4M7GA

Streptomyces erythraeus trypsin
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
223
structure length
222
Chain Sequence
IVGGEDANVQDHPFTVALVTPDGQQFCGGTLAAPNKVVTAAHCTVGSQPADINVVSGRTVMSSNEGTVSKVTNVWVHPEYQDAAKGFDVSVLTLEAPVKEAPIELAKADDAGYAPDTAATILGWGNTSEGGQQADHLQKATVVNSDDTCKQAYGEYTPDAMVCAGVPEGGVDTCQGDSGGPMVVNNKLIGVTSWGEGCARPGKPGVYARVGAYYDVLMEQIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Trypsin-like protease
publication title Conformational flexibility in the catalytic triad revealed by the high-resolution crystal structure of Streptomyces erythraeus trypsin in an unliganded state.
pubmed doi rcsb
source organism Saccharopolyspora erythraea
total genus 61
structure length 222
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4m7gA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4m7gA01
3CS0A 4FUFA 3SGAE 1GI8B 3RXOA 3O8DA 1K2I1 5C5OA 1RJXB 2GT8A 3KF2A 4XE4A 4X1RU 2GP9B 3SGBE 1CSOE 1C5SA 3M7UA 2BD4A 1TWXB 3ZV9A 2PTCE 4CBNA 2FX4A 1DITH 3ATKA 3STIA 1IQNA 1NZQH 1F5RA 3ATWA 1O2NA 1CA0B 1PPHE 3PMHB 4NZQA 5A0BA 2GX4A 2RG3A 2FI3E 2XC0A 2BVSH 2OBOA 1NFYA 3C1KA 4Y8ZA 2A32A 2FOEA 2GDDA 1AZZA 1ESBA 4R8TB 1N6XA 1WSSH 1SR5C 1AVXA 1SGPE 1BITA 4LZ1H 4ABAA 2PR3A 4NFEA 1ELGA 2ANYA 1Y3UA 3ZVDA 2FYRA 3SV2H 4B76A 2OC1A 2B5TB 1FY8E 2CHAC 1MCVA 3D49H 2ZFFH 4Q2KA 5DP3A 8GCHG 1UJ1A 1UTKA 4GSOA 4IC5A 1Y8TA 1O30A 1QQ4A 2QXJA 1IQHA 2J95A 4BOHA 5HYOA 1TBZH 2Q1JA 2ZCLP 1GHVH 1DXWA 1ARCA 2RA3A 4YM9A 4AGKA 2FOGA 1ZPZA 1O3EA 1O5FH 3VPKA 1C5WB 1A0HB 3RXPA 4JK6A 1IQEA 2A4OA 1C1OA 4AGJA 2Y7XA 1GMDG 2ZGCA 5DP8A 1EX3A 1HLTH 3LC3A 2Y5HA 3K9XB 3BG8A 1ZZZA 3VB3A 1DE7H 2PKAA 1VCPA 1HGTH 2Z3DA 4ISNA 1MMJN 3SJ9A 3MYWA 1GJ9B 3QTOH 3RXRA 3SNCA 1NY22 1KLTA 1ARBA 2BLWA 1GMDF 2TPIZ 2FOBA 1DUAA 2PTNA 9LPRA 4OS6A 3UWJH 1GG6B 2RDLA 2OC8A 3ZZBA 1CT2E 3B9FH 1V6DA 4X2VA 1C5OH 3RC6A 4B71A 1V2MT 1LQDB 1NFUA 1TNHA 2H9EH 2Z9GA 4JYUH 3M35A 3BTDE 3RMNH 1GBEA 2ODYB 1TGBA 5DP4A 5DP7A 1UCYE 4DT7B 3W94A 2GCTB 1TPSA 3QZQA 1L1GA 2BHGA 1J17T 3LH1A 4Y11E 2F9NA 3MO3A 3T26A 1AE8H 2G8TA 2DE8A 4I32A 4CRFA 2UWPA 2C93B 3LOXA 1ZHRA 2WPJS 4FUJA 3MMGA 1O2GH 1W0ZU 3ZZ4A 3RP2A 1IAUA 3BIUH 3A7ZA 1A61H 1GHZA 3EA8A 2D2DA 1GCDA 1J8AA 3E0PB 4Y7BA 1F5KU 1S83A 1V2RT 1ZPCA 4WH6A 1UMAH 2FPZA 1WQSA 2XCFA 3A7VA 2BZAA 3SQHE 1U6QA 3A82A 4UD9H 1HB0B 5T6DA 1FJSA 2EI8A 1AKSB 1VJ9U 2FDAA 5I46H 1LPKB 3A86A 5CHAC 1O3DA 3I29A 3RXQA 1ELCA 5ABWA 3A8BA 3UNRA 1HAVB 3D62A 3ATMA 5JDUB 2Z9IA 2BOHB 1MTVA 3LGTA 5AHGH 3HPTB 1C1TA 1O5EH 2GT7A 1D9IA 1O33A 4TPYA 1ESTA 2Z9JA 5C5NA 1V2KT 2STBE 1C2HA 1SC8U 4H4FA 1GBBA 2Z3EA 1TMTH 1G2MA 1BZXE 1GBCA 1SGNE 3U9AH 1YM0A 1V2TT 3ZZ7A 1SFQB 1T32A 2BYAX 1ZLRA 1UVPA 2BY6X 1PYTC 1DX5M 1O2RA 3EE0B 1S84A 1TB6H 1NU7B 4B2BA 4XBCA 1ETSH 3PV4A 1DLEA 5GWZA 5E0JA 3FP7E 1A3BH 2ZGXH 1WTHD 1WQVH 1O2XA 2J9NA 1P8VC 3LT3A 3UTUH 2H9TH 3UQOA 5HMAA 1P2QA 4NA9H 5E2OA 1IQGA 1BTPA 1YYY1 4WVPE 2R3YA 3SU3A 1K1MA 1ABJH 1O34A 2Y5GA 1GBDA 2GVFA 1T8MA 1TOMH 1EJMA 2ZNKH 1EJAA 2A2QH 5K7RA 1OP8A 4DG4A 4PROA 2ZU5A 1V2LT 2PUXB 1DVAH 3CP7A 2FXRA 3SHAH 3TJUA 1AWHB 1GI6A 2RCEA 3MWIU 2ZDMA 2XBVA 4X1NU 4Q80A 1O0DH 1HYLA 1KXCA 4CREA 1BRUP 1GHWH 4O9VA 2BMGB 1AFQC 2FX6A 1A7SA 2BD5A 3KNXA 2GMTB 3LU9B 5HXFA 1LTOA 4GPGA 1PPBH 1DOJA 2V6NA 4MLFB 1UHBA 4A1TA 2FOMB 3E91A 3PTNA 4B1TA 2HNTE 1KLIH 2F91A 2Y81A 4WMFA 4D7GA 1W8BH 1GMCG 4X1QU 2OP9A 4ZMAH 2ODQA 3URCA 3S7HB 1UTQA 1C5TA 1Q31A 2VB0A 4VGCB 2VH6A 3TK5A 5J4QA 3GY8A 1EZSC 3MH5A 5HM2A 1GMCF 1YCPH 1O38A 2VIWA 3EQ0H 2BLOA 2FOFA 4IW4E 5FX5A 5C20A 1LVMA 4TY6A 3MH4A 1NRSH 2AGGX 3KIDU 1S0QA 3QTVH 1SGEE 1C5ZB 3K65B 4YOJA 3OSYA 1AZ8A 3ZVGA 3BTQE 3E3TA 1BIOA 5LPRA 3FANA 5FPYA 2W5EA 1LKAA 2IJOB 1V2WT 5FX6A 3BV9B 2ZHEH 3E6PH 5F8ZA 6CHAB 3PMAB 3GCTG 1OS8A 2FS9A 5LH8A 3M5NA 4CRGA 1GBMA 4YT7H 3MNSA 1D3PB 4AN7A 2NU1E 2G52A 3GY4A 3SU5A 1OWKA 2AFQB 3GCTF 1C5RA 4X6OA 1SG8B 1EAUA 2ZDKA 1F0TA 3LDXH 1UCYK 4O3UA 2D26C 1V2NT 5SGAE 1HJ9A 3U1IB 1QR3E 2SFAA 3NWUA 4NG9H 4AFUA 4D8NA 2FI4E 1NC6A 3TGKE 2A4RA 3FP6E 3A88A 3SNEA 3TJOA 3U1JB 3OU0A 1AQ7A 3FVFB 3E90B 1GCTB 1NM6A 5AFYH 4Y8YA 1GMHG 1GJCB 4WMDA 1H8IH 5EPYA 1PPCE 2XTTB 2ZKSA 3GYMA 2PFEA 1N8OB 1S82A 2P95A 2F9PA 4MPVA 2TGAA 2W7SA 8ESTE 1TX7A 2QF0A 2ZU4A 1FUJA 1GMHF 1AVGH 1DDJA 2FIRH 1QJ1B 4CHAC 5FCRA 2BVXH 5G4BA 1AWFH 1SGFA 4AB9A 3P8NA 1GI9B 1MU8B 4GHQA 4UFGH 5EW1H 2OXSA 1C2LA 4MTBA 1IHSH 3UREA 2C8XB 1YPHE 1CHGA 1S6FA 3HKJB 3PLPA 3VXFH 1CHOG 1Y5AT 2ZGBH 1IQMA 4GVUA 3MU4A 4WH8A 4ZROA 1OXGA 1BHXF 1UK3A 3B23B 1ANCA 1O3BA 4K2YA 3RXUA 4YOIA 1QBNA 4K1EA 4ABDA 3MNXA 5BRRE 1EASA 4IN1A 1ID5H 4Y10E 1MZDA 3PWBA 1QGFA 3FFGA 4LK4A 2G5NA 4RKOB 2SNVA 3Q3XA 4X6MA 2ULLA 4JK5A 2VVUA 1TX8A 3PO1C 1F0SA 3A85A 1JRSA 4A1VA 1FI8A 1DT2A 2ZCHP 1O31A 1S85A 4KELA 4B73A 2P16A 2G55A 1TONA 4YLUA 3TIUA 2H2ZA 5DPAA 1AGJA 4OS7A 4E7RG 1GBLA 4H6TA 4BTUB 1AI8H 3BSQA 3ZYEA 3RU4D 1EXFA 2SGEE 5A0AE 1SHYA 1FV9A 1SQAA 1O2PA 4I33A 1P0SH 1LO6A 1G9IE 2PLXA 1HAIH 1P05A 1C1VH 2A31A 2FODA 2FTLE 1YPJH 1MKWH 4ABBA 3MO9A 4WJG2 1XMNB 1X7AC 1OX1A 2BY8X 3V3MA 1O3AA 2WPKS 3KQDA 5L2YH 2WV4A 4TWYA 1V2VT 4NIXA 2C3SA 1TFXA 3V12A 1HUTH 1QBVH 1SHHB 1D6RA 1PQ8A 1ZJKA 4NFFA 4U30A 1MQ6A 5DGJA 1ZTLA 2GZ9A 1FONA 3SNBA 3RXLA 3GISB 1EOJA 3HGPA 1PYTD 4TYDA 3QUMP 4X2XA 3SNDA 4GUXA 2JH0D 4E05H 4KKDA 1BHXB 2FZZA 4UFFH 4NWLA 5ESTE 4K3JA 5FPSA 4ZXXH 5J4SA 1THPB 2THFB 1SLXB 1ZHMA 3SHCH 4ABIA 3PB1E 2JH5D 1A5HA 3EGKH 1GWAA 1YKTA 2Z9LA 1O5CB 1QNJA 1FY3A 9ESTA 3RU4T 3SI3H 5FPTA 4NSVA 1E37B 3UQVA 1QURH 1J15A 2ALVA 2I6QA 3TH3H 2OD3B 1BCUH 3K6ZA 3GOVB 3P17H 1B5GH 2JETC 1YF4A 1O3NA 3SU4A 1L4ZA 3MH6A 1NRPH 1FIZA 1L1NA 4BTIB 1SGDE 3RXGA 1ETRH 3B8JA 1MBMA 1C1NA 2O8LA 3PLBA 1BUIA 1KXAA 1GL0E 1GJDB 1NPMA 3TLOA 4AFZA 1HBTH 1LHCH 1K1PA 1GBIA 4J1YA 4JZ1A 4AX9H 1T31A 2A4QA 2VNTA 3BG4B 1BTHH 3IG6B 4X6PA 1VGCC 1O37A 1C5PA 3HK3B 1GPZA 4X2YA 1GJ4H 5EQRA 1CVWH 3SUEA 1FMGA 3DHKH 3ESTA 3UIRA 1HAPH 1SPJA 3SJIA 4Z0KA 2F9OA 1TPOA 1MU6B 2D8WA 5HM9A 1H4WA 1HAXB 3GCOA 4FU8A 2G4TA 2XNIA 3A81A 3BTGE 1F92A 1EPTB 1OP2A 3DT0H 1T8NA 1MTNC 4BNRA 4I8JA 5DO4H 3LGUA 1C2FA 3ZVFA 2DE9A 3PYHA 1NN6A 4YESB 5EXNA 4LOYH 4AFSA 2ZDAH 4B2AA 3F68H 1C9TA 1QA7A 1W13U 1EKBB 1HRTH 2FOAA 3FZDA 1P01A 1ZTKA 2ZDVH 3GYLB 4AYYB 4QT8C 4D9QA 1A0JA 3TGJE 4I7YH 1TA2A 3EA9A 4GAWA 3TJNA 2AYWA 1MQ5A 2VIDA 2ZHDA 1EB2A 4NIVA 3QZRA 4FUHA 1SGRE 3GDVA 2HALA 3UR9A 2SGAA 1FDPA 5EXMA 4MNXA 3SJKA 5GIBA 1O5GH 1XUIA 2P8OC 1XVOA 2OUAA 1C1UH 1DXPA 2BX3A 5FHTA 3TGIE 1YPLH 1WYKA 1TNLA 1O2VA 4JYVH 1K1NA 1N6YA 1ZR0A 1AN1E 2C90B 1SBWA 1ZSLA 2VIVA 5JPMH 1MKXK 3BIVH 2G51A 2WPMS 5JB8S 3KQBA 1HFDA 2W7UA 3DD2H 1O2WA 2H6MA 5EGMA 3L6PA 5CHAB 4WMEA 1EPTA 3PROA 1Z1IA 1QTFA 3SGQE 1SB1H 4Q7ZA 4OGYA 4ZKSU 4BAOB 3KQCA 5ESBA 1VCWA 1HAYB 1Z71A 3SBKA 1NRRH 3T62A 1TIOA 5EQSA 2UWLA 3FP8E 3ATIA 1Y59T 2BDGA 4CRBA 2FTMA 3RLYH 1GJ6A 2ANWA 3T28A 3ZZ8A 1EB1H 4AOQA 3CENA 4U01A 1O2YA 1O2HA 2HNTC 2NU2E 1BMLA 1G36A 4F49A 1FPCH 4A1XA 1MBQA 5EODA 3RXSA 2YOLA 2PW8H 3QWCH 1TNKA 3RXJA 1ZMJA 1W3CA 4HZHA 3ZVBA 1OWEA 5A8XA 2P93A 5E0HA 2BQWB 2AS9A 1SGCA 1AUJA 1RTLA 1UTOA 1TA6A 3GY2A 5FBEA 3SW2B 1C5VA 1HJAC 1N1LA 1TGTA 3RXCA 1EUFA 3T29A 3S69A 1MTSA 1F0UA 2HOBA 1IHTH 5FXLA 1AHTH 1TGCA 1O2TA 1QIXB 3P92A 1SLUB 5C1XA 1ZRBA 2OLGA 2NWNA 1UTPA 1EZXC 1Y3WA 1H9LB 1LMWB 1GVKB 1SOZA 1UCYH 2XBWA 1UK2A 2AEIH 4OS1A 3EYDA 3RC5A 2BDIA 4LXBH 4XDEA 1QRZA 3MFJA 2QXHA 2BD8A 1ELFA 1XUGA 3JZ1B 1NFXA 1ACBE 1SI5H 2CF9H 3MO6A 3MTYA 3SV9A 2ZG0H 3C27B 1ELTA 3QLPH 1CO7E 2BLVA 1BT7A 1P2NA 3QGJA 5FBIA 2ZCKP 1IQFA 4DOQA 3S7KB 1AFQB 1WV7H 4WY3A 4ABEA 4NCYA 4A92A 1TPPA 5JYIA 3RC4A 3AASA 4MPXA 1K9OE 1SLWB 3F9GA 4AORA 3P8FA 2STAE 2UUJB 4SGAE 1AY6H 1G30B 4UEHH 1YCPM 2KAIB 2B8OH 1MTWA 3SUGA 3BTHE 1TGSZ 4A6LA 2FWWA 4RN6A 1V2OT 2GCHG 4JYTA 2SGQE 1AB9C 1GBTA 2V35A 2BXUH 2J2UA 1ELEE 3RM2H 4HFPB 3M61U 1QA0A 2HPQH 3JZ2B 1LDTT 3T2NA 2ZTYA 1AVWA 4ZKOU 3MNCA 2GCHF 1OWJA 3SUFA 2O8UA 1O2JA 1QL7A 1GHXH 1Z8GA 1YPHC 1EAXA 5JBCS 1W7XH 2EI7A 1KXDA 1O3CA 1ZOMA 4OS5A 5EU8A 1T8LA 1C1RA 4FUIA 1AKSA 2PKSC 1HXEH 3TVJB 3TPIZ 4DY7B 5B6OA 4GLYA 3UUZA 5T6FA 1VITF 1HAZB 3RDZA 6GCHG 5JBAS 1BA8B 4O97A 1SGIB 2H5DA 4RSPA 3U8TH 5T6GA 1HAVA 3TH2H 1O5DH 4K8BA 3U8RH 3RXHA 5E0GA 2A2XH 2F3CE 3TITA 4Q7XA 4SGBE 4DGJA 6GCHF 1QBOA 1GVZA 2Y82A 1O2QA 3RXFA 4A7IB 3V0XA 1ZMNA 3MU8A 1HAOH 7ESTE 2AERH 3HK6B 2IN2A 5AF9H 2KAIA 1YPEH 3UNSA 2EEKA 1LPZB 2XYAA 3FZZA 1C5YB 4Y0ZE 1PPEE 1Z8RA 3VB6A 3MNBA 4MPUA 2QF3A 3SORA 1YBWA 4ZXYH 2BVRH 2WYGA 3SOSA 4JCNA 2Y80A 4HI3A 2WV5A 1TNIA 2XBXA 2VIPA 3ODFA 1W10U 1O3PB 5JB9S 3F9FA 1OWIA 3RM0H 4X6NA 4I8GA 3STJA 3F1SB 1WBGB 3MU1A 1EAIA 4CHAB 3SI4H 4FUBA 1EQ9A 3EDXB 1TOCB 1TPAE 1C2IA 1XXDA 3PTBA 3LONA 3A83A 1PPGE 1TAWA 1KXFA 4AB8A 2XWBI 1T7CA 1YPGH 2VWNA 4MVNA 1IQLA 3DA9B 4I8LA 2J92A 1P57B 4DJZB 1ELDE 1Z1JA 1J9CH 5L6NH 1DS2E 5EXLA 3E1XB 4JZFH 1B0EA 2TGPZ 1VJAU 4ZHLU 1K1IA 4O03A 1MTUA 1HIAB 1TMBH 3GDUA 1RFNA 1BJVA 1Z8JB 1THSH 2A5IA 2ZHFH 2UWOA 4NIYA 2BM2A 2Q6GA 3LGYA 1VCQA 1ZTJA 3PO1B 2ZQ1A 5FAHA 2ZFQH 1TBQH 3RXMA 1GBJA 1FY5A 1YPMH 4UE7H 1KY9A 2H5CA 1C4U2 1D6WA 1VZQH 3S9AA 3SZNA 6ESTA 3VB7A 3P70B 1S5SA 5C1UA 4ISLA 3MHWU 2QA9E 2WYJA 3TK6A 1GI2A 1W11U 1NU9A 1LVYA 1AD8H 4DIHH 1P2OA 5BPEA 1A3EH 5GJ4B 3MH7A 1FN6A 4MDSA 1CE5A 1D3TB 4I31A 3RLWH 2R9PA 1QFKH 2QYIA 1SLVB 3ZZDA 2ANMH 2EA3A 2QC2A 2Y6TA 1HNEE 4YO9A 5EOKA 3BTTE 5JBBS 3U69H 2C8ZB 4OS2A 3SV6A 1OWDA 4O3TA 3GY7A 1G3BA 4FVDA 4X1PU 2BY5X 3V13A 1XXFA 1EZUC 1TABE 2A5AA 4D9RA 2PUQH 1ZHPA 2F83A 1OYQA 2AGEX 2TIOA 2CGAA 1BOQA 1K1LA 2O8TA 1A2CH 1A46H 1HIAA 4X1SU 5F8XA 1ANEA 1LPGB 2C4FH 2A0QB 3VEQB 1KDQB 3AVZA 1A0LA 1LQEA 1AUTC 3KQEA 1C2DA 1NS3A 3HGNA 4XFQA 1OP0A 2Z7FE 4Y71A 3RXEA 3MI4A 1A4WH 4BAMB 2XC4A 1O3KA 1G2LA 2O8WA 2YNBA 3T27A 3U8OH 1UK4A 1HAHH 5IYTA 3A8CA 4DVAU 2Z94A 4ISHH 1BTYA 1D3QB 2OCVB 1BMAA 2P94A 6CHAC 1V2UT 3MU5A 1XUFA 2VWOA 1Z8IB 2XCNA 4FVBA 4UFEH 3TNTA 5EW2H 2JH6D 1L0ZA 2CXVA 2UUFB 2JETB 3KN2A 3KCGH 2VINA 3RXBA 3ODDA 1EOLA 1V3XA 2VGCB 2FYQA 2QCYA 4ZUHA 3E16B 1AMHA 3Q77A 4AG2A 5ETXA 3ENSB 1MH0A 2SNWA 5DP9A 4H42U 2I6SA 1BTUA 5K0HA 1MUEB 2H9HA 2J4IA 3SNAA 3LGIA 2PV9B 1ZGIA 5DJ7A 3HATH 1C5QA 1VGCB 1JOUB 1MAXA 2FMJA 3NPSA 3RXAA 4ABGA 2BDYA 2R2WU 1CA8B 2YNAA 1P9SA 1LHFH 4MNYA 3RXVA 2B9LA 1MD8A 1IQJA 3OYPA 3UOPA 4K60A 3ZZAA 2GV7A 1GJBB 2HPPH 2NU3E 2BXTH 1XUJA 1LKBA 2SGDE 4Q7YA 1MTNB 2AGIX 3K2UA 1H9IE 1ELAA 1BBRE 1C4V2 1ZSKA 1Q3XA 1O3IA 2PGQB 3BTWE 1BQYA 1C1WH 1SL3A 4CR5A 1O39A 2HNTF 1LCYA 1W14U 1V2PT 1TE0A 1RXPA 1P3EA 3N7OA 4YLQH 4ABFA 1GHBF 1O2KA 5HGGA 2XXLA 3OY6U 1DY8A 3UY9A 3LH3A 1EZQA 4CR9A 2LNCA 1UTLM 3TNSA 2XWAA 3S0NA 2CHAB 3KGPA 1HXFH 5A09A 1QRWA 2R2MB 1FAKH 1G3CA 1O2IA 1IQIA 2PHBA 1XVMA 2FO9A 3PMBB 1GGDC 1FY4A 1SVPA 2Z3CA 4UONA 3SQEE 3Q76A 1ANBA 1TLDA 1CBWC 1T4VH 1Y5UT 3VB4A 3L33A 2Z6BD 1YC0A 1GBFA 5AVDA 4OGXA 2QXIA 3O8CA 1XKAC 4TY7A 4UDWH 3ITIA 1P2IA 1YLDA 1QQUA 5TJXA 3GCHC 2BY7X 2LPRA 1DLKB 4ISOA 3ZYDA 4X8TH 3VGCC 1TYNA 3VB5A 1BTWA 1GVLA 1D4PB 1SGQE 5A0CA 4I8HA 2CJIA 3PMJA 1EATA 1DWDH 3S9BA 1RIWC 3OTJE 2WUBA 1Q2WA 1GI1A 3PM3A 1PPFE 3A89A 1F7ZA 3P8OA 2BTCE 5DG6A 1NO9H 1P2KA 1XUHA 2FS8A 1P10A 3P6ZB 2BD2A 1DFPA 5TCCA 1P06A 2W3IA 4XSKU 4CBOA 3SJ8A 1ETTH 2V3HH 1NT1A 3HKIB 4TWWA 1DM4B 1BB0B 3PLKA 5F8TA 2XBYA 3I77A 3P8GA 1H1BA 1WUNH 2TGDA 1KLJH 1GHAG 4TPIZ 2PKAB 2PWXA 2QV1A 2CN0H 3Q00A 4RKJB 3ZZ6A 2ODPA 1C1PA 2ZPRA 3QDZB 1RS0A 5IDKA 1PJPA 1HJAB 1BDAA 2CF8H 1DPOA 4BAHB 2BX4A 1F2SE 2AIQA 1GHAF 1BRBE 1W12U 4KTSA 4FUEA 4JZDH 1MAYA 1TRNA 1LHGH 1VITH 3A7WA 1W0YH 2GV6A 4X0WU 3BTME 1DY9A 2GDEH 1KSNA 5A8YA 5GCHG 1Y5BT 4AG1A 5CE1A 2HWLB 7KMEH 4U32A 4THNH 2H1UA 1O5BB 1E38B 4NWKA 3A8DA 2ILNA 1C9PA 1T4UH 2G5VA 1TBRH 4BXSA 1L1JA 3A7XA 4I8KA 5LGOA 5PTPA 3W95A 5GCHF 4Y6DA 1GDNA 3QN7A 5LPEA 1JMOH 1QJ7B 7LPRA 1P3CA 4NGAH 8GCHF 1CGHA 1HAGE 3S9CA 4ABHA 1UVUH 3NUMA 2ZI2H 3LKWA 1C2MA 3BG4C 2VVVA 3ZZ5A 2ZGHA 1GI7B 3M7QA 1O2ZA 1K1OA 3ZZ9A 1C5NH 1ABIH 4ESTE 3RXDA 3UOUA 3WY8A 3RXKA 1C2JA 4BXWA 1K22H 5DP6A 3AW1A 4INKA 1E35B 2WPIS 2GZ7A 4DCDA 1O5AB 1TRMA 1DWBH 1OYTH 2CMYA 1C1SA 3ZVCA 3SUDA 2ANKH 5JBTA 2OTVA 4WF8A 1MKWK 5C3NA 5C1YA 1PQAA 1UVSH 2AIPA 4ZHAA 1EPTC 1CGIE 5FCKA 3DFLA 2VH0A 1CA0C 3L3TA 4X8UH 1QJ6B 1C2KA 1AB9B 1JRTA 1AO5A 5DKMA 2QN5T 2ZPSA 1EJNA 2A4GA 2ZA5A 1BRCE 4MNVA 1O3GA 3UFAA 5EG4A 5L30H 1SGYE 3LGWA 4YTAA 4AZ2B 1UTMA 4CH8B 1O3OA 3M5LA 1H8DH 3GICB 1UVOA 4K1SA 3UNQA 1O3FA 1QCPA 1L2EA 5LPFA 1IQKA 4ZAEA 2PKSB 3RXTA 3BEIB 3M37A 3V7TA 3TH4H 1ESAA 4BANB 5CMXH 2FEQH 1BMMH 1G32B 1WAYB 3LIWA 4FU7A 1T8OA 4ZH8A 1BBRK 4NIWA 2ZFTA 4BTTB 1TX6A 1HCGA 2BY9X 1C2GA 1DSTA 1C1QA 1ZYOA 1QB6A 2BQ7B 1ZMLA 3M3SA 1RTKA 5L2ZH 2ZO3H 1V2ST 1RRKA 4MQAA 3AAVA 1G3DA 1O35A 1ORFA 2ALPA 2HVXA 2ASUB 1AFEH 1JXPA 3M5MA 1B0FA 1ZSJA 2TRMA 2GKVE 2BOKA 4MG3A 1ZGVA 1D3DB 2BD9A 2OQ5A 2VWLA 5TCAA 2A7CA 4ZHMU 2WPLS 2ZHQH 8LPRA 2XRCA 1BTXA 2Y5FA 2WINI 4WXVA 4JZIA 4JMYA 2A1DB 2FESH 2B0FA 1AIXH 2F9UA 1NESE 2G81E 1YP9A 1O2MA 3RMOH 4E06H 1TQ0B 2BLQA 4IMQA 1GG6C 1QHRB 1DWCH 1LVOA 3QGNB 1Z6EA 5DK1A 1G3EA 1K1JA 4Y0YE 4H6SB 1W7GH 1C5XB 1P9UA 3QX5H 3VFEA 3TU7H 2OC7A 3E8LA 1RGQA 3LPRA 2EI6A 2B7DH 1GI4A 4ZKNU 1VITG 1A5GH 4M7GA 3DFJA 1UHBB 2GCTC 2IPHA 1Z6JH 3GY3A 2K1QA 4X8SH 4YZUA 3FAOA 2C8YB 3BTEE 2J38A 2ZP0H 1SGFG 3SU1A 2FP7B 3TJVA 1C1MA 1TNGA 1P03A 4NSYA 1SQTA 1WTGH 1GBHA 2OQUA 4KTUA 1Y3YA 1KXEA 1TALA 3QO6A 3EAJA 3ZZCA 2ZZUH 1BMNH 1WOFA 3QK1A 1Z7KA 5H4IB 2D1JA 4ISIH 2P3FH 2CV3A 2ZEBA 2F9BH 2PSYA 4HGCA 1OOKB 1SQOA 4NZLA 4B75A 1ELVA 2ZPQA 1XX9A 4YOGA 5E8EH 1GHYH 1DUEA 4FUCA 4GCHG 4WXIA 4FUGA 4CRDA 5C2ZA 3RMLH 1OKXA 2QXGA 1A1RA 1NRQH 1QB9A 3NK8A 1BJUA 4Z6AH 2OBQA 2NU0E 6LPRA 2QAAA 4MNWA 4Y7AA 3SN8A 2R0KA 4IBLH 3M5OA 3RXIA 4GCHF 1AU8A 2M5TA 1O3HA 3F9HA 2ZFSA 4X2WA 1S0RA 1WU1A 1LHDH 2FM2A 2ZECA 2ZDLA 3NXPA 1E34B 3NZIA 2ZFPH 1YLCA 4K5ZA 3LGVA 2ZGJA 3UWIA 4YT6H 1UO6A 1Y3XA 3URDA 4AFQA 5F6MA 4KP0A 2ZIQH 1C4Y2 1EP6A 2ZU1A 3H7OA 3IITA 1MZAA 4Y76A 1SFIA 2P59A 3TK9A 2BDBA 5EPNA 1F5LA 3KEEA 1JIRA 1EAWA 2A45B 2BDAA 2AMQA 1OSSA 1QY6A 1DANH 2ZF0H 4U2WA 2P3UB 2WUCA 4R0IA 5C67A 1QL8A 1FAXA 1KXBA 5EQQA 1H9HE 3H5CB 3DUXH 2ZC9H 1RTFB 4NA7A 1WCZA 1SOTA 1O3MA 2HGTH 4CH2B 1OPHB 4NA8A 3IWMA 3A8AA 3BEUA 3Q3YA 2A7HA 4D7FA 1TNJA 1PFXC 1MCTA 1GI0A 2PSXA 3ZVEA 1UTNA 3P95A 1A5IA 3KL6A 3A87A 4GHTA 4ZKRU 1DICA 2Q6FA 5E2PA 3E0NB 1O2SA 5GDSH 1QRXA 4INHA 2XW9A 2P3TB 4K69A 5F03A 3UR6A 1J16A 3RU4E 5A2MH 2QGRA 3KHVA 1TGNA 4IC6A 3BTFE 3LC5A 1GDUA 1SGTA 3NKKA 2FI5E 1RD3B 5GPIB 4DIIH 1HJ8A 1V2JT 4ABJA 4CRCA 1B7XB 1GJ5H 3I78A 2RA0A 4J2YB 2R0LA 3O8BA 1JWTA 4F4OC 1C5UA 1CGJE 2GMTC 2UUYA 1ELBA 2A5KA 2W26A 2VIOA 3GY6A 2O8MA 3ZVAA 1GDQA 4UFDH 4B74A 3D23A 1PQ5A 5A8ZA 1BRAA 1DWEH 1SSXA 1C2EA 2SGFE 3SV7A 3SU0A 1GJ7B 2Y7ZA 2G4UA 1LVBA 2QIQA 2SGPE 4VGCC 2J94A 4XOJA 4IGDA 3SO3A 1G37A 2F9VA 1YGCH 2ZTXA 1NRNH 2ZU3A 1HPGA 3SU6A 1EP5A 2BDHA 2BD7A 3BTKE 1FLEE 1P2MA 1FIWA 8KME2 1CT0E 2G00A 2R3UA 1LHEH 2TGTA 1KTSB 2V0BA 2ZTZA 2ZWLH 1QB1A 1HV7A 1Y3VA 2EC9H 3D65E 3M3VA 3SJOA 1XM1A 4FU9A 4Y8XA 1O2LA 3U98H 2W3KA 3VXEH 1GBKA 1IOEA 2ZU2A 4E7NA 4LZ4B 3Q3KA 3PWCA 3SU2A 3G01A 4DURA 2V3OH 2TBSA 3M3TA 1E36B 2GZ8A 1CHOF 4X8VH 4A5TS 1MKXH 1TMUH 3MU0A 1KIGH 1O32A 2PGBB 2GGVB 2VIQA 1GGDB 2BZ6H 1GJ8B 3T5FH 1CBWB 2Q6DA 4HTCH 2NU4E 5I25A 4MPWA 3A80A 3O8RA 2BD3A 1E0FD 2QY0B 3OY5U 1NROH 2FOCA 3ZZ3A 3MOCA 4IS5A 1ZRKA 1GI3A 3AAUA 4OS4A 3GCHB 1HDTH 1O36A 4K8YA 1PPZA 2OINA 5DP5A 1CQQA 1K21H 2ZDNA 3VGCB 1FQ3A 1GCTC 1GL1A 1NTPA 5AFZH 4AYVB 4JZEH 1FNIA 4FUDA 1OWHA 3ZV8A 4B2CA 1AE5A 1KDQA 3K6YA 1N8OC 2AMPA 3M36A 3F6UH 1FXYA 3GDSA 1TQ7B 2A7JA 1C5MD 1P12E 1RIWB 4XBBA 3LJJA 4K1TA 3SV8A 2FLBH 1F0RA 3M7TA 3R0FA 1TRYA 2FOHA 1XKBC 3GY5A 2GD4B 1P04A 1P02A 4XBDA 3BN9A 3CS7A 1GHBG 1K28D 4KTCA 3H7TA 2VJ1A 4FXGH 3OX7U 1O2OA 4WWYA 1DSUA 3UPEA 1M9UA 4D76A 1FN8A 3RMMH 4CRAA 2AH4X 1JIMA 1P11E 2VWMA 3LJOA 3A84A 2VVCA 1J14A 1S81A 2GTBA 2ZFRH 1YCPK 3R3GB 2VU8E 5T3HA 1P09A 1FY1A 4IMZA 3RUOA 1ZPBA 7GCHG 4BAKB 3GCNA 2IOTA 2BDCA 2BQ6B 1JBUH 4KGAA 1YPKH 2ZQ2A 1CU1A 1BBRH 1KYNA 2P8OB 2J34A 1FZZA 1THRH 2FLRH 3BF6H 7GCHF 1L4DA 1O3JA 2UUKB 2O9QA 1ZJDA 2XC5A 1INCA 2DUCA 3A7TA 1CT4E 1ANDA 4IN2A 2Z9KA 1SMFE 1UTJA 5GXPA 4BAQB 1FPHH 1W2KH 1XUKA 3BEFB 3ELAH 1O3LA 3EA7A 4INLA 3A7YA 1V2QT 3F9EA 1MD7A 2VGCC 2AMDA 1O2UA 1PQ7A 2C8WB 3ATLA 1S6HA 4Y79A 2BB4A 2JKHA 2OC0A 1UVTH 1KTTB 3NCLA 1C5LH 1GJAB 1GI5A 1BTZA 2HRVA 3AW0A 2ESTE 4ASHA 1VR1H 1QL9A 4DW2U 3T25A 1GBAA 1P2JA 2ZHWH 2HLCA 2WPHS 1NFWA
chains in the Genus database with same CATH superfamily
3CS0A 4FUFA 3SGAE 1GI8B 3RXOA 3O8DA 1K2I1 5C5OA 1RJXB 2GT8A 3KF2A 4XE4A 4X1RU 2GP9B 3SGBE 1CSOE 3F3BA 1C5SA 3M7UA 2BD4A 1TWXB 3ZV9A 2PTCE 4CBNA 2FX4A 1DITH 3ATKA 3STIA 1IQNA 1NZQH 3PRBA 1F5RA 3ATWA 1O2NA 1CA0B 1MABB 4OM9A 1PPHE 3PMHB 4NZQA 5A0BA 2GX4A 2RG3A 2FI3E 2XC0A 3ZIAD 2BVSH 2OBOA 2WV9A 1NFYA 3C1KA 4Y8ZA 2A32A 2FOEA 2GDDA 1AZZA 3DSOA 1ESBA 4R8TB 1N6XA 1WSSH 1SR5C 1AVXA 1SGPE 1BITA 4LZ1H 4ABAA 2PR3A 4NFEA 1ELGA 2ANYA 1Y3UA 3ZVDA 2FYRA 3SV2H 4B76A 2OC1A 2B5TB 1FY8E 2CHAC 1MCVA 3D49H 2ZFFH 4Q2KA 5DP3A 8GCHG 1UJ1A 1UTKA 4GSOA 4IC5A 1Y8TA 1O30A 1QQ4A 2QXJA 1IQHA 2J95A 4BOHA 5HYOA 1TBZH 2Q1JA 2ZCLP 3N99A 4RT1A 1GHVH 1DXWA 1ARCA 2RA3A 4YM9A 4AGKA 2FOGA 1ZPZA 1O3EA 1O5FH 3VPKA 1C5WB 1A0HB 3RXPA 4JK6A 4P02A 1IQEA 2A4OA 1C1OA 4AGJA 3DCLA 2Y7XA 1GMDG 2ZGCA 5DP8A 1EX3A 1HLTH 3LC3A 2Y5HA 3K9XB 3BG8A 1ZZZA 3VB3A 1DE7H 2PKAA 1VCPA 1HGTH 2Z3DA 4ISNA 1MMJN 3SJ9A 3MYWA 1GJ9B 3QTOH 3RXRA 3SNCA 1NY22 1KLTA 1ARBA 2BLWA 1GMDF 2TPIZ 2FOBA 1DUAA 2PTNA 9LPRA 4OS6A 3UWJH 1GG6B 5C0UA 2RDLA 2OC8A 3ZZBA 4DT4A 1CT2E 3B9FH 1V6DA 4X2VA 3U28C 1C5OH 3RC6A 4B71A 1V2MT 1LQDB 1NFUA 1TNHA 2H9EH 1YY3A 2Z9GA 4JYUH 3M35A 3BTDE 3RMNH 1GBEA 1TGBA 2ODYB 5DP4A 5DP7A 1UCYE 4DT7B 1COWD 3W94A 2GCTB 1TPSA 3QZQA 1L1GA 2BHGA 1J17T 3LH1A 4Y11E 2F9NA 3MO3A 3T26A 1AE8H 2G8TA 2DE8A 4I32A 4CRFA 2OK5A 2UWPA 2C93B 3LOXA 1ZHRA 2WPJS 4FUJA 1K0HA 3MMGA 1O2GH 1W0ZU 3ZZ4A 3RP2A 1IAUA 3BIUH 3A7ZA 1KMHB 1A61H 1GHZA 3EA8A 2D2DA 1GCDA 1J8AA 3E0PB 4Y7BA 3SYJA 1F5KU 1S83A 1V2RT 1ZPCA 4WH6A 1UMAH 2FPZA 1WQSA 2XCFA 3A7VA 2BZAA 3SQHE 1U6QA 3A82A 4UD9H 1HB0B 5T6DA 1FJSA 2EI8A 1AKSB 1VJ9U 2FDAA 5I46H 2WSSD 1LPKB 3A86A 5IK2D 2QF5A 5CHAC 1O3DA 2AHME 3I29A 3RXQA 1ELCA 5ABWA 3A8BA 3UNRA 1HAVB 2QF4A 3D62A 3ATMA 5JDUB 2Z9IA 2BOHB 1MTVA 3LGTA 5AHGH 3HPTB 1C1TA 1O5EH 2GT7A 1D9IA 1O33A 4TPYA 1ESTA 2Z9JA 5C5NA 1V2KT 2STBE 1C2HA 1SC8U 4H4FA 1GBBA 2Z3EA 1TMTH 1G2MA 1BZXE 1GBCA 1SGNE 3U9AH 1YM0A 1V2TT 3ZZ7A 1SFQB 2K0QA 1T32A 2BYAX 1ZLRA 1UVPA 2M2AA 2BY6X 1PYTC 1DX5M 1O2RA 3EE0B 1S84A 1TB6H 1NU7B 4B2BA 3VG8A 4XBCA 1ETSH 3PV4A 1DLEA 5GWZA 5E0JA 3FP7E 4Q4LA 1A3BH 2ZGXH 1WTHD 1WQVH 1O2XA 2J9NA 1P8VC 3LT3A 3UTUH 2H9TH 3UQOA 5HMAA 1P2QA 4NA9H 5E2OA 1IQGA 1BTPA 1E1QD 1YYY1 4WVPE 2R3YA 3SU3A 1K1MA 1ABJH 1O34A 2Y5GA 1GBDA 2GVFA 1T8MA 1TOMH 1EJMA 2ZNKH 1EJAA 2A2QH 5K7RA 1OP8A 4DG4A 4PROA 2ZU5A 1V2LT 2PUXB 1DVAH 3CP7A 2FXRA 3SHAH 3TJUA 3H09A 1AWHB 1GI6A 2XNDD 2RCEA 3MWIU 2ZDMA 2XBVA 4X1NU 4Q80A 1O0DH 1HYLA 1KXCA 4CREA 4F48B 1BRUP 1GHWH 4O9VA 3WW7A 2BMGB 1AFQC 2FX6A 1A7SA 2BD5A 3KNXA 2GMTB 3LU9B 5HXFA 1LTOA 4GPGA 1PPBH 1DOJA 2V6NA 4MLFB 1UHBA 2L6OA 4A1TA 2FOMB 3E91A 3PTNA 4B1TA 2HNTE 4ACAA 1KLIH 2F91A 2Y81A 4WMFA 4D7GA 1W8BH 1GMCG 4X1QU 2OP9A 4ZMAH 2ODQA 3URCA 3S7HB 1UTQA 1C5TA 1Q31A 2VB0A 4VGCB 2VH6A 3TK5A 5GNDA 5J4QA 3GY8A 1EZSC 3MH5A 5HM2A 1GMCF 1YCPH 1O38A 2VIWA 3EQ0H 2BLOA 2FOFA 4IW4E 5FX5A 5C20A 1LVMA 4TY6A 2KCOA 3MH4A 1NRSH 2AGGX 3KIDU 1S0QA 3QTVH 1SGEE 1C5ZB 3K65B 4YOJA 3OSYA 1AZ8A 3ZVGA 3BTQE 3E3TA 1BIOA 5LPRA 3FANA 5FPYA 2W5EA 1LKAA 2IJOB 1V2WT 5FX6A 3BV9B 2ZHEH 3E6PH 5F8ZA 6CHAB 3PMAB 3GCTG 1OS8A 2FS9A 5LH8A 3M5NA 4CRGA 1GBMA 4YT7H 3MNSA 4ZCNA 1D3PB 4AN7A 2NU1E 1SKYE 2G52A 2KX4A 3GY4A 3SU5A 1OWKA 2AFQB 3GCTF 3GS9A 1C5RA 4X6OA 1SG8B 4M9FA 1EAUA 2ZDKA 1F0TA 3LDXH 1UCYK 4O3UA 2D26C 1V2NT 5SGAE 1HJ9A 3U1IB 1QR3E 2SFAA 3NWUA 2CK3D 4NG9H 4AFUA 3F0PA 4D8NA 2FI4E 1NC6A 3TGKE 2A4RA 3FP6E 3A88A 3SNEA 3TJOA 2PP6A 3U1JB 3OU0A 1AQ7A 3FVFB 3E90B 1GCTB 1NM6A 5AFYH 4Y8YA 1GMHG 1GJCB 4WMDA 1H8IH 5EPYA 1PPCE 2XTTB 2ZKSA 3GYMA 2PFEA 1N8OB 1S82A 2P95A 2JIZD 2F9PA 4FOUC 4MPVA 2TGAA 2W7SA 8ESTE 1TX7A 2QF0A 2ZU4A 1FUJA 1GMHF 1AVGH 3F2HA 1DDJA 2HVYB 2FIRH 1QJ1B 4CHAC 3PRDA 5FCRA 2BVXH 5G4BA 1AWFH 1SGFA 4AB9A 3P8NA 1GI9B 4P00A 1MU8B 4GHQA 4UFGH 5EW1H 2OXSA 1C2LA 4MTBA 1IHSH 3UREA 2C8XB 1YPHE 1CHGA 1S6FA 3HKJB 3PLPA 3VXFH 5CDFE 1CHOG 1Y5AT 2ZGBH 3W1EA 1IQMA 4GVUA 3MU4A 4WH8A 4ZROA 1OXGA 1BHXF 1UK3A 3B23B 1ANCA 1O3BA 4K2YA 2JDID 3RXUA 4YOIA 1QBNA 4K1EA 4ABDA 3MNXA 5BRRE 1EASA 4IN1A 1ID5H 4Y10E 1MZDA 3PWBA 1QGFA 3FFGA 4LK4A 2G5NA 4RKOB 2SNVA 3Q3XA 4X6MA 2ULLA 3KYFA 4JK5A 2VVUA 1TX8A 3PO1C 1F0SA 3A85A 1JRSA 4A1VA 1FI8A 1DT2A 2ZCHP 3SZEA 1O31A 1S85A 4KELA 4B73A 5KEDA 2P16A 2G55A 1TONA 4YLUA 3TIUA 1EFRD 2H2ZA 5DPAA 1AGJA 4OS7A 4E7RG 1GBLA 4H6TA 4BTUB 1AI8H 3BSQA 3ZYEA 3RU4D 4YXWD 1EXFA 2SGEE 5A0AE 1SHYA 1FV9A 1SQAA 1O2PA 2V7QD 4I33A 1P0SH 1LO6A 1G9IE 2PLXA 1HAIH 1P05A 1C1VH 2A31A 2FODA 2FTLE 1YPJH 1MKWH 4ABBA 3MO9A 4WJG2 1XMNB 1X7AC 1OX1A 2BY8X 3V3MA 1O3AA 2WPKS 3KQDA 3N7EA 5L2YH 2WV4A 4TWYA 1V2VT 4NIXA 2C3SA 1TFXA 3V12A 1HUTH 1QBVH 1SHHB 1D6RA 1PQ8A 1ZJKA 4NFFA 4U30A 1MQ6A 5DGJA 5KECA 1ZTLA 2GZ9A 1FONA 3SNBA 3RXLA 2W6JD 3GISB 1EOJA 3HGPA 1PYTD 4TYDA 3QUMP 4X2XA 3SNDA 1H8HD 4GUXA 2JH0D 5F53A 4E05H 4KKDA 1BHXB 2FZZA 4UFFH 4NWLA 5ESTE 4K3JA 5FPSA 4ZXXH 5J4SA 1THPB 2THFB 1SLXB 1ZHMA 3SHCH 4ABIA 3PB1E 2JH5D 1A5HA 3EGKH 1GWAA 1YKTA 2Z9LA 1O5CB 1QNJA 1FY3A 9ESTA 3RU4T 3SI3H 5FPTA 4NSVA 1E37B 3UQVA 1QURH 1J15A 2ALVA 2I6QA 3TH3H 2OD3B 1BCUH 3K6ZA 3GOVB 3P17H 1B5GH 2JETC 1YF4A 1O3NA 3SU4A 1L4ZA 3MH6A 1NRPH 3FO8D 1FIZA 1YLNA 1L1NA 4BTIB 1SGDE 3RXGA 1ETRH 3B8JA 1MBMA 2IPQX 1C1NA 2O8LA 3PLBA 1BUIA 1KXAA 1GL0E 1GJDB 1NPMA 2J5UA 3TLOA 4AFZA 1HBTH 1LHCH 1K1PA 1GBIA 4J1YA 4JZ1A 4AX9H 1T31A 2A4QA 2VNTA 3BG4B 1BTHH 3IG6B 4X6PA 1VGCC 1O37A 4AC9A 1C5PA 3HK3B 1GPZA 4X2YA 1GJ4H 5EQRA 1CVWH 3SUEA 1FMGA 3DHKH 3ESTA 3UIRA 1HAPH 1SPJA 3OFND 3SJIA 4Z0KA 2F9OA 1TPOA 1MU6B 2D8WA 5HM9A 1H4WA 1HAXB 3GCOA 4FU8A 2G4TA 2XNIA 3A81A 3BTGE 1F92A 3UB0A 1EPTB 1OP2A 2WPDD 2EQNA 1T8NA 2HLDD 3DT0H 1MTNC 4BNRA 4I8JA 5DO4H 3LGUA 1C2FA 3ZVFA 2DE9A 3PYHA 1NN6A 4YESB 3WWBA 5EXNA 4LOYH 4AFSA 2ZDAH 4B2AA 3F68H 1C9TA 1QA7A 1W13U 1EKBB 1HRTH 2FOAA 3FZDA 1P01A 1ZTKA 2ZDVH 3GYLB 4AYYB 4QT8C 4D9QA 1A0JA 3TGJE 4I7YH 1TA2A 3EA9A 4GAWA 3TJNA 2AYWA 1MQ5A 2VIDA 2ZHDA 1EB2A 4NIVA 3QZRA 4FUHA 1SGRE 3GDVA 2HALA 3UR9A 2SGAA 1FDPA 5EXMA 4MNXA 3SJKA 5GIBA 1O5GH 1XUIA 2P8OC 1XVOA 2OUAA 1C1UH 1DXPA 2BX3A 5FHTA 3TGIE 1YPLH 1WYKA 1TNLA 1O2VA 4JYVH 1K1NA 1N6YA 1ZR0A 1AN1E 2C90B 1SBWA 2KCYA 1ZSLA 2VIVA 5JPMH 1MKXK 3BIVH 2G51A 2WPMS 5JB8S 3KQBA 1HFDA 2W7UA 4TSFD 3DD2H 1O2WA 2H6MA 5EGMA 3L6PA 5CHAB 4WMEA 1EPTA 3PROA 1Z1IA 1QTFA 3SGQE 1SB1H 4Q7ZA 4OGYA 4ZKSU 4BAOB 3KQCA 5ESBA 1VCWA 1HAYB 1Z71A 3SBKA 1NRRH 1E79D 3T62A 1TIOA 5EQSA 2UWLA 3FP8E 3ATIA 1Y59T 2BDGA 4CRBA 2FTMA 3RLYH 1GJ6A 2ANWA 3T28A 3ZZ8A 1EB1H 4AOQA 3CENA 4U01A 1O2YA 1O2HA 2KM0A 2HNTC 2NU2E 1BMLA 1G36A 5EJZA 4F49A 1FPCH 4A1XA 1MBQA 5EODA 3RXSA 2YOLA 2PW8H 3QWCH 1TNKA 3RXJA 1ZMJA 1W3CA 2WHXA 4HZHA 3ZVBA 3MQKC 1OWEA 5A8XA 2P93A 3AK5A 4B6FA 5E0HA 2BQWB 2AS9A 1SGCA 1AUJA 1RTLA 1UTOA 1TA6A 3GY2A 5FBEA 3SW2B 1C5VA 1HJAC 1N1LA 1NBME 1TGTA 1EUFA 3RXCA 3OEED 3T29A 3S69A 1MTSA 1F0UA 2HOBA 1IHTH 5FXLA 1AHTH 1TGCA 1O2TA 1QIXB 3P92A 1SLUB 5C1XA 1ZRBA 2OLGA 2NWNA 1UTPA 1EZXC 1Y3WA 1H9LB 1LMWB 1GVKB 1SOZA 1UCYH 2XBWA 5HIZA 1UK2A 2AEIH 4OS1A 3EYDA 3RC5A 2BDIA 4LXBH 4XDEA 1QRZA 3F2GA 3MFJA 2QXHA 2BD8A 1ELFA 1XUGA 3JZ1B 1NFXA 1ACBE 1SI5H 2CF9H 3FOAA 3MO6A 3MTYA 3SV9A 2ZG0H 5HIYA 3C27B 1ELTA 3QLPH 1CO7E 2BLVA 1BT7A 1P2NA 2WZQA 3QGJA 5FBIA 2ZCKP 1IQFA 4DOQA 3S7KB 1AFQB 1WV7H 4WY3A 4ABEA 4NCYA 4A92A 1TPPA 2J98B 5JYIA 3RC4A 3AASA 4MPXA 1K9OE 1SLWB 3F9GA 4AORA 3P8FA 2STAE 2UUJB 4SGAE 1AY6H 1G30B 4UEHH 1YCPM 2KAIB 2B8OH 1MTWA 3SUGA 3BTHE 2YMSC 1TGSZ 4A6LA 2FWWA 4RN6A 4Z1MD 1V2OT 2GCHG 4JYTA 2SGQE 1AB9C 1GBTA 2V35A 2BXUH 2J2UA 1ELEE 3RM2H 4HFPB 3M61U 1QA0A 2HPQH 3JZ2B 1LDTT 3T2NA 2ZTYA 1AVWA 4ZKOU 3MNCA 2GCHF 1OWJA 3SUFA 2O8UA 1O2JA 2RDEA 1QL7A 1GHXH 1Z8GA 1YPHC 1EAXA 5JBCS 1W7XH 2EI7A 1KXDA 1W0JD 1O3CA 1ZOMA 4OS5A 5EU8A 1T8LA 1C1RA 4FUIA 1AKSA 2PKSC 1HXEH 3TVJB 3TPIZ 4DY7B 5B6OA 4GLYA 3UUZA 5T6FA 1VITF 1HAZB 3RDZA 6GCHG 2GJGA 1QZ8A 5JBAS 1BA8B 4O97A 3WWFA 1SGIB 2H5DA 4RSPA 3U8TH 5T6GA 1HAVA 3TH2H 1O5DH 4K8BA 3U8RH 3RXHA 5E0GA 2A2XH 2F3CE 2J98A 3TITA 4Q7XA 4SGBE 4DGJA 6GCHF 1QBOA 1GVZA 2Y82A 1O2QA 3RXFA 4A7IB 3V0XA 1ZMNA 3MU8A 1HAOH 7ESTE 2AERH 3HK6B 2IN2A 5AF9H 2KAIA 1YPEH 3UNSA 2EEKA 1LPZB 2XYAA 3FZZA 1C5YB 4Y0ZE 1PPEE 1Z8RA 2KCAA 3VB6A 1W0KD 3MNBA 4MPUA 2QF3A 3SORA 1YBWA 4ZXYH 2BVRH 2WYGA 3SOSA 4JCNA 2Y80A 4HI3A 2WV5A 1TNIA 2XBXA 2VIPA 3ODFA 1W10U 1O3PB 5JB9S 3F9FA 1OWIA 3RM0H 4X6NA 4I8GA 3STJA 3F1SB 1WBGB 3MU1A 1EAIA 4CHAB 3SI4H 4FUBA 1EQ9A 3EDXB 1TOCB 1TPAE 1C2IA 1XXDA 3PTBA 3LONA 3A83A 1PPGE 1TAWA 1KXFA 4AB8A 2XWBI 1T7CA 1YPGH 2VWNA 4MVNA 1IQLA 3DA9B 4I8LA 2J92A 1P57B 4DJZB 1ELDE 1Z1JA 1J9CH 5L6NH 1DS2E 5EXLA 3E1XB 4JZFH 1B0EA 2TGPZ 1VJAU 4ZHLU 1K1IA 4O03A 1MTUA 1HIAB 1TMBH 3GDUA 1RFNA 1BJVA 1Z8JB 1THSH 2A5IA 2ZHFH 5FL7D 2UWOA 4NIYA 2BM2A 2Q6GA 3LGYA 1VCQA 1ZTJA 3PO1B 2ZQ1A 5FAHA 2ZFQH 1TBQH 3RXMA 1GBJA 1FY5A 4F55A 1YPMH 4UE7H 1KY9A 2H5CA 1C4U2 1D6WA 1H8ED 1VZQH 3S9AA 3SZNA 6ESTA 2LP6A 3VB7A 3P70B 4ASUD 1S5SA 5C1UA 4ISLA 3MHWU 2QA9E 2WYJA 3TK6A 1GI2A 1W11U 1NU9A 1LVYA 1AD8H 4DIHH 1P2OA 5BPEA 1A3EH 5GJ4B 3MH7A 1FN6A 3N7DA 4MDSA 1CE5A 1D3TB 4I31A 3RLWH 2R9PA 1QFKH 3PV2A 2QYIA 1SLVB 3ZZDA 2ANMH 5HKKD 2EA3A 2QC2A 2Y6TA 1HNEE 4YO9A 2JJ2D 5EOKA 3BTTE 5JBBS 2EY4C 3U69H 2C8ZB 4OS2A 3SV6A 1OWDA 4O3TA 3GY7A 1G3BA 4FVDA 4X1PU 2BY5X 3V13A 1XXFA 1EZUC 1TABE 2A5AA 4D9RA 2PUQH 1ZHPA 2F83A 1OYQA 2AGEX 2TIOA 2CGAA 1BOQA 1K1LA 2O8TA 1A2CH 1A46H 1HIAA 4I86A 4X1SU 5F8XA 1ANEA 1LPGB 2C4FH 2A0QB 3VEQB 1KDQB 3AVZA 1A0LA 1LQEA 1AUTC 3KQEA 1C2DA 1NS3A 3HGNA 4XFQA 1OP0A 2Z7FE 5C94A 4Y71A 3RXEA 3F2FA 3MI4A 1A4WH 4BAMB 2XC4A 1O3KA 1G2LA 2O8WA 2YNBA 3T27A 3U8OH 1UK4A 1HAHH 5IYTA 3A8CA 4DVAU 2Z94A 4ISHH 1BTYA 1D3QB 2OCVB 1BMAA 2P94A 2KR7A 1V2UT 6CHAC 3MU5A 3FKSD 3FN8A 1XUFA 2VWOA 1Z8IB 2XCNA 4FVBA 4UFEH 3TNTA 5EW2H 2JH6D 1L0ZA 2CXVA 2UUFB 2JETB 3KN2A 3KCGH 2VINA 3RXBA 3ODDA 1EOLA 1V3XA 2VGCB 2FYQA 2QCYA 4ZUHA 3E16B 1AMHA 3Q77A 4AG2A 5ETXA 3ENSB 1MH0A 2SNWA 5DP9A 4H42U 2I6SA 1BTUA 5K0HA 1MUEB 2H9HA 2J4IA 3SNAA 3LGIA 2PV9B 1ZGIA 5DJ7A 3HATH 1C5QA 1VGCB 1JOUB 1MAXA 2FMJA 3NPSA 3RXAA 4ABGA 2BDYA 2R2WU 1CA8B 2YNAA 1P9SA 1LHFH 4MNYA 3RXVA 2B9LA 1MD8A 1IQJA 2RFKC 2YMSD 3OYPA 3UOPA 4K60A 3ZZAA 2GV7A 1GJBB 2HPPH 2NU3E 2BXTH 1XUJA 1LKBA 2SGDE 4Q7YA 1MTNB 2AGIX 4XRNA 3K2UA 1H9IE 1ELAA 3DSPA 1BBRE 1C4V2 1ZSKA 1Q3XA 1O3IA 2PGQB 3BTWE 1BQYA 1C1WH 1SL3A 4CR5A 1O39A 3EE7A 2HNTF 1LCYA 1W14U 1V2PT 1TE0A 1RXPA 1P3EA 3N7OA 4YLQH 4ABFA 1GHBF 1O2KA 5HGGA 2XXLA 3OY6U 1DY8A 3UY9A 3LH3A 1EZQA 4CR9A 2LNCA 1UTLM 3TNSA 2V3MA 2XWAA 3S0NA 2CHAB 3KGPA 1HXFH 5A09A 1QRWA 2R2MB 1FAKH 1G3CA 1O2IA 1IQIA 2PHBA 1XVMA 2FO9A 3PMBB 1GGDC 1FY4A 1SVPA 2Z3CA 4UONA 3SQEE 3Q76A 1ANBA 1TLDA 1CBWC 1T4VH 1Y5UT 5DSFA 3VB4A 3L33A 2Z6BD 3OE7D 1YC0A 1GBFA 5AVDA 4OGXA 5KGOA 2QXIA 3O8CA 1XKAC 4TY7A 4UDWH 3ITIA 1P2IA 1YLDA 1QQUA 5TJXA 3GCHC 2BY7X 2LPRA 1DLKB 4ISOA 3ZYDA 4X8TH 3VGCC 1TYNA 3VB5A 1BTWA 1GVLA 1D4PB 1SGQE 5A0CA 4I8HA 2CJIA 3KQ5A 3PMJA 1EATA 1DWDH 3S9BA 1RIWC 3OTJE 2WUBA 1Q2WA 1GI1A 3PM3A 1PPFE 3A89A 1F7ZA 3P8OA 2BTCE 5DG6A 1NO9H 3OAAD 2FS8A 1P2KA 1XUHA 1P10A 3P6ZB 2BD2A 2J97A 1DFPA 5TCCA 1P06A 2W3IA 4XSKU 4CBOA 3SJ8A 1ETTH 2V3HH 1NT1A 3HKIB 4TWWA 1DM4B 1BB0B 3PLKA 5F8TA 2XBYA 3I77A 3P8GA 1H1BA 1WUNH 2TGDA 1KLJH 1GHAG 4TPIZ 2PKAB 2PWXA 2QV1A 2CN0H 3Q00A 4RKJB 3ZZ6A 2ODPA 1C1PA 2ZPRA 3QDZB 1RS0A 5IDKA 1PJPA 1HJAB 1BDAA 2CF8H 1DPOA 4BAHB 4B6EA 2BX4A 1F2SE 2AIQA 1GHAF 1BRBE 1W12U 4KTSA 4FUEA 4JZDH 1MAYA 1TRNA 1LHGH 1VITH 3A7WA 1W0YH 2GV6A 4X0WU 3BTME 1DY9A 2GDEH 1KSNA 3NRLA 5A8YA 5GCHG 1Y5BT 4AG1A 5CE1A 2HWLB 7KMEH 4U32A 4THNH 2H1UA 1O5BB 1E38B 4NWKA 3A8DA 2ILNA 1C9PA 1T4UH 2G5VA 1TBRH 4BXSA 1L1JA 3A7XA 4I8KA 5LGOA 5PTPA 3W95A 5GCHF 4Y6DA 1GDNA 3QN7A 3OEHD 1JMOH 5LPEA 1QJ7B 7LPRA 1P3CA 4NGAH 8GCHF 1CGHA 1HAGE 2KZ4A 3S9CA 4ABHA 1UVUH 2JJ1D 3NUMA 2ZI2H 3LKWA 1C2MA 4XD7D 3BG4C 2VVVA 3ZZ5A 2ZGHA 1GI7B 3M7QA 1O2ZA 1K1OA 3ZZ9A 1C5NH 5C0TA 1ABIH 4ESTE 3RXDA 3UOUA 3WY8A 3RXKA 1C2JA 4BXWA 1K22H 5DP6A 3AW1A 4INKA 1E35B 2WPIS 2GZ7A 4DCDA 1O5AB 1TRMA 1DWBH 1OYTH 2CMYA 1C1SA 3ZVCA 3SUDA 2ANKH 2YMSB 2OTVA 4WF8A 1MKWK 5JBTA 5C3NA 5C1YA 1PQAA 1UVSH 2AIPA 4ZHAA 1EPTC 1UW7A 1CGIE 5FCKA 3DFLA 2VH0A 1CA0C 3L3TA 4X8UH 1QJ6B 1C2KA 1AB9B 1JRTA 1AO5A 5DKMA 2QN5T 2ZPSA 1EJNA 2A4GA 4RT0A 2ZA5A 1BRCE 4MNVA 1O3GA 3UFAA 5EG4A 5L30H 1SGYE 3LGWA 4YTAA 4AZ2B 1UTMA 4CH8B 1O3OA 3M5LA 1H8DH 3GICB 1UVOA 4K1SA 1FX0B 3UNQA 1O3FA 1QCPA 1L2EA 5LPFA 1IQKA 4ZAEA 5EIYA 2PKSB 3RXTA 3BEIB 3M37A 3V7TA 3CNRA 3TH4H 1ESAA 4BANB 5CMXH 2F4LA 2FEQH 1BMMH 1G32B 1WAYB 3LIWA 4FU7A 1T8OA 4ZH8A 1BBRK 4NIWA 2ZFTA 3KYGA 4BTTB 1TX6A 1HCGA 2BY9X 1C2GA 1DSTA 1C1QA 1ZYOA 1QB6A 2BQ7B 1ZMLA 3M3SA 1RTKA 5L2ZH 2ZO3H 1OHHD 1V2ST 1RRKA 4MQAA 3AAVA 1G3DA 1O35A 1ORFA 2ALPA 2HVXA 2ASUB 1AFEH 1JXPA 3M5MA 1B0FA 1ZSJA 2TRMA 2GKVE 2BOKA 4MG3A 1ZGVA 1D3DB 2BD9A 2OQ5A 2VWLA 5TCAA 2A7CA 5EJ1A 4ZHMU 1VKYA 2WPLS 2ZHQH 8LPRA 2XRCA 1BTXA 2Y5FA 2WINI 4WXVA 4JZIA 4JMYA 2A1DB 2FESH 2B0FA 1AIXH 2F9UA 1NESE 2G81E 1YP9A 1O2MA 3RMOH 4E06H 5EJLA 1TQ0B 2BLQA 4IMQA 5DN6D 1GG6C 1QHRB 1DWCH 1LVOA 3QGNB 2LELA 1Z6EA 2XOKD 5DK1A 1G3EA 1K1JA 4Y0YE 4H6SB 1W7GH 1C5XB 1P9UA 3QX5H 3VFEA 3TU7H 2OC7A 3E8LA 1RGQA 3LPRA 2EI6A 2B7DH 1GI4A 4ZKNU 1VITG 1A5GH 4M7GA 3DFJA 1UHBB 2GCTC 2IPHA 1Z6JH 3GY3A 2K1QA 4X8SH 4YZUA 3FAOA 2C8YB 3BTEE 2J38A 2QE7D 1SGFG 2ZP0H 2FP7B 3SU1A 3TJVA 1NBMD 4RI0A 1C1MA 1TNGA 1P03A 4NSYA 3DSGA 1SQTA 1WTGH 1GBHA 2OQUA 3OTPA 4KTUA 1Y3YA 1KXEA 1TALA 4HG6A 3QO6A 3EAJA 3ZZCA 2ZZUH 1BMNH 1WOFA 3QK1A 1Z7KA 5H4IB 2D1JA 4ISIH 2P3FH 2CV3A 2ZEBA 2F9BH 2PSYA 4HGCA 1OOKB 1SQOA 4NZLA 4B75A 1ELVA 2ZPQA 1XX9A 4YOGA 5E8EH 1GHYH 1DUEA 4FUCA 4GCHG 4WXIA 4FUGA 4CRDA 5C2ZA 3RMLH 1OKXA 2QXGA 1A1RA 1NRQH 1QB9A 3NK8A 1BJUA 4Z6AH 2OBQA 2NU0E 6LPRA 2QAAA 4MNWA 4Y7AA 3SN8A 2R0KA 4IBLH 3M5OA 3RXIA 4GCHF 1AU8A 2M5TA 1O3HA 3F9HA 2ZFSA 4X2WA 1S0RA 1WU1A 1LHDH 2FM2A 2ZECA 2ZDLA 3NXPA 2W6ID 1E34B 3NZIA 2ZFPH 1YLCA 4K5ZA 3LGVA 2ZGJA 3UWIA 4YT6H 1UO6A 1Y3XA 3URDA 4AFQA 5F6MA 4KP0A 2ZIQH 1C4Y2 1EP6A 2ZU1A 3H7OA 3IITA 1MZAA 4Y76A 1SFIA 2P59A 3TK9A 2BDBA 5EPNA 1F5LA 3KEEA 1JIRA 1EAWA 2A45B 2BDAA 2AMQA 2VBCA 1OSSA 1QY6A 1DANH 2ZF0H 4U2WA 2P3UB 2WUCA 4R0IA 5C67A 1QL8A 1FAXA 1KXBA 5EQQA 1H9HE 3H5CB 3DUXH 2ZC9H 1RTFB 4NA7A 1WCZA 1SOTA 1O3MA 2HGTH 4CH2B 1OPHB 4NA8A 3IWMA 3A8AA 3BEUA 3Q3YA 2A7HA 4D7FA 1TNJA 1PFXC 1MCTA 1WXRA 1GI0A 2PSXA 3ZVEA 1UTNA 3P95A 1A5IA 3KL6A 3A87A 4GHTA 4ZKRU 3UAIC 1DICA 2Q6FA 5E2PA 3E0NB 1O2SA 4Q63A 5GDSH 1QRXA 4INHA 2XW9A 2P3TB 4K69A 5F03A 3UR6A 1J16A 3RU4E 5A2MH 2QGRA 3KHVA 1TGNA 4IC6A 3BTFE 3LC5A 2KCPA 1GDUA 1SGTA 3NKKA 2FI5E 1RD3B 5GPIB 4DIIH 1HJ8A 1V2JT 4ABJA 4CRCA 1B7XB 1GJ5H 3I78A 2RA0A 4J2YB 2R0LA 3O8BA 1JWTA 4F4OC 1C5UA 1CGJE 2GMTC 2UUYA 1ELBA 2A5KA 2W26A 2VIOA 3GY6A 2O8MA 3ZVAA 1GDQA 4UFDH 4B74A 2F43B 3D23A 1PQ5A 5A8ZA 1BRAA 1DWEH 1SSXA 1C2EA 2SGFE 3SV7A 5T1VA 3SU0A 1GJ7B 2Y7ZA 2G4UA 1LVBA 2QIQA 2SGPE 4VGCC 2J94A 4XOJA 4IGDA 3SO3A 1G37A 2F9VA 1YGCH 2ZTXA 1NRNH 2ZU3A 1HPGA 3SU6A 1EP5A 2BDHA 2BD7A 3BTKE 1FLEE 1P2MA 1FIWA 8KME2 1CT0E 2G00A 2R3UA 1LHEH 2TGTA 1KTSB 2V0BA 2ZTZA 2ZWLH 1QB1A 1HV7A 1Y3VA 2EC9H 3D65E 3M3VA 3SJOA 1XM1A 4FU9A 4Y8XA 1O2LA 3U98H 2W3KA 3VXEH 1GBKA 1IOEA 2ZU2A 4E7NA 4LZ4B 3Q3KA 3PWCA 3SU2A 3G01A 4DURA 2V3OH 2TBSA 3M3TA 1E36B 2GZ8A 1CHOF 4X8VH 4A5TS 1MKXH 1TMUH 3MU0A 1KIGH 1O32A 2PGBB 1YWUA 2GGVB 2VIQA 1GGDB 2BZ6H 1GJ8B 3T5FH 1CBWB 2Q6DA 4HTCH 1SQRA 2NU4E 5I25A 4MPWA 3A80A 4FETA 3O8RA 2BD3A 1E0FD 2QY0B 3OY5U 1NROH 2FOCA 3ZZ3A 3MOCA 4IS5A 1ZRKA 1GI3A 3AAUA 4OS4A 3GCHB 1HDTH 1O36A 4K8YA 1PPZA 2OINA 5DP5A 1CQQA 1K21H 2ZDNA 3VGCB 1FQ3A 1GCTC 1GL1A 1NTPA 5AFZH 4AYVB 4JZEH 1FNIA 4FUDA 1OWHA 3ZV8A 4B2CA 1AE5A 1KDQA 3K6YA 1N8OC 2AMPA 3M36A 3F6UH 2IJD1 1FXYA 3GDSA 1TQ7B 2A7JA 1C5MD 1P12E 1RIWB 4XBBA 3LJJA 4K1TA 3SV8A 2FLBH 1F0RA 3M7TA 3R0FA 1TRYA 2FOHA 1XKBC 3GY5A 2GD4B 4ACBA 1P04A 1P02A 4XBDA 3BN9A 3CS7A 1GHBG 1K28D 4KTCA 3H7TA 2VJ1A 4FXGH 3PV5A 3OX7U 1O2OA 4WWYA 1DSUA 3UPEA 1M9UA 4D76A 1S6LA 1FN8A 3RMMH 4CRAA 2AH4X 5B6LA 1JIMA 1P11E 2VWMA 3LJOA 3A84A 2VVCA 1J14A 1S81A 2GTBA 2ZFRH 1YCPK 3R3GB 2VU8E 5T3HA 1P09A 1FY1A 4IMZA 3RUOA 1ZPBA 7GCHG 4BAKB 3GCNA 2IOTA 2BDCA 2BQ6B 5C17A 1BMFD 1JBUH 4KGAA 1YPKH 3F0OA 2ZQ2A 1CU1A 1BBRH 1KYNA 2L74A 2P8OB 2J34A 1FZZA 1THRH 1WDIA 2FLRH 3BF6H 7GCHF 1L4DA 1O3JA 2UUKB 2O9QA 1ZJDA 2XC5A 1INCA 2DUCA 3A7TA 1CT4E 1ANDA 4IN2A 2Z9KA 1SMFE 5CHBA 1UTJA 5GXPA 4BAQB 1FPHH 1W2KH 1XUKA 3BEFB 3ELAH 1O3LA 2KFWA 3EA7A 4INLA 3A7YA 1V2QT 3F9EA 1MD7A 2VGCC 2AMDA 1O2UA 1PQ7A 2C8WB 3ATLA 1S6HA 4Y79A 2BB4A 2JKHA 2OC0A 1UVTH 1KTTB 3NCLA 1C5LH 1GJAB 1GI5A 1BTZA 2HRVA 2K8IA 3AW0A 2ESTE 4ASHA 1VR1H 1QL9A 1E1RD 3T25A 4TT3D 4DW2U 1GBAA 1P2JA 2ZHWH 2HLCA 2WPHS 1NFWA
chains in the Genus database with same CATH topology
3CS0A 4FUFA 3SGAE 1GI8B 3RXOA 3O8DA 1K2I1 5C5OA 1RJXB 2GT8A 3KF2A 4XE4A 4X1RU 2GP9B 3SGBE 1CSOE 1C5SA 3M7UA 2BD4A 1TWXB 3ZV9A 2PTCE 4CBNA 2FX4A 1DITH 3ATKA 3STIA 1IQNA 1NZQH 1F5RA 3ATWA 1O2NA 1CA0B 1PPHE 3PMHB 4NZQA 5A0BA 2GX4A 2RG3A 2FI3E 2XC0A 2BVSH 2OBOA 1NFYA 3C1KA 4Y8ZA 2A32A 2FOEA 2GDDA 1AZZA 1ESBA 4R8TB 1N6XA 1WSSH 1SR5C 1AVXA 1SGPE 1BITA 4LZ1H 4ABAA 2PR3A 4NFEA 1ELGA 2ANYA 1Y3UA 3ZVDA 2FYRA 3SV2H 4B76A 2OC1A 2B5TB 1FY8E 2CHAC 1MCVA 3D49H 2ZFFH 4Q2KA 5DP3A 8GCHG 1UJ1A 1UTKA 4GSOA 4IC5A 1Y8TA 1O30A 1QQ4A 2QXJA 1IQHA 2J95A 4BOHA 5HYOA 1TBZH 2Q1JA 2ZCLP 1GHVH 1DXWA 1ARCA 2RA3A 4YM9A 4AGKA 2FOGA 1ZPZA 1O3EA 1O5FH 3VPKA 1C5WB 1A0HB 3RXPA 4JK6A 1IQEA 2A4OA 1C1OA 4AGJA 2Y7XA 1GMDG 2ZGCA 5DP8A 1EX3A 1HLTH 3LC3A 2Y5HA 3K9XB 3BG8A 1ZZZA 3VB3A 1DE7H 2PKAA 1VCPA 1HGTH 2Z3DA 4ISNA 1MMJN 3SJ9A 3MYWA 1GJ9B 3QTOH 3RXRA 3SNCA 1NY22 1KLTA 1ARBA 2BLWA 1GMDF 2TPIZ 2FOBA 1DUAA 2PTNA 9LPRA 4OS6A 3UWJH 1GG6B 2RDLA 2OC8A 3ZZBA 1CT2E 3B9FH 1V6DA 4X2VA 1C5OH 3RC6A 4B71A 1V2MT 1LQDB 1NFUA 1TNHA 2H9EH 2Z9GA 4JYUH 3M35A 3BTDE 3RMNH 1GBEA 2ODYB 1TGBA 5DP4A 5DP7A 1UCYE 4DT7B 3W94A 2GCTB 1TPSA 3QZQA 1L1GA 2BHGA 1J17T 3LH1A 4Y11E 2F9NA 3MO3A 3T26A 1AE8H 2G8TA 2DE8A 4I32A 4CRFA 2UWPA 2C93B 3LOXA 1ZHRA 2WPJS 4FUJA 3MMGA 1O2GH 1W0ZU 3ZZ4A 3RP2A 1IAUA 3BIUH 3A7ZA 1A61H 1GHZA 3EA8A 2D2DA 1GCDA 1J8AA 3E0PB 4Y7BA 1F5KU 1S83A 1V2RT 1ZPCA 4WH6A 1UMAH 2FPZA 1WQSA 2XCFA 3A7VA 2BZAA 3SQHE 1U6QA 3A82A 4UD9H 1HB0B 5T6DA 1FJSA 2EI8A 1AKSB 1VJ9U 2FDAA 5I46H 1LPKB 3A86A 5CHAC 1O3DA 3I29A 3RXQA 1ELCA 5ABWA 3A8BA 3UNRA 1HAVB 3D62A 3ATMA 5JDUB 2Z9IA 2BOHB 1MTVA 3LGTA 5AHGH 3HPTB 1C1TA 1O5EH 2GT7A 1D9IA 1O33A 4TPYA 1ESTA 2Z9JA 5C5NA 1V2KT 2STBE 1C2HA 1SC8U 4H4FA 1GBBA 2Z3EA 1TMTH 1G2MA 1BZXE 1GBCA 1SGNE 3U9AH 1YM0A 1V2TT 3ZZ7A 1SFQB 1T32A 2BYAX 1ZLRA 1UVPA 2BY6X 1PYTC 1DX5M 1O2RA 3EE0B 1S84A 1TB6H 1NU7B 4B2BA 4XBCA 1ETSH 3PV4A 1DLEA 5GWZA 5E0JA 3FP7E 1A3BH 2ZGXH 1WTHD 1WQVH 1O2XA 2J9NA 1P8VC 3LT3A 3UTUH 2H9TH 3UQOA 5HMAA 1P2QA 4NA9H 5E2OA 1IQGA 1BTPA 1YYY1 4WVPE 2R3YA 3SU3A 1K1MA 1ABJH 1O34A 2Y5GA 1GBDA 2GVFA 1T8MA 1TOMH 1EJMA 2ZNKH 1EJAA 2A2QH 5K7RA 1OP8A 4DG4A 4PROA 2ZU5A 1V2LT 2PUXB 1DVAH 3CP7A 2FXRA 3SHAH 3TJUA 1AWHB 1GI6A 2RCEA 3MWIU 2ZDMA 2XBVA 4X1NU 4Q80A 1O0DH 1HYLA 1KXCA 4CREA 1BRUP 1GHWH 4O9VA 2BMGB 1AFQC 2FX6A 1A7SA 2BD5A 3KNXA 2GMTB 3LU9B 5HXFA 1LTOA 4GPGA 1PPBH 1DOJA 2V6NA 4MLFB 1UHBA 4A1TA 2FOMB 3E91A 3PTNA 4B1TA 2HNTE 1KLIH 2F91A 2Y81A 4WMFA 4D7GA 1W8BH 1GMCG 4X1QU 2OP9A 4ZMAH 2ODQA 3URCA 3S7HB 1UTQA 1C5TA 1Q31A 2VB0A 4VGCB 2VH6A 3TK5A 5J4QA 3GY8A 1EZSC 3MH5A 5HM2A 1GMCF 1YCPH 1O38A 2VIWA 3EQ0H 2BLOA 2FOFA 4IW4E 5FX5A 5C20A 1LVMA 4TY6A 3MH4A 1NRSH 2AGGX 3KIDU 1S0QA 3QTVH 1SGEE 1C5ZB 3K65B 4YOJA 3OSYA 1AZ8A 3ZVGA 3BTQE 3E3TA 1BIOA 5LPRA 3FANA 5FPYA 2W5EA 1LKAA 2IJOB 1V2WT 5FX6A 3BV9B 2ZHEH 3E6PH 5F8ZA 6CHAB 3PMAB 3GCTG 1OS8A 2FS9A 5LH8A 3M5NA 4CRGA 1GBMA 4YT7H 3MNSA 1D3PB 4AN7A 2NU1E 2G52A 3GY4A 3SU5A 1OWKA 2AFQB 3GCTF 1C5RA 4X6OA 1SG8B 1EAUA 2ZDKA 1F0TA 3LDXH 1UCYK 4O3UA 2D26C 1V2NT 5SGAE 1HJ9A 3U1IB 1QR3E 2SFAA 3NWUA 4NG9H 4AFUA 4D8NA 2FI4E 1NC6A 3TGKE 2A4RA 3FP6E 3A88A 3SNEA 3TJOA 3U1JB 3OU0A 1AQ7A 3FVFB 3E90B 1GCTB 1NM6A 5AFYH 4Y8YA 1GMHG 1GJCB 4WMDA 1H8IH 5EPYA 1PPCE 2XTTB 2ZKSA 3GYMA 2PFEA 1N8OB 1S82A 2P95A 2F9PA 4MPVA 2TGAA 2W7SA 8ESTE 1TX7A 2QF0A 2ZU4A 1FUJA 1GMHF 1AVGH 1DDJA 2FIRH 1QJ1B 4CHAC 5FCRA 2BVXH 5G4BA 1AWFH 1SGFA 4AB9A 3P8NA 1GI9B 1MU8B 4GHQA 4UFGH 5EW1H 2OXSA 1C2LA 4MTBA 1IHSH 3UREA 2C8XB 1YPHE 1CHGA 1S6FA 3HKJB 3PLPA 3VXFH 1CHOG 1Y5AT 2ZGBH 1IQMA 4GVUA 3MU4A 4WH8A 4ZROA 1OXGA 1BHXF 1UK3A 3B23B 1ANCA 1O3BA 4K2YA 3RXUA 4YOIA 1QBNA 4K1EA 4ABDA 3MNXA 5BRRE 1EASA 4IN1A 1ID5H 4Y10E 1MZDA 3PWBA 1QGFA 3FFGA 4LK4A 2G5NA 4RKOB 2SNVA 3Q3XA 4X6MA 2ULLA 4JK5A 2VVUA 1TX8A 3PO1C 1F0SA 3A85A 1JRSA 4A1VA 1FI8A 1DT2A 2ZCHP 1O31A 1S85A 4KELA 4B73A 2P16A 2G55A 1TONA 4YLUA 3TIUA 2H2ZA 5DPAA 1AGJA 4OS7A 4E7RG 1GBLA 4H6TA 4BTUB 1AI8H 3BSQA 3ZYEA 3RU4D 1EXFA 2SGEE 5A0AE 1SHYA 1FV9A 1SQAA 1O2PA 4I33A 1P0SH 1LO6A 1G9IE 2PLXA 1HAIH 1P05A 1C1VH 2A31A 2FODA 2FTLE 1YPJH 1MKWH 4ABBA 3MO9A 4WJG2 1XMNB 1X7AC 1OX1A 2BY8X 3V3MA 1O3AA 2WPKS 3KQDA 5L2YH 2WV4A 4TWYA 1V2VT 4NIXA 2C3SA 1TFXA 3V12A 1HUTH 1QBVH 1SHHB 1D6RA 1PQ8A 1ZJKA 4NFFA 4U30A 1MQ6A 5DGJA 1ZTLA 2GZ9A 1FONA 3SNBA 3RXLA 3GISB 1EOJA 3HGPA 1PYTD 4TYDA 3QUMP 4X2XA 3SNDA 4GUXA 2JH0D 4E05H 4KKDA 1BHXB 2FZZA 4UFFH 4NWLA 5ESTE 4K3JA 5FPSA 4ZXXH 5J4SA 1THPB 2THFB 1SLXB 1ZHMA 3SHCH 4ABIA 3PB1E 2JH5D 1A5HA 3EGKH 1GWAA 1YKTA 2Z9LA 1O5CB 1QNJA 1FY3A 9ESTA 3RU4T 3SI3H 5FPTA 4NSVA 1E37B 3UQVA 1QURH 1J15A 2ALVA 2I6QA 3TH3H 2OD3B 1BCUH 3K6ZA 3GOVB 3P17H 1B5GH 2JETC 1YF4A 1O3NA 3SU4A 1L4ZA 3MH6A 1NRPH 1FIZA 1L1NA 4BTIB 1SGDE 3RXGA 1ETRH 3B8JA 1MBMA 1C1NA 2O8LA 3PLBA 1BUIA 1KXAA 1GL0E 1GJDB 1NPMA 3TLOA 4AFZA 1HBTH 1LHCH 1K1PA 1GBIA 4J1YA 4JZ1A 4AX9H 1T31A 2A4QA 2VNTA 3BG4B 1BTHH 3IG6B 4X6PA 1VGCC 1O37A 1C5PA 3HK3B 1GPZA 4X2YA 1GJ4H 5EQRA 1CVWH 3SUEA 1FMGA 3DHKH 3ESTA 3UIRA 1HAPH 1SPJA 3SJIA 4Z0KA 2F9OA 1TPOA 1MU6B 2D8WA 5HM9A 1H4WA 1HAXB 3GCOA 4FU8A 2G4TA 2XNIA 3A81A 3BTGE 1F92A 1EPTB 1OP2A 3DT0H 1T8NA 1MTNC 4BNRA 4I8JA 5DO4H 3LGUA 1C2FA 3ZVFA 2DE9A 3PYHA 1NN6A 4YESB 5EXNA 4LOYH 4AFSA 2ZDAH 4B2AA 3F68H 1C9TA 1QA7A 1W13U 1EKBB 1HRTH 2FOAA 3FZDA 1P01A 1ZTKA 2ZDVH 3GYLB 4AYYB 4QT8C 4D9QA 1A0JA 3TGJE 4I7YH 1TA2A 3EA9A 4GAWA 3TJNA 2AYWA 1MQ5A 2VIDA 2ZHDA 1EB2A 4NIVA 3QZRA 4FUHA 1SGRE 3GDVA 2HALA 3UR9A 2SGAA 1FDPA 5EXMA 4MNXA 3SJKA 5GIBA 1O5GH 1XUIA 2P8OC 1XVOA 2OUAA 1C1UH 1DXPA 2BX3A 5FHTA 3TGIE 1YPLH 1WYKA 1TNLA 1O2VA 4JYVH 1K1NA 1N6YA 1ZR0A 1AN1E 2C90B 1SBWA 1ZSLA 2VIVA 5JPMH 1MKXK 3BIVH 2G51A 2WPMS 5JB8S 3KQBA 1HFDA 2W7UA 3DD2H 1O2WA 2H6MA 5EGMA 3L6PA 5CHAB 4WMEA 1EPTA 3PROA 1Z1IA 1QTFA 3SGQE 1SB1H 4Q7ZA 4OGYA 4ZKSU 4BAOB 3KQCA 5ESBA 1VCWA 1HAYB 1Z71A 3SBKA 1NRRH 3T62A 1TIOA 5EQSA 2UWLA 3FP8E 3ATIA 1Y59T 2BDGA 4CRBA 2FTMA 3RLYH 1GJ6A 2ANWA 3T28A 3ZZ8A 1EB1H 4AOQA 3CENA 4U01A 1O2YA 1O2HA 2HNTC 2NU2E 1BMLA 1G36A 4F49A 1FPCH 4A1XA 1MBQA 5EODA 3RXSA 2YOLA 2PW8H 3QWCH 1TNKA 3RXJA 1ZMJA 1W3CA 4HZHA 3ZVBA 1OWEA 5A8XA 2P93A 5E0HA 2BQWB 2AS9A 1SGCA 1AUJA 1RTLA 1UTOA 1TA6A 3GY2A 5FBEA 3SW2B 1C5VA 1HJAC 1N1LA 1TGTA 3RXCA 1EUFA 3T29A 3S69A 1MTSA 1F0UA 2HOBA 1IHTH 5FXLA 1AHTH 1TGCA 1O2TA 1QIXB 3P92A 1SLUB 5C1XA 1ZRBA 2OLGA 2NWNA 1UTPA 1EZXC 1Y3WA 1H9LB 1LMWB 1GVKB 1SOZA 1UCYH 2XBWA 1UK2A 2AEIH 4OS1A 3EYDA 3RC5A 2BDIA 4LXBH 4XDEA 1QRZA 3MFJA 2QXHA 2BD8A 1ELFA 1XUGA 3JZ1B 1NFXA 1ACBE 1SI5H 2CF9H 3MO6A 3MTYA 3SV9A 2ZG0H 3C27B 1ELTA 3QLPH 1CO7E 2BLVA 1BT7A 1P2NA 3QGJA 5FBIA 2ZCKP 1IQFA 4DOQA 3S7KB 1AFQB 1WV7H 4WY3A 4ABEA 4NCYA 4A92A 1TPPA 5JYIA 3RC4A 3AASA 4MPXA 1K9OE 1SLWB 3F9GA 4AORA 3P8FA 2STAE 2UUJB 4SGAE 1AY6H 1G30B 4UEHH 1YCPM 2KAIB 2B8OH 1MTWA 3SUGA 3BTHE 1TGSZ 4A6LA 2FWWA 4RN6A 1V2OT 2GCHG 4JYTA 2SGQE 1AB9C 1GBTA 2V35A 2BXUH 2J2UA 1ELEE 3RM2H 4HFPB 3M61U 1QA0A 2HPQH 3JZ2B 1LDTT 3T2NA 2ZTYA 1AVWA 4ZKOU 3MNCA 2GCHF 1OWJA 3SUFA 2O8UA 1O2JA 1QL7A 1GHXH 1Z8GA 1YPHC 1EAXA 5JBCS 1W7XH 2EI7A 1KXDA 1O3CA 1ZOMA 4OS5A 5EU8A 1T8LA 1C1RA 4FUIA 1AKSA 2PKSC 1HXEH 3TVJB 3TPIZ 4DY7B 5B6OA 4GLYA 3UUZA 5T6FA 1VITF 1HAZB 3RDZA 6GCHG 5JBAS 1BA8B 4O97A 1SGIB 2H5DA 4RSPA 3U8TH 5T6GA 1HAVA 3TH2H 1O5DH 4K8BA 3U8RH 3RXHA 5E0GA 2A2XH 2F3CE 3TITA 4Q7XA 4SGBE 4DGJA 6GCHF 1QBOA 1GVZA 2Y82A 1O2QA 3RXFA 4A7IB 3V0XA 1ZMNA 3MU8A 1HAOH 7ESTE 2AERH 3HK6B 2IN2A 5AF9H 2KAIA 1YPEH 3UNSA 2EEKA 1LPZB 2XYAA 3FZZA 1C5YB 4Y0ZE 1PPEE 1Z8RA 3VB6A 3MNBA 4MPUA 2QF3A 3SORA 1YBWA 4ZXYH 2BVRH 2WYGA 3SOSA 4JCNA 2Y80A 4HI3A 2WV5A 1TNIA 2XBXA 2VIPA 3ODFA 1W10U 1O3PB 5JB9S 3F9FA 1OWIA 3RM0H 4X6NA 4I8GA 3STJA 3F1SB 1WBGB 3MU1A 1EAIA 4CHAB 3SI4H 4FUBA 1EQ9A 3EDXB 1TOCB 1TPAE 1C2IA 1XXDA 3PTBA 3LONA 3A83A 1PPGE 1TAWA 1KXFA 4AB8A 2XWBI 1T7CA 1YPGH 2VWNA 4MVNA 1IQLA 3DA9B 4I8LA 2J92A 1P57B 4DJZB 1ELDE 1Z1JA 1J9CH 5L6NH