7ESTE

Interaction of the peptide cf3-leu-ala-nh-c6h4-cf3(tfla) with porcine pancreatic elastase. x-ray studies at 1.8 angstroms
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ELASTASE
publication title Interaction of the peptide CF3-Leu-Ala-NH-C6H4-CF3 (TFLA) with porcine pancreatic elastase. X-ray studies at 1.8 A.
pubmed doi rcsb
source organism Sus scrofa
total genus 55
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1990-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 7estE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 7estE01
1CHOF 1YBWA 5DP8A 1P03A 1TYNA 4ABDA 1DSTA 1TGSZ 1G2MA 1C2HA 2ZDNA 1HBTH 1ELGA 1MKXK 1ZMNA 4QT8C 3BV9B 4GSOA 1CHOG 5E8EH 4MPUA 2PSXA 1Z8IB 2Z9GA 2ZEBA 2LNCA 1QA0A 5DJ7A 4YM9A 1C1WH 4B75A 2AMPA 3QGNB 3ELAH 3MO3A 1TBRH 1GJCB 2F9UA 1C1PA 5JBBS 5JBCS 1P04A 1JMOH 1SGFG 1O36A 3SGQE 3TGIE 1SGRE 4O3TA 2PFEA 3GISB 1OP2A 1FZZA 3E0PB 1YPHC 1AI8H 1OX1A 3WY8A 1OWEA 1TNJA 3MU5A 1ABIH 3DA9B 1KDQB 2NU0E 4MPXA 2ALVA 2A7CA 1EJNA 3T62A 1ZTLA 3P6ZB 2AGEX 3HPTB 4IW4E 3HGPA 1GHAF 1QQ4A 3KL6A 4ABAA 2G5VA 1TQ7B 2O8MA 1HCGA 3F9EA 3MWIU 4GVUA 5CE1A 5J4SA 1NRRH 1LHDH 4E7RG 5JBTA 1E35B 1NN6A 2F9NA 2TIOA 3NXPA 1GHAG 2STAE 1QNJA 1JOUB 1AFQC 3SJ8A 5C20A 2B8OH 1O3BA 3P92A 1IQKA 3GY8A 1BTZA 5F03A 4CR5A 3BTQE 1C5VA 1Z8RA 4GUXA 3DT0H 1WQVH 5LPEA 3PWBA 2BX3A 3ITIA 3M61U 3VGCC 2SGPE 2A32A 3SNCA 1F0SA 2OQUA 3PMBB 1SGQE 3RXQA 1W10U 2WPJS 1D3QB 2A5AA 2FOAA 2TGPZ 1EKBB 1TGNA 2A5IA 4U01A 3UTUH 1GMHG 1SBWA 2ZGJA 3RXSA 2BDBA 1SLVB 4Y79A 1ZHPA 3CENA 4SGBE 4AGKA 3RXIA 2VINA 4DT7B 1HXFH 1MCTA 4XFQA 1BMNH 3GYMA 1BMLA 3GCOA 3GDSA 4UONA 1GMCF 2W7UA 1PPFE 2JH0D 1PQ7A 4Y6DA 2FM2A 1C9PA 3GDUA 1YGCH 1LDTT 3SV2H 1P2KA 3ATWA 1FJSA 2W7SA 1UK3A 1QBOA 2RCEA 2QYIA 4MNVA 1KDQA 2ILNA 1Y59T 2ZQ1A 3LGWA 1C5OH 1OSSA 3MOCA 4D9RA 3T5FH 1SQOA 1ELVA 3MU1A 4D7GA 6CHAB 1MTNC 1TMBH 1Z8JB 2FWWA 1O3KA 1WV7H 3OU0A 3UFAA 4H42U 1TIOA 3V3MA 2V6NA 4ISHH 3MH7A 3IWMA 3RC4A 2FOBA 3TVJB 2VVVA 1VGCB 3TITA 1GI1A 1CT2E 1GPZA 2CN0H 3SUGA 3O8RA 2FO9A 2ZHQH 5FBIA 3M3VA 1IQJA 2RG3A 3VB4A 1UMAH 4LZ4B 1P12E 1UCYK 2P16A 1DY8A 3L3TA 1KYNA 5DP7A 3ZVGA 4YTAA 5DK1A 3FZZA 1G3CA 4NIVA 4B2CA 2A4OA 3A80A 2V3OH 4KTCA 4X6MA 5BRRE 1TRNA 3JZ1B 4O97A 3PWCA 3ZZCA 1W12U 1GL0E 1TPSA 4K1SA 2ZI2H 1N6XA 1ZRKA 5A0AE 2FOMB 3VPKA 3PM3A 1D6WA 1C4V2 2ODPA 2EI6A 4Y7AA 1ELEE 4BANB 1QURH 3S69A 1MU6B 3LONA 5JB9S 4NGAH 4KELA 2CGAA 2BZAA 1EQ9A 1EOLA 1XXFA 3E8LA 1XX9A 3KQBA 3OSYA 3FFGA 4UFEH 3SUDA 1GBJA 4Y71A 1NFXA 5LH8A 2P3TB 3SJIA 1QL7A 1W2KH 4WJG2 4X2WA 9ESTA 1C1QA 4CRDA 3HK6B 1TNGA 1ELFA 3SBKA 1NS3A 3Q00A 2WPIS 3A89A 5HXFA 5T6DA 1IQGA 4HFPB 2UWLA 1J9CH 4F4OC 2Y6TA 4X1PU 2ZA5A 2FX4A 1L1JA 1TRYA 3ZVBA 3TU7H 4JZIA 3MNXA 4U2WA 5L2YH 1O5DH 4KGAA 1O32A 8LPRA 2OBOA 1NU9A 1NESE 5E0HA 1TGTA 3A8BA 2OXSA 4AYYB 2BD9A 1O3FA 4DG4A 4XDEA 1K9OE 1DX5M 3UY9A 7GCHG 1LQEA 1BBRE 1K22H 1HAIH 2C8YB 1ZOMA 2KAIA 2F3CE 2OQ5A 1BTPA 1KSNA 2ZIQH 4F49A 1YYY1 3GY7A 1O3HA 1TGBA 1T4VH 4Y11E 2SNVA 4H6TA 2GV6A 3ZVDA 1PPBH 2FXRA 2R3YA 2Y5HA 4K69A 8GCHG 1QTFA 2DE8A 4NIXA 1O33A 2P93A 1O5GH 7ESTE 2TGAA 2PGQB 3KEEA 3NUMA 1CO7E 1VR1H 2J2UA 2G4TA 1VZQH 1UK4A 4WMFA 5EU8A 2XC0A 3LIWA 2A7HA 1AGJA 2P95A 1D9IA 3K65B 1ELTA 2ZKSA 2C3SA 2WPMS 4CRCA 1F92A 1HAXB 1T8LA 3RXUA 1EJAA 1MU8B 4HGCA 1ARBA 4NCYA 1GVZA 3LOXA 1V2WT 1Y3XA 2ZFTA 3DFLA 4DVAU 2CF8H 1VITG 1O2NA 2V3HH 1LHEH 2G8TA 3VXFH 4MNYA 2ANMH 1ANEA 4DOQA 1K1LA 2R0LA 1ANCA 2Z9KA 1V2JT 4IC6A 2A2QH 1BZXE 2I6SA 2Z3EA 3FVFB 4JK6A 2XTTB 1GBEA 1TBQH 2PHBA 2ZPQA 1CGJE 1Z8GA 1GBKA 1WOFA 3PTBA 3L6PA 5DP5A 1TA2A 1GJAB 1ZTJA 4MPVA 1C5WB 1FPCH 4OS5A 3RC6A 1P8VC 4A92A 1G3BA 2C93B 2THFB 1LVOA 1O2WA 3D65E 4ABBA 4AGJA 1FPHH 4XSKU 4AN7A 1KXFA 1QL8A 1JRSA 4TPYA 1D3DB 2C90B 2TGDA 3RC5A 2BLQA 1PQAA 1LCYA 2ZFSA 4I8GA 1AN1E 1FI8A 1GHYH 5C67A 1AE8H 2CV3A 3BIVH 5SGAE 4JK5A 4K60A 4MNWA 1YPLH 1HJ8A 4BAOB 1DXWA 4NIYA 2ZPRA 2BD8A 3A7YA 3GCTG 3A8AA 5A2MH 1LQDB 2ZGHA 1ZHRA 2PKSB 1RTKA 3SU5A 4R0IA 4D76A 2Z3DA 3QN7A 1O2PA 5DP4A 1Y5AT 1Y3VA 2PUQH 1U6QA 1IHSH 1OKXA 4X6NA 5AHGH 1GCTB 1TMUH 3M36A 5GCHG 1OWHA 3HKIB 3ESTA 5AVDA 3PLKA 3ZZ6A 2VWLA 3M5OA 3ZZ3A 3ZVFA 1J17T 2XYAA 4IN1A 3T29A 1J15A 4CRBA 4ABGA 1LVYA 5DP3A 2O8UA 3S0NA 1EPTC 2D26C 2QV1A 5DO4H 4FUEA 1LHFH 4YT6H 2GD4B 4B2AA 3MI4A 1BRCE 3LDXH 3TJOA 1AD8H 4X2XA 4Y8XA 1C2GA 1FY5A 3GCHC 2ZO3H 1HAYB 1ESTA 1OOKB 1KTTB 1G37A 1P3CA 3S7KB 1DWDH 1DWCH 1GI9B 1C5LH 1FN8A 4YOJA 1L0ZA 1ZZZA 4Y0ZE 1EUFA 1S85A 4FU9A 3MFJA 4FUJA 2BOKA 1VCWA 3TH3H 2GDDA 1YPJH 1GHXH 3QDZB 3RXFA 3QO6A 1O2QA 3B8JA 3SW2B 3Q76A 1AB9C 2I6QA 1G36A 1G2LA 1DPOA 4ZKNU 1A5IA 1GMDF 1HRTH 5C2ZA 2F83A 1GI5A 4TWYA 4K8BA 1F5KU 1TABE 1CA0B 3MH6A 3SHCH 4BTIB 3T25A 1GHZA 1GBHA 3AAUA 1C2KA 1NZQH 4K5ZA 1KY9A 2EC9H 2Q6GA 1IQEA 4ZKOU 1HLTH 2FIRH 5F8TA 1GI3A 1EAUA 2WPKS 2Y5FA 3NZIA 1W7GH 2FPZA 1SGCA 3OYPA 3P8NA 1TONA 1XMNB 1WBGB 2CF9H 2D1JA 2ZHDA 4MNXA 1EAXA 2H1UA 2P3UB 5T6GA 1ZMJA 1QRWA 2P8OC 4NSVA 3NK8A 2ZHWH 2CXVA 4MVNA 1O2XA 1RRKA 5ESBA 1ZSKA 1LHCH 2STBE 1EZUC 3EA7A 4H4FA 3V7TA 2ZFRH 3BTME 2J38A 2XCNA 1JWTA 1NO9H 1O2TA 4UD9H 3GY5A 3UNQA 5E2OA 1OYTH 1G9IE 1G30B 4HZHA 1BTWA 3A85A 4OGYA 2FI4E 1V2LT 3EGKH 3M7UA 6GCHF 1FAKH 3ZVAA 5IYTA 1RXPA 2GT7A 1ZSLA 4XBCA 2GZ7A 1DITH 2AS9A 4DURA 2Y5GA 4BXSA 2G5NA 5JYIA 3P70B 1RTFB 1TNHA 3ODFA 1AMHA 1MH0A 1GI7B 1UO6A 6GCHG 3MU8A 2ZC9H 3RM2H 1TE0A 1ACBE 2BHGA 5F6MA 1CSOE 1C1RA 1WTHD 5FPTA 3SO3A 1AO5A 1TFXA 3QTOH 1DSUA 1MTWA 2BVXH 2RA0A 3I78A 4JYUH 1FMGA 1YPEH 1QB6A 2D8WA 5DPAA 2BDYA 1A5GH 2BDGA 1A0JA 2H9EH 1AZZA 4K1EA 1KXDA 1W14U 2G81E 3E3TA 2ANWA 1TQ0B 3C1KA 1AFQB 1HDTH 3VB3A 5AFZH 1O2LA 4IGDA 3JZ2B 3ZVEA 4UFFH 2XBXA 3ENSB 3QK1A 3UWJH 2UWOA 1UTMA 2AYWA 1O2GH 2VVUA 3SQHE 2G52A 1GJBB 1HAGE 1J14A 3STIA 1S6HA 3VGCB 1Z1IA 2ALPA 1PYTD 4TY6A 1RIWC 4MPWA 3SGAE 1BCUH 3BEUA 1O3NA 1JIRA 3MHWU 1ETSH 4WVPE 2FEQH 2CHAC 1DUAA 2ZDLA 1EP6A 1OP0A 1VCPA 2FLBH 2NU2E 3GICB 2QXJA 1AY6H 4O03A 3ODDA 1AVGH 1YCPK 3BEFB 1P2OA 2BD5A 5LGOA 5EODA 4JYTA 2WPLS 2VIOA 3PB1E 3S7HB 2A1DB 1HIAA 3MNBA 1G32B 1JXPA 3H5CB 1O2YA 1VJAU 1ZHMA 1Z7KA 1BB0B 2NWNA 4B74A 1X7AC 4U30A 2XBVA 5JB8S 3TK9A 1KXCA 3PMHB 1V2NT 3AW1A 1NRQH 4J2YB 4UE7H 1LHGH 4B76A 4D8NA 4KTUA 2V0BA 3FZDA 1SGFA 2W26A 2ZCKP 5DGJA 3TGKE 1G3EA 1SQTA 1O3GA 2Q1JA 1W0ZU 1UTNA 1UK2A 5FHTA 1A4WH 1NU7B 4MTBA 3RXEA 4Q80A 2FOHA 1MCVA 1SSXA 1UVPA 3BEIB 3U8TH 2VNTA 1HAZB 1N8OC 3EAJA 1ELCA 1GMHF 2UUJB 4X0WU 1WTGH 3KGPA 1B5GH 1C9TA 2F9PA 4I32A 1P9SA 3GY3A 2FESH 1GBCA 1AQ7A 2FI5E 2VWOA 2NU3E 1T8MA 4CH2B 3W94A 4AOQA 1FAXA 1O2UA 3BG4C 2SFAA 1ANBA 5DP6A 3ZYEA 3RXGA 1ZGIA 2QF3A 1YPKH 4A1VA 2A7JA 1NFWA 3SI4H 2Z7FE 3LC3A 4FVBA 5FX5A 1C5NH 3SNBA 1O38A 3UPEA 1AUTC 4FUGA 1A0LA 3PMAB 2SGFE 1CBWC 2ZU1A 1IQMA 4Q7ZA 1UTKA 1EP5A 2NU1E 1GWAA 2HWLB 1BQYA 2GGVB 3RXTA 1A1RA 3MNCA 1SGPE 2PR3A 1O5EH 2FMJA 3E1XB 1GGDC 1NRNH 1XXDA 1P11E 4BAQB 3MTYA 1TWXB 1OS8A 4U32A 5A0CA 2WPHS 5HM2A 3UOPA 1Z1JA 2HNTE 1HFDA 2BYAX 1GI6A 1ID5H 4D7FA 2F9VA 2AEIH 2FP7B 2QY0B 3BTTE 4IMQA 1AWFH 1GG6C 2VU8E 1MTVA 1G3DA 1WU1A 1AUJA 2VGCC 1O3LA 3ATMA 2KAIB 2Y81A 3FP6E 2ZG0H 3RXDA 1HYLA 2QCYA 2SNWA 4B1TA 2Y7ZA 4KP0A 3KHVA 3KQDA 1WAYB 1TGCA 2W3KA 5CHAC 4ZH8A 1S83A 1C5RA 2R2MB 1DLEA 1XUKA 2O8LA 1DICA 4ZMAH 1GJ4H 1O3JA 7KMEH 1K1OA 1O2IA 5E2PA 1C1SA 1KXEA 2TGTA 4IMZA 1GDQA 1NM6A 2EI8A 4WH8A 1C5MD 1EASA 1HJ9A 1LPKB 1BIOA 4DGJA 1ORFA 2QC2A 1MBMA 5AFYH 4Z6AH 1M9UA 2Z9LA 2WUCA 3R0FA 5C1UA 2A31A 1DVAH 1WUNH 1Z6EA 2AGGX 1SGYE 4X1RU 1O35A 5C1YA 1K21H 2D2DA 4ZROA 4KKDA 1SFIA 3UR6A 5EXNA 5L6NH 3RXPA 6ESTA 2OD3B 3K9XB 2J92A 1O3DA 3LKWA 4YZUA 1BTUA 2J9NA 2ZZUH 4CH8B 3OY5U 4THNH 1W11U 1NROH 3P8OA 1HJAC 4Q7XA 2GCTC 1THRH 2VIVA 4INLA 4ABFA 1FDPA 3RU4E 1HAPH 1NC6A 7GCHF 3PLBA 3QZQA 4X6OA 3GDVA 5EPYA 4DIIH 1BDAA 2DE9A 4ZKSU 2SGDE 3KF2A 4ISOA 2H5CA 1GBMA 3A88A 4X1NU 4A1XA 3ZZ5A 3BTEE 5EQQA 1TX7A 1K1MA 2AGIX 2BY8X 5EW2H 1LPGB 3DFJA 1XKAC 3RXKA 4CHAB 1Y3WA 2ESTE 3FP8E 4JZEH 2GX4A 2OP9A 1QY6A 1H4WA 3R3GB 2QGRA 3URDA 8GCHF 1HGTH 1HAOH 1ZRBA 1NY22 1VJ9U 3RXMA 2ZDAH 4NA9H 2FYRA 1TX6A 1CQQA 1ELBA 2VWNA 1GHWH 1MBQA 1EX3A 2VIPA 3AVZA 1H1BA 1TMTH 4JZFH 2A5KA 1LO6A 2HRVA 3ATLA 1FONA 4AFSA 1YC0A 3F6UH 4LOYH 8ESTE 1ZYOA 4OS4A 3SU1A 1BTXA 3UWIA 1MKWH 5HGGA 1UHBB 2A0QB 3Q3XA 2XBWA 1SC8U 2BY7X 1FIZA 1C2DA 1C4U2 1YPHE 1QFKH 3S9BA 3IITA 2R2WU 1KLTA 4J1YA 1AWHB 3K2UA 3CP7A 4RKOB 1VITF 3E16B 3M5MA 2PUXB 1SPJA 1O5AB 3E90B 2IN2A 1C4Y2 3S9AA 4WH6A 2FOFA 5FCRA 3ZV9A 1QJ7B 1IQHA 2OC8A 1CA8B 1O2RA 1O2OA 1MQ6A 3HK3B 1AFEH 3VB7A 4K3JA 1INCA 3A7XA 4NSYA 4I33A 1MD7A 2ZHEH 5C1XA 3F9FA 5EG4A 3LPRA 3A7VA 3AASA 1SLWB 1UTLM 4DY7B 1L2EA 1FIWA 3A7WA 2PSYA 2A4QA 2XW9A 2ZTZA 1MKXH 2ODYB 1FQ3A 3OTJE 2BXTH 1GJ7B 1HUTH 1OP8A 1S5SA 4A7IB 1T7CA 5H4IB 1C2JA 1LVBA 1ZR0A 1ABJH 3U1IB 1SI5H 1P2QA 4ISLA 5JDUB 1O37A 1S82A 3UQVA 2A4RA 1T4UH 1EPTB 1B0EA 2UUKB 3SV6A 2HPQH 2H2ZA 1KXAA 2BLOA 3MYWA 1AKSB 1O3EA 4IBLH 2OC1A 2AFQB 3GCHB 1YCPH 4E7NA 3GCTF 4GAWA 4GCHG 3SU2A 4X8VH 3NCLA 1QJ1B 1P05A 2WV4A 3SNAA 4ZKRU 1W0YH 4X1SU 3P95A 4ASHA 1UHBA 2UWPA 5FPSA 2ZNKH 1AIXH 1C1OA 3UOUA 3RUOA 1MTUA 4I31A 1GCDA 2XRCA 5TCCA 4FUCA 3T26A 5GCHF 1QB9A 3PO1C 1AB9B 1NFUA 1F5LA 4Y7BA 1XVMA 2AMQA 5FPYA 1QRZA 4H6SB 5A8XA 3FANA 1C1UH 5ESTE 2XWAA 1O5CB 3BTFE 4ISIH 2GV7A 1OWKA 1UCYE 3U1JB 3QZRA 1TA6A 1MUEB 4CR9A 2BOHB 4AFZA 3RMOH 5T6FA 1GI2A 1V2KT 1FN6A 1ZSJA 2BY5X 3SJOA 1EAWA 2BY9X 1FXYA 1DOJA 2F9OA 2JH5D 5BPEA 3ATIA 3SHAH 2JETC 3LGTA 3BG8A 1GI0A 3F9HA 4HI3A 2BQ7B 1MAYA 3FP7E 3GCNA 1ETTH 3MO6A 3A8CA 1V6DA 2BXUH 1GBFA 1LKBA 7LPRA 2HLCA 2BLVA 2CJIA 1BT7A 1C1MA 1C2EA 2P94A 1EPTA 1OWIA 2XNIA 3MU0A 1BA8B 4GHTA 3EA9A 3A7TA 1RFNA 1ZJDA 1BMMH 3B9FH 4ABJA 1ANDA 3TK5A 1AKSA 1TAWA 1XUHA 4FUBA 4YESB 1ZPZA 3RMLH 1XVOA 2QAAA 4A1TA 3A82A 3QTVH 1HXEH 2PKAB 1V2TT 2ZFFH 4K8YA 3RXVA 3N7OA 1A3EH 4ZUHA 4FU7A 3F9GA 1GJ8B 1T8NA 3MU4A 4ISNA 4BOHA 1QB1A 4ZXXH 2JH6D 4TPIZ 2TPIZ 3RU4D 4AB8A 2W5EA 4B71A 1HAVB 4NFEA 2HNTC 1TOCB 2K1QA 1OPHB 3Q3KA 1O2ZA 2YNAA 1XUGA 2O9QA 1TB6H 3DUXH 3RDZA 2R3UA 1O2SA 4VGCC 4XBBA 3TJVA 1NT1A 4XOJA 1JRTA 1LVMA 3SV9A 1EOJA 1QJ6B 2ZU5A 5EXLA 1HB0B 2Y80A 1IOEA 1UCYH 1DE7H 3M7TA 3BN9A 1A2CH 2FI3E 2ZTYA 4Y8YA 1HPGA 1DDJA 1ELDE 4IS5A 4GLYA 4JZ1A 4X6PA 1SVPA 1TX8A 4NZLA 4ABHA 1DFPA 1O2VA 2XBYA 2IPHA 5DKMA 2ZDVH 5IDKA 1TALA 1C5ZB 2VIWA 1GDNA 1HIAB 4ZXYH 2VB0A 2UUYA 3BIUH 2OUAA 1P10A 5GWZA 1RIWB 2G51A 1C5PA 1SQAA 3GY2A 3PROA 4MQAA 4BNRA 3QGJA 1T8OA 1XUJA 1DUEA 2VWMA 3E6PH 3SQEE 2ZU3A 2Z3CA 4RKJB 1ZGVA 4D9QA 1B7XB 2BDAA 3A84A 3LH3A 1K1IA 3PLPA 3ZZ8A 1SGDE 3UREA 2B7DH 1O2MA 2GVFA 5AF9H 1ZLRA 4IC5A 1YLCA 2PKAA 1CU1A 1BITA 3S9CA 1MAXA 1QR3E 2ODQA 3RXJA 1RGQA 3QWCH 3EQ0H 1K1NA 5CMXH 2ZGCA 1DANH 1SGEE 2BD7A 2PGBB 1IQLA 2C8XB 3UNSA 4ESTE 1HAVA 3MH5A 4JMYA 1FNIA 1OWDA 1A3BH 3ZZ7A 5F8XA 2BM2A 4CREA 2FS9A 4FUHA 4WMEA 1CE5A 1CT4E 1EAIA 2PTCE 1QA7A 1TPPA 4UDWH 2C4FH 2GMTC 1UVSH 4ZHAA 4LXBH 1P02A 4OS2A 1O3MA 1N8OB 4ZHMU 1GI8B 3TGJE 1TNLA 1UTPA 2ZU2A 1IQNA 4AFQA 4GHQA 3T2NA 3KQCA 1Q31A 1GBDA 1QRXA 1W3CA 3RMMH 1THSH 1O5FH 5HYOA 3T28A 4FUFA 1O3CA 2BDCA 3M35A 3ZYDA 1SL3A 4NG9H 2V35A 1O3IA 1YM0A 3BG4B 4KTSA 5TJXA 5DP9A 1C5TA 3EA8A 1HNEE 1Y5BT 1N6YA 3K6YA 5JPMH 4Y76A 1BBRK 1EATA 1F0TA 1L1GA 1K2I1 3ATKA 3E0NB 2P59A 1C5SA 3M5NA 4TWWA 1QIXB 3RXRA 4TY7A 1P2IA 3PV4A 1CBWB 4CRGA 3LJOA 2ZGBH 4SGAE 1N1LA 1V2UT 2EEKA 5JBAS 1TNKA 1J8AA 3TH4H 2AH4X 2QIQA 1FV9A 2Z94A 1TBZH 3VB6A 3U9AH 2QA9E 3U8OH 2FZZA 2BY6X 1E38B 2Q6FA 1GGDB 1MTNB 2AIPA 4WWYA 2G55A 1SHHB 4AB9A 3BTHE 3HATH 3SORA 1V2QT 3M37A 4NIWA 4CRAA 3G01A 1L1NA 1H9IE 3OX7U 4CRFA 1Y3UA 1SLUB 1GBTA 1XKBC 1T31A 3EE0B 1GG6B 3RXHA 2F91A 5J4QA 1Y3YA 4WXIA 4YT7H 2VGCB 3RM0H 3LGVA 2QXGA 1NFYA 5GXPA 4I7YH 2QF0A 3TJUA 5EW1H 2C8WB 2OCVB 2G00A 2M5TA 3FAOA 4NA8A 3T27A 5A8ZA 4LZ1H 5CHAB 3O8CA 2ZCLP 1SGIB 1CGHA 2GP9B 1Z71A 3NKKA 1PYTC 1QHRB 5FCKA 1YPMH 2GKVE 1SR5C 4X2VA 1MQ5A 5LPFA 1W13U 1VITH 3M3TA 3LGIA 2Z6BD 1P0SH 2GZ9A 3A87A 2OBQA 2H9TH 3MO9A 1TOMH 5L2ZH 1GJ5H 2Z9JA 3LU9B 5F8ZA 3SU3A 3D49H 3VFEA 1KTSB 1W7XH 1QCPA 3BTDE 3SUEA 2B5TB 2NU4E 4FU8A 1ZMLA 3UQOA 3BSQA 3DD2H 3P8GA 1NTPA 5FAHA 1GMCG 1GJ9B 1O30A 2GT8A 3I77A 4Z0KA 1S0QA 4INKA 1S0RA 2OTVA 3STJA 3O8DA 1NRPH 1ZPBA 5I46H 2PLXA 1TPAE 3AW0A 1T32A 1GDUA 1C2MA 1HJAB 1NPMA 3SZNA 1EB1H 3VEQB 3PTNA 2AIQA 3Q3YA 2FDAA 3W95A 2GCTB 3LJJA 4YOGA 3TJNA 1PPZA 4MLFB 1BTHH 3ZV8A 3I29A 3EYDA 2OC7A 1BUIA 3QUMP 2EA3A 2IOTA 2VH6A 1ZTKA 2BDHA 5C5NA 2IJOB 2CMYA 1Q3XA 3U8RH 4FXGH 3SNDA 4NFFA 2WINI 4WXVA 1BRAA 1DM4B 2J94A 1O3AA 1C5XB 1E0FD 1RJXB 3NPSA 3BF6H 1A46H 1JBUH 1ETRH 2QN5T 2H9HA 2BTCE 2BD4A 4JCNA 4YLQH 1SB1H 1AZ8A 1ARCA 1LTOA 4WF8A 1UVUH 3SOSA 1E36B 1HV7A 3A86A 5GPIB 1D3TB 1GHVH 1UVOA 5GDSH 1GBAA 1KXBA 1C2IA 1V2OT 1AVWA 2BQ6B 1GBLA 2FYQA 1O2JA 3DHKH 4X2YA 4Q7YA 1BMAA 4XBDA 1XUIA 1QQUA 3SU4A 3UIRA 4CBNA 1BJUA 2VIDA 5EQRA 6CHAC 2O8TA 4BXWA 2VIQA 4ZHLU 1CGIE 3OY6U 1H9HE 1UTOA 1E34B 5FX6A 1YF4A 2OLGA 2PTNA 2O8WA 2BD3A 1YLDA 2XC4A 1F5RA 3KNXA 5L30H 1FY4A 1HAHH 1VGCC 2ZDKA 4BAKB 1J16A 2FX6A 1IAUA 1MMJN 5GJ4B 3TK6A 2FTLE 3EDXB 2W3IA 4ABIA 2SGAA 3RP2A 4AZ2B 4DIHH 2QXHA 3UNRA 1FY8E 1PFXC 3CS7A 3PYHA 4YOIA 1UTQA 5C5OA 1UJ1A 1K28D 2ZECA 1P01A 1TPOA 1O31A 4A5TS 1BJVA 1A61H 3ZZBA 1DLKB 1SG8B 1IQFA 1C5UA 4I8HA 2Y82A 4B2BA 5FXLA 1CVWH 1SOTA 1WCZA 1P09A 2WYJA 4X8TH 3V12A 1ESBA 2R9PA 3F1SB 1P2NA 4RN6A 5DG6A 2AMDA 2BX4A 1LKAA 1C2LA 1OYQA 1P06A 3LT3A 3MMGA 5E0JA 4FVDA 1VCQA 1D6RA 5HMAA 2GTBA 2ULLA 4GPGA 1S84A 3RXAA 2ANYA 3SV7A 1TNIA 2PWXA 2SGEE 2HVXA 1DWEH 2FTMA 9LPRA 1PQ8A 2J95A 3SJ9A 1NRSH 3BTKE 4I8KA 1O0DH 4BTUB 2A4GA 2OINA 4UFGH 4TYDA 1PQ5A 1GHBF 4AYVB 1EXFA 4Y10E 2J34A 1V3XA 2WV5A 1AVXA 1GJDB 4ZAEA 1MTSA 3GY6A 3CS0A 1JIMA 1C2FA 3RLWH 4OS1A 1GHBG 5A0BA 1EZXC 3AAVA 1AU8A 4UEHH 4Q2KA 3SUFA 1P2MA 3PO1B 5EGMA 1YPGH 1CT0E 1O2HA 3GY4A 1O39A 1GBIA 1GI4A 3V0XA 1KIGH 2AERH 3E91A 3H7TA 1WYKA 1H8DH 2ZFQH 3K6ZA 2VJ1A 1KLJH 4RSPA 3PMJA 1B0FA 3F68H 4CHAC 2C8ZB 1FLEE 3KN2A 1UVTH 4GCHF 1E37B 6LPRA 3ZVCA 2H5DA 3VB5A 1L4DA 3RXCA 4INHA 5A8YA 2JETB 1OWJA 1EZSC 1F0RA 2GCHF 1THPB 1A5HA 1SOZA 1KLIH 1PPHE 1DY9A 1SMFE 2BD2A 3BTGE 4A6LA 4MG3A 1MZDA 4X1QU 1TRMA 5C3NA 1O34A 2FLRH 2GCHG 1ESAA 1BBRH 1MD8A 2BB4A 2FOEA 3BTWE 2BLWA 4M7GA 2WUBA 1TLDA 4O9VA 1SGTA 1FY1A 5I25A 5GIBA 4E05H 3SGBE 2VVCA 1F2SE 2P3FH 3SI3H 3HKJB 1SHYA 2ANKH 2F9BH 5E0GA 1RD3B 2ZHFH 5T3HA 5EPNA 4NA7A 2RDLA 2VH0A 2ZQ2A 2SGQE 1V2PT 1CHGA 5K0HA 2ZTXA 3KCGH 1V2VT 4AORA 4JYVH 1PPEE 1D4PB 5ETXA 1PJPA 3O8BA 3HGNA 4LK4A 3TPIZ 3UR9A 2H6MA 3D23A 1QL9A 2XXLA 3A8DA 4AG2A 1V2RT 2FOGA 1ZJKA 2ASUB 3GYLB 1EZQA 2OC0A 2YOLA 5B6OA 1Y5UT 1C1NA 3LC5A 1ELAA 4VGCB 2P8OB 4ABEA 1RTLA 2Z9IA 3L33A 4NWKA 3TNSA 4BTTB 1IQIA 4WMDA 4AG1A 1EJMA 5EOKA 3URCA 3LGYA 3P17H 1D3PB 3TIUA 2PV9B 1XUFA 4NWLA 4DCDA 4B73A 4JZDH 2HALA 1LMWB 1AHTH 1DWBH 1V2MT 2HNTF 2QXIA 1AE5A 2FODA 1O5BB 2ZF0H 3MH4A 1C1TA 3IG6B 3P8FA 3U69H 4MDSA 2EI7A 4BAMB 3H7OA 4WY3A 4OS7A 1RS0A 2BDIA 3D62A 1S6FA 3SU0A 2ZCHP 5HM9A 4O3UA 2ZDMA 3TLOA 1K1JA 1V2ST 3TNTA 3QX5H 2XC5A 1QBVH 1DT2A 1DXPA 1BOQA 2RA3A 2R0KA 1SGNE 3RXBA 1UTJA 2ZP0H 4DW2U 5A09A 1WQSA 2PKSC 4XE4A 2HOBA 5G4BA 4I8LA 1FY3A 1GVKB 4Y8ZA 2A2XH 3LH1A 3RLYH 1O3PB 1C1VH 2DUCA 1GCTC 1YP9A 1OXGA 1ZPCA 4YO9A 5EQSA 3ZZ9A 3LGUA 3V13A 5K7RA 5TCAA 1QBNA 4NZQA 2Q6DA 2BZ6H 1GMDG 1IHTH 1F7ZA 3SU6A 3ZZ4A 2J4IA 4X8UH 1O2KA 1FUJA 3UUZA 5ABWA 1A0HB 1WSSH 1YCPM 8KME2 1BHXB 4I8JA 1C5QA 2XWBI 1GJ6A 1GL1A 1Y8TA 1H8IH 3NWUA 3VXEH 1BRUP 2FS8A 2GMTB 3RXLA 4PROA 1EB2A 4UFDH 2GDEH 1P9UA 1K1PA 2HPPH 4E06H 2BVRH 1F0UA 2ZFPH 4YLUA 1MZAA 1BTYA 3M5LA 3RMNH 1C5YB 1S81A 4X8SH 1BRBE 4BAHB 2TBSA 3RXOA 2PW8H 1DS2E 1W8BH 1P57B 2HGTH 2CHAB 3MNSA 3KQEA 4AX9H 4OGXA 4Y0YE 1BHXF 4K2YA 4R8TB 4DJZB 4CBOA 3A83A 1MKWK 2G4UA 1SFQB 2JKHA 1Z6JH 1CA0C 4FUDA 3SN8A 3TH2H 1P2JA 2TRMA 4IN2A 1H9LB 2Y7XA 3A81A 2LPRA 2A45B 2ZPSA 1XM1A 2ZGXH 4K1TA 1P3EA 3KIDU 2B0FA 3U98H 3ZZDA 1PPCE 1L4ZA 3SNEA 1GVLA 2YNBA 3GOVB 3M7QA 2FOCA 3Q77A 3M3SA 5EXMA 1A7SA 1Q2WA 3SJKA 3QLPH 2BMGB 3ZZAA 4AFUA 2BQWB 4FUIA 3C27B 1GBBA 1PPGE 2ZWLH 3A7ZA 1O3OA 3B23B 3RU4T 2GZ8A 1QGFA 5LPRA 1SLXB 2BVSH 5FBEA 2B9LA 1YKTA 2UUFB 4HTCH 2WYGA 1LPZB 2ZU4A 3SV8A 2XCFA 5PTPA 4OS6A
chains in the Genus database with same CATH superfamily
1CHOF 1YBWA 5DP8A 2WV9A 1P03A 1TYNA 4ABDA 1DSTA 1TGSZ 1G2MA 1C2HA 2ZDNA 1HBTH 1ELGA 1MKXK 1ZMNA 4QT8C 3BV9B 4GSOA 1CHOG 5E8EH 4MPUA 2PSXA 1Z8IB 2Z9GA 2ZEBA 2LNCA 1QA0A 5DJ7A 4YM9A 1C1WH 4B75A 2AMPA 3QGNB 3ELAH 3MO3A 5KEDA 1TBRH 1GJCB 2F9UA 1C1PA 5JBBS 5JBCS 1P04A 1JMOH 1SGFG 1O36A 2RDEA 3SGQE 3TGIE 1SGRE 4O3TA 3ZIAD 2PFEA 3GISB 1OP2A 1FZZA 3E0PB 1YPHC 1AI8H 3UB0A 1OX1A 3WY8A 1OWEA 1TNJA 4ASUD 3MU5A 1ABIH 3DA9B 1KDQB 2NU0E 4MPXA 2ALVA 2A7CA 1EJNA 3T62A 1ZTLA 3P6ZB 2AGEX 3HPTB 4IW4E 2JJ2D 3HGPA 1GHAF 1QQ4A 3KL6A 4ABAA 2G5VA 1TQ7B 2O8MA 1HCGA 3F9EA 3MWIU 4GVUA 5CE1A 5J4SA 1NRRH 1LHDH 4P00A 4E7RG 5JBTA 1E35B 1NN6A 2F9NA 2TIOA 3NXPA 1GHAG 2STAE 1QNJA 1JOUB 1AFQC 3SJ8A 5C20A 2B8OH 1O3BA 3P92A 1IQKA 3GY8A 1BTZA 2F43B 5F03A 4CR5A 3BTQE 3PRDA 1C5VA 1Z8RA 4GUXA 3DT0H 1WQVH 5LPEA 3PWBA 2BX3A 3ITIA 3M61U 3VGCC 2SGPE 2A32A 5F53A 3SNCA 1F0SA 2OQUA 3PMBB 1SGQE 2JJ1D 3RXQA 1W10U 2WPJS 1D3QB 2A5AA 2J5UA 2FOAA 2TGPZ 1EKBB 1TGNA 2A5IA 4U01A 3UTUH 1GMHG 1SBWA 2ZGJA 3RXSA 3OAAD 2XNDD 2BDBA 1SLVB 4Y79A 1ZHPA 3CENA 1UW7A 4SGBE 4AGKA 3RXIA 2VINA 4DT7B 1HXFH 1MCTA 4XFQA 1BMNH 3GYMA 1BMLA 3GCOA 3GDSA 4UONA 1GMCF 2W7UA 1PPFE 2JH0D 1PQ7A 4Y6DA 2FM2A 1C9PA 3GDUA 1YGCH 1LDTT 3SV2H 1P2KA 3ATWA 1FJSA 2W7SA 1UK3A 1QBOA 2RCEA 2QYIA 4MNVA 1KDQA 2ILNA 1Y59T 2ZQ1A 3LGWA 1C5OH 1OSSA 3MOCA 4D9RA 3T5FH 1SQOA 1ELVA 3MU1A 4D7GA 6CHAB 1MTNC 1TMBH 1Z8JB 2FWWA 1O3KA 1WV7H 1BMFD 3OU0A 3UFAA 4H42U 1TIOA 3V3MA 2V6NA 4ISHH 3WWFA 3F2HA 3MH7A 3IWMA 3RC4A 2FOBA 3TVJB 2VVVA 1VGCB 4OM9A 1GI1A 3TITA 1CT2E 5C94A 1GPZA 2CN0H 3SUGA 3O8RA 2FO9A 2ZHQH 4RI0A 5FBIA 3M3VA 5CDFE 3PV5A 1IQJA 2RG3A 3VB4A 1UMAH 4LZ4B 1P12E 1UCYK 3KYFA 2P16A 1DY8A 3L3TA 1KYNA 5DP7A 3ZVGA 4YTAA 5DK1A 3FZZA 1G3CA 4NIVA 4B2CA 2A4OA 3A80A 2V3OH 4KTCA 4X6MA 5BRRE 1TRNA 3JZ1B 4O97A 3PWCA 3ZZCA 1W12U 1GL0E 1TPSA 4K1SA 2ZI2H 1N6XA 1ZRKA 5A0AE 2FOMB 3VPKA 3PM3A 1D6WA 1C4V2 2ODPA 2EI6A 4Y7AA 1ELEE 4BANB 1QURH 3S69A 1MU6B 3LONA 5JB9S 4NGAH 4KELA 2CGAA 2BZAA 1EQ9A 1EOLA 1XXFA 3E8LA 1XX9A 4YXWD 3KQBA 3OSYA 4ACBA 3FFGA 4UFEH 2EY4C 3SUDA 1GBJA 4Y71A 1NFXA 5LH8A 2P3TB 3UAIC 4B6EA 3SJIA 1QL7A 1W2KH 4WJG2 4X2WA 9ESTA 1C1QA 4CRDA 3HK6B 1TNGA 1ELFA 3SBKA 1NS3A 3Q00A 2WPIS 3A89A 5HXFA 5T6DA 1IQGA 5B6LA 4HFPB 2UWLA 1J9CH 4F4OC 2Y6TA 4X1PU 2ZA5A 2FX4A 1L1JA 1TRYA 3ZVBA 3TU7H 4JZIA 3MNXA 4U2WA 5L2YH 1O5DH 4KGAA 3SZEA 1O32A 8LPRA 2OBOA 1SQRA 1NU9A 1NESE 5E0HA 1TGTA 3A8BA 2OXSA 4AYYB 2BD9A 1O3FA 4DG4A 4XDEA 1K9OE 1DX5M 3UY9A 7GCHG 1LQEA 1BBRE 1K22H 1HAIH 2C8YB 1ZOMA 2KAIA 2F3CE 2OQ5A 1BTPA 1KSNA 2ZIQH 4F49A 1YYY1 3GY7A 1O3HA 1TGBA 1T4VH 4Y11E 2SNVA 4H6TA 2GV6A 3ZVDA 1PPBH 2FXRA 2R3YA 2Y5HA 4K69A 8GCHG 1QTFA 2DE8A 4NIXA 1O33A 2P93A 1O5GH 7ESTE 2TGAA 2PGQB 3KEEA 3NUMA 1CO7E 1VR1H 2J2UA 2G4TA 1VZQH 1UK4A 4WMFA 5EU8A 2XC0A 3LIWA 2A7HA 1AGJA 2P95A 1D9IA 3K65B 1ELTA 2ZKSA 2KZ4A 2C3SA 2WPMS 4CRCA 1F92A 1HAXB 1T8LA 3RXUA 1EJAA 1MU8B 3F0OA 4XRNA 4HGCA 1ARBA 4NCYA 1GVZA 3LOXA 1V2WT 1Y3XA 2ZFTA 3DFLA 4DVAU 2CF8H 1VITG 1O2NA 2V3HH 2V3MA 1LHEH 2G8TA 3VXFH 4MNYA 2ANMH 1ANEA 4DOQA 1K1LA 2R0LA 1ANCA 2Z9KA 1V2JT 4IC6A 2A2QH 1BZXE 2I6SA 2Z3EA 3FVFB 4JK6A 2XTTB 1GBEA 1TBQH 2PHBA 2ZPQA 1CGJE 1Z8GA 1GBKA 1WOFA 3PTBA 5GNDA 3L6PA 5DP5A 1TA2A 1GJAB 1ZTJA 4MPVA 1C5WB 1FPCH 4OS5A 3RC6A 4Z1MD 1P8VC 4A92A 1G3BA 2C93B 2THFB 1LVOA 1O2WA 2W6ID 3D65E 4ABBA 4AGJA 1FPHH 4XSKU 4AN7A 1KXFA 1QL8A 1JRSA 4TPYA 1D3DB 2C90B 2TGDA 3RC5A 2BLQA 1PQAA 1LCYA 2ZFSA 4I8GA 1AN1E 1FI8A 1GHYH 5C67A 1AE8H 2CV3A 3BIVH 5SGAE 4JK5A 4K60A 4MNWA 1YPLH 1HJ8A 3VG8A 4BAOB 1DXWA 4NIYA 2ZPRA 2BD8A 3A7YA 3GCTG 2WSSD 3A8AA 5A2MH 2JIZD 1LQDB 2ZGHA 1ZHRA 2PKSB 1RTKA 3SU5A 2KM0A 4R0IA 2Z3DA 4D76A 3QN7A 1O2PA 5DP4A 1Y5AT 1Y3VA 2PUQH 1U6QA 1IHSH 1OKXA 4X6NA 5AHGH 1GCTB 1TMUH 3M36A 5GCHG 1OWHA 3HKIB 3ESTA 5AVDA 3PLKA 3ZZ6A 2VWLA 3M5OA 3ZZ3A 3ZVFA 1J17T 2XYAA 4IN1A 3T29A 1J15A 4CRBA 4ABGA 1LVYA 5DP3A 2O8UA 3S0NA 2QF4A 1EPTC 2D26C 2QV1A 5DO4H 4FUEA 1LHFH 4YT6H 2GD4B 4B2AA 3MI4A 1BRCE 3LDXH 3TJOA 1YY3A 1AD8H 4X2XA 4Y8XA 1C2GA 1FY5A 3GCHC 2ZO3H 1HAYB 1ESTA 1OOKB 1KTTB 1G37A 1P3CA 3S7KB 1DWDH 1DWCH 1GI9B 1C5LH 1FN8A 4YOJA 3DSPA 1L0ZA 1ZZZA 4Y0ZE 1EUFA 1S85A 4FU9A 3MFJA 4FUJA 2BOKA 1VCWA 3TH3H 2GDDA 4FETA 1YPJH 1GHXH 3QDZB 3RXFA 3QO6A 5EJ1A 1O2QA 3B8JA 3SW2B 3Q76A 1AB9C 2I6QA 1G36A 1G2LA 1DPOA 1YLNA 4ZKNU 1A5IA 1GMDF 1HRTH 5C2ZA 2F83A 1GI5A 4TWYA 4K8BA 1F5KU 1TABE 1CA0B 3MH6A 3SHCH 4BTIB 1QZ8A 2F4LA 3T25A 1GHZA 1GBHA 3AAUA 1C2KA 1NZQH 4K5ZA 1KY9A 2EC9H 2Q6GA 1IQEA 4ZKOU 1HLTH 2FIRH 5F8TA 1GI3A 1EAUA 2WPKS 2Y5FA 3NZIA 1W7GH 2FPZA 1SGCA 3OYPA 3P8NA 1TONA 1XMNB 1WBGB 2CF9H 2D1JA 2ZHDA 4MNXA 1EAXA 2H1UA 2P3UB 3FOAA 5T6GA 1ZMJA 1QRWA 2P8OC 4NSVA 3NK8A 2ZHWH 2CXVA 4MVNA 1O2XA 4P02A 1RRKA 5ESBA 1ZSKA 1LHCH 2STBE 1EZUC 3EA7A 4H4FA 3V7TA 2ZFRH 3BTME 2J38A 2XCNA 1WXRA 1JWTA 1NO9H 1O2TA 4UD9H 3GY5A 3UNQA 5E2OA 1OYTH 1G9IE 1G30B 3CNRA 4HZHA 1BTWA 3A85A 4OGYA 2FI4E 1V2LT 3EGKH 3M7UA 6GCHF 1FAKH 3ZVAA 5IYTA 1RXPA 2GT7A 1ZSLA 4XBCA 2GZ7A 1DITH 2AS9A 4DURA 2Y5GA 4BXSA 2G5NA 5JYIA 3P70B 1RTFB 1TNHA 3ODFA 1AMHA 1MH0A 1GI7B 1UO6A 6GCHG 3AK5A 4HG6A 3MU8A 2ZC9H 3RM2H 1TE0A 1ACBE 2BHGA 5F6MA 1CSOE 1C1RA 1WTHD 5FPTA 3SO3A 1AO5A 3OFND 1TFXA 4M9FA 3QTOH 1DSUA 1MTWA 2BVXH 2RA0A 2W6JD 3I78A 4JYUH 1FMGA 1YPEH 1QB6A 2D8WA 5DPAA 2BDYA 3N7EA 1A5GH 2BDGA 1A0JA 2H9EH 1AZZA 4K1EA 1KXDA 1W14U 2G81E 3E3TA 2ANWA 1TQ0B 3C1KA 1AFQB 1HDTH 3VB3A 5AFZH 1O2LA 4IGDA 3JZ2B 3ZVEA 4UFFH 2XBXA 3ENSB 3QK1A 3UWJH 2UWOA 1UTMA 2AYWA 1O2GH 3OEED 2VVUA 3SQHE 2G52A 1GJBB 1HAGE 1J14A 3STIA 1VKYA 1S6HA 3VGCB 1Z1IA 2ALPA 1PYTD 4TY6A 1RIWC 4MPWA 3SGAE 1BCUH 3BEUA 1O3NA 1JIRA 3MHWU 1ETSH 4WVPE 1H8HD 2FEQH 2CHAC 1DUAA 2ZDLA 1EP6A 1OP0A 1VCPA 2FLBH 2NU2E 3GICB 2QXJA 1AY6H 4O03A 3ODDA 1AVGH 1YCPK 3BEFB 1P2OA 2BD5A 5LGOA 5EODA 4JYTA 2WPLS 2VIOA 3PB1E 3S7HB 2A1DB 1HIAA 3MNBA 1G32B 1JXPA 1YWUA 3H5CB 1O2YA 1VJAU 1ZHMA 1Z7KA 1BB0B 2NWNA 4B74A 1X7AC 4U30A 2XBVA 5JB8S 3TK9A 1KXCA 3PMHB 1V2NT 3AW1A 1NRQH 4J2YB 4UE7H 1LHGH 4B76A 4D8NA 4KTUA 2V0BA 3FZDA 1SGFA 2W26A 2ZCKP 5DGJA 3TGKE 1G3EA 1SQTA 1O3GA 2Q1JA 1W0ZU 1UTNA 1UK2A 5FHTA 1A4WH 1NU7B 4MTBA 3RXEA 4Q80A 2FOHA 1MCVA 1SSXA 1UVPA 3BEIB 3U8TH 2VNTA 1HAZB 1N8OC 3EAJA 1ELCA 1GMHF 2UUJB 4X0WU 1WTGH 3KGPA 1B5GH 1C9TA 2F9PA 4I32A 1P9SA 3GY3A 2FESH 1GBCA 1AQ7A 2FI5E 2QE7D 2VWOA 2NU3E 1T8MA 4CH2B 5C0TA 3W94A 4AOQA 1MABB 1FAXA 1O2UA 3BG4C 2SFAA 1ANBA 5DP6A 3ZYEA 3RXGA 1ZGIA 1WDIA 2QF3A 1YPKH 4A1VA 2A7JA 1NFWA 3SI4H 2Z7FE 3LC3A 4FVBA 5FX5A 1C5NH 3SNBA 1O38A 3UPEA 1AUTC 4FUGA 2YMSD 1A0LA 3PMAB 2SGFE 1CBWC 2ZU1A 1IQMA 4Q7ZA 1UTKA 1EP5A 2NU1E 3WWBA 5C17A 1GWAA 2YMSB 2HWLB 1BQYA 2GGVB 3RXTA 1A1RA 3MNCA 1SGPE 2PR3A 1NBMD 1O5EH 2FMJA 3E1XB 1GGDC 1NRNH 1XXDA 4FOUC 1P11E 4BAQB 3MTYA 1TWXB 1OS8A 4U32A 5A0CA 2WPHS 5HM2A 3UOPA 1Z1JA 2HNTE 1HFDA 2BYAX 5FL7D 1GI6A 1ID5H 4D7FA 2F9VA 2AEIH 2FP7B 2QY0B 3BTTE 4IMQA 1AWFH 3SYJA 1GG6C 2VU8E 1MTVA 1G3DA 1WU1A 1AUJA 3PV2A 2VGCC 1O3LA 3ATMA 2KAIB 2Y81A 3FP6E 2ZG0H 3RXDA 1HYLA 2QCYA 2SNWA 4B1TA 2Y7ZA 4KP0A 3KHVA 3KQDA 1WAYB 1TGCA 2W3KA 5CHAC 4ZH8A 1S83A 1C5RA 2R2MB 1DLEA 1XUKA 2O8LA 4RT0A 1DICA 4ZMAH 1GJ4H 1O3JA 7KMEH 1K1OA 1O2IA 5E2PA 1C1SA 1KXEA 2TGTA 4IMZA 1GDQA 1NM6A 2EI8A 4WH8A 1C5MD 1EASA 1HJ9A 1LPKB 1BIOA 4DGJA 1ORFA 2QC2A 1MBMA 5AFYH 4Z6AH 1M9UA 2Z9LA 2WUCA 3R0FA 5C1UA 2A31A 1DVAH 1WUNH 1Z6EA 2AGGX 1SGYE 4X1RU 1O35A 5C1YA 1K21H 2D2DA 4ZROA 4KKDA 1SFIA 3UR6A 5EXNA 2L74A 5L6NH 3RXPA 6ESTA 2OD3B 3K9XB 2J92A 2VBCA 1O3DA 2KCAA 3LKWA 4YZUA 1BTUA 2J9NA 2ZZUH 4CH8B 3OY5U 4THNH 1W11U 1NROH 3P8OA 1HJAC 4Q7XA 2GCTC 1THRH 2VIVA 4INLA 4ABFA 1FDPA 3RU4E 1HAPH 1NC6A 7GCHF 4TSFD 3PLBA 2QF5A 3QZQA 2WZQA 4X6OA 3GDVA 5EPYA 4DIIH 1BDAA 2DE9A 4ZKSU 2SGDE 3KF2A 4ISOA 3H09A 2H5CA 3F2GA 1GBMA 3A88A 4X1NU 4A1XA 3ZZ5A 3BTEE 5EQQA 1TX7A 1K1MA 2AGIX 2BY8X 5EW2H 1LPGB 3DFJA 1XKAC 3RXKA 4CHAB 1Y3WA 2ESTE 3FP8E 4JZEH 2GX4A 2OP9A 1QY6A 1H4WA 3R3GB 2QGRA 3URDA 8GCHF 1HGTH 1FX0B 1HAOH 1ZRBA 1NY22 1VJ9U 3RXMA 2ZDAH 4NA9H 2FYRA 3FN8A 1TX6A 1CQQA 1ELBA 2VWNA 1GHWH 1MBQA 1EX3A 2VIPA 3AVZA 1H1BA 1TMTH 2OK5A 4JZFH 2A5KA 1LO6A 2HRVA 3ATLA 1FONA 4AFSA 1YC0A 3F6UH 4LOYH 8ESTE 1ZYOA 4OS4A 3SU1A 1BTXA 3UWIA 1MKWH 5HGGA 1UHBB 2A0QB 3Q3XA 2XBWA 1SC8U 2BY7X 1FIZA 1C2DA 1C4U2 1YPHE 1QFKH 3S9BA 3IITA 2R2WU 1KLTA 4J1YA 1AWHB 3K2UA 2KCYA 3CP7A 3F2FA 4RKOB 1VITF 3E16B 3M5MA 2PUXB 1SPJA 1O5AB 3E90B 2IN2A 1C4Y2 3S9AA 4WH6A 2FOFA 5FCRA 3ZV9A 1QJ7B 1IQHA 2OC8A 1CA8B 1O2RA 1O2OA 1MQ6A 3HK3B 1AFEH 3VB7A 4K3JA 1INCA 3A7XA 4NSYA 4I33A 1MD7A 2ZHEH 5C1XA 3F9FA 5EG4A 3LPRA 3A7VA 3AASA 1SLWB 1UTLM 4DY7B 1L2EA 1FIWA 2JDID 3A7WA 2PSYA 2A4QA 2XW9A 2ZTZA 1MKXH 2ODYB 1FQ3A 3OTJE 2BXTH 1GJ7B 1HUTH 1OP8A 1S5SA 4A7IB 1T7CA 5H4IB 1C2JA 1LVBA 5IK2D 1ZR0A 1ABJH 3U1IB 1SI5H 1P2QA 4ISLA 5CHBA 5JDUB 1O37A 1S82A 3UQVA 2A4RA 1T4UH 1EPTB 1B0EA 2UUKB 3SV6A 2HPQH 2H2ZA 1KXAA 2BLOA 3MYWA 1AKSB 1O3EA 4IBLH 2OC1A 2AFQB 3GCHB 1YCPH 4E7NA 3GCTF 4GAWA 4GCHG 3SU2A 4X8VH 3NCLA 1QJ1B 1P05A 2WV4A 3SNAA 4ZKRU 1W0YH 4X1SU 3P95A 4ASHA 1UHBA 2UWPA 5FPSA 2ZNKH 1AIXH 1C1OA 3UOUA 3RUOA 1MTUA 4I31A 1GCDA 2XRCA 5TCCA 4FUCA 3T26A 5GCHF 1QB9A 3PO1C 1AB9B 1NFUA 1F5LA 4Y7BA 1XVMA 3DSGA 2AMQA 5FPYA 1QRZA 4H6SB 5A8XA 3FANA 1C1UH 5ESTE 2XWAA 1E1QD 1O5CB 3BTFE 4ISIH 2V7QD 2WHXA 2GV7A 1OWKA 1UCYE 3U1JB 3QZRA 1TA6A 1MUEB 4CR9A 2BOHB 4AFZA 3RMOH 5T6FA 1GI2A 1V2KT 1FN6A 1ZSJA 2BY5X 3SJOA 1EAWA 2BY9X 1FXYA 1DOJA 2F9OA 2JH5D 5BPEA 3ATIA 3SHAH 5KGOA 2JETC 3LGTA 3BG8A 1GI0A 3F9HA 4HI3A 1EFRD 2BQ7B 1MAYA 3FP7E 3GCNA 1ETTH 3MO6A 3A8CA 1V6DA 2BXUH 1GBFA 1LKBA 7LPRA 2HLCA 1KMHB 2BLVA 2CJIA 1BT7A 1C1MA 1C2EA 2P94A 1EPTA 1OWIA 2XNIA 3MU0A 1BA8B 4GHTA 3EA9A 3A7TA 1RFNA 1ZJDA 1BMMH 3B9FH 4ABJA 1ANDA 3TK5A 1AKSA 1TAWA 1XUHA 4FUBA 4YESB 1ZPZA 3RMLH 1XVOA 2QAAA 2IJD1 2KFWA 4A1TA 3A82A 3QTVH 1HXEH 2PKAB 1V2TT 2ZFFH 3OEHD 4K8YA 3RXVA 3N7OA 1A3EH 4ZUHA 4FU7A 3F9GA 1GJ8B 1T8NA 3MU4A 4ISNA 4BOHA 1QB1A 4ZXXH 2JH6D 1NBME 2TPIZ 4TPIZ 3RU4D 4AB8A 2W5EA 4B71A 1HAVB 3FO8D 4NFEA 2HNTC 1TOCB 2K8IA 2K1QA 1OPHB 3Q3KA 1O2ZA 2YNAA 1XUGA 2O9QA 1TB6H 3DUXH 3RDZA 1H8ED 2R3UA 1O2SA 4VGCC 4XBBA 3TJVA 1NT1A 4XOJA 1JRTA 1LVMA 3SV9A 1EOJA 1QJ6B 2ZU5A 5EXLA 1HB0B 2Y80A 1IOEA 1UCYH 1DE7H 3M7TA 3BN9A 1A2CH 2FI3E 2ZTYA 4Y8YA 1HPGA 1DDJA 1ELDE 4IS5A 4GLYA 4JZ1A 4X6PA 1SVPA 1TX8A 4NZLA 4ABHA 1DFPA 1O2VA 2XBYA 2IPHA 5DKMA 2ZDVH 3W1EA 5IDKA 1TALA 1C5ZB 2VIWA 3N99A 1GDNA 1HIAB 4ZXYH 2VB0A 2UUYA 3BIUH 2CK3D 2OUAA 1P10A 5GWZA 1RIWB 2G51A 1C5PA 1SQAA 3GY2A 3PROA 4MQAA 4BNRA 2LELA 3QGJA 1T8OA 1XUJA 1DUEA 2VWMA 3E6PH 3SQEE 2ZU3A 2Z3CA 4RKJB 1ZGVA 4D9QA 1B7XB 2BDAA 3A84A 3LH3A 1K1IA 4F48B 3PLPA 3ZZ8A 1SGDE 3UREA 2B7DH 1O2MA 2GVFA 5AF9H 1ZLRA 4IC5A 1YLCA 2L6OA 2PKAA 1CU1A 1BITA 3S9CA 1MAXA 1QR3E 2ODQA 3RXJA 1RGQA 3QWCH 3EQ0H 1K1NA 5CMXH 2ZGCA 1DANH 1SGEE 2BD7A 2PGBB 1IQLA 2C8XB 3UNSA 4ESTE 1HAVA 3MH5A 4JMYA 1FNIA 1OWDA 1A3BH 4I86A 3ZZ7A 5F8XA 2BM2A 4CREA 2FS9A 4FUHA 4WMEA 1CE5A 1CT4E 1EAIA 2PTCE 1QA7A 1TPPA 4UDWH 2C4FH 2GMTC 1UVSH 4ZHAA 4LXBH 1P02A 4OS2A 1O3MA 1N8OB 4Q4LA 4ZHMU 1GI8B 2KX4A 3TGJE 1TNLA 1UTPA 2ZU2A 1IQNA 4AFQA 4GHQA 3T2NA 3KQCA 1Q31A 1GBDA 1QRXA 1W3CA 3RMMH 1THSH 1O5FH 5HYOA 3T28A 4FUFA 1O3CA 2BDCA 3M35A 3ZYDA 1SL3A 4NG9H 2V35A 1O3IA 1YM0A 3BG4B 2KCPA 4KTSA 5TJXA 5DP9A 1C5TA 3EA8A 1HNEE 1Y5BT 1N6YA 3K6YA 2KCOA 5JPMH 4Y76A 1BBRK 1EATA 1F0TA 1L1GA 4DT4A 1K2I1 3ATKA 3E0NB 3KQ5A 2P59A 1C5SA 3M5NA 4TWWA 1QIXB 3RXRA 4TY7A 1P2IA 3PV4A 1CBWB 4CRGA 3LJOA 2ZGBH 4SGAE 1N1LA 1V2UT 2EEKA 5HKKD 5JBAS 1TNKA 1J8AA 4XD7D 3TH4H 2AH4X 2QIQA 1FV9A 2Z94A 1TBZH 3VB6A 3U9AH 2QA9E 3U8OH 2FZZA 2BY6X 1E38B 2Q6FA 1GGDB 1MTNB 2AIPA 4WWYA 2G55A 1SHHB 4AB9A 3BTHE 3HATH 3SORA 1V2QT 3M37A 2LP6A 4NIWA 4CRAA 3G01A 1L1NA 1H9IE 3OX7U 4CRFA 1Y3UA 1SLUB 1GBTA 1XKBC 1T31A 3EE0B 1GG6B 3RXHA 2F91A 5J4QA 1Y3YA 4WXIA 4YT7H 2VGCB 3RM0H 3LGVA 2QXGA 1NFYA 5GXPA 4I7YH 2QF0A 3TJUA 5EW1H 2C8WB 2OCVB 2G00A 2M5TA 3FAOA 4NA8A 3T27A 5A8ZA 4LZ1H 5CHAB 3O8CA 2ZCLP 1SGIB 1CGHA 2GP9B 1Z71A 3F3BA 3NKKA 1PYTC 1QHRB 5FCKA 1YPMH 2GKVE 1SR5C 4X2VA 1MQ5A 5LPFA 1W13U 1VITH 3M3TA 3LGIA 2Z6BD 1P0SH 2GZ9A 3A87A 2OBQA 2H9TH 3MO9A 1TOMH 5L2ZH 1GJ5H 2Z9JA 3DCLA 3LU9B 5F8ZA 3SU3A 2HLDD 3D49H 3VFEA 1KTSB 1W7XH 4ZCNA 2AHME 1QCPA 3BTDE 3SUEA 2B5TB 2NU4E 4FU8A 1ZMLA 3UQOA 3BSQA 2HVYB 3DD2H 3P8GA 1NTPA 5FAHA 1GMCG 1GJ9B 1O30A 2GT8A 3I77A 4Z0KA 1S0QA 3KYGA 4INKA 1S0RA 5HIYA 2OTVA 3STJA 3O8DA 1NRPH 3WW7A 1ZPBA 5I46H 2PLXA 1TPAE 3AW0A 1T32A 1GDUA 1C2MA 1HJAB 1NPMA 3OE7D 1EB1H 3SZNA 3PTNA 2AIQA 3Q3YA 2FDAA 3VEQB 2GCTB 3LJJA 4YOGA 3TJNA 1PPZA 3W95A 3MQKC 4MLFB 2GJGA 1BTHH 3ZV8A 3I29A 3EYDA 2OC7A 1BUIA 3QUMP 2EA3A 2IOTA 2VH6A 1ZTKA 2BDHA 5C5NA 2IJOB 2CMYA 1Q3XA 3U8RH 4FXGH 3SNDA 4NFFA 2WINI 4WXVA 1BRAA 1DM4B 2J94A 1O3AA 1C5XB 1E0FD 1RJXB 3NPSA 3BF6H 1A46H 1JBUH 1ETRH 2QN5T 2H9HA 2BTCE 2BD4A 4JCNA 4YLQH 1SB1H 1AZ8A 1ARCA 1LTOA 4WF8A 1UVUH 4AC9A 3SOSA 1E36B 2EQNA 1HV7A 3A86A 5GPIB 3EE7A 2IPQX 1D3TB 1GHVH 1UVOA 5GDSH 1GBAA 1KXBA 1C2IA 1V2OT 3GS9A 1AVWA 2BQ6B 1GBLA 2FYQA 1O2JA 3DHKH 4X2YA 4Q7YA 1BMAA 2YMSC 4XBDA 1COWD 1XUIA 1QQUA 1S6LA 3SU4A 3UIRA 4CBNA 1BJUA 2VIDA 5EQRA 6CHAC 2O8TA 4BXWA 2VIQA 4ZHLU 1CGIE 3OY6U 1H9HE 1UTOA 1E34B 5FX6A 1YF4A 2OLGA 2PTNA 2O8WA 2BD3A 5EJLA 1YLDA 2XC4A 4ACAA 1F5RA 3KNXA 5L30H 1FY4A 1HAHH 5EJZA 1VGCC 5EIYA 2ZDKA 4BAKB 1J16A 2FX6A 1IAUA 1MMJN 5GJ4B 3TK6A 2FTLE 3EDXB 2W3IA 4ABIA 2SGAA 3RP2A 4AZ2B 4DIHH 2QXHA 3UNRA 1FY8E 1PFXC 3CS7A 3PYHA 4Q63A 1UTQA 4YOIA 5C5OA 1UJ1A 1K28D 2ZECA 1P01A 5DSFA 1TPOA 1O31A 4A5TS 1BJVA 2J97A 1A61H 3ZZBA 1DLKB 1SG8B 1IQFA 1C5UA 4I8HA 2Y82A 4B2BA 5FXLA 1CVWH 1SOTA 1WCZA 1P09A 2WYJA 4X8TH 3V12A 1ESBA 2R9PA 3F1SB 1P2NA 4RN6A 5DG6A 2AMDA 2BX4A 2M2AA 1LKAA 1C2LA 1OYQA 1P06A 3LT3A 3MMGA 5E0JA 5HIZA 4FVDA 1VCQA 1D6RA 5HMAA 2GTBA 2ULLA 4GPGA 1S84A 3RXAA 2ANYA 3SV7A 1TNIA 2PWXA 2SGEE 2HVXA 1DWEH 2FTMA 9LPRA 1PQ8A 2J95A 3SJ9A 1NRSH 3BTKE 4I8KA 1O0DH 4BTUB 2A4GA 2OINA 4UFGH 4TYDA 1PQ5A 1GHBF 4AYVB 1EXFA 4Y10E 2J34A 1V3XA 2WV5A 1AVXA 1GJDB 4ZAEA 1MTSA 3GY6A 3CS0A 1JIMA 1C2FA 3RLWH 4OS1A 1GHBG 5A0BA 1EZXC 3AAVA 1AU8A 4UEHH 4Q2KA 3SUFA 1P2MA 3PO1B 5EGMA 1YPGH 1CT0E 1O2HA 3GY4A 1O39A 1GBIA 1GI4A 3V0XA 1KIGH 2AERH 3E91A 3H7TA 1WYKA 1H8DH 2ZFQH 3K6ZA 2VJ1A 1KLJH 4RSPA 3PMJA 1B0FA 3F68H 4CHAC 2C8ZB 5KECA 1FLEE 2K0QA 3KN2A 1UVTH 4GCHF 1E37B 6LPRA 3ZVCA 2H5DA 3VB5A 1L4DA 3RXCA 1W0KD 4INHA 5A8YA 2JETB 1OWJA 1EZSC 1F0RA 2GCHF 1THPB 2J98B 1A5HA 4B6FA 1SOZA 1SKYE 1KLIH 3N7DA 1PPHE 5T1VA 1DY9A 1SMFE 2BD2A 3BTGE 4A6LA 1K0HA 4MG3A 1MZDA 4X1QU 1TRMA 5C3NA 1O34A 2FLRH 2GCHG 1ESAA 3DSOA 1BBRH 1MD8A 2BB4A 2FOEA 3BTWE 2KR7A 2BLWA 4M7GA 2WUBA 1TLDA 4O9VA 1SGTA 1FY1A 5I25A 5GIBA 4E05H 2WPDD 2RFKC 3SGBE 2VVCA 1F2SE 2P3FH 3SI3H 3HKJB 1SHYA 2ANKH 2F9BH 5E0GA 1RD3B 2ZHFH 5T3HA 5EPNA 3PRBA 4NA7A 2RDLA 2VH0A 2ZQ2A 2SGQE 1V2PT 1CHGA 5K0HA 2ZTXA 3KCGH 1V2VT 4AORA 4JYVH 1PPEE 1D4PB 5ETXA 1PJPA 3O8BA 3HGNA 4LK4A 1OHHD 3TPIZ 3UR9A 2H6MA 3D23A 1QL9A 2XXLA 3A8DA 4AG2A 1V2RT 2FOGA 1ZJKA 2ASUB 3GYLB 2XOKD 1EZQA 2OC0A 2YOLA 4TT3D 5B6OA 1Y5UT 1C1NA 3LC5A 1ELAA 4VGCB 2P8OB 4ABEA 1RTLA 2Z9IA 3L33A 4NWKA 3TNSA 4BTTB 5DN6D 1IQIA 4WMDA 4AG1A 1EJMA 5EOKA 3URCA 3LGYA 3P17H 1D3PB 3TIUA 2PV9B 1XUFA 4NWLA 4DCDA 4B73A 4JZDH 2HALA 1LMWB 1W0JD 1AHTH 1DWBH 1E79D 1V2MT 2HNTF 1AE5A 2QXIA 2FODA 1O5BB 2ZF0H 3MH4A 1C1TA 3IG6B 2J98A 3P8FA 3U69H 4MDSA 2EI7A 4BAMB 3OTPA 3H7OA 4WY3A 4OS7A 1RS0A 2BDIA 4RT1A 3D62A 1S6FA 3SU0A 2ZCHP 5HM9A 3F0PA 1E1RD 2ZDMA 4O3UA 3TLOA 1K1JA 1V2ST 3TNTA 3QX5H 2XC5A 4F55A 1QBVH 1DT2A 1DXPA 1BOQA 2RA3A 2R0KA 1SGNE 3RXBA 1UTJA 2ZP0H 4DW2U 5A09A 1WQSA 2PKSC 4XE4A 2HOBA 3FKSD 5G4BA 4I8LA 1FY3A 1GVKB 4Y8ZA 2A2XH 3LH1A 3RLYH 1O3PB 1C1VH 2DUCA 1GCTC 1YP9A 1OXGA 1ZPCA 4YO9A 5EQSA 3ZZ9A 3LGUA 3V13A 5K7RA 5TCAA 1QBNA 4NZQA 2Q6DA 2BZ6H 1GMDG 1IHTH 1F7ZA 3SU6A 3ZZ4A 2J4IA 5C0UA 4X8UH 1O2KA 1FUJA 3UUZA 2PP6A 5ABWA 1A0HB 1WSSH 1YCPM 8KME2 1BHXB 4I8JA 1C5QA 2XWBI 1GJ6A 1GL1A 1Y8TA 1H8IH 3NWUA 3VXEH 1BRUP 2FS8A 2GMTB 3RXLA 4PROA 1EB2A 4UFDH 2GDEH 1P9UA 1K1PA 2HPPH 4E06H 2BVRH 1F0UA 2ZFPH 4YLUA 1MZAA 1BTYA 3M5LA 3RMNH 1C5YB 1S81A 4X8SH 1BRBE 4BAHB 2TBSA 3RXOA 2PW8H 1DS2E 1W8BH 1P57B 2HGTH 2CHAB 3MNSA 3KQEA 4AX9H 4OGXA 4Y0YE 1BHXF 4K2YA 4R8TB 4DJZB 4CBOA 3A83A 1MKWK 2G4UA 1SFQB 2JKHA 1Z6JH 1CA0C 4FUDA 3SN8A 3TH2H 1P2JA 2TRMA 4IN2A 1H9LB 2Y7XA 3A81A 2LPRA 2A45B 2ZPSA 1XM1A 2ZGXH 4K1TA 1P3EA 3KIDU 2B0FA 3U98H 3ZZDA 1PPCE 1L4ZA 3SNEA 1GVLA 2YNBA 3GOVB 3M7QA 2FOCA 3Q77A 3M3SA 5EXMA 1A7SA 1Q2WA 3SJKA 3QLPH 2BMGB 3ZZAA 4AFUA 2BQWB 4FUIA 3C27B 1GBBA 1PPGE 2ZWLH 3A7ZA 1O3OA 3B23B 3RU4T 2GZ8A 1QGFA 5LPRA 1SLXB 2BVSH 5FBEA 2B9LA 1YKTA 3NRLA 2UUFB 4HTCH 2WYGA 1LPZB 3U28C 2ZU4A 3SV8A 2XCFA 5PTPA 4OS6A
chains in the Genus database with same CATH topology
1CHOF 1YBWA 5DP8A 1P03A 1TYNA 4ABDA 1DSTA 1TGSZ 1G2MA 1C2HA 2ZDNA 1HBTH 1ELGA 1MKXK 1ZMNA 4QT8C 3BV9B 4GSOA 1CHOG 5E8EH 4MPUA 2PSXA 1Z8IB 2Z9GA 2ZEBA 2LNCA 1QA0A 5DJ7A 4YM9A 1C1WH 4B75A 2AMPA 3QGNB 3ELAH 3MO3A 1TBRH 1GJCB 2F9UA 1C1PA 5JBBS 5JBCS 1P04A 1JMOH 1SGFG 1O36A 3SGQE 3TGIE 1SGRE 4O3TA 2PFEA 3GISB 1OP2A 1FZZA 3E0PB 1YPHC 1AI8H 1OX1A 3WY8A 1OWEA 1TNJA 3MU5A 1ABIH 3DA9B 1KDQB 2NU0E 4MPXA 2ALVA 2A7CA 1EJNA 3T62A 1ZTLA 3P6ZB 2AGEX 3HPTB 4IW4E 3HGPA 1GHAF 1QQ4A 3KL6A 4ABAA 2G5VA 1TQ7B 2O8MA 1HCGA 3F9EA 3MWIU 4GVUA 5CE1A 5J4SA 1NRRH 1LHDH 4E7RG 5JBTA 1E35B 1NN6A 2F9NA 2TIOA 3NXPA 1GHAG 2STAE 1QNJA 1JOUB 1AFQC 3SJ8A 5C20A 2B8OH 1O3BA 3P92A 1IQKA 3GY8A 1BTZA 5F03A 4CR5A 3BTQE 1C5VA 1Z8RA 4GUXA 3DT0H 1WQVH 5LPEA 3PWBA 2BX3A 3ITIA 3M61U 3VGCC 2SGPE 2A32A 3SNCA 1F0SA 2OQUA 3PMBB 1SGQE 3RXQA 1W10U 2WPJS 1D3QB 2A5AA 2FOAA 2TGPZ 1EKBB 1TGNA 2A5IA 4U01A 3UTUH 1GMHG 1SBWA 2ZGJA 3RXSA 2BDBA 1SLVB 4Y79A 1ZHPA 3CENA 4SGBE 4AGKA 3RXIA 2VINA 4DT7B 1HXFH 1MCTA 4XFQA 1BMNH 3GYMA 1BMLA 3GCOA 3GDSA 4UONA 1GMCF 2W7UA 1PPFE 2JH0D 1PQ7A 4Y6DA 2FM2A 1C9PA 3GDUA 1YGCH 1LDTT 3SV2H 1P2KA 3ATWA 1FJSA 2W7SA 1UK3A 1QBOA 2RCEA 2QYIA 4MNVA 1KDQA 2ILNA 1Y59T 2ZQ1A 3LGWA 1C5OH 1OSSA 3MOCA 4D9RA 3T5FH 1SQOA 1ELVA 3MU1A 4D7GA 6CHAB 1MTNC 1TMBH 1Z8JB 2FWWA 1O3KA 1WV7H 3OU0A 3UFAA 4H42U 1TIOA 3V3MA 2V6NA 4ISHH 3MH7A 3IWMA 3RC4A 2FOBA 3TVJB 2VVVA 1VGCB 3TITA 1GI1A 1CT2E 1GPZA 2CN0H 3SUGA 3O8RA 2FO9A 2ZHQH 5FBIA 3M3VA 1IQJA 2RG3A 3VB4A 1UMAH 4LZ4B 1P12E 1UCYK 2P16A 1DY8A 3L3TA 1KYNA 5DP7A 3ZVGA 4YTAA 5DK1A 3FZZA 1G3CA 4NIVA 4B2CA 2A4OA 3A80A 2V3OH 4KTCA 4X6MA 5BRRE 1TRNA 3JZ1B 4O97A 3PWCA 3ZZCA 1W12U 1GL0E 1TPSA 4K1SA 2ZI2H 1N6XA 1ZRKA 5A0AE 2FOMB 3VPKA 3PM3A 1D6WA 1C4V2 2ODPA 2EI6A 4Y7AA 1ELEE 4BANB 1QURH 3S69A 1MU6B 3LONA 5JB9S 4NGAH 4KELA 2CGAA 2BZAA 1EQ9A 1EOLA 1XXFA 3E8LA 1XX9A 3KQBA 3OSYA 3FFGA 4UFEH 3SUDA 1GBJA 4Y71A 1NFXA 5LH8A 2P3TB 3SJIA 1QL7A 1W2KH 4WJG2 4X2WA 9ESTA 1C1QA 4CRDA 3HK6B 1TNGA 1ELFA 3SBKA 1NS3A 3Q00A 2WPIS 3A89A 5HXFA 5T6DA 1IQGA 4HFPB 2UWLA 1J9CH 4F4OC 2Y6TA 4X1PU 2ZA5A 2FX4A 1L1JA 1TRYA 3ZVBA 3TU7H 4JZIA 3MNXA 4U2WA 5L2YH 1O5DH 4KGAA 1O32A 8LPRA 2OBOA 1NU9A 1NESE 5E0HA 1TGTA 3A8BA 2OXSA 4AYYB 2BD9A 1O3FA 4DG4A 4XDEA 1K9OE 1DX5M 3UY9A 7GCHG 1LQEA 1BBRE 1K22H 1HAIH 2C8YB 1ZOMA 2KAIA 2F3CE 2OQ5A 1BTPA 1KSNA 2ZIQH 4F49A 1YYY1 3GY7A 1O3HA 1TGBA 1T4VH 4Y11E 2SNVA 4H6TA 2GV6A 3ZVDA 1PPBH 2FXRA 2R3YA 2Y5HA 4K69A 8GCHG 1QTFA 2DE8A 4NIXA 1O33A 2P93A 1O5GH 7ESTE 2TGAA 2PGQB 3KEEA 3NUMA 1CO7E 1VR1H 2J2UA 2G4TA 1VZQH 1UK4A 4WMFA 5EU8A 2XC0A 3LIWA 2A7HA 1AGJA 2P95A 1D9IA 3K65B 1ELTA 2ZKSA 2C3SA 2WPMS 4CRCA 1F92A 1HAXB 1T8LA 3RXUA 1EJAA 1MU8B 4HGCA 1ARBA 4NCYA 1GVZA 3LOXA 1V2WT 1Y3XA 2ZFTA 3DFLA 4DVAU 2CF8H 1VITG 1O2NA 2V3HH 1LHEH 2G8TA 3VXFH 4MNYA 2ANMH 1ANEA 4DOQA 1K1LA 2R0LA 1ANCA 2Z9KA 1V2JT 4IC6A 2A2QH 1BZXE 2I6SA 2Z3EA 3FVFB 4JK6A 2XTTB 1GBEA 1TBQH 2PHBA 2ZPQA 1CGJE 1Z8GA 1GBKA 1WOFA 3PTBA 3L6PA 5DP5A 1TA2A 1GJAB 1ZTJA 4MPVA 1C5WB 1FPCH 4OS5A 3RC6A 1P8VC 4A92A 1G3BA 2C93B 2THFB 1LVOA 1O2WA 3D65E 4ABBA 4AGJA 1FPHH 4XSKU 4AN7A 1KXFA 1QL8A 1JRSA 4TPYA 1D3DB 2C90B 2TGDA 3RC5A 2BLQA 1PQAA 1LCYA 2ZFSA 4I8GA 1AN1E 1FI8A 1GHYH 5C67A 1AE8H 2CV3A 3BIVH 5SGAE 4JK5A 4K60A 4MNWA 1YPLH 1HJ8A 4BAOB 1DXWA 4NIYA 2ZPRA 2BD8A 3A7YA 3GCTG 3A8AA 5A2MH 1LQDB 2ZGHA 1ZHRA 2PKSB 1RTKA 3SU5A 4R0IA 4D76A 2Z3DA 3QN7A 1O2PA 5DP4A 1Y5AT 1Y3VA 2PUQH 1U6QA 1IHSH 1OKXA 4X6NA 5AHGH 1GCTB 1TMUH 3M36A 5GCHG 1OWHA 3HKIB 3ESTA 5AVDA 3PLKA 3ZZ6A 2VWLA 3M5OA 3ZZ3A 3ZVFA 1J17T 2XYAA 4IN1A 3T29A 1J15A 4CRBA 4ABGA 1LVYA 5DP3A 2O8UA 3S0NA 1EPTC 2D26C 2QV1A 5DO4H 4FUEA 1LHFH 4YT6H 2GD4B 4B2AA 3MI4A 1BRCE 3LDXH 3TJOA 1AD8H 4X2XA 4Y8XA 1C2GA 1FY5A 3GCHC 2ZO3H 1HAYB 1ESTA 1OOKB 1KTTB 1G37A 1P3CA 3S7KB 1DWDH 1DWCH 1GI9B 1C5LH 1FN8A 4YOJA 1L0ZA 1ZZZA 4Y0ZE 1EUFA 1S85A 4FU9A 3MFJA 4FUJA 2BOKA 1VCWA 3TH3H 2GDDA 1YPJH 1GHXH 3QDZB 3RXFA 3QO6A 1O2QA 3B8JA 3SW2B 3Q76A 1AB9C 2I6QA 1G36A 1G2LA 1DPOA 4ZKNU 1A5IA 1GMDF 1HRTH 5C2ZA 2F83A 1GI5A 4TWYA 4K8BA 1F5KU 1TABE 1CA0B 3MH6A 3SHCH 4BTIB 3T25A 1GHZA 1GBHA 3AAUA 1C2KA 1NZQH 4K5ZA 1KY9A 2EC9H 2Q6GA 1IQEA 4ZKOU 1HLTH 2FIRH 5F8TA 1GI3A 1EAUA 2WPKS 2Y5FA 3NZIA 1W7GH 2FPZA 1SGCA 3OYPA 3P8NA 1TONA 1XMNB 1WBGB 2CF9H 2D1JA 2ZHDA 4MNXA 1EAXA 2H1UA 2P3UB 5T6GA 1ZMJA 1QRWA 2P8OC 4NSVA 3NK8A 2ZHWH 2CXVA 4MVNA 1O2XA 1RRKA 5ESBA 1ZSKA 1LHCH 2STBE 1EZUC 3EA7A 4H4FA 3V7TA 2ZFRH 3BTME 2J38A 2XCNA 1JWTA 1NO9H 1O2TA 4UD9H 3GY5A 3UNQA 5E2OA 1OYTH 1G9IE 1G30B 4HZHA 1BTWA 3A85A 4OGYA 2FI4E 1V2LT 3EGKH 3M7UA 6GCHF 1FAKH 3ZVAA 5IYTA 1RXPA 2GT7A 1ZSLA 4XBCA 2GZ7A 1DITH 2AS9A 4DURA 2Y5GA 4BXSA 2G5NA 5JYIA 3P70B 1RTFB 1TNHA 3ODFA 1AMHA 1MH0A 1GI7B 1UO6A 6GCHG 3MU8A 2ZC9H 3RM2H 1TE0A 1ACBE 2BHGA 5F6MA 1CSOE 1C1RA 1WTHD 5FPTA 3SO3A 1AO5A 1TFXA 3QTOH 1DSUA 1MTWA 2BVXH 2RA0A 3I78A 4JYUH 1FMGA 1YPEH 1QB6A 2D8WA 5DPAA 2BDYA 1A5GH 2BDGA 1A0JA 2H9EH 1AZZA 4K1EA 1KXDA 1W14U 2G81E 3E3TA 2ANWA 1TQ0B 3C1KA 1AFQB 1HDTH 3VB3A 5AFZH 1O2LA 4IGDA 3JZ2B 3ZVEA 4UFFH 2XBXA 3ENSB 3QK1A 3UWJH 2UWOA 1UTMA 2AYWA 1O2GH 2VVUA 3SQHE 2G52A 1GJBB 1HAGE 1J14A 3STIA 1S6HA 3VGCB 1Z1IA 2ALPA 1PYTD 4TY6A 1RIWC 4MPWA 3SGAE 1BCUH 3BEUA 1O3NA 1JIRA 3MHWU 1ETSH 4WVPE 2FEQH 2CHAC 1DUAA 2ZDLA 1EP6A 1OP0A 1VCPA 2FLBH 2NU2E 3GICB 2QXJA 1AY6H 4O03A 3ODDA 1AVGH 1YCPK 3BEFB 1P2OA 2BD5A 5LGOA 5EODA 4JYTA 2WPLS 2VIOA 3PB1E 3S7HB 2A1DB 1HIAA 3MNBA 1G32B 1JXPA 3H5CB 1O2YA 1VJAU 1ZHMA 1Z7KA 1BB0B 2NWNA 4B74A 1X7AC 4U30A 2XBVA 5JB8S 3TK9A 1KXCA 3PMHB 1V2NT 3AW1A 1NRQH 4J2YB 4UE7H 1LHGH 4B76A 4D8NA 4KTUA 2V0BA 3FZDA 1SGFA 2W26A 2ZCKP 5DGJA 3TGKE 1G3EA 1SQTA 1O3GA 2Q1JA 1W0ZU 1UTNA 1UK2A 5FHTA 1A4WH 1NU7B 4MTBA 3RXEA 4Q80A 2FOHA 1MCVA 1SSXA 1UVPA 3BEIB 3U8TH 2VNTA 1HAZB 1N8OC 3EAJA 1ELCA 1GMHF 2UUJB 4X0WU 1WTGH 3KGPA 1B5GH 1C9TA 2F9PA 4I32A 1P9SA 3GY3A 2FESH 1GBCA 1AQ7A 2FI5E 2VWOA 2NU3E 1T8MA 4CH2B 3W94A 4AOQA 1FAXA 1O2UA 3BG4C 2SFAA 1ANBA 5DP6A 3ZYEA 3RXGA 1ZGIA 2QF3A 1YPKH 4A1VA 2A7JA 1NFWA 3SI4H 2Z7FE 3LC3A 4FVBA 5FX5A 1C5NH 3SNBA 1O38A 3UPEA 1AUTC 4FUGA 1A0LA 3PMAB 2SGFE 1CBWC 2ZU1A 1IQMA 4Q7ZA 1UTKA 1EP5A 2NU1E 1GWAA 2HWLB 1BQYA 2GGVB 3RXTA 1A1RA 3MNCA 1SGPE 2PR3A 1O5EH 2FMJA 3E1XB 1GGDC 1NRNH 1XXDA 1P11E 4BAQB 3MTYA 1TWXB 1OS8A 4U32A 5A0CA 2WPHS 5HM2A 3UOPA 1Z1JA 2HNTE 1HFDA 2BYAX 1GI6A 1ID5H 4D7FA 2F9VA 2AEIH 2FP7B 2QY0B 3BTTE 4IMQA 1AWFH 1GG6C 2VU8E 1MTVA 1G3DA 1WU1A 1AUJA 2VGCC 1O3LA 3ATMA 2KAIB 2Y81A 3FP6E 2ZG0H 3RXDA 1HYLA 2QCYA 2SNWA 4B1TA 2Y7ZA 4KP0A 3KHVA 3KQDA 1WAYB 1TGCA 2W3KA 5CHAC 4ZH8A 1S83A 1C5RA 2R2MB 1DLEA 1XUKA 2O8LA 1DICA 4ZMAH 1GJ4H 1O3JA 7KMEH 1K1OA 1O2IA 5E2PA 1C1SA 1KXEA 2TGTA 4IMZA 1GDQA 1NM6A 2EI8A 4WH8A 1C5MD 1EASA 1HJ9A 1LPKB 1BIOA 4DGJA 1ORFA 2QC2A 1MBMA 5AFYH 4Z6AH 1M9UA 2Z9LA 2WUCA 3R0FA 5C1UA 2A31A 1DVAH 1WUNH 1Z6EA 2AGGX 1SGYE 4X1RU 1O35A 5C1YA 1K21H 2D2DA 4ZROA 4KKDA 1SFIA 3UR6A 5EXNA 5L6NH 3RXPA 6ESTA 2OD3B 3K9XB 2J92A 1O3DA 3LKWA 4YZUA 1BTUA 2J9NA 2ZZUH 4CH8B 3OY5U 4THNH 1W11U 1NROH 3P8OA 1HJAC 4Q7XA 2GCTC 1THRH 2VIVA 4INLA 4ABFA 1FDPA 3RU4E 1HAPH 1NC6A 7GCHF 3PLBA 3QZQA 4X6OA 3GDVA 5EPYA 4DIIH 1BDAA 2DE9A 4ZKSU 2SGDE 3KF2A 4ISOA 2H5CA 1GBMA 3A88A 4X1NU 4A1XA 3ZZ5A 3BTEE 5EQQA 1TX7A 1K1MA 2AGIX 2BY8X 5EW2H 1LPGB 3DFJA 1XKAC 3RXKA 4CHAB 1Y3WA 2ESTE 3FP8E 4JZEH 2GX4A 2OP9A 1QY6A 1H4WA 3R3GB 2QGRA 3URDA 8GCHF 1HGTH 1HAOH 1ZRBA 1NY22 1VJ9U 3RXMA 2ZDAH 4NA9H 2FYRA 1TX6A 1CQQA 1ELBA 2VWNA 1GHWH 1MBQA 1EX3A 2VIPA 3AVZA 1H1BA 1TMTH 4JZFH 2A5KA 1LO6A 2HRVA 3ATLA 1FONA 4AFSA 1YC0A 3F6UH 4LOYH 8ESTE 1ZYOA 4OS4A 3SU1A 1BTXA 3UWIA 1MKWH 5HGGA 1UHBB 2A0QB 3Q3XA 2XBWA 1SC8U 2BY7X 1FIZA 1C2DA 1C4U2 1YPHE 1QFKH 3S9BA 3IITA 2R2WU 1KLTA 4J1YA 1AWHB 3K2UA 3CP7A 4RKOB 1VITF 3E16B 3M5MA 2PUXB 1SPJA 1O5AB 3E90B 2IN2A 1C4Y2 3S9AA 4WH6A 2FOFA 5FCRA 3ZV9A 1QJ7B 1IQHA 2OC8A 1CA8B 1O2RA 1O2OA 1MQ6A 3HK3B 1AFEH 3VB7A 4K3JA 1INCA 3A7XA 4NSYA