDU 1TGCA 3TH3H 3GY7A 2A5IA 1T8MA 2F9OA 4RKOB 4DW2U 1F0SA 2FOFA 4DT7B 4O9VA 1P0SH 3NZIA 1XKAC 3OEHD 1C1PA 1D6RA 2WUBA 4X8VH 1Y59T 5JBTA 1C2MA 1HJ9A 5SGAE 4D7GA 3ATLA 5E0HA 2BD9A 2QCYA 3PB1E 1FIWA 2L6OA 5FCKA 1GG6C 1UHBA 2ANWA 4AN7A 2SGDE 2PW8H 1SR5C 3PTBA 1C9PA 1C1RA 2P59A 2EQNA 4MPWA 4Q7ZA 1BCUH 2BVXH 4BXSA 1KDQA 2PUQH 1MTNB 3SO3A 1D3QB 1SI5H 2QA9E 1KTTB 4K8YA 1OWHA 2ZGBH 5FPYA 3GY2A 3CENA 1HLTH 1ELCA 1VCPA 1B5GH 2FI3E 2ZHQH 3MU4A 4ABEA 1K9OE 5GIBA 1CA8B 2BZ6H 2CGAA 1PYTC 4NSYA 4ZH8A 3TPIZ 3RXOA 1Q31A 5KGOA 1NRNH 1JMOH 3TJNA 3NPSA 1LHFH 1DT2A 1LKAA 4ZKSU 5AVDA 1YP9A 2Z3DA 3V3MA 2SGFE 3MO6A 1V2ST 1VCWA 1BA8B 1Y3UA 3M61U 5HGGA 2WZQA 3UIRA 1GI6A 2Z9JA 2OQ5A 3GCNA 3P92A 1H8DH 2NU2E 3SU5A 1ZR0A 4LZ4B 3M5OA 1CA0B 1BB0B 1CGIE 6LPRA 1LPGB 1QFKH 4CBOA 4FUDA 1SQOA 2C3SA 4SGBE 3U8TH 1EAUA 2KZ4A 4AFQA 3PO1C 1TLDA 3L33A 6GCHG 2PV9B 3QDZB 5GWZA 2WHXA 2BLWA 1S6LA 2ZTXA 2VINA 1GI1A 5CHAB 4MQAA 4B6EA 2BD2A 1H8IH 1GI0A 1G3EA 4GHQA 1SGFA 1VZQH 1UTPA 1MQ5A 4Y0ZE 2XBVA 4WH8A 2IPHA 3FVFB 1IQNA 2CK3D 1VITH 3SYJA 3ZV8A 2ANMH 1LHCH 1MUEB 2A2XH 3ZZ6A 5EXNA 2GP9B 2OUAA 1E35B 2G5VA 5FAHA 4B2BA 1ARCA 3TGJE 2JH0D 1E0FD 1C2GA 5C94A 1DX5M 2QC2A 4VGCC 1XUIA 1RTLA 1AO5A 5GCHF 4Y11E 1V2NT 5I25A 3KQCA 2A45B 3S69A 1UMAH 3RXPA 5CDFE 4CRCA 3M36A 2GZ8A 2CN0H 3MYWA 3FOAA 2VIWA 4XDEA 3GCTG 1P2IA 3T2NA 1QB1A 2Y5FA 1OYTH 2H5DA 1BJUA 1T7CA 1YPLH 2WV9A 2RA0A 2O8TA 1O2SA 2SGQE 1AD8H 3PWCA 1AGJA 3EA9A 1C2LA 3RU4E 1O33A 2ZU4A 1FNIA 2W5EA 4O97A 4FOUC 2G4TA 1RXPA 3A7TA 1YLNA 1EZSC 1GCTB 4KKDA 3KNXA 2LELA 1LHGH 3AAUA 4UFEH 3U28C 1T8LA 2C93B 4ACBA 3M7TA 1OP0A 2ODPA 1GVKB 1G37A 2LP6A 2BX3A 2JIZD 1AFEH 2ALPA 4LOYH 3SJ8A 2PHBA 4CHAC 3ZZCA 3PV5A 3A8DA 1TMUH 1P2QA 2XWBI 3ZIAD 1QY6A 1DICA 2BDIA 2J97A 1DXPA 1V2PT 1TX6A 4GVUA 2JETB 2O8WA 1PPHE 1UTJA 1QQUA 3PV2A 1XX9A 3M3TA 5EQQA 1S6HA 3QK1A 1GBMA 1EZQA 4FXGH 1GHAG 1HAPH 3LIWA 1D3DB 2GTBA 1TRMA 1SGYE 1OHHD 4DY7B 2ZI2H 4GCHF 1WYKA 1EPTA 2XBWA 2BDHA 1IQJA 1UTKA 1WQSA 4B76A 1EKBB 3GOVB 1O34A 5A09A 1P12E 2QXHA 4M9FA 1QL8A 1FZZA 1CBWC 1C2JA 5E2PA 4CH8B 1IQFA 1HXEH 1DITH 1RJXB 3TH2H 1SGCA 3TNSA 3VB4A 2SGEE 3HK3B 2TGPZ 1V2UT 2BDYA 3D65E 1AWHB 1Z71A 1HAOH 4UEHH 4TT3D 1F0RA 1THPB 5B6LA 1KSNA 1RTKA 1OWEA 4FVDA 1V2JT 1JXPA 3EGKH 1O30A 4XSKU 2ZF0H 3AK5A 3DFJA 3A7XA 2BDGA 3MH5A 2PKAB 1GJ8B 3QGJA 1BIOA 3ELAH 4NZQA 2EEKA 1GBCA 4I33A 1W14U 4X8TH 4ABFA 1O3BA 4OGYA 1GG6B 1C5TA 1W10U 3RXQA 1D9IA 1GL1A 4Q4LA 1O3OA 4WVPE 3IWMA 2KCPA 1S0QA 1T31A 1SGQE 4Q7XA 4ZUHA 3U9AH 2WPJS 4ABJA 3STIA 3SV7A 1ANBA 2XXLA 1BHXB 2G52A 2Z6BD 2B8OH 5DO4H 1SGFG 1NESE 1GMHG 3VFEA 1BHXF 5AFZH 4GPGA 1W7GH 3PTNA 5C67A 1AFQB 1PJPA 3GCOA 4K1SA 2CF9H 4P02A 2FI4E 1U6QA 3NRLA 1OXGA 2F4LA 1G30B 3OFND 1K1JA 1JIRA 4Y79A 1MTSA 3A7VA 4O3TA 3LGIA 1GVZA 1XKBC 3A8CA 5FBEA 4ABHA 4Y8YA 3PMHB 3F9GA 2JH5D 4K69A 2RCEA 3LGVA 1ORFA 1QIXB 2YMSC 1ANDA 2GCHG 1F5RA 1O3LA 1O2IA 4OM9A 4CR9A 3P8FA 1YLDA 4YM9A 4TPIZ 1CSOE 2BY7X 1C5UA 2FYRA 3SU6A 4AG1A 2HNTF 4BXWA 1DSTA 1BBRH 2FXRA 5E2OA 2A2QH 1E37B 1MBMA 2H6MA 1MZAA 2TIOA 3OX7U 3P6ZB 1J15A 1LVOA 3FO8D 5GNDA 2PLXA 3EAJA 2A1DB 1O3MA 1HAHH 2VGCC 2XNDD 1B0FA 1Z8JB 1BRBE 2ZFRH 1S0RA 4GSOA 1SQTA 4KP0A 2KFWA 3UOPA 1G2MA 4AX9H 2H9EH 1RRKA 1C2HA 1AVXA 2FMJA 2TPIZ 4I8HA 1LO6A 2OC8A 4K5ZA 2C8XB 3TVJB 1NU9A 5ETXA 2D26C 2KX4A 1WBGB 1ZRKA 1QCPA 1C1VH 3U98H 4A6LA 1KIGH 1MZDA 1ARBA 2AH4X 4YTAA 3K6YA 1NTPA 1SGDE 3M3SA 3NK8A 4YOJA 1ZJKA 1C1NA 3E6PH 5F8ZA 1LPZB 5C2ZA 1K1MA 1VKYA 5T1VA 4U30A 2K0QA 3N7EA 1XM1A 3RC5A 4RSPA 3SUDA 4IMQA 5DG6A 1AB9B 2GV7A 2LNCA 1SLUB 4IBLH 4K1EA 3SNAA 1QURH 2ALVA 3H7TA 1MTNC 1P8VC 1KXDA 4YO9A 3SOSA 4FUGA 3CP7A 1OPHB 1RGQA 4TYDA 3RU4D 6GCHF 3ATMA 3LGTA 3SV6A 1IOEA 4FUEA 2BXUH 1O3GA 2FWWA 2BD7A 1E36B 2ZIQH 2FOMB 4XBBA 1C9TA 1DLEA 3M5MA 5A8YA 2PGBB 2GDDA 3VGCC 2IJD1 5C1XA 1MTWA 3BTWE 1Z8RA 1ELEE 1C5XB 3LU9B 1W8BH 5EU8A 1AN1E 2O8LA 3A84A 4X1PU 4A1TA 1TGNA 4ABGA 1MD7A 2JH6D 3RMLH 2FX4A 5DP4A 1F7ZA 1BTWA 2P3UB 3C1KA 2K8IA 1O5FH 1QA0A 2UUJB 3ODFA 1ZPCA 1CA0C 4JZEH 2ZFFH 3SQEE 1QBOA 2O8MA 1LVYA 2W3IA 1MABB 1GBFA 1LDTT 2RFKC 1GBJA 1KXEA 1LTOA 1J8AA 1V2VT 1HJAB 2IJOB 2BDCA 5CHAC 4B71A 3MQKC 1TE0A 4JZDH 3FZDA 1G2LA 2FLRH 1K22H 3RXHA 4I7YH 3RLYH 5DP5A 2QF0A 4CR5A 3ZVGA 4Z6AH 1EAXA 1YPEH 1UCYK 4E06H 1KXFA 4AGKA 2R0KA 4OS4A 2KM0A 3GCTF 2ESTE 1OS8A 1ZSJA 2FYQA 1ZYOA 1ELFA 5T3HA 1O3EA 5C0UA 1LPKB 4ISIH 2W7UA 4NIVA 2ZPQA 3B23B 3CNRA 1OOKB 4ASUD 1GGDC 2Z9IA 2FO9A 3A83A 4ZXYH 3WWBA 3PM3A 3Q3YA 1SGTA 1NT1A 2XWAA 4JZFH 3ZZ3A 5ESBA 4NIXA 3KL6A 4AZ2B 1T8NA 2CXVA 2F9NA 5TCAA 4YOGA 4ZKRU 1WTGH 2YOLA 4WWYA 1WQVH 3TK6A 1AMHA 1FN8A 3A7ZA 3KYGA 4AFSA 1L0ZA 5JB9S 1Y3XA 2CJIA 1TPPA 2W6ID 1C5NH 3Q3XA 3KF2A 1AVGH 1GDNA 1KTSB 1O5CB 3SHAH 1O31A 3U1IB 3NXPA 2G55A 3W94A 3OY6U 2BMGB 4U32A 3SBKA 1O2LA 1DVAH 5F6MA 1KXBA 1GHAF 2IN2A 1T4VH 3QZQA 3VB5A 3ENSB 1C1QA 1A2CH 4AB9A 3BTTE 3VXEH 3SQHE 2ODQA 4OS6A 1GCTC 1TYNA 1O2NA 4F48B 1E1RD 2V3HH 1QJ6B 1QL9A 1C5OH 2VIOA 4CRBA 1P06A 2WPIS 1FJSA 3ZVCA 1ESTA 2VWOA 3IITA 4X8SH 1TNKA 2FPZA 2ZU3A 1LKBA 2ZGCA 4BAQB 2Y80A 3LPRA 4ZROA 2Q6GA 8KME2 1WXRA 3RXEA 4INHA 2G4UA 1O2PA 2AFQB 2BOKA 3RXRA 1BT7A 3MO3A 4JZIA 1EOJA 3S9CA 5GJ4B 3PWBA 3JZ1B 4TPYA 1PQ8A 2F9BH 2AMDA 2JETC 1ABJH 4HG6A 3OTJE 3HGPA 3D23A 1BMMH 2BD3A 2J94A 1PPCE 2THFB 2AGGX 2IOTA 2XC0A 1P9UA 1S83A 2VWLA 3SW2B 2AS9A 1S81A 1D3TB 3S9BA 2ZHFH 3BEIB 1Y8TA 1VJAU 1C2FA 1C4U2 1BUIA 3GISB 3RXJA 3UWJH 1QB9A 4WMDA 1A4WH 4WJG2 2V3MA 1UJ1A 2RDLA 1NS3A 3D49H 3UQOA 4OS2A 3F68H 4ZMAH 4JYUH 3TK9A 4RKJB 4ZHMU 3S0NA 2QN5T 1THSH 2GJGA 1GMHF 1P2KA 1GHBG 3A87A 3EE0B 5FCRA 2PR3A 3C27B 3GCHB 1ELGA 2FOAA 1DDJA 1H8ED 2YNBA 1FY5A 4FUFA 2UUYA 1BITA 1D3PB 3CS7A 3KQBA 5DPAA 1VCQA 1O2TA 4X1RU 1O2MA 4MNVA 1O2VA 1A0LA 4Q63A 4DIIH 2Y7ZA 4DURA 4ZHLU 5L2YH 2HRVA 2Z9GA 2G8TA 3RXTA 1DWBH 2EI6A 1SFIA 4HGCA 4ISLA 5E0JA 2GCHF 1THRH 1UTLM 3IG6B 2QIQA 2PSXA 5EJ1A 3A8BA 1X7AC 5A8ZA 1XUKA 1O5DH 4NA7A 1AHTH 2A4GA 1HJ8A 5HYOA 2BD4A 1TAWA 3NWUA 1C1SA 1FY3A 4Y6DA 1C5MD 1BTXA 4DOQA 1EXFA 2ZFTA 2HPQH 1UTNA 1AFQC 1DWDH 1C5ZB 1ETTH 1GI4A 3VGCB 1YCPM 4H6TA 4OGXA 3RXMA 3A86A 1Z6EA 4X1SU 1BRAA 1HGTH 3ATWA 1LVMA 1O3IA 3ZZ9A 2GDEH 2R0LA 2RDEA 3UR6A 2F9UA 3HGNA 5DP6A 3SGAE 2ZO3H 3Q76A 1C5WB 1ESAA 1AQ7A 1EASA 1V2LT 3B9FH 4ABIA 1GHZA 2R3UA 2XOKD 3HKIB 1NZQH 2STBE 1PPGE 1QJ1B 2HNTC 5DJ7A 3RXSA 5PTPA 4B2CA 2F83A 3RXGA 1UTOA 4WF8A 3F3BA 4DGJA 4ZKOU 1H9IE 1L2EA 4BTTB 2Z7FE 3U8RH 1DUAA 2WUCA 3EYDA 1AKSA 1CQQA 5DK1A 4ASHA 1AU8A 3WY8A 3DA9B 5I46H 2BB4A 1FDPA 2WSSD 1L4ZA 3LT3A 1O2JA 3UB0A 1NROH 2EI7A 2FS9A 3GY6A 3UY9A 5C17A 1W13U 1O37A 1HAVA 3FN8A 4GLYA 1GGDB 5EXLA 1QHRB 1BDAA 3AW1A 1A5HA 4ABAA 1BZXE 5KEDA 3GYMA 3MHWU 1UTMA 2Z3EA 3OE7D 5L2ZH 1C4V2 1C5RA 1EJNA 3MNXA 5CE1A 1GHVH 1PYTD 2BTCE 2M2AA 1JWTA 1LQDB 1GBLA 1WU1A 3ZZ7A 3P8GA 1G9IE 1O3JA 2VB0A 1SGEE 1F92A 3NUMA 3MI4A 5HM2A 4AGJA 1HIAB 4E7NA 2ZP0H 4J1YA 1H1BA 1SGNE 3D62A 2FIRH 2Z3CA 1V6DA 2PKSB 3LGYA 1KY9A 1C1OA 1AB9C 3HATH 4I8JA 4OS7A 1GDUA 1CGJE 2GD4B 2QXGA 8GCHG 4M7GA 2XYAA 3SJKA 1NRPH 2C8YB 1P02A 3F9FA 5EODA 3MU1A 1TB6H 1L1NA 1UO6A 1C1UH 2A7HA 2ZDAH 1QRXA 4XD7D 3TJOA 1LMWB 4NG9H 4Y7AA 2W6JD 1GJDB 1K1LA 2V35A 3BN9A 4KTSA 1YGCH 5LGOA 1O36A 2C4FH 1P57B 4NZLA 2OD3B 2SNWA 3RMOH 1JIMA 3M35A 4X6MA 4RT1A 3BTFE 1EZUC 1SQRA 2V0BA 2P3TB 4BNRA 1GBDA 1FX0B 1ZGIA 2GZ9A 2A7JA 1M9UA 5A0BA 4CBNA 1BBRE 1O2UA 2ZFQH 3LOXA 3UOUA 4NWKA 2P3FH 3QUMP 3AAVA 1TONA 2ZGJA 1P9SA 1GVLA 5ABWA 4H4FA 1C1WH 1TA6A 3MTYA 1C5SA 2A4QA 4A5TS 1QRZA 4JCNA 3KEEA 2NWNA 1HJAC 2QXIA 2ZFPH 4HI3A 5HKKD 4ZXXH 1S85A 4AORA 5DKMA 5TCCA 3EE7A 2ULLA 2D1JA 1BTUA 2KCOA 3BTME 3KHVA 3SI4H 5EW2H 2VVCA 1TALA 3M3VA 2KR7A 3RC6A 4K8BA 5FX5A 1QNJA 1WUNH 2AGEX 5EG4A 1IQMA 1ACBE 1YKTA 1OWJA 1NFXA 5JBCS 1GJBB 4YXWD 3T28A 2BOHB 1O3FA 1O5EH 1O3DA 3E1XB 3MO9A 5EW1H 1JOUB 4AFUA 1H4WA 2FS8A 2PTCE 1CT0E 1Y5AT 1KMHB 3DSGA 1JRSA 4MTBA 3GS9A 2HALA 1SHHB 5EPNA 2ZHDA 5K0HA 2BZAA 5A0CA 2GGVB 4IMZA 2AHME 1AIXH 3UUZA 3T5FH 3W1EA 1MKXK 1YY3A 2ZQ2A 1BTPA 3LKWA 3RXVA 2CF8H 1TWXB 5FPTA 2W26A 2WYJA 3P95A 1N8OB 2BHGA 3MOCA 1XUFA 1TGBA 2UWLA 1A5GH 4D9RA 4NCYA 1FI8A 1ID5H 1ZMNA 4K60A 4D9QA 1BTHH 4Y7BA 1Z1JA 1K1NA 3ESTA 2OBQA 5EXMA 1ZLRA 3F9EA 3N7DA 2TGAA 3UFAA 2IPQX 1D6WA 1GJ5H 4TWYA 1NFWA 1MKXH 1GHXH 2ANYA 2PGQB 1DWEH 1FAKH 2CHAB 1RTFB 3EQ0H 2F91A 1BRCE 4X2YA 4AG2A 2D8WA 3ZZ4A 1UK4A 4X1NU 3ZVFA 3RUOA 3I78A 3UNSA 1HAGE 3T62A 1BJVA 2KCYA 2KAIB 1TQ7B 1EJAA 2XTTB 4BOHA 3F2HA 4FU7A 3ZZ5A 1O39A 3SI3H 2FOHA 2PFEA 4DIHH 3A89A 1NBME 4NFEA 4RI0A 5HXFA 1HRTH 1GHBF 5AFYH 4XFQA 5EOKA 2XBYA 3ZVEA 1VR1H 3TLOA 2QYIA 3VB7A 2EC9H 4FVBA 4ZKNU 3GDSA 5DP3A 1O2XA 1J16A 3F2GA 2ZCKP 1PPEE 3RXLA 1A1RA 1TGTA 2WPHS 3BTDE 1QA7A 1W7XH 3K6ZA 5LH8A 2ZU1A 1DOJA 1GJCB 5EPYA 1C2DA 2PP6A 1NN6A 3QWCH 3DT0H 5E0GA 1HB0B 2P8OC 1XMNB 1Y3VA 2GZ7A 4THNH 4Y8ZA 1DUEA 4DVAU 1HDTH 1GMCG 5GPIB 4QT8C 2ZEBA 1GHWH 3DFLA 3RP2A 2B5TB 3RXBA 1V2WT 1J9CH 1D4PB 1UVPA 1H9HE 1PQ5A 2ZDLA 5A8XA 3ZZ8A 3VXFH 5H4IB 3AVZA 3GCHC 1MU8B 1O5AB 4MG3A 1WOFA 1UVSH 1SGRE 1HXFH 3UTUH 3URDA 1P05A 1W11U 5BPEA 3HKJB 3TJUA 2BLOA 3EDXB 2FOCA 3QTOH 1ZHMA 4F55A 1QR3E 1O2KA 1ZMLA 3PMJA 3LGWA 4UFDH 2A7CA 2PKAA 3M37A 3M7QA 1FN6A 2Y5HA 3DUXH 3SU1A 2WPLS 2BQWB 3SV9A 3QZRA 1HPGA 3O8BA 1BTZA 1MD8A 1QRWA 2F9PA 2OP9A 1LHEH 1BMLA 1TMTH 1ZHPA 2YMSD 5EQSA 1YC0A 2GT8A 4I8KA 3A88A 1VGCC 1Z8IB 3LDXH 1ZTLA 3UR9A 1SB1H 4NA9H 1EP5A 3QN7A 4NA8A 2SGPE 1PPBH 1O2YA 2SFAA 1XVOA 4MNWA 5A0AE 5IK2D 4GUXA 1A0JA 4FETA 1N6XA 1ZGVA 4NWLA 1E1QD 2ZU2A 3Q00A 1KYNA 1SBWA 1GJ6A 3BEFB 1P2MA 1YCPK 1SHYA 2A32A 2ZWLH 2PTNA 2ZHWH 3SJ9A 1TPOA 3GDVA 1P3CA 2ZC9H 1O32A 3SU3A 1ELTA 2XW9A 5JB8S 2OC7A 3UREA 1O2WA 3MH6A 1NFYA 4ZCNA 1IHTH 5DGJA 4TWWA 2J9NA 1YPGH 3S7HB 5B6OA 4Q80A 4HFPB 1B7XB 3ZVBA 1CT4E 1O38A 3FANA 4YLUA 3V0XA 2H1UA 1DM4B 3E91A 3H7OA 1SQAA 2XC5A 4FUHA 3EA7A 4E7RG 1ELBA 4IC5A 2G51A 1MAYA 1L1GA 1PPZA 1NY22 1YLCA 3A85A 3MU8A 2J98B 4WH6A 4Q2KA 3SV2H 2P93A 2AIPA 5JPMH 3SU2A 5G4BA 2Z9KA 1P04A 2C8WB 2OC0A 3K65B 1Z8GA 1SOTA 2NU1E 1OYQA 3F1SB 4CRFA 1TX8A 4ZHAA 3SUGA 4H42U 1G36A 4ACAA 4LK4A 5EJZA 8GCHF 1DWCH 1FMGA 5F8XA 1YBWA 2WPMS 2ZGXH 3L6PA 3LH1A 2A31A 1CO7E 1YPJH 1UVOA 4WXIA 1TX7A 5C3NA 2ZDKA 4B6FA 2OTVA 3OEED 1AUJA 1XXDA 5FHTA 1O3AA 1UCYH 2ZNKH 1O2QA 3U69H 1CGHA 4KGAA 4R8TB 4A92A 2BVRH 3E8LA 2W3KA 3NCLA 1UK3A 4ISNA 3RXFA 3A81A 3OAAD 2ZA5A 1ELAA 1N1LA 1GBAA 1TFXA 1UTQA 1YM0A 2Y81A 4MLFB 3BIVH 1C1TA 1ELVA 2FM2A 5C5OA 1UHBB 1O3KA 4IW4E 2PKSC 4BTUB 2P95A 2VH6A 1NRQH 5CHBA 1JBUH 3TIUA 2P16A 1KDQB 1TNHA 4I31A 5AHGH 2HNTE 1ZPZA 1PFXC 1GBIA 4I32A 8LPRA 2A4RA 2WPKS 2XCNA 3RM2H 1AY6H 2BY9X 1BTYA 3LJOA 1SLWB 4AYYB 1IQEA 3RXUA 2ZG0H 6CHAC 1V2MT 1DS2E 1ZHRA 3ZZBA 2FEQH 3T26A 1DLKB 3G01A 1O3HA 1OP2A 1MTVA 1WCZA 1NBMD 3BTGE 5C0TA 1FY8E 1OWDA 1F0TA 1CHOG 1OX1A 3TH4H 1V2OT 3MNBA 2HVYB 2QAAA 1Y5UT 4E05H 5DP9A 1EB1H 1NO9H 4GAWA 4D7FA 3CS0A 1AZ8A 1P2JA 5JDUB 2V6NA 3M7UA 4UE7H 5AF9H 2BLQA 4XE4A 5BRRE 3O8RA 1PQ7A 3DSOA 4HTCH 2TRMA 1CHGA 4A1VA 5L6NH 5TJXA 4Z0KA 2GX4A 3GDUA 4X6NA 1RIWB 2BX4A 3GY4A 7GCHG 2P8OB 1BQYA 3E3TA 3TGKE 1RS0A 3T27A 3MFJA 3SNCA 2HGTH 1ZSLA 1OWKA 1FIZA 4MPUA 4Q7YA 4OS1A 1C5QA 2WPDD 2ZGHA 1GI7B 1EATA 2ZCLP 1XUJA 4KELA 4ABBA 1A0HB 1C5PA 2F43B 2VVUA 2RA3A 3BTKE 5LPFA 1H9LB 3ZYDA 1DE7H 2ZDNA 2LPRA 2H9TH 2AMQA 2Y82A 1O2ZA 1O5GH 4NSVA 3P8OA 1Q2WA 1BMNH 1GJ7B 4TY6A 2Q1JA 5IYTA 2J4IA 1A3EH 2GVFA 4CRGA 1ZTKA 3KYFA 4XBDA 1V2RT 1ZTJA 4AFZA 3SORA 1GBKA 1N8OC 2R2WU 2BY6X 1O2OA 4MVNA 1OKXA 1P2OA 4DG4A 1ABIH 1LVBA 1VGCB 1DXWA 4I8LA 1ZZZA 1O2GH 3ZZAA
chains in the Genus database with same CATH topology
3MNCA 2BDBA 1YPMH 1EX3A 1GCDA 3KGPA 2FX6A 3GY8A 3MU5A 2CHAC 2VJ1A 4X6PA 1GMDG 1W0ZU 1ZJDA 4UFFH 5C1YA 1SG8B 1FUJA 2Y5GA 1A3BH 3FAOA 2BM2A 4IC6A 1FQ3A 1TBZH 3A80A 1SMFE 1GMCF 1MAXA 4Y0YE 1ZOMA 1V3XA 2ILNA 2VWMA 2WYGA 1EJMA 1KXAA 4AOQA 3BV9B 4ISOA 3F6UH 1L4DA 1ELDE 1V2TT 2XC4A 2Y7XA 1Y3WA 1VITG 3LH3A 1GI8B 1PPFE 1Y3YA 4NIYA 2FESH 4Y76A 4D76A 1AE8H 4JMYA 5CMXH 2GMTC 1F0UA 1V2QT 2ZPSA 1G3CA 3ZYEA 3SUFA 1KLJH 2H9HA 2ZCHP 3RXAA 1EPTB 2K1QA 3BEUA 2WV5A 3BG4B 1O3NA 1AE5A 1FY4A 3MNSA 4PROA 1FPHH 1NFUA 4FU8A 2BD5A 4H6SB 2J95A 2QXJA 4YT6H 2C8ZB 1GDQA 1HAIH 1QJ7B 1YPKH 3UWIA 1S5SA 1MKWK 5J4SA 2HVXA 1C5LH 1HAXB 4B75A 1CE5A 1QB6A 3BSQA 3K2UA 2AEIH 3TNTA 1TMBH 1UK2A 3QTVH 3RMMH 1ANCA 1LHDH 3RXDA 1IAUA 2Q6DA 1AI8H 1TBRH 1N6YA 1WSSH 3LC3A 1AZZA 2P94A 4BAMB 4B73A 1YPHE 1QGFA 2RG3A 2XCFA 2GV6A 2D2DA 3E0NB 2ZPRA 4BANB 2VIPA 2BY5X 4IN1A 1MKWH 4MPVA 2HOBA 3R0FA 1W2KH 3TITA 2BDAA 1RFNA 2HPPH 4X2VA 1NC6A 2OLGA 1HAYB 2OCVB 3P17H 4SGAE 2AYWA 2TGDA 2Q6FA 2FTMA 1GWAA 2PUXB 4IGDA 2NU0E 4LXBH 4CRDA 2H2ZA 3FZZA 4CREA 2A4OA 2GKVE 3DHKH 3NKKA 1P03A 2AIQA 2ZQ1A 3SGQE 2HWLB 6CHAB 1NM6A 1T32A 2NU3E 4X1QU 2DE8A 1HUTH 8ESTE 1C1MA 2OXSA 3V12A 3SGBE 2FLBH 4F4OC 4JYVH 1C5YB 3RM0H 2EA3A 4AB8A 3A7YA 2FOEA 1GHYH 1TA2A 4KTUA 1YYY1 1WTHD 2WINI 1INCA 3VB3A 2NU4E 4FUCA 4XBCA 4MDSA 1TGSZ 2FOBA 3KQDA 4UONA 5LPRA 3URCA 2OBOA 3JZ2B 4X6OA 1O3PB 1FY1A 1IQIA 2ZZUH 2OINA 1OSSA 3E90B 2XNIA 2Z94A 2PWXA 1GI2A 1HYLA 3R3GB 3SHCH 1ZSKA 1FPCH 5FPSA 3PMBB 2DUCA 1W3CA 4YLQH 1KLIH 4NFFA 1GI3A 3TU7H 3LJJA 4HZHA 3BF6H 3QO6A 2FI5E 1K1IA 2I6SA 1EZXC 1DFPA 1JRTA 4FUJA 1TIOA 1CU1A 1FLEE 3BIUH 1OP8A 1K1OA 1QTFA 2AERH 2BVSH 3T25A 4R0IA 4FUBA 1G3DA 2CMYA 3ATKA 4X2XA 1QQ4A 3MWIU 2VNTA 4UFGH 4D8NA 2A5AA 2TBSA 1SL3A 4O3UA 1BMAA 4BAHB 3SZNA 1Z6JH 5L30H 2G5NA 1W0YH 3SJIA 1EQ9A 3L3TA 2ZKSA 4WMEA 3SNDA 4ESTE 2R9PA 1CT2E 1O2HA 5FBIA 2J2UA 4DJZB 1TRYA 1SGIB 1GI5A 1CHOF 3PLPA 1A61H 5F03A 1GI9B 3VEQB 1HIAA 3BTQE 3OSYA 2ZECA 2ANKH 4O03A 1PQAA 4F49A 3K9XB 4UD9H 3UPEA 3OYPA 3B8JA 3HK6B 3ZVDA 2OC1A 3STJA 3AW0A 1YPHC 3FP8E 2F9VA 3MH4A 3ITIA 2GT7A 1S6FA 7GCHF 1HFDA 2VIVA 2FOGA 3O8DA 3RXKA 4BAOB 1SLVB 1IQGA 3MH7A 1FONA 1Y5BT 1GJAB 3M5NA 1MH0A 2BQ6B 2GCTC 3V7TA 1A7SA 1TNLA 4IN2A 1TQ0B 3KQEA 4NIWA 1BBRK 3P70B 2WV4A 3GY5A 2A0QB 1ESBA 2UUFB 4BAKB 1UVUH 2GMTB 1DY9A 1J17T 1SGPE 4CRAA 1T4UH 4TY7A 2UWPA 3F9HA 3ATIA 3Q3KA 4RN6A 4IS5A 2ZHEH 1TABE 3I77A 2CV3A 1F5KU 2BXTH 1RIWC 1ETRH 3MMGA 3PV4A 3PO1B 3PLKA 2J38A 3S9AA 1MMJN 3AASA 1A46H 1TOMH 3A7WA 5FXLA 1O5BB 1UCYE 4I8GA 4FUIA 2W7SA 3RC4A 1TOCB 4ZAEA 3U8OH 2FP7B 2VVVA 2B9LA 3RXCA 1ETSH 1MU6B 1SPJA 2V3OH 1GJ4H 1GMDF 1VJ9U 1EOLA 4JYTA 2Z9LA 1EUFA 2J92A 3PYHA 2DE9A 3FFGA 2VH0A 4YT7H 1XVMA 4X2WA 4A7IB 4VGCB 1SLXB 3ZZDA 2M5TA 1EP6A 4YESB 3DD2H 1SC8U 1TRNA 1F5LA 3BTEE 3RU4T 3P8NA 1LQEA 2SGAA 4K2YA 5GDSH 1VITF 2I6QA 3T29A 1K2I1 4U01A 5A2MH 2QV1A 1TNJA 1FXYA 1S82A 3KN2A 1GJ9B 3SUEA 1HBTH 3ZVAA 1TNGA 5HM9A 2ZDVH 1P2NA 3ODDA 2UWOA 9ESTA 5GXPA 3QLPH 5DP8A 3VPKA 5T6FA 3BTHE 2AGIX 1ZMJA 3ZV9A 7LPRA 2B7DH 4MNXA 3QGNB 3PLBA 2VIDA 1G3BA 3GY3A 3LC5A 1C4Y2 2BD8A 1ANEA 4X0WU 2SNVA 2BLVA 2H5CA 1G32B 1Z7KA 2FTLE 2KAIA 3MU0A 4OS5A 2B0FA 1MQ6A 1L1JA 2BYAX 2O8UA 1HAZB 4XOJA 5GCHG 4JZ1A 1C2EA 2HLCA 1FAXA 3OY5U 2F3CE 1XUGA 1Z1IA 3V13A 3RXIA 1TPSA 1O35A 1YCPH 1TBQH 3A8AA 4CHAB 4ISHH 3E16B 5T6DA 4WMFA 1QL7A 3RDZA 1TNIA 4NGAH 3TK5A 7KMEH 2R2MB 2FDAA 4X8UH 1W12U 1C2IA 2PSYA 3GICB 3RLWH 3SJOA 1K1PA 1SVPA 2TGTA 1EPTC 4Y71A 3A82A 4JK5A 1MCTA 3BG4C 2FZZA 3U1JB 5JYIA 1B0EA 1IQLA 2ZDMA 1DPOA 2ZFSA 2ZTZA 5JBAS 4B1TA 1DSUA 5T6GA 1EAWA 2J34A 4J2YB 2JKHA 1WV7H 1CBWB 3N7OA 4INKA 4ABDA 1V2KT 1ZRBA 1E38B 2EI8A 4Y10E 2VWNA 3Q77A 1HNEE 2BQ7B 3I29A 1KXCA 5F8TA 5JBBS 1IQHA 1T8OA 1ZPBA 3TGIE 4B2AA 1C2KA 5ESTE 1OWIA 1Q3XA 1O0DH 5J4QA 1LCYA 5EQRA 3UNRA 3KCGH 1SFQB 2R3YA 5EGMA 1IQKA 2AMPA 1P3EA 1YF4A 2BY8X 3SU0A 2QF3A 4INLA 4UDWH 3SV8A 4GCHG 1GBHA 5LPEA 1BOQA 2G00A 3PMAB 1XXFA 4U2WA 3SN8A 1K28D 3LGUA 1AWFH 3W95A 3O8CA 5C20A 3M5LA 4DCDA 3EA8A 4MPXA 4YZUA 4A1XA 4CH2B 2C90B 4FU9A 1S84A 2ZTYA 1DANH 2A5KA 9LPRA 1MBQA 2VU8E 4JK6A 2O9QA 5HMAA 1XUHA 3UQVA 1E34B 1BRUP 4GHTA 5K7RA 1O2RA 2FODA 3SNEA 1NRSH 1RD3B 1DY8A 2GCTB 1GBBA 3GYLB 1NPMA 4YOIA 2XBXA 4WXVA 1P10A 5FX6A 1SSXA 4B74A 2G81E 4WY3A 3RMNH 5E8EH 2ZU5A 3BG8A 4K3JA 1K21H 3FP7E 1AUTC 4K1TA 4Y8XA 1HCGA 1UVTH 3TJVA 1C5VA 2ASUB 2Y6TA 1F2SE 1P11E 5DP7A 2UUKB 4AYVB 1KLTA 1EAIA 3H5CB 1GBTA 1AKSB 1GL0E 1MTUA 1SOZA 3QX5H 3SU4A 1TPAE 1CVWH 3S7KB 1FV9A 3LONA 3PROA 3VB6A 1GPZA 1NU7B 1IHSH 2OQUA 1HAVB 3SNBA 7ESTE 1AVWA 1WAYB 3FP6E 1A5IA 4MNYA 4BTIB 4LZ1H 5C1UA 1NRRH 1GBEA 1MCVA 2XRCA 1HV7A 1QBNA 2STAE 4KTCA 2QGRA 1P09A 2VGCB 3E0PB 1P01A 5IDKA 2ODYB 1EB2A 3UNQA 1QBVH 1J14A 2VIQA 2YNAA 3HPTB 3OU0A 2QY0B 6ESTA 1O3CA 5C5NA 3KIDU 1TGCA 3TH3H 3GY7A 2A5IA 1T8MA 2F9OA 4RKOB 4DW2U 1F0SA 2FOFA 4DT7B 4O9VA 1P0SH 3NZIA 1XKAC 1C1PA 1D6RA 2WUBA 4X8VH 1Y59T 5JBTA 1C2MA 1HJ9A 5SGAE 4D7GA 3ATLA 5E0HA 2BD9A 2QCYA 3PB1E 1FIWA 5FCKA 1GG6C 1UHBA 2ANWA 4AN7A 2SGDE 2PW8H 1SR5C 3PTBA 1C9PA 1C1RA 2P59A 4MPWA 4Q7ZA 1BCUH 2BVXH 4BXSA 1KDQA 2PUQH 1MTNB 3SO3A 1D3QB 1SI5H 2QA9E 1KTTB 4K8YA 1OWHA 2ZGBH 5FPYA 3GY2A 3CENA 1HLTH 1ELCA 1VCPA 1B5GH 2FI3E 2ZHQH 3MU4A 4ABEA 1K9OE 5GIBA 1CA8B 2BZ6H 2CGAA 1PYTC 4NSYA 4ZH8A 3TPIZ 3RXOA 1Q31A 1NRNH 1JMOH 3TJNA 3NPSA 1LHFH 1DT2A 1LKAA 4ZKSU 5AVDA 1YP9A 2Z3DA 3V3MA 2SGFE 3MO6A 1V2ST 1VCWA 1BA8B 1Y3UA 3M61U 5HGGA 3UIRA 1GI6A 2Z9JA 2OQ5A 3GCNA 3P92A 1H8DH 2NU2E 3SU5A 1ZR0A 4LZ4B 3M5OA 1CA0B 1BB0B 1CGIE 6LPRA 1LPGB 1QFKH 4CBOA 4FUDA 1SQOA 2C3SA 4SGBE 3U8TH 1EAUA 4AFQA 3PO1C 1TLDA 3L33A 6GCHG 2PV9B 3QDZB 5GWZA 2BLWA 2ZTXA 2VINA 1GI1A 5CHAB 4MQAA 2BD2A 1H8IH 1GI0A 1G3EA 4GHQA 1SGFA 1VZQH 1UTPA 1MQ5A 4Y0ZE 2XBVA 4WH8A 2IPHA 3FVFB 1IQNA 1VITH 3ZV8A 2ANMH 1LHCH 1MUEB 2A2XH 3ZZ6A 5EXNA 2GP9B 2OUAA 1E35B 2G5VA 5FAHA 4B2BA 1ARCA 3TGJE 2JH0D 1E0FD 1C2GA 1DX5M 2QC2A 4VGCC 1XUIA 1RTLA 1AO5A 5GCHF 4Y11E 1V2NT 5I25A 3KQCA 2A45B 3S69A 1UMAH 3RXPA 4CRCA 3M36A 2GZ8A 2CN0H 3MYWA 2VIWA 4XDEA 3GCTG 1P2IA 3T2NA 1QB1A 2Y5FA 1OYTH 2H5DA 1BJUA 1T7CA 1YPLH 2RA0A 2O8TA 1O2SA 2SGQE 1AD8H 3PWCA 1AGJA 3EA9A 1C2LA 3RU4E 1O33A 2ZU4A 1FNIA 2W5EA 4O97A 2G4TA 1RXPA 3A7TA 1EZSC 1GCTB 4KKDA 3KNXA 1LHGH 3AAUA 4UFEH 1T8LA 2C93B 3M7TA 1OP0A 2ODPA 1GVKB 1G37A 2BX3A 1AFEH 2ALPA 4LOYH 3SJ8A 2PHBA 4CHAC 3ZZCA 3A8DA 1TMUH 1P2QA 2XWBI 1QY6A 1DICA 2BDIA 1DXPA 1V2PT 1TX6A 4GVUA 2JETB 2O8WA 1PPHE 1UTJA 1QQUA 1XX9A 3M3TA 5EQQA 1S6HA 3QK1A 1GBMA 1EZQA 4FXGH 1GHAG 1HAPH 3LIWA 1D3DB 2GTBA 1TRMA 1SGYE 4DY7B 2ZI2H 4GCHF 1WYKA 1EPTA 2XBWA 2BDHA 1IQJA 1UTKA 1WQSA 4B76A 1EKBB 3GOVB 1O34A 5A09A 1P12E 2QXHA 1QL8A 1FZZA 1CBWC 1C2JA 5E2PA 4CH8B 1IQFA 1HXEH 1DITH 1RJXB 3TH2H 1SGCA 3TNSA 3VB4A 2SGEE 3HK3B 2TGPZ 1V2UT 2BDYA 3D65E 1AWHB 1Z71A 1HAOH 4UEHH 1F0RA 1THPB 1KSNA 1RTKA 1OWEA 4FVDA 1V2JT 1JXPA 3EGKH 1O30A 4XSKU 2ZF0H 3DFJA 3A7XA 2BDGA 3MH5A 2PKAB 1GJ8B 3QGJA 1BIOA 3ELAH 4NZQA 2EEKA 1GBCA 4I33A 1W14U 4X8TH 4ABFA 1O3BA 4OGYA 1GG6B 1C5TA 1W10U 3RXQA 1D9IA 1GL1A 1O3OA 4WVPE 3IWMA 1S0QA 1T31A 1SGQE 4Q7XA 4ZUHA 3U9AH 2WPJS 4ABJA 3STIA 3SV7A 1ANBA 2XXLA 1BHXB 2G52A 2Z6BD 2B8OH 5DO4H 1SGFG 1NESE 1GMHG 3VFEA 1BHXF 5AFZH 4GPGA 1W7GH 3PTNA 5C67A 1AFQB 1PJPA 3GCOA 4K1SA 2CF9H 2FI4E 1U6QA 1OXGA 1G30B 1K1JA 1JIRA 4Y79A 1MTSA 3A7VA 4O3TA 3LGIA 1GVZA 1XKBC 3A8CA 5FBEA 4ABHA 4Y8YA 3PMHB 3F9GA 2JH5D 4K69A 2RCEA 3LGVA 1ORFA 1QIXB 1ANDA 2GCHG 1F5RA 1O3LA 1O2IA 4CR9A 3P8FA 1YLDA 4YM9A 4TPIZ 1CSOE 2BY7X 1C5UA 2FYRA 3SU6A 4AG1A 2HNTF 4BXWA 1DSTA 1BBRH 2FXRA 5E2OA 2A2QH 1E37B 1MBMA 2H6MA 1MZAA 2TIOA 3OX7U 3P6ZB 1J15A 1LVOA 2PLXA 3EAJA 2A1DB 1O3MA 1HAHH 2VGCC 1B0FA 1Z8JB 1BRBE 2ZFRH 1S0RA 4GSOA 1SQTA 4KP0A 3UOPA 1G2MA 4AX9H 2H9EH 1RRKA 1C2HA 1AVXA 2FMJA 2TPIZ 4I8HA 1LO6A 2OC8A 4K5ZA 2C8XB 3TVJB 1NU9A 5ETXA 2D26C 1WBGB 1ZRKA 1QCPA 1C1VH 3U98H 4A6LA 1KIGH 1MZDA 1ARBA 2AH4X 4YTAA 3K6YA 1NTPA