2FX6A

Bovine trypsin complexed with 2-aminobenzamidazole
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Trypsin
publication title Structure-guided design of Peptide-based tryptase inhibitors.
pubmed doi rcsb
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2006-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fx6A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fx6A02
3UIRA 2HNTF 1P2JA 2D2DA 2UUFB 1M9UA 2SGFE 2DUCA 1DFPA 1QQUA 1OWJA 3T29A 4K60A 1GCDA 1GI3A 2VIVA 4Y8ZA 3S7HB 5CHAC 2BDYA 2NU1E 2TIOA 4K1TA 5J4QA 1GHZA 1JWTA 2FWWA 4ZXXH 1ESAA 3D49H 4AORA 4FUDA 5TCAA 5A0AE 4Q7YA 2KAIA 1BUIA 3HPTB 7ESTE 4CH8B 1DITH 1TNLA 3ZZ4A 2BLWA 2QXHA 3ZZCA 4AB9A 5H4IB 1TABE 4AFUA 3LH3A 1MZDA 2PR3A 2UUJB 2WPJS 3QK1A 3QWCH 4ISOA 3SUEA 2W3IA 2FTMA 2A4RA 1IOEA 2BYAX 2FOHA 1YPHE 1MMJN 1AGJA 2K1QA 3M61U 4AFQA 1EPTC 1KXEA 2ODYB 2XBYA 1G2MA 1VJ9U 2BDGA 3KGPA 3TNTA 1OOKB 2FP7B 1QR3E 2FOEA 3RU4E 1E34B 1C1TA 3ATWA 1VCPA 2QN5T 1C5XB 1GBBA 2FDAA 1BMLA 4D76A 5HM2A 4B75A 1S83A 3A7VA 2BQ7B 1QL7A 1QB1A 1O2GH 2O8UA 3I29A 1OWHA 1CHOF 1AKSA 4NWLA 1C2MA 2ODQA 1TALA 4BXSA 4X8VH 1C1NA 1O2YA 4I31A 4ABJA 4OGXA 4OS6A 4OGYA 6CHAB 1O33A 3SNEA 2B9LA 3GICB 1DT2A 1ANBA 1ZSJA 4E7RG 1BTYA 4YLUA 1INCA 1P2OA 4KP0A 1HV7A 2Z3DA 4ISIH 1F92A 2ZTZA 2C90B 3HKJB 1V2UT 3GY4A 1OKXA 3SU0A 8GCHF 1C5UA 3TJVA 4BAMB 1RTLA 1HJAC 4IN2A 1O32A 4MTBA 5L2YH 4I8LA 4LXBH 1P02A 2ZQ1A 3UREA 1ANCA 1C5LH 4D8NA 4NIWA 2W3KA 1DPOA 1GJDB 2H9HA 4IS5A 2VNTA 5A09A 2BQ6B 1YPMH 1GHWH 3RMNH 1Y3VA 5EPYA 1QNJA 3RU4D 4I8GA 1UVUH 1BBRE 1K21H 2H2ZA 1OP0A 2V3OH 2VIOA 2C8WB 1EP5A 1B7XB 1OWEA 5LPFA 1GI6A 1ETRH 1N8OC 3A8BA 1QRZA 2PKAA 5TJXA 3LGUA 1OWKA 4WWYA 1W0YH 2OQUA 3DFJA 2P3UB 4KTUA 1BRAA 5IYTA 3BV9B 4E06H 1KY9A 1FNIA 4UFFH 4Y6DA 1TONA 3QTOH 4AFZA 4BAKB 1T32A 2TGAA 1XXDA 3URCA 1DM4B 2R2WU 1C1QA 1LVBA 1ELEE 3QDZB 3KCGH 1SQTA 1FY8E 3GCNA 1C1MA 2A7JA 3RXOA 1SI5H 3GY2A 2BDBA 4TY6A 2XC0A 1GI9B 5A0BA 1V2TT 1NFXA 4A7IB 2BHGA 2ANKH 1TWXB 1F5RA 1K1PA 4BAQB 3GYMA 2VIWA 1HDTH 1UK2A 2OC8A 2CF8H 4YOIA 3TK6A 4B76A 3S0NA 3BIUH 3RXSA 3SJKA 3OTJE 1GI8B 1GHAF 1O2XA 4FUGA 4TWWA 3VEQB 2ZNKH 3UTUH 2Y5FA 2ZFTA 4X2VA 4YOGA 3RXDA 2CN0H 1Q31A 4AB8A 4FU9A 2A31A 3L3TA 1C5MD 1GBKA 1W7GH 5DK1A 3ZVDA 1IQNA 1V2QT 2FM2A 2RA0A 2P95A 1WOFA 2VH0A 1GJ7B 1N6XA 5DKMA 1S81A 1NESE 4XDEA 5EW1H 1EJAA 1SVPA 3LKWA 4YOJA 1GCTB 1AB9B 1YBWA 1GMHG 2G5NA 4UE7H 2A32A 1ZR0A 1HAVB 5F8TA 1HJ8A 2DE9A 4XFQA 1GBJA 1NZQH 4NIVA 1O2MA 1LPZB 4VGCB 1UVOA 2FESH 1AO5A 2WV4A 1GHXH 3K9XB 1LCYA 1VZQH 2DE8A 1BBRK 1K22H 1MKWH 1ZJKA 2ZCLP 1X7AC 1GDQA 4AN7A 1MD8A 3R0FA 9LPRA 1AUJA 1S6HA 2H1UA 3GCTF 2FS9A 3DT0H 2A45B 5E8EH 4CBNA 1O36A 4JCNA 2C8ZB 3DHKH 3MNSA 5JBTA 5C5OA 4BAOB 4FVBA 2F9OA 1GBDA 3SI4H 1O5AB 3U8TH 3FZDA 3BTHE 1CU1A 1O5GH 3RXPA 1NFWA 3T5FH 1UVSH 2V6NA 1C5VA 1HAYB 2P94A 1AQ7A 3P17H 4B2AA 1EB1H 1ELDE 1QHRB 4X8SH 5CHAB 1QBOA 1ZHPA 3FFGA 4MNYA 3L6PA 1ZSKA 4B2CA 3LOXA 3ATIA 4WJG2 1SQAA 3EYDA 2BY5X 4OS5A 3A8DA 3E3TA 1P2MA 1KTSB 4H6SB 5FBEA 1UTPA 3MTYA 2F9BH 1W14U 2M5TA 1LQDB 4ZHMU 2WPIS 2VWOA 2BD7A 1O2ZA 1P09A 1C9TA 4WXIA 1BIOA 1P8VC 3U8OH 4DW2U 2XCNA 1IQMA 1P9UA 1LHEH 1S85A 2PGQB 4ISNA 3VXEH 1GMCF 4AG2A 1SGQE 1YCPH 1YF4A 4U32A 4UEHH 3S7KB 3P8GA 3PO1C 1VJAU 1GI5A 1Z8RA 1EPTB 4MDSA 1IQKA 3EAJA 5FPYA 1FY5A 2F9UA 2Z9IA 4A1TA 3NZIA 1TX6A 1TA6A 4DOQA 3MNXA 1C4U2 1RXPA 4DJZB 4DG4A 2GZ9A 1G3DA 1O2WA 2A1DB 1HYLA 2TGTA 6GCHF 1DSTA 3RXHA 1ZPBA 3GCHC 3SV7A 3GISB 4JYUH 3LDXH 1O3KA 3ATMA 3EE0B 1EAXA 3FAOA 1JMOH 1O39A 1GI2A 1TNIA 4KELA 3VB4A 1P2KA 1QURH 4SGBE 2D1JA 2ZGBH 1S84A 3JZ2B 2A4GA 3UNQA 3O8RA 2OXSA 2FOFA 2HALA 1DXWA 1RTKA 3CP7A 1BHXB 4TWYA 1LTOA 4D9RA 5DG6A 2BTCE 3RM0H 1MU6B 2GT7A 3RMOH 3Q00A 4Y10E 4K8YA 3M35A 2HOBA 2AMQA 1J9CH 3ZVFA 3D62A 1HJAB 3SJIA 1YCPM 2AIQA 1ANEA 1V2PT 2PFEA 1C9PA 3BG8A 2ANYA 2ZDKA 1THSH 2FIRH 2GCTC 3F1SB 4ZAEA 2UUYA 3A86A 1F2SE 1A3EH 2CF9H 5F8ZA 4F4OC 4NCYA 1QL8A 1G32B 1GGDC 3PMJA 4TPYA 4LK4A 2JETC 1RRKA 1V2MT 1PYTD 1EUFA 1XUKA 2XXLA 2JKHA 2I6QA 1D3PB 1HUTH 1N8OB 1V2KT 5CMXH 3IG6B 2ZWLH 1BTUA 3P70B 2Y5HA 3T62A 1UO6A 1SGIB 2BVRH 2ZC9H 2A2XH 1NO9H 1P11E 1GHBF 1RS0A 1A46H 1O3EA 4NIXA 4HI3A 2ANWA 2VU8E 4X6PA 1EB2A 1EJMA 3RXEA 4JYVH 1A7SA 4IMQA 4CHAC 2B8OH 5DO4H 1Y5AT 3EA9A 3AAUA 3TJOA 3OX7U 3TK9A 3ODFA 1ELTA 1ZJDA 1P05A 3SO3A 4BXWA 2F9PA 3SU1A 3TITA 2STAE 1GBHA 3CS7A 4X1NU 2G55A 1LDTT 1DE7H 1C4V2 2WINI 1BJVA 3O8DA 1TB6H 1C2GA 1ZRBA 1SL3A 2A7HA 3D65E 2J34A 4HGCA 1NRNH 2A2QH 2HPPH 4BOHA 5GIBA 1TNGA 2GMTC 3QGNB 1DWDH 1AVWA 3RXLA 1A0LA 4NSVA 1O2KA 1Q2WA 2XBXA 2ZTXA 3GY6A 3RXKA 3TGJE 3LU9B 1EOLA 5IDKA 3SGQE 3BF6H 1GMDG 2WPKS 1MKXH 1THRH 4Z0KA 3SBKA 1SQOA 1TPOA 4ABGA 3ZV9A 1A4WH 1QA7A 2IPHA 5C1YA 1T8MA 1SHHB 1SGEE 3JZ1B 2BD2A 2BMGB 2B7DH 4IMZA 5A2MH 1E38B 4BTUB 1MAXA 3MI4A 1F5LA 1K1LA 2RCEA 3SUDA 2AGIX 5F03A 5FCRA 2AMDA 3PYHA 2Q6GA 1O3JA 1TIOA 3FP8E 2QAAA 3M5OA 3A82A 1D3TB 4WXVA 1O30A 5EXLA 1QRWA 5GCHG 2C8YB 1DICA 4MPUA 4ABIA 3GY8A 2F9VA 1JIRA 3LJJA 1H1BA 5ESTE 3M3TA 1VGCC 3SNBA 1Z1IA 5C20A 3ZVAA 1HJ9A 3SGAE 1E36B 1DANH 1EXFA 1IAUA 1JBUH 1ZMNA 3KIDU 1F0UA 2GCHG 1LPGB 3MOCA 1K1NA 1WQSA 1CVWH 1G3EA 4MVNA 1ZZZA 2Z9KA 1B0EA 4GCHG 2ZFFH 4M7GA 1QRXA 3M3SA 1C2EA 1CGHA 3MNBA 5AHGH 1AFQC 1P12E 3KF2A 3MU0A 1DLEA 1O2SA 5J4SA 4O3TA 3NUMA 1SR5C 3ZZ5A 2BD5A 1XXFA 1PPEE 3K6ZA 1DUAA 1PPFE 4K1SA 3P8FA 4WMFA 1YPJH 1MUEB 3C27B 1IHTH 4WMDA 1NFUA 4X2WA 2ZDNA 2ZPQA 2VIQA 1S0RA 3BEIB 3BTWE 5C2ZA 1C2FA 3MH4A 3L33A 1NU7B 2FOMB 5BRRE 2OBOA 3MO6A 3OY6U 1UCYE 4MLFB 1P3EA 1OWIA 4R0IA 5E0GA 3PO1B 7GCHG 4OS4A 2FOCA 1MZAA 4XOJA 2XC5A 1EKBB 1Z6EA 2VIDA 1RIWC 1AWFH 2LPRA 5C1UA 2JH0D 1ZPCA 1GL1A 1XUGA 2VVVA 1K2I1 3T25A 2FS8A 4X8UH 1O31A 1VITH 1W8BH 4INKA 4LZ4B 3O8CA 1FJSA 2XW9A 2PTNA 2TGPZ 3GCHB 3NK8A 1SG8B 3LGWA 2XNIA 1HIAB 2A5IA 2J92A 4I7YH 2SGPE 1O37A 1BDAA 1QB6A 1TRNA 5DP9A 1O3GA 1FQ3A 1O5CB 5GJ4B 1O3LA 3ZZ8A 2BY9X 1C5RA 4IC5A 1O5EH 3SW2B 3A84A 2GKVE 1N6YA 1NRSH 1HAVA 1XKAC 3A88A 1EP6A 2HNTC 3U98H 5EPNA 4AZ2B 4ABBA 1DDJA 5A8ZA 3ZZAA 4E7NA 1Y3YA 2BDIA 2Q6DA 3M5MA 3GCOA 1GI4A 1P2QA 1TMUH 4Y7BA 4CR5A 1C2JA 1FAKH 5HMAA 4FUJA 1XKBC 1QTFA 1GVKB 2ZFPH 3PLBA 2IN2A 3ZYEA 2P3TB 2Q6FA 4X6MA 3MU5A 2GCTB 1TQ7B 2A5AA 1C5SA 2ASUB 3TNSA 2GX4A 3Q77A 3LC5A 3VPKA 1GGDB 2JETB 3GDVA 6LPRA 2AMPA 3H7TA 4TYDA 3SU5A 2BVSH 3QGJA 5E0HA 3B9FH 2OUAA 2QCYA 1JRSA 1KLJH 1YYY1 3TH4H 3SV2H 3HGNA 1ZYOA 1H8IH 2A0QB 1P0SH 2A5KA 2PV9B 2Y81A 1TGTA 3F68H 3A80A 1G3CA 1YLDA 4LZ1H 3Q3XA 1UCYK 1GWAA 4ZMAH 3S9BA 2H9TH 1GJ4H 1D6WA 2ILNA 2BQWB 4CHAB 1ID5H 2OP9A 1XUFA 2XCFA 1O2TA 1C1SA 4HZHA 5F8XA 3RC5A 3BEFB 2ZTYA 1O35A 1O2RA 1Z6JH 3CS0A 2ZHWH 3UR9A 2ZZUH 4Q2KA 1EX3A 1TE0A 1V2JT 2SNWA 4FUHA 2ZP0H 2VWLA 1PJPA 1TRYA 1SGNE 4R8TB 3UOUA 2CHAC 1GBIA 3M3VA 2ZA5A 3ATKA 1BJUA 2ZIQH 2A4OA 3VB5A 3T27A 1BRBE 1ARBA 1PPHE 3MU1A 4UDWH 1EOJA 1EPTA 4RKOB 1PPZA 1ZSLA 2GMTB 5HGGA 1GDUA 2ZFSA 1CQQA 3VGCC 1SBWA 4CRFA 1O2VA 3SQHE 1QL9A 1SB1H 2BY7X 1LKBA 1BB0B 1UK3A 3T28A 1J15A 6ESTA 1CT0E 3RC6A 4ZKOU 3UY9A 1YPHC 1O5DH 3RUOA 1SOTA 1DS2E 2VWNA 4B74A 2BX3A 3VB6A 2Z94A 5EW2H 1TX8A 1HAHH 3MH6A 4WMEA 4GSOA 2Q1JA 2QXIA 2KAIB 2PW8H 4YESB 3RXVA 2FX4A 1BRUP 1W12U 1ABIH 1O5FH 2D26C 1TMBH 3O8BA 3TH2H 3Q76A 2ZU3A 1ZGVA 4NWKA 5FAHA 1L4DA 2ZQ2A 1QGFA 2CXVA 3UR6A 3DFLA 3TGKE 1BTPA 1YPGH 2ZU2A 4Y0YE 4Y71A 1TQ0B 5E2OA 1FN6A 4K8BA 4YT6H 2IOTA 4D9QA 1EZXC 1DSUA 2PUQH 5EGMA 1F5KU 3RM2H 2ZHEH 5DP6A 3H7OA 1NTPA 3SNCA 1PQ7A 1UTKA 2FEQH 3MH5A 1SGFG 2CV3A 1MTNC 1O3MA 1SGDE 3MNCA 3UQOA 1VGCB 4NZQA 1TNKA 1OYTH 3V0XA 1HAOH 3ZZDA 4U01A 1PFXC 1TBRH 4IC6A 1ESTA 3FZZA 2WPHS 2ESTE 1E0FD 1G3BA 2FPZA 1NRQH 2OCVB 1W0ZU 3A89A 1EAUA 4I8JA 1MTSA 1O2NA 1HAGE 5CE1A 2BB4A 4AYYB 1BQYA 1AFQB 1GJCB 4H6TA 4O03A 1UTJA 3DUXH 1AD8H 4ZKSU 2O8LA 4OS1A 1ETTH 1XX9A 1QQ4A 1LHGH 1BBRH 1HXFH 1MQ6A 3S69A 1ARCA 2BD3A 3VXFH 1U6QA 3K65B 3A7XA 2FO9A 1V6DA 3NKKA 1PPGE 1O3BA 2ZU5A 4NG9H 4AX9H 5DP7A 3SUFA 1PPCE 1SGYE 3Q3YA 1OP8A 1ELBA 8ESTE 2BDAA 1J14A 4Y11E 1LHDH 1GBMA 2FYQA 1FXYA 3E16B 4IGDA 1D6RA 7LPRA 3ATLA 4U2WA 4ZROA 1GBAA 1YCPK 5JB9S 1Z7KA 3FANA 1ORFA 4WH8A 4ISHH 1A5IA 1RIWB 3PWCA 2QGRA 1TPSA 1UHBB 2WYJA 3KQDA 1FI8A 1PQ5A 2EI7A 1RD3B 3BEUA 3STIA 3A87A 2PUXB 1H8DH 3RXMA 4K2YA 2SGAA 3A81A 3F6UH 2QY0B 1UK4A 3C1KA 1C2LA 1XVMA 1ZMLA 2PKSC 5C67A 1MU8B 4LOYH 4DGJA 1P03A 2WV5A 3W95A 4UFDH 5JPMH 1HAPH 5A8XA 5SGAE 1HNEE 1VITG 2BOKA 1SFQB 3STJA 2XC4A 3PV4A 4GVUA 4NA8A 4H42U 1V2WT 1FONA 9ESTA 1SFIA 3SU4A 2G00A 3LT3A 3E0PB 3BG4C 1DVAH 3EA8A 1HCGA 2OQ5A 2G51A 2GTBA 2VB0A 4BTIB 5HYOA 4CH2B 5JDUB 3HGPA 1A0HB 2F3CE 2ZDVH 2AS9A 1C2DA 5DGJA 3QO6A 4ABDA 5EXMA 1A61H 2Y5GA 2YOLA 3NPSA 2FZZA 4MPVA 5AF9H 2HWLB 1YC0A 1KXDA 2FOAA 2PSXA 1O0DH 1AZ8A 4IN1A 1CHGA 3N7OA 2TBSA 3PTNA 5E0JA 3P6ZB 4NA9H 2OINA 1QY6A 4AFSA 3GYLB 2ZGJA 4AYVB 1Y8TA 1GHYH 1GHVH 3BTQE 2UUKB 5JBCS 5DPAA 1KLTA 3LGIA 1GL0E 1AN1E 1MD7A 4B1TA 2GGVB 3RXQA 3RXTA 1MTVA 1G2LA 1QBNA 4YTAA 1H9IE 4MPXA 1TFXA 2XWBI 1VR1H 2RG3A 1XM1A 3FP6E 2ZHQH 2XBWA 4GAWA 1S5SA 2OC0A 1XMNB 1ZLRA 1P06A 5B6OA 3AW1A 2PTCE 3QN7A 5T6GA 2ZEBA 1GBFA 1KXBA 2SGDE 4CRAA 3MU4A 4DY7B 3BN9A 5FX5A 2H9EH 5DP5A 3MWIU 2BDCA 1Z8IB 4FUFA 2ALPA 1GG6C 4WVPE 1SOZA 2BZAA 2VVCA 1SMFE 1SGCA 3V7TA 1NN6A 1QJ7B 1O2LA 1GBCA 3HKIB 4FU8A 2NU0E 3DD2H 1C2KA 4JZEH 4WH6A 2A7CA 4H4FA 1ACBE 5GPIB 4XBCA 2CHAB 1T8LA 1O2OA 1O2UA 1RGQA 4TPIZ 3U69H 2Z6BD 3ZVEA 4GUXA 5GDSH 1RTFB 4UFEH 2ZFRH 5AVDA 2HLCA 1LHCH 4ZKRU 1ELAA 2FODA 1CHOG 1GMHF 8LPRA 1W2KH 1O2IA 5FBIA 1HAXB 4X2XA 3VGCB 3BTDE 3QZRA 1ZTKA 2FXRA 1AI8H 1O2QA 2Z9LA 1TGCA 1TOCB 2ZPRA 2OC1A 3HK6B 1DWCH 5FPTA 3IWMA 4HFPB 1MAYA 1YM0A 1WCZA 3TPIZ 1OX1A 4GLYA 1HAIH 3OU0A 1XUJA 1LPKB 1Y3WA 1HIAA 4NA7A 3BTGE 3BSQA 1AHTH 3MMGA 8GCHG 3BTEE 1S0QA 1W3CA 3ELAH 1QJ1B 5DP4A 1P01A 1PYTC 2Z7FE 1UJ1A 5TCCA 4MG3A 4B73A 1IQEA 2ZI2H 1MH0A 1P2NA 1D9IA 1HXEH 1AMHA 5T6FA 3W94A 3SV8A 2R3YA 3TVJB 4YT7H 4DCDA 2J94A 4X2YA 4E05H 3SU6A 3RLYH 3P8NA 1V2NT 3UOPA 4KGAA 4PROA 3A85A 2ANMH 4UFGH 1TOMH 2LNCA 3MH7A 2PGBB 5JBBS 4A1VA 3TJUA 5LGOA 1D3DB 1ZGIA 1MTNB 1NRRH 4KTSA 2YNAA 3P92A 1WTHD 4CRBA 1C1UH 1GI0A 1CO7E 2CMYA 2CJIA 1YKTA 4DURA 3UPEA 1CGIE 3ZZ7A 3SUGA 1AFEH 1Z71A 4HTCH 4Y7AA 4X6NA 1ZTLA 2EC9H 1FIZA 4D7GA 1O3OA 3B23B 3ZVCA 2J38A 4MNXA 1J17T 1ELVA 1V2VT 3KNXA 3RXIA 4ZXYH 5T6DA 3TU7H 5GXPA 1O3DA 1C5NH 1T7CA 4RN6A 4FUIA 1DY8A 1ELFA 1L1JA 3PB1E 2JH6D 1O2PA 2ZPSA 4ZKNU 4AOQA 3ITIA 1KXCA 1CA0C 5DJ7A 1F0TA 4NZLA 1YP9A 2PSYA 4NFEA 3RMMH 1TBQH 1YGCH 2ZGXH 1NY22 1KXFA 2R9PA 1C5WB 1RJXB 1SPJA 3SN8A 1WYKA 1GHAG 2Y82A 2WPMS 4JMYA 2F91A 3LC3A 4JZIA 3ZVGA 2Y80A 4XE4A 4NFFA 3M5NA 3V13A 1BTXA 1CBWC 3EDXB 1AE8H 1EZUC 1P57B 2QC2A 1XUHA 4Y0ZE 4Y8YA 3RXBA 4K69A 1NRPH 2J9NA 1MTWA 3GY3A 5DP8A 2BLQA 4QT8C 2PLXA 3E8LA 3RP2A 4BANB 1ZOMA 1L1GA 1XUIA 1MTUA 3TJNA 5AFYH 3GOVB 5FX6A 2PKSB 1GJBB 3M7UA 1FN8A 3EGKH 3SGBE 5EQQA 1LKAA 1C2IA 1MBQA 2FI5E 5JYIA 1BHXF 3PMAB 1GBTA 4GHTA 4CBOA 1Y5BT 2BD9A 3ZZ6A 4YZUA 1KTTB 1B5GH 3MO9A 2UWOA 1T31A 1O3PB 1C1VH 3U8RH 1JRTA 1BMAA 3CENA 3BG4B 3SOSA 1ETSH 5L30H 3GCTG 5LPEA 3FVFB 4D7FA 4J1YA 1F0RA 4FUEA 3OSYA 5C5NA 2OBQA 2BY6X 2ZDAH 1C5QA 2GDDA 3I78A 4CREA 3S9CA 2GP9B 5HM9A 1WQVH 1YLCA 4FU7A 2F83A 1IQJA 3KN2A 1SGFA 2XYAA 4I33A 1TGSZ 2H6MA 4BNRA 1OXGA 1AUTC 3RU4T 4XBDA 4NGAH 1FY1A 1IQLA 1TMTH 2QXGA 5EG4A 3M7QA 2STBE 4JZFH 3MU8A 5FCKA 2THFB 3E1XB 1KYNA 2EA3A 2W5EA 3NWUA 3EA7A 3KL6A 2BOHB 3FP7E 1Q3XA 5EQSA 1EATA 2OC7A 1KXAA 3UNSA 1K9OE 2W7SA 1AE5A 3RMLH 1MBMA 3E6PH 3GY7A 3P95A 3PTBA 1WSSH 1K1OA 2Y7ZA 3LH1A 2VWMA 3SQEE 2G81E 3I77A 1BT7A 1L1NA 4ISLA 4BAHB 1FPHH 3UWIA 1ZRKA 3LIWA 2HRVA 4X1SU 4DVAU 2ZU1A 2ZHFH 3RXJA 4YM9A 4B71A 1MCVA 2QXJA 1ELGA 4O3UA 4Y79A 5HXFA 1TRMA 3AASA 4K5ZA 4JK6A 3SZNA 1Z1JA 1GMCG 4MQAA 1C4Y2 1THPB 8KME2 1KDQB 2BD8A 1DLKB 2VH6A 3A7ZA 3MO3A 1GG6B 2A4QA 2Y7XA 2OTVA 3H5CB 3U1JB 1T8NA 1GI7B 1TGNA 1SSXA 3F9FA 4JZDH 2FLBH 1AIXH 1QFKH 3B8JA 1TBZH 3SJ9A 1TPAE 3TK5A 1A3BH 3RXCA 1GMDF 2SNVA 3TGIE 4K3JA 2J2UA 2UWLA 2EI6A 5AFZH 1V2ST 6GCHG 1Y59T 1T8OA 1WTGH 1OPHB 4A92A 1DY9A 5EQRA 3V12A 3P8OA 3BIVH 2VJ1A 1KIGH 3F9GA 3QUMP 1UHBA 1ZPZA 5BPEA 3UNRA 3PROA 2EI8A 3TH3H 3UWJH 2XTTB 1N1LA 2HVXA 2QF3A 2ZCHP 2R2MB 1NS3A 4XSKU 3BTME 1SHYA 2P16A 3A83A 2V3HH 1LHFH 2VGCC 2XRCA 1P3CA 3RDZA 3SHCH 1A5GH 3MHWU 1UCYH 2C3SA 2ZF0H 1AY6H 1TNJA 3LGYA 2IJOB 1HGTH 3RXGA 2TPIZ 3PLPA 1P2IA 1GBEA 3V3MA 1TNHA 3OY5U 1VCQA 2XWAA 5GCHF 5GWZA 1W13U 4Y8XA 2FTLE 3D23A 2AFQB 4X1RU 1O34A 1UTLM 1P10A 3A7WA 2V35A 4O9VA 2BY8X 3SNAA 2ZDLA 2ZGHA 1FV9A 1BMMH 2O8MA 1T4UH 2GT8A 2TRMA 1GJ9B 3RC4A 2W26A 4ABAA 5JBAS 3PLKA 1CSOE 4JZ1A 2GCHF 4YLQH 2P8OC 3VFEA 1OS8A 2R0LA 1W11U 3KQBA 3LPRA 1NC6A 4X1PU 4FXGH 4X8TH 1KSNA 4GCHF 2FYRA 1LVMA 2W7UA 2QIQA 1F0SA 3KHVA 3A8CA 1IQFA 1WU1A 2AH4X 4AGKA 3QZQA 2NU2E 1GBLA 3UUZA 1T4VH 1HB0B 1GHBG 3SI3H 4B2BA 1FPCH 1SLVB 4OS7A 2AGGX 1MKWK 2PWXA 1V2OT 2AERH 2H5DA 5G4BA 4ZHLU 1QBVH 4INHA 1NFYA 2OLGA 5EU8A 2ZGCA 1NROH 1HPGA 1B0FA 2UWPA 4ABHA 2FX6A 4CRDA 1V3XA 4RSPA 1EZSC 1HLTH 4I32A 1BTZA 1TA2A 2PHBA 1SGTA 1Y5UT 3SORA 7GCHF 2R0KA 1BITA 1EASA 2FI3E 3ZV8A 2G4UA 5E2PA 1RFNA 4ABFA 1EAWA 2BLOA 1AKSB 2AIPA 1IQHA 5FPSA 1H9HE 1CA0B 4A6LA 1DXPA 1FDPA 1AU8A 2Z3CA 5EODA 2ZKSA 2GV6A 3UQVA 1O3CA 4A5TS 4Q80A 1K1IA 4BTTB 5LPRA 2J4IA 1A1RA 1CBWB 2AGEX 2NWNA 2QA9E 1ESBA 2G4TA 3QX5H 1SLXB 3E90B 1AVXA 2V0BA 4GPGA 2HPQH 1BA8B 1FY4A 1SLWB 4ASHA 1FUJA 1G9IE 3SU3A 2BDHA 1WV7H 1PQAA 1O5BB 5K7RA 3OYPA 3A8AA 3VB7A 1J16A 2XBVA 3F9HA 3Q3KA 2QF0A 3E0NB 3URDA 1HAZB 2ZDMA 1YPLH 4JK5A 1OP2A 2C8XB 5ETXA 2ALVA 4INLA 4UONA 1CA8B 2WPLS 2ZU4A 1DUEA 2I6SA 5L2ZH 1IHSH 3UFAA 3MFJA 1TLDA 1SC8U 2YNBA 1C5PA 4WY3A 4ESTE 2PKAB 2Y6TA 1W10U 1H9LB 1PPBH 1TGBA 1JOUB 4GHQA 2FI4E 3TLOA 1H4WA 3KQCA 1QIXB 1GDNA 2P59A 1ZHRA 2GV7A 2EEKA 1GVLA 2BXUH 1LVOA 5K0HA 1O3AA 1UTNA 1C1OA 2H5CA 4I8KA 1A0JA 1EJNA 4IW4E 2G8TA 1WBGB 4A1XA 1L0ZA 1IQGA 1S6FA 2FMJA 3T2NA 1K1MA 1D3QB 1HBTH 3MYWA 1GJ5H 1Z8JB 1EAIA 1Y3UA 1YPKH 1SGRE 1C2HA 1XVOA 5C3NA 1O3FA 4K1EA 2O8TA 3G01A 1OWDA 2F9NA 2FLRH 2BZ6H 2HGTH 3WY8A 2Z9GA 5ESBA 4YO9A 3RXRA 3SHAH 3A7TA 1OSSA 5I25A 2J95A 1C1PA 1BMNH 2ZO3H 1MQ5A 3BTKE 2SGQE 4ZH8A 1GI1A 3M36A 1A2CH 1HFDA 3SV9A 3M37A 1L2EA 2VINA 4FVDA 4FUBA 1O3NA 3KEEA 4X0WU 4UD9H 1AWHB 1ZMJA 5ABWA 4ZUHA 3VB3A 3AVZA 2VIPA 1CT4E 1OYQA 3BTTE 1S82A 1LO6A 3DA9B 6CHAC 2GZ8A 3EQ0H 5EOKA 1O2JA 2ZG0H 2R3UA 4IBLH 4Q7ZA 1CE5A 1GVZA 3ODDA 2BX4A 4FUCA 1WUNH 2BVXH 1GJ6A 1FIWA 2C4FH 4AGJA 1NU9A 3T26A 1FY3A 3TIUA 4MNWA 1C5ZB 1BOQA 1D4PB 1JXPA 1C1RA 2NU4E 4SGAE 3PMBB 2BXTH 4Z6AH 1C1WH 1JIMA 1NT1A 3M5LA 3KQEA 3GDSA 3SU2A 3ESTA 4Q7XA 2QYIA 3U9AH 2BLVA 4DIHH 4DT7B 1KLIH 1QA0A 2P93A 2VGCB 3ZZ9A 2TGDA 1DWBH 3ENSB 2ZECA 4J2YB 4MPWA 2BD4A 3RXAA 2ULLA 2CGAA 2SGEE 2O8WA 3HATH 2FOBA 2SFAA 1QCPA 1BTHH 2ZFQH 5T3HA 1A5HA 1K28D 2O9QA 3AAVA 4NSYA 2FOGA 1TPPA 5EXNA 1O38A 4JYTA 1BRCE 1QJ6B 3SJOA 1MKXK 2P3FH 1WAYB 3LJOA 1K1JA 1E35B 4NIYA 4ZHAA 1ANDA 3ZYDA 4F49A 4OS2A 4THNH 2WUBA 1YPEH 1PQ8A 1FZZA 3NXPA 3BTFE 2P8OB 1O3HA 1NPMA 2GDEH 4WF8A 5F6MA 4Y76A 1TX7A 3IITA 3QLPH 1C5TA 1C5YB 4XBBA 1UVPA 1DX5M 1SLUB 1F7ZA 2Z3EA 1UVTH 1AVGH 2Z9JA 3R3GB 2OD3B 1P04A 3AW0A 1Y3XA 2JH5D 4CRGA 3K6YA 2NU3E 1UTOA 1NM6A 3PM3A 5C1XA 5I46H 1J8AA 2RA3A 1QB9A 1G36A 3GY5A 1EZQA 2GZ7A 3SJ8A 2G5VA 3E91A 3U1IB 1C5OH 3ZZ3A 2BM2A 1O3IA 4MNVA 2B0FA 3NCLA 5DP3A 3SV6A 3SNDA 1VCWA 4ABEA 3QTVH 5L6NH 1G37A 1G30B 2WYGA 2HNTE 3PWBA 7KMEH 5JB8S 5FXLA 1Z8GA 3RLWH 3S9AA 1KDQA 3LGTA 5A0CA 3RXFA 4AG1A 4CRCA 1SGPE 4O97A 1O2HA 1UMAH 1GCTC 1AB9C 4X1QU 1FAXA 1V2RT 4U30A 1BZXE 1DOJA 1FMGA 1E37B 3ZVBA 4I8HA 1GJAB 5A8YA 5LH8A 4KTCA 1BCUH 1L4ZA 1ZTJA 3K2UA 2QV1A 1BTWA 1DWEH 1GPZA 4VGCC 1ABJH 1VITF 2ZHDA 1IQIA 2B5TB 1W7XH 2WUCA 2VVUA 3ZZBA 4RKJB 1CT2E 2RDLA 1ELCA 1LMWB 1MCTA 1FLEE 4TY7A 1CGJE 1EQ9A 3LGVA 3M7TA 4DIIH 1GJ8B 3GDUA 1LQEA 1UTQA 2GD4B 2D8WA 4KKDA 1TYNA 2C93B 3A7YA 3HK3B 3F9EA 1ZHMA 2AYWA 4CR9A 4X6OA 5FHTA 3PMHB 1AZZA 1HRTH 1UTMA 3LONA 1LVYA 3RXUA 2AEIH 2GVFA 2ODPA 1TAWA 2ZCKP 5PTPA 2G52A 1P9SA 1V2LT
chains in the Genus database with same CATH superfamily
3UIRA 2HNTF 1P2JA 2D2DA 2UUFB 1M9UA 2SGFE 2DUCA 1DFPA 1QQUA 1OWJA 3T29A 4K60A 1GCDA 1GI3A 2VIVA 4Y8ZA 3S7HB 5CHAC 2BDYA 5KECA 2NU1E 2TIOA 4K1TA 5J4QA 1GHZA 1JWTA 2FWWA 4ZXXH 1ESAA 3D49H 4AORA 4FUDA 5TCAA 5A0AE 4Q7YA 2KAIA 1BUIA 3HPTB 7ESTE 4CH8B 1DITH 1TNLA 3ZZ4A 2BLWA 2QXHA 3ZZCA 4AB9A 5H4IB 1TABE 4AFUA 3LH3A 1MZDA 2PR3A 2UUJB 2WPJS 3QK1A 3QWCH 4ISOA 3SUEA 2W3IA 2FTMA 2A4RA 1IOEA 2BYAX 2FOHA 1YPHE 1MMJN 1AGJA 2K1QA 3M61U 4AFQA 1EPTC 1KXEA 2ODYB 2XBYA 1G2MA 2J98B 1VJ9U 2BDGA 3KGPA 3TNTA 1OOKB 2FP7B 1QR3E 2FOEA 3RU4E 1E34B 1C1TA 3ATWA 1VCPA 2QN5T 1C5XB 1GBBA 2FDAA 1BMLA 4D76A 5HM2A 4B75A 1S83A 3A7VA 2BQ7B 1QL7A 2V7QD 1QB1A 1O2GH 2O8UA 5GNDA 3I29A 1OWHA 1CHOF 1AKSA 4NWLA 1C2MA 1W0JD 2ODQA 1TALA 4BXSA 4X8VH 1C1NA 2XNDD 1O2YA 4I31A 4ABJA 4OGXA 4OS6A 4OGYA 6CHAB 1O33A 3SNEA 4HG6A 2B9LA 3GICB 1DT2A 1ANBA 1ZSJA 4E7RG 1BTYA 4YLUA 2VBCA 1INCA 1P2OA 4KP0A 1HV7A 2Z3DA 4ISIH 1F92A 2ZTZA 2C90B 3HKJB 1V2UT 3GS9A 3GY4A 1OKXA 3SU0A 8GCHF 1C5UA 3TJVA 4BAMB 1RTLA 1HJAC 4IN2A 1O32A 4MTBA 5L2YH 4I8LA 4LXBH 1P02A 2ZQ1A 3UREA 1ANCA 1C5LH 4D8NA 4NIWA 3UB0A 2W3KA 1DPOA 1GJDB 2H9HA 4IS5A 2VNTA 5A09A 2J5UA 2BQ6B 1YPMH 1GHWH 3RMNH 1Y3VA 5EPYA 1QNJA 3RU4D 4I8GA 1UVUH 1BBRE 1K21H 2H2ZA 1OP0A 2V3OH 2VIOA 2C8WB 1EP5A 2EY4C 1B7XB 1OWEA 5LPFA 1GI6A 1ETRH 1N8OC 3A8BA 1QRZA 2PKAA 5TJXA 3LGUA 1OWKA 4WWYA 1W0YH 2KR7A 2OQUA 3DFJA 2P3UB 4KTUA 1BRAA 5IYTA 3BV9B 1EFRD 4E06H 1KY9A 1FNIA 4UFFH 4Y6DA 1TONA 3QTOH 4AFZA 4BAKB 1T32A 2TGAA 1XXDA 3URCA 1DM4B 2R2WU 1C1QA 1LVBA 1ELEE 3QDZB 3KCGH 1SQTA 1FY8E 3GCNA 1C1MA 2A7JA 3RXOA 1SI5H 3GY2A 2BDBA 4TY6A 2XC0A 1GI9B 5A0BA 1V2TT 1NFXA 4A7IB 2BHGA 2ANKH 1TWXB 2WHXA 1F5RA 1K1PA 4BAQB 3GYMA 4RT1A 2VIWA 1HDTH 1UK2A 2OC8A 2CF8H 4YOIA 3TK6A 4B76A 3S0NA 3BIUH 3RXSA 3SJKA 3OTJE 1GI8B 5DN6D 1GHAF 1O2XA 4FUGA 4TWWA 3VEQB 3AK5A 2ZNKH 5F53A 3UTUH 2Y5FA 2ZFTA 4X2VA 4YOGA 3RXDA 2CN0H 1Q31A 4AB8A 4FU9A 2A31A 3L3TA 1C5MD 1GBKA 1W7GH 5DK1A 3ZVDA 1IQNA 1V2QT 2FM2A 2RA0A 2P95A 1WOFA 2VH0A 1GJ7B 1N6XA 5DKMA 1S81A 1NESE 4XDEA 5EW1H 1EJAA 1SVPA 3LKWA 4YOJA 1GCTB 1AB9B 1YBWA 1GMHG 2G5NA 4UE7H 1S6LA 2A32A 1ZR0A 1HAVB 1YWUA 1HJ8A 5F8TA 2DE9A 4XFQA 1GBJA 1NZQH 4NIVA 1O2MA 1LPZB 4VGCB 1UVOA 3F2HA 2FESH 1AO5A 2WV4A 1GHXH 3K9XB 1LCYA 1VZQH 2DE8A 2XOKD 1BBRK 1K22H 1MKWH 1ZJKA 2ZCLP 2F43B 1X7AC 1GDQA 4AN7A 4DT4A 1MD8A 3R0FA 9LPRA 1AUJA 1S6HA 2H1UA 3GCTF 2FS9A 3DT0H 2A45B 5E8EH 4CBNA 1O36A 4JCNA 3PV2A 2C8ZB 3DHKH 3MNSA 5JBTA 5C5OA 4BAOB 4FVBA 2F9OA 1GBDA 3SI4H 2PP6A 1O5AB 3U8TH 3FZDA 3BTHE 1CU1A 1O5GH 3RXPA 1NFWA 3T5FH 1UVSH 2V6NA 1C5VA 1HAYB 2P94A 1AQ7A 3P17H 4B2AA 2EQNA 1EB1H 2K8IA 1ELDE 1QHRB 4X8SH 5CHAB 1QBOA 1ZHPA 3FFGA 4MNYA 3L6PA 1ZSKA 4B2CA 3LOXA 3ATIA 4WJG2 1SQAA 3EYDA 2BY5X 4OS5A 3A8DA 3E3TA 1P2MA 1KTSB 4H6SB 5FBEA 1UTPA 3MTYA 2F9BH 1W14U 2M5TA 1LQDB 4ZHMU 2WPIS 2VWOA 2BD7A 1O2ZA 1P09A 1C9TA 4WXIA 1BIOA 1P8VC 3U8OH 4DW2U 2XCNA 1IQMA 1P9UA 1LHEH 1S85A 2PGQB 4ISNA 2YMSC 3VXEH 1GMCF 4AG2A 1SGQE 1YCPH 1YF4A 4U32A 4UEHH 3SYJA 3S7KB 3NRLA 4Z1MD 1MABB 3P8GA 3PO1C 1VJAU 1GI5A 1Z8RA 1EPTB 4MDSA 1IQKA 3EAJA 3KYGA 5FPYA 1FY5A 2F9UA 2Z9IA 4A1TA 3NZIA 1TX6A 1TA6A 4DOQA 3MNXA 1C4U2 1RXPA 4DJZB 4DG4A 2GZ9A 1G3DA 1O2WA 2A1DB 1HYLA 2TGTA 6GCHF 1DSTA 3PV5A 3RXHA 1ZPBA 4F48B 3GCHC 3SV7A 3GISB 4JYUH 3LDXH 1O3KA 3ATMA 3EE0B 1EAXA 3FAOA 1JMOH 1O39A 1GI2A 1TNIA 2QE7D 4KELA 3VB4A 1P2KA 1QURH 4SGBE 2D1JA 2ZGBH 1S84A 3JZ2B 2A4GA 3UNQA 3O8RA 2OXSA 2FOFA 2HALA 1DXWA 1RTKA 3CP7A 1BHXB 4TWYA 1LTOA 4D9RA 5C17A 5DG6A 2BTCE 3RM0H 1MU6B 3F0PA 2GT7A 3RMOH 3Q00A 4Y10E 2JDID 4K8YA 3M35A 2HOBA 2AMQA 1J9CH 2F4LA 3ZVFA 3D62A 1HJAB 3SJIA 1YCPM 2AIQA 1ANEA 1V2PT 2PFEA 1C9PA 3BG8A 2ANYA 2ZDKA 1THSH 2FIRH 2GCTC 3F1SB 4ZAEA 2UUYA 3A86A 1F2SE 1A3EH 2CF9H 5F8ZA 4F4OC 4NCYA 1QL8A 1G32B 1GGDC 3PMJA 4TPYA 4LK4A 2JETC 1RRKA 1V2MT 1PYTD 1EUFA 1XUKA 2XXLA 2JKHA 2I6QA 1D3PB 1HUTH 1N8OB 1V2KT 5CMXH 3IG6B 2ZWLH 1BTUA 3P70B 2Y5HA 3T62A 1UO6A 1SGIB 2BVRH 2ZC9H 2A2XH 1NO9H 1P11E 1GHBF 1RS0A 1A46H 1O3EA 4NIXA 4HI3A 2ANWA 2VU8E 4X6PA 1EB2A 1EJMA 3RXEA 4JYVH 1A7SA 4IMQA 4CHAC 2B8OH 5DO4H 1Y5AT 3EA9A 3AAUA 3TJOA 1UW7A 3OX7U 3TK9A 3ODFA 2QF5A 1ELTA 1E1RD 1ZJDA 1P05A 5CHBA 3SO3A 4BXWA 2F9PA 3SU1A 3TITA 2STAE 1GBHA 3CS7A 4X1NU 3DCLA 2G55A 1LDTT 1DE7H 1C4V2 2WINI 1BJVA 3O8DA 1TB6H 1C2GA 1ZRBA 1SL3A 2A7HA 3WWFA 3D65E 2J34A 4HGCA 1NRNH 2A2QH 2HPPH 1VKYA 4BOHA 5GIBA 1TNGA 2GMTC 3QGNB 2J98A 1DWDH 1AVWA 3RXLA 3F2FA 1A0LA 4NSVA 1O2KA 1Q2WA 2XBXA 2ZTXA 3GY6A 3RXKA 3TGJE 3LU9B 1EOLA 1COWD 5IDKA 3SGQE 3BF6H 1GMDG 2WPKS 1MKXH 1THRH 4Z0KA 3SBKA 2KCAA 1SQOA 1TPOA 4ABGA 3ZV9A 1A4WH 1QA7A 2IPHA 5C1YA 3F0OA 1T8MA 1SHHB 1SGEE 3JZ1B 2BD2A 2BMGB 2B7DH 4IMZA 5A2MH 1E38B 4B6EA 4BTUB 1MAXA 3MI4A 1F5LA 1K1LA 2RCEA 3SUDA 2AGIX 5F03A 5FCRA 2AMDA 3PYHA 2Q6GA 1O3JA 1NBMD 1TIOA 3FP8E 2QAAA 3M5OA 3A82A 1D3TB 4WXVA 2RDEA 1O30A 5EXLA 1QRWA 2OK5A 2JIZD 5GCHG 2C8YB 1DICA 4MPUA 4ABIA 3GY8A 2F9VA 1JIRA 3LJJA 1H1BA 5ESTE 3M3TA 1VGCC 3SNBA 1Z1IA 5C20A 3ZVAA 1HJ9A 2GJGA 1E36B 3SGAE 1DANH 4F55A 1EXFA 1IAUA 1JBUH 1ZMNA 3KIDU 1F0UA 2GCHG 1LPGB 3MOCA 1K1NA 1WQSA 1CVWH 1G3EA 4MVNA 1ZZZA 2Z9KA 1B0EA 4GCHG 2ZFFH 4M7GA 1QRXA 3M3SA 2HLDD 1C2EA 1CGHA 4YXWD 2LP6A 3MNBA 5AHGH 1AFQC 1P12E 3KF2A 3MU0A 1DLEA 2KCOA 1O2SA 5J4SA 4O3TA 3NUMA 1SR5C 3ZZ5A 2BD5A 1XXFA 1PPEE 3K6ZA 1DUAA 1PPFE 4K1SA 3P8FA 4WMFA 1YPJH 1MUEB 3C27B 1IHTH 4WMDA 1NFUA 4X2WA 2ZDNA 2ZPQA 2VIQA 1S0RA 3BEIB 3BTWE 3EE7A 5C2ZA 1C2FA 2M2AA 3MH4A 3L33A 2YMSB 1NU7B 2FOMB 5BRRE 2OBOA 3MO6A 3OY6U 1UCYE 4MLFB 1P3EA 1OWIA 4R0IA 5E0GA 3PO1B 7GCHG 4OS4A 2FOCA 4P00A 1MZAA 4XOJA 2XC5A 1EKBB 1Z6EA 2VIDA 1RIWC 1AWFH 2LPRA 5C1UA 2JH0D 1ZPCA 1GL1A 1XUGA 2VVVA 1K2I1 3T25A 2FS8A 4X8UH 1O31A 1VITH 1W8BH 4INKA 4LZ4B 3O8CA 1FJSA 2XW9A 2PTNA 2TGPZ 3GCHB 3NK8A 3FOAA 1SG8B 3LGWA 2XNIA 1HIAB 1W0KD 2A5IA 2J92A 4I7YH 2SGPE 1O37A 1BDAA 1QB6A 1TRNA 5DP9A 1O3GA 1FQ3A 1O5CB 5GJ4B 1O3LA 3ZZ8A 4RI0A 2BY9X 1C5RA 4IC5A 1O5EH 3SW2B 3A84A 2GKVE 1N6YA 1NRSH 1HAVA 1XKAC 3A88A 1EP6A 2HNTC 3MQKC 3U98H 5EPNA 4AZ2B 1SKYE 4ABBA 1DDJA 5A8ZA 3ZZAA 4E7NA 1Y3YA 2BDIA 2Q6DA 3M5MA 3GCOA 1GI4A 1P2QA 1TMUH 4Y7BA 4CR5A 1C2JA 1FAKH 5HMAA 4FUJA 1XKBC 1QTFA 4ACAA 1GVKB 2ZFPH 3PLBA 2IN2A 3ZYEA 2P3TB 2Q6FA 3PRBA 4X6MA 3MU5A 2GCTB 2RFKC 1TQ7B 2A5AA 1C5SA 4I86A 2ASUB 3DSPA 4M9FA 3TNSA 2GX4A 3Q77A 3LC5A 3VPKA 1GGDB 2JETB 3GDVA 6LPRA 2AMPA 3H7TA 4TYDA 3SU5A 2BVSH 3QGJA 5E0HA 3B9FH 2OUAA 2QCYA 1JRSA 1KLJH 1YYY1 3TH4H 3SV2H 3HGNA 1ZYOA 1H8IH 2KX4A 2A0QB 1P0SH 2A5KA 2PV9B 2Y81A 1TGTA 3F68H 4FOUC 3A80A 5CDFE 1G3CA 1YLDA 4LZ1H 3Q3XA 1FX0B 1UCYK 1GWAA 4ZMAH 3S9BA 2H9TH 1GJ4H 1D6WA 2ILNA 2BQWB 4CHAB 1ID5H 2OP9A 1XUFA 2XCFA 1O2TA 1C1SA 3OTPA 4HZHA 5F8XA 3RC5A 3BEFB 2ZTYA 1O35A 1O2RA 1Z6JH 3CS0A 2ZHWH 3UR9A 2CK3D 2ZZUH 4Q2KA 1EX3A 1TE0A 1V2JT 2SNWA 4FUHA 2ZP0H 2VWLA 1PJPA 1TRYA 1SGNE 4R8TB 3UOUA 2CHAC 1GBIA 3M3VA 2ZA5A 3ATKA 1BJUA 2ZIQH 2A4OA 3VB5A 3T27A 1BRBE 1ARBA 1PPHE 3MU1A 4UDWH 1EOJA 1EPTA 4RKOB 1PPZA 1ZSLA 2IJD1 2GMTB 5HGGA 1GDUA 2ZFSA 1CQQA 3VGCC 1SBWA 4CRFA 1O2VA 3SQHE 3OAAD 1QL9A 1SB1H 2BY7X 1LKBA 1BB0B 1UK3A 3T28A 1J15A 6ESTA 1CT0E 3RC6A 4ZKOU 3UY9A 1YPHC 2J97A 1O5DH 3OEHD 3OEED 3RUOA 1SOTA 1DS2E 2VWNA 4B74A 2BX3A 3VB6A 2Z94A 5EW2H 1TX8A 1HAHH 3MH6A 4WMEA 2HVYB 2LELA 4GSOA 2Q1JA 2QXIA 2KAIB 2PW8H 3OE7D 4YESB 3RXVA 2FX4A 1BRUP 1W12U 5HIZA 1ABIH 1O5FH 2D26C 1TMBH 3O8BA 3TH2H 3Q76A 2ZU3A 1ZGVA 4NWKA 5FAHA 1L4DA 2ZQ2A 1QGFA 2CXVA 3UR6A 3DFLA 3TGKE 1BTPA 1YPGH 2ZU2A 4Y0YE 4Y71A 1TQ0B 5E2OA 1FN6A 4K8BA 2IPQX 4YT6H 2IOTA 4D9QA 1EZXC 1DSUA 2PUQH 5EGMA 1F5KU 3RM2H 2ZHEH 5DP6A 3H7OA 4B6FA 1NTPA 3SNCA 1PQ7A 1UTKA 2FEQH 3MH5A 1SGFG 2CV3A 1MTNC 1O3MA 1SGDE 3MNCA 4XD7D 3UQOA 1VGCB 4NZQA 3U28C 1TNKA 1OYTH 3V0XA 1HAOH 3ZZDA 4U01A 1PFXC 1TBRH 4AC9A 4IC6A 1ESTA 3FZZA 1H8ED 2WPHS 2ESTE 1E0FD 1G3BA 2FPZA 1NRQH 3ZIAD 2OCVB 1W0ZU 2YMSD 3A89A 1EAUA 4I8JA 1MTSA 3W1EA 1O2NA 1HAGE 5CE1A 2BB4A 4AYYB 1BQYA 1AFQB 1GJCB 4H6TA 4O03A 1UTJA 3DUXH 1AD8H 4ZKSU 2O8LA 2KZ4A 4OS1A 1ETTH 1XX9A 1QQ4A 1LHGH 1BBRH 1HXFH 1MQ6A 3S69A 1ARCA 2BD3A 3VXFH 1U6QA 3K65B 3A7XA 2FO9A 1V6DA 3NKKA 1PPGE 1O3BA 2ZU5A 4NG9H 4AX9H 5DP7A 3SUFA 1PPCE 1SGYE 3Q3YA 1OP8A 1ELBA 8ESTE 2BDAA 2AHME 1J14A 4Y11E 1LHDH 1GBMA 2FYQA 1FXYA 3E16B 4IGDA 1D6RA 5KEDA 5T1VA 7LPRA 3ATLA 4U2WA 4ZROA 1GBAA 1YCPK 5JB9S 1Z7KA 3FANA 1ORFA 4WH8A 4ISHH 1A5IA 1RIWB 3PWCA 2QGRA 1TPSA 1UHBB 2WYJA 3KQDA 1KMHB 1FI8A 1PQ5A 2EI7A 1RD3B 3BEUA 3STIA 3A87A 2PUXB 1H8DH 3RXMA 4K2YA 2SGAA 3A81A 3F6UH 2KCPA 2QY0B 1UK4A 3C1KA 1C2LA 1XVMA 1ZMLA 2PKSC 5C67A 1MU8B 4LOYH 4DGJA 1P03A 2WV5A 3W95A 4UFDH 5JPMH 1HAPH 5A8XA 5SGAE 1HNEE 1VITG 2BOKA 1SFQB 3STJA 2XC4A 3PV4A 4GVUA 4NA8A 4H42U 1V2WT 1FONA 9ESTA 1SFIA 3SU4A 2G00A 3LT3A 3E0PB 3BG4C 1DVAH 3EA8A 1HCGA 2OQ5A 2G51A 2GTBA 2VB0A 4BTIB 5HYOA 4CH2B 5JDUB 3HGPA 1A0HB 2F3CE 2ZDVH 2AS9A 1C2DA 5DGJA 3QO6A 4ABDA 1SQRA 3F3BA 5EXMA 1A61H 2Y5GA 2YOLA 3NPSA 2FZZA 4MPVA 5AF9H 2HWLB 1YC0A 5EJ1A 1KXDA 2FOAA 2PSXA 1O0DH 1AZ8A 4IN1A 1CHGA 3N7OA 2TBSA 3PTNA 5E0JA 3P6ZB 4NA9H 2OINA 1QY6A 4AFSA 3GYLB 2ZGJA 4AYVB 1Y8TA 1GHYH 1GHVH 3BTQE 2UUKB 5JBCS 5DPAA 1KLTA 3LGIA 1GL0E 1AN1E 1MD7A 4B1TA 2GGVB 3RXQA 3RXTA 1MTVA 1G2LA 1QBNA 4YTAA 1H9IE 4MPXA 1TFXA 2XWBI 1VR1H 2RG3A 1XM1A 3FP6E 2ZHQH 2XBWA 4GAWA 1S5SA 2OC0A 1XMNB 1ZLRA 1P06A 5B6OA 3AW1A 2PTCE 3QN7A 5T6GA 2ZEBA 1GBFA 1KXBA 2SGDE 4CRAA 3MU4A 2JJ2D 4DY7B 3BN9A 5FX5A 2H9EH 5DP5A 3MWIU 2BDCA 1Z8IB 4FUFA 2ALPA 1GG6C 4WVPE 1SOZA 2BZAA 2VVCA 1SMFE 1SGCA 3V7TA 1NN6A 1QJ7B 1H8HD 1O2LA 1GBCA 3HKIB 4FU8A 2NU0E 3DD2H 1C2KA 4JZEH 4WH6A 2A7CA 4H4FA 1ACBE 5GPIB 4XBCA 2CHAB 1T8LA 1O2OA 1O2UA 1RGQA 4TPIZ 3U69H 2Z6BD 3ZVEA 4GUXA 5GDSH 1RTFB 4UFEH 2ZFRH 5AVDA 2HLCA 1LHCH 4ZKRU 1ELAA 2FODA 1CHOG 1GMHF 8LPRA 1W2KH 1O2IA 5FBIA 1HAXB 4X2XA 3VGCB 3BTDE 1NBME 3QZRA 1ZTKA 2FXRA 1AI8H 1O2QA 2Z9LA 1TGCA 1TOCB 2ZPRA 2OC1A 3HK6B 1DWCH 5FPTA 3IWMA 4HFPB 1MAYA 1YM0A 1WCZA 3TPIZ 3OFND 1OX1A 4GLYA 1HAIH 3OU0A 1XUJA 1LPKB 1Y3WA 1HIAA 4NA7A 3BTGE 3BSQA 1AHTH 5EIYA 3MMGA 8GCHG 3BTEE 1S0QA 1W3CA 3ELAH 1QJ1B 5DP4A 1P01A 1PYTC 5C0TA 2Z7FE 1UJ1A 5TCCA 4MG3A 4B73A 1IQEA 2ZI2H 1MH0A 1P2NA 5HKKD 1D9IA 1HXEH 1AMHA 5T6FA 3W94A 3SV8A 2R3YA 3TVJB 4YT7H 4DCDA 2J94A 4X2YA 4E05H 3SU6A 3RLYH 3P8NA 1V2NT 3UOPA 4KGAA 3WW7A 4PROA 3A85A 2ANMH 4UFGH 1TOMH 2LNCA 3MH7A 2PGBB 5JBBS 4A1VA 3TJUA 5LGOA 1D3DB 1ZGIA 1MTNB 1NRRH 2WSSD 4KTSA 2YNAA 3P92A 1WTHD 4CRBA 1C1UH 1GI0A 1QZ8A 1CO7E 2CMYA 2CJIA 1YKTA 4DURA 3UPEA 1CGIE 3ZZ7A 3SUGA 1AFEH 1Z71A 4HTCH 4Y7AA 5C94A 4X6NA 1ZTLA 2EC9H 1FIZA 1K0HA 4D7GA 1O3OA 3B23B 3ZVCA 2J38A 4MNXA 1J17T 1ELVA 1V2VT 3KNXA 3RXIA 4ZXYH 5T6DA 3TU7H 5GXPA 1O3DA 1C5NH 1T7CA 4RN6A 5IK2D 4FUIA 3VG8A 1DY8A 1ELFA 1L1JA 3PB1E 2JH6D 1O2PA 2ZPSA 4ZKNU 4AOQA 3ITIA 1KXCA 1CA0C 5DJ7A 1F0TA 4NZLA 1YP9A 2PSYA 4P02A 4NFEA 3RMMH 1TBQH 1YGCH 2ZGXH 1NY22 1KXFA 2R9PA 1C5WB 1RJXB 1SPJA 3SN8A 1WYKA 1GHAG 2Y82A 4ZCNA 2WPMS 4JMYA 2F91A 3LC3A 4JZIA 3ZVGA 3DSGA 2Y80A 4XE4A 4NFFA 3M5NA 3V13A 1BTXA 2QF4A 1CBWC 3EDXB 3F2GA 1AE8H 1EZUC 1P57B 2QC2A 1XUHA 4Y0ZE 4Y8YA 3RXBA 4K69A 1NRPH 2J9NA 1MTWA 3GY3A 5DP8A 2BLQA 4QT8C 2PLXA 3E8LA 3RP2A 4BANB 1ZOMA 1L1GA 1XUIA 1MTUA 3TJNA 5AFYH 3GOVB 5FX6A 2PKSB 1GJBB 3M7UA 1FN8A 3EGKH 3SGBE 5EQQA 2L6OA 1LKAA 1C2IA 1MBQA 2FI5E 5JYIA 1BHXF 3PMAB 1GBTA 4GHTA 4CBOA 1Y5BT 2BD9A 3ZZ6A 4YZUA 1KTTB 1B5GH 3MO9A 2UWOA 1T31A 1O3PB 1C1VH 3U8RH 1JRTA 1BMAA 3CENA 3BG4B 3SOSA 1ETSH 5L30H 3GCTG 5LPEA 3FVFB 4D7FA 4J1YA 1F0RA 4FUEA 3OSYA 5C5NA 2OBQA 2BY6X 2ZDAH 1C5QA 2GDDA 3I78A 4CREA 2L74A 3S9CA 2GP9B 5HM9A 1WQVH 1YLCA 4FU7A 2F83A 1IQJA 3KN2A 1SGFA 2XYAA 4I33A 1E1QD 1TGSZ 2H6MA 4BNRA 1OXGA 1AUTC 3RU4T 4XBDA 4NGAH 1FY1A 1IQLA 1TMTH 2QXGA 5EG4A 3M7QA 2STBE 4JZFH 3MU8A 5FCKA 4FETA 2THFB 3E1XB 1KYNA 2EA3A 2W5EA 3NWUA 3EA7A 3KL6A 2BOHB 3FP7E 1Q3XA 5EQSA 1EATA 2OC7A 1KXAA 3UNSA 1K9OE 5FL7D 1AE5A 2W7SA 3RMLH 1MBMA 3E6PH 3GY7A 3P95A 3PTBA 1WSSH 1K1OA 2Y7ZA 3LH1A 2VWMA 3SQEE 2G81E 3I77A 1BT7A 1L1NA 4ISLA 4BAHB 1FPHH 3UWIA 1ZRKA 3LIWA 2HRVA 4X1SU 4DVAU 2ZU1A 2ZHFH 3RXJA 3UAIC 4YM9A 4B71A 1MCVA 2QXJA 1ELGA 4O3UA 4Y79A 5HXFA 1TRMA 3AASA 4K5ZA 4JK6A 3SZNA 1Z1JA 1GMCG 4MQAA 1C4Y2 1THPB 8KME2 1KDQB 2BD8A 1DLKB 2VH6A 3A7ZA 3MO3A 1GG6B 2A4QA 2Y7XA 2OTVA 3H5CB 3U1JB 1T8NA 1GI7B 1TGNA 1SSXA 3F9FA 4JZDH 2FLBH 1AIXH 1QFKH 3B8JA 1TBZH 3SJ9A 1TPAE 5HIYA 3TK5A 1A3BH 3RXCA 1GMDF 2SNVA 3TGIE 4K3JA 2J2UA 2UWLA 2EI6A 5AFZH 1V2ST 6GCHG 1Y59T 1T8OA 1WTGH 3SZEA 1OPHB 4A92A 1DY9A 5EQRA 3V12A 3P8OA 3BIVH 2VJ1A 1KIGH 3F9GA 3QUMP 1UHBA 1ZPZA 5BPEA 3UNRA 3PROA 2EI8A 3N7DA 3TH3H 3UWJH 2XTTB 1N1LA 2HVXA 2QF3A 2ZCHP 2R2MB 1NS3A 5DSFA 4XSKU 3BTME 1SHYA 2KFWA 2P16A 3A83A 2V3HH 1LHFH 2VGCC 2XRCA 1P3CA 3RDZA 1WDIA 3SHCH 1A5GH 3MHWU 1UCYH 2C3SA 2ZF0H 1AY6H 1TNJA 3LGYA 2IJOB 1HGTH 3RXGA 2TPIZ 3PLPA 1P2IA 1GBEA 3CNRA 3V3MA 1TNHA 3OY5U 1VCQA 2XWAA 5GCHF 5GWZA 1W13U 4Y8XA 2FTLE 3D23A 2AFQB 3FO8D 4X1RU 1O34A 1UTLM 1P10A 3A7WA 2V35A 4O9VA 2BY8X 3SNAA 2ZDLA 2ZGHA 1FV9A 1BMMH 2O8MA 1T4UH 2GT8A 2TRMA 1GJ9B 2KCYA 2W26A 3RC4A 4ABAA 5JBAS 3PLKA 1CSOE 4JZ1A 4XRNA 2GCHF 4YLQH 2P8OC 3VFEA 1OS8A 3DSOA 2R0LA 1W11U 3KQBA 3LPRA 1NC6A 4X1PU 4FXGH 4X8TH 1KSNA 4GCHF 2FYRA 1LVMA 2W7UA 2WV9A 2QIQA 1F0SA 2WPDD 3KHVA 3A8CA 1E79D 1IQFA 1WU1A 2AH4X 4AGKA 3QZQA 2JJ1D 2NU2E 1GBLA 3UUZA 1T4VH 1HB0B 1GHBG 5KGOA 3SI3H 4B2BA 5C0UA 1FPCH 1SLVB 2KM0A 4OS7A 2AGGX 1MKWK 2PWXA 1V2OT 2AERH 2H5DA 3H09A 5G4BA 4ZHLU 1QBVH 4INHA 1NFYA 2OLGA 5EU8A 2ZGCA 1NROH 1HPGA 1B0FA 2UWPA 4ABHA 2FX6A 4CRDA 1V3XA 4RSPA 1EZSC 1HLTH 1BMFD 4I32A 1BTZA 1TA2A 2PHBA 1SGTA 4RT0A 1Y5UT 3SORA 7GCHF 2R0KA 1BITA 1EASA 2FI3E 3ZV8A 2G4UA 5E2PA 1RFNA 4ABFA 1EAWA 2BLOA 1AKSB 2AIPA 1IQHA 5FPSA 1H9HE 1CA0B 4A6LA 1DXPA 1FDPA 1AU8A 2Z3CA 5EODA 2ZKSA 2GV6A 3UQVA 2W6ID 1O3CA 4A5TS 4Q80A 1K1IA 4BTTB 5LPRA 2J4IA 1A1RA 1CBWB 2AGEX 2NWNA 2QA9E 1ESBA 2G4TA 3QX5H 1SLXB 3E90B 1AVXA 2V0BA 4GPGA 1OHHD 2HPQH 1BA8B 1FY4A 1SLWB 4ASHA 1FUJA 1G9IE 3SU3A 2BDHA 1WV7H 1PQAA 1O5BB 5K7RA 3OYPA 3A8AA 3VB7A 1J16A 2XBVA 4OM9A 3N7EA 3F9HA 3Q3KA 2QF0A 3E0NB 3URDA 1HAZB 2ZDMA 1YPLH 4JK5A 1OP2A 2C8XB 5ETXA 2ALVA 4INLA 4ASUD 4UONA 1CA8B 2WPLS 2ZU4A 1DUEA 2I6SA 5L2ZH 1IHSH 3UFAA 3MFJA 1TLDA 1SC8U 3KQ5A 2YNBA 1C5PA 4WY3A 3WWBA 4ESTE 2PKAB 2Y6TA 4Q4LA 2WZQA 1W10U 1H9LB 1PPBH 1TGBA 1JOUB 4GHQA 2FI4E 3TLOA 1H4WA 3KQCA 1QIXB 1GDNA 2P59A 1ZHRA 2GV7A 2EEKA 1GVLA 2BXUH 1LVOA 5K0HA 1O3AA 1UTNA 1C1OA 2K0QA 2H5CA 4I8KA 1A0JA 1EJNA 4IW4E 2G8TA 1WBGB 4A1XA 1L0ZA 3KYFA 1IQGA 1YY3A 1S6FA 2FMJA 3T2NA 1K1MA 1D3QB 1HBTH 3MYWA 1GJ5H 1Z8JB 1EAIA 1Y3UA 1YPKH 1SGRE 1C2HA 1XVOA 5C3NA 1O3FA 4K1EA 2O8TA 3G01A 1OWDA 2F9NA 2FLRH 2BZ6H 2HGTH 3WY8A 2Z9GA 5ESBA 4YO9A 3RXRA 3N99A 3SHAH 3A7TA 1OSSA 5I25A 2J95A 1C1PA 1BMNH 2ZO3H 1MQ5A 3BTKE 2SGQE 4ZH8A 1GI1A 3M36A 1A2CH 1HFDA 3FN8A 3SV9A 3M37A 1L2EA 2VINA 4FVDA 4FUBA 1O3NA 3FKSD 3KEEA 4X0WU 4UD9H 1AWHB 1ZMJA 5ABWA 4ZUHA 3VB3A 3AVZA 2VIPA 1CT4E 1OYQA 3BTTE 1S82A 1LO6A 3DA9B 6CHAC 2GZ8A 3EQ0H 5EOKA 1O2JA 2ZG0H 2R3UA 4IBLH 4Q7ZA 1CE5A 1GVZA 3ODDA 2BX4A 4FUCA 1WUNH 2BVXH 1GJ6A 1FIWA 2C4FH 4AGJA 1NU9A 3T26A 1FY3A 3TIUA 4MNWA 1C5ZB 1BOQA 1D4PB 1JXPA 1C1RA 2NU4E 4SGAE 3PMBB 2BXTH 4Z6AH 1C1WH 1JIMA 1NT1A 3M5LA 3KQEA 3GDSA 3SU2A 3ESTA 4Q7XA 2QYIA 3U9AH 2BLVA 4DIHH 4DT7B 4Q63A 1KLIH 1QA0A 2P93A 2VGCB 3ZZ9A 2TGDA 1DWBH 2V3MA 3ENSB 2ZECA 4J2YB 4MPWA 2BD4A 3RXAA 2ULLA 2CGAA 2SGEE 2O8WA 3HATH 2FOBA 2SFAA 1QCPA 1BTHH 2ZFQH 5T3HA 1A5HA 1K28D 2O9QA 3AAVA 4NSYA 2FOGA 1TPPA 5EXNA 4TSFD 1O38A 4JYTA 1BRCE 1QJ6B 3SJOA 1MKXK 2P3FH 1WAYB 3LJOA 1K1JA 1E35B 4NIYA 4ZHAA 1ANDA 3ZYDA 4F49A 4OS2A 4THNH 2WUBA 1YPEH 1PQ8A 1FZZA 3NXPA 3BTFE 2P8OB 1O3HA 1NPMA 2GDEH 4WF8A 5F6MA 4Y76A 1TX7A 3IITA 3QLPH 1C5TA 1C5YB 4XBBA 1UVPA 1DX5M 1SLUB 1F7ZA 2Z3EA 1UVTH 1AVGH 2Z9JA 3R3GB 2OD3B 1P04A 3AW0A 1Y3XA 2JH5D 4CRGA 3K6YA 2NU3E 1UTOA 1NM6A 3PM3A 5C1XA 5I46H 4TT3D 1J8AA 2RA3A 1QB9A 1G36A 3GY5A 1EZQA 2GZ7A 3SJ8A 2G5VA 3E91A 3U1IB 1C5OH 3ZZ3A 2BM2A 1O3IA 4MNVA 2B0FA 3NCLA 5DP3A 3SV6A 3SNDA 1VCWA 4ABEA 3QTVH 5L6NH 1G37A 1G30B 2WYGA 5B6LA 2HNTE 3PWBA 7KMEH 5JB8S 5FXLA 1Z8GA 3RLWH 3S9AA 1KDQA 3LGTA 4ACBA 5A0CA 3RXFA 4AG1A 4CRCA 1SGPE 4O97A 1WXRA 1O2HA 1UMAH 1GCTC 1AB9C 4X1QU 1FAXA 1V2RT 4U30A 1BZXE 1DOJA 2W6JD 1FMGA 1E37B 3ZVBA 4I8HA 1GJAB 5A8YA 3PRDA 5LH8A 4KTCA 1BCUH 1L4ZA 1ZTJA 3K2UA 2QV1A 1BTWA 1DWEH 1GPZA 1YLNA 4VGCC 1ABJH 1VITF 2ZHDA 1IQIA 2B5TB 1W7XH 2WUCA 2VVUA 3ZZBA 4RKJB 1CT2E 2RDLA 1ELCA 1LMWB 1MCTA 1FLEE 4TY7A 1CGJE 1EQ9A 3LGVA 3M7TA 4DIIH 5EJZA 1GJ8B 3GDUA 1LQEA 1UTQA 2GD4B 2D8WA 4KKDA 1TYNA 2C93B 5EJLA 3A7YA 3HK3B 3F9EA 1ZHMA 2AYWA 4CR9A 4X6OA 5FHTA 3PMHB 1AZZA 1HRTH 1UTMA 3LONA 1LVYA 3RXUA 2AEIH 2GVFA 2ODPA 1TAWA 2ZCKP 5PTPA 2G52A 1P9SA 1V2LT
chains in the Genus database with same CATH topology
3UIRA 2HNTF 1P2JA 2D2DA 2UUFB 1M9UA 2SGFE 2DUCA 1DFPA 1QQUA 1OWJA 3T29A 4K60A 1GCDA 1GI3A 2VIVA 4Y8ZA 3S7HB 5CHAC 2BDYA 2NU1E 2TIOA 4K1TA 5J4QA 1GHZA 1JWTA 2FWWA 4ZXXH 1ESAA 3D49H 4AORA 4FUDA 5TCAA 5A0AE 4Q7YA 2KAIA 1BUIA 3HPTB 7ESTE 4CH8B 1DITH 1TNLA 3ZZ4A 2BLWA 2QXHA 3ZZCA 4AB9A 5H4IB 1TABE 4AFUA 3LH3A 1MZDA 2PR3A 2UUJB 2WPJS 3QK1A 3QWCH 4ISOA 3SUEA 2W3IA 2FTMA 2A4RA 1IOEA 2BYAX 2FOHA 1YPHE 1MMJN 1AGJA 2K1QA 3M61U 4AFQA 1EPTC 1KXEA 2ODYB 2XBYA 1G2MA 1VJ9U 2BDGA 3KGPA 3TNTA 1OOKB 2FP7B 1QR3E 2FOEA 3RU4E 1E34B 1C1TA 3ATWA 1VCPA 2QN5T 1C5XB 1GBBA 2FDAA 1BMLA 4D76A 5HM2A 4B75A 1S83A 3A7VA 2BQ7B 1QL7A 1QB1A 1O2GH 2O8UA 3I29A 1OWHA 1CHOF 1AKSA 4NWLA 1C2MA 2ODQA 1TALA 4BXSA 4X8VH 1C1NA 1O2YA 4I31A 4ABJA 4OGXA 4OS6A 4OGYA 6CHAB 1O33A 3SNEA 2B9LA 3GICB 1DT2A 1ANBA 1ZSJA 4E7RG 1BTYA 4YLUA 1INCA 1P2OA 4KP0A 1HV7A 2Z3DA 4ISIH 1F92A 2ZTZA 2C90B 3HKJB 1V2UT 3GY4A 1OKXA 3SU0A 8GCHF 1C5UA 3TJVA 4BAMB 1RTLA 1HJAC 4IN2A 1O32A 4MTBA 5L2YH 4I8LA 4LXBH 1P02A 2ZQ1A 3UREA 1ANCA 1C5LH 4D8NA 4NIWA 2W3KA 1DPOA 1GJDB 2H9HA 4IS5A 2VNTA 5A09A 2BQ6B 1YPMH 1GHWH 3RMNH 1Y3VA 5EPYA 1QNJA 3RU4D 4I8GA 1UVUH 1BBRE 1K21H 2H2ZA 1OP0A 2V3OH 2VIOA 2C8WB 1EP5A 1B7XB 1OWEA 5LPFA 1GI6A 1ETRH 1N8OC 3A8BA 1QRZA 2PKAA 5TJXA 3LGUA 1OWKA 4WWYA 1W0YH 2OQUA 3DFJA 2P3UB 4KTUA 1BRAA 5IYTA 3BV9B 4E06H 1KY9A 1FNIA 4UFFH 4Y6DA 1TONA 3QTOH 4AFZA 4BAKB 1T32A 2TGAA 1XXDA 3URCA 1DM4B 2R2WU 1C1QA 1LVBA 1ELEE 3QDZB 3KCGH 1SQTA 1FY8E 3GCNA 1C1MA 2A7JA 3RXOA 1SI5H 3GY2A 2BDBA 4TY6A 2XC0A 1GI9B 5A0BA 1V2TT 1NFXA 4A7IB 2BHGA 2ANKH 1TWXB 1F5RA 1K1PA 4BAQB 3GYMA 2VIWA 1HDTH 1UK2A 2OC8A 2CF8H 4YOIA 3TK6A 4B76A 3S0NA 3BIUH 3RXSA 3SJKA 3OTJE 1GI8B 1GHAF 1O2XA 4FUGA 4TWWA 3VEQB 2ZNKH 3UTUH 2Y5FA 2ZFTA 4X2VA 4YOGA 3RXDA 2CN0H 1Q31A 4AB8A 4FU9A 2A31A 3L3TA 1C5MD 1GBKA 1W7GH 5DK1A 3ZVDA 1IQNA 1V2QT 2FM2A 2RA0A 2P95A 1WOFA 2VH0A 1GJ7B 1N6XA 5DKMA 1S81A 1NESE 4XDEA 5EW1H 1EJAA 1SVPA 3LKWA 4YOJA 1GCTB 1AB9B 1YBWA 1GMHG 2G5NA 4UE7H 2A32A 1ZR0A 1HAVB 5F8TA 1HJ8A 2DE9A 4XFQA 1GBJA 1NZQH 4NIVA 1O2MA 1LPZB 4VGCB 1UVOA 2FESH 1AO5A 2WV4A 1GHXH 3K9XB 1LCYA 1VZQH 2DE8A 1BBRK 1K22H 1MKWH 1ZJKA 2ZCLP 1X7AC 1GDQA 4AN7A 1MD8A 3R0FA 9LPRA 1AUJA 1S6HA 2H1UA 3GCTF 2FS9A 3DT0H 2A45B 5E8EH 4CBNA 1O36A 4JCNA 2C8ZB 3DHKH 3MNSA 5JBTA 5C5OA 4BAOB 4FVBA 2F9OA 1GBDA 3SI4H 1O5AB 3U8TH 3FZDA 3BTHE 1CU1A 1O5GH 3RXPA 1NFWA 3T5FH 1UVSH 2V6NA 1C5VA 1HAYB 2P94A 1AQ7A 3P17H 4B2AA 1EB1H 1ELDE 1QHRB 4X8SH 5CHAB 1QBOA 1ZHPA 3FFGA 4MNYA 3L6PA 1ZSKA 4B2CA 3LOXA 3ATIA 4WJG2 1SQAA 3EYDA 2BY5X 4OS5A 3A8DA 3E3TA 1P2MA 1KTSB 4H6SB 5FBEA 1UTPA 3MTYA 2F9BH 1W14U 2M5TA 1LQDB 4ZHMU 2WPIS 2VWOA 2BD7A 1O2ZA 1P09A 1C9TA 4WXIA 1BIOA 1P8VC 3U8OH 4DW2U 2XCNA 1IQMA 1P9UA 1LHEH 1S85A 2PGQB 4ISNA 3VXEH 1GMCF 4AG2A 1SGQE 1YCPH 1YF4A 4U32A 4UEHH 3S7KB 3P8GA 3PO1C 1VJAU 1GI5A 1Z8RA 1EPTB 4MDSA 1IQKA 3EAJA 5FPYA 1FY5A 2F9UA 2Z9IA 4A1TA 3NZIA 1TX6A 1TA6A 4DOQA 3MNXA 1C4U2 1RXPA 4DJZB 4DG4A 2GZ9A 1G3DA 1O2WA 2A1DB 1HYLA 2TGTA 6GCHF 1DSTA 3RXHA 1ZPBA 3GCHC 3SV7A 3GISB 4JYUH 3LDXH 1O3KA 3ATMA 3EE0B 1EAXA 3FAOA 1JMOH 1O39A 1GI2A 1TNIA 4KELA 3VB4A 1P2KA 1QURH 4SGBE 2D1JA 2ZGBH 1S84A 3JZ2B 2A4GA 3UNQA 3O8RA 2OXSA 2FOFA 2HALA 1DXWA 1RTKA 3CP7A 1BHXB 4TWYA 1LTOA 4D9RA 5DG6A 2BTCE 3RM0H 1MU6B 2GT7A 3RMOH 3Q00A 4Y10E 4K8YA 3M35A 2HOBA 2AMQA 1J9CH 3ZVFA 3D62A 1HJAB 3SJIA 1YCPM 2AIQA 1ANEA 1V2PT 2PFEA 1C9PA 3BG8A 2ANYA 2ZDKA 1THSH 2FIRH 2GCTC 3F1SB 4ZAEA 2UUYA 3A86A 1F2SE 1A3EH 2CF9H 5F8ZA 4F4OC 4NCYA 1QL8A 1G32B 1GGDC 3PMJA 4TPYA 4LK4A 2JETC 1RRKA 1V2MT 1PYTD 1EUFA 1XUKA 2XXLA 2JKHA 2I6QA 1D3PB 1HUTH 1N8OB 1V2KT 5CMXH 3IG6B 2ZWLH 1BTUA 3P70B 2Y5HA 3T62A 1UO6A 1SGIB 2BVRH 2ZC9H 2A2XH 1NO9H 1P11E 1GHBF 1RS0A 1A46H 1O3EA 4NIXA 4HI3A 2ANWA 2VU8E 4X6PA 1EB2A 1EJMA 3RXEA 4JYVH 1A7SA 4IMQA 4CHAC 2B8OH 5DO4H 1Y5AT 3EA9A 3AAUA 3TJOA 3OX7U 3TK9A 3ODFA 1ELTA 1ZJDA 1P05A 3SO3A 4BXWA 2F9PA 3SU1A 3TITA 2STAE 1GBHA 3CS7A 4X1NU 2G55A 1LDTT 1DE7H 1C4V2 2WINI 1BJVA 3O8DA 1TB6H 1C2GA 1ZRBA 1SL3A 2A7HA 3D65E 2J34A 4HGCA 1NRNH 2A2QH 2HPPH 4BOHA 5GIBA 1TNGA 2GMTC 3QGNB 1DWDH 1AVWA 3RXLA 1A0LA 4NSVA 1O2KA 1Q2WA 2XBXA 2ZTXA 3GY6A 3RXKA 3TGJE 3LU9B 1EOLA 5IDKA 3SGQE 3BF6H 1GMDG 2WPKS 1MKXH 1THRH 4Z0KA 3SBKA 1SQOA 1TPOA 4ABGA 3ZV9A 1A4WH 1QA7A 2IPHA 5C1YA 1T8MA 1SHHB 1SGEE 3JZ1B 2BD2A 2BMGB 2B7DH 4IMZA 5A2MH 1E38B 4BTUB 1MAXA 3MI4A 1F5LA 1K1LA 2RCEA 3SUDA 2AGIX 5F03A 5FCRA 2AMDA 3PYHA 2Q6GA 1O3JA 1TIOA 3FP8E 2QAAA 3M5OA 3A82A 1D3TB 4WXVA 1O30A 5EXLA 1QRWA 5GCHG 2C8YB 1DICA 4MPUA 4ABIA 3GY8A 2F9VA 1JIRA 3LJJA 1H1BA 5ESTE 3M3TA 1VGCC 3SNBA 1Z1IA 5C20A 3ZVAA 1HJ9A 3SGAE 1E36B 1DANH 1EXFA 1IAUA 1JBUH 1ZMNA 3KIDU 1F0UA 2GCHG 1LPGB 3MOCA 1K1NA 1WQSA 1CVWH 1G3EA 4MVNA 1ZZZA 2Z9KA 1B0EA 4GCHG 2ZFFH 4M7GA 1QRXA 3M3SA 1C2EA 1CGHA 3MNBA 5AHGH 1AFQC 1P12E 3KF2A 3MU0A 1DLEA 1O2SA 5J4SA 4O3TA 3NUMA 1SR5C 3ZZ5A 2BD5A 1XXFA 1PPEE 3K6ZA 1DUAA 1PPFE 4K1SA 3P8FA 4WMFA 1YPJH 1MUEB 3C27B 1IHTH 4WMDA 1NFUA 4X2WA 2ZDNA 2ZPQA 2VIQA 1S0RA 3BEIB 3BTWE 5C2ZA 1C2FA 3MH4A 3L33A 1NU7B 2FOMB 5BRRE 2OBOA 3MO6A 3OY6U 1UCYE 4MLFB 1P3EA 1OWIA 4R0IA 5E0GA 3PO1B 7GCHG 4OS4A 2FOCA 1MZAA 4XOJA 2XC5A 1EKBB 1Z6EA 2VIDA 1RIWC 1AWFH 2LPRA 5C1UA 2JH0D 1ZPCA 1GL1A 1XUGA 2VVVA 1K2I1 3T25A 2FS8A 4X8UH 1O31A 1VITH 1W8BH 4INKA 4LZ4B 3O8CA 1FJSA 2XW9A 2PTNA 2TGPZ 3GCHB 3NK8A 1SG8B 3LGWA 2XNIA 1HIAB 2A5IA 2J92A 4I7YH 2SGPE 1O37A 1BDAA 1QB6A 1TRNA 5DP9A 1O3GA 1FQ3A 1O5CB 5GJ4B 1O3LA 3ZZ8A 2BY9X 1C5RA 4IC5A 1O5EH 3SW2B 3A84A 2GKVE 1N6YA 1NRSH 1HAVA 1XKAC 3A88A 1EP6A 2HNTC 3U98H 5EPNA 4AZ2B 4ABBA 1DDJA 5A8ZA 3ZZAA 4E7NA 1Y3YA 2BDIA 2Q6DA 3M5MA 3GCOA 1GI4A 1P2QA 1TMUH 4Y7BA 4CR5A 1C2JA 1FAKH 5HMAA 4FUJA 1XKBC 1QTFA 1GVKB 2ZFPH 3PLBA 2IN2A 3ZYEA 2P3TB 2Q6FA 4X6MA 3MU5A 2GCTB 1TQ7B 2A5AA 1C5SA 2ASUB 3TNSA 2GX4A 3Q77A 3LC5A 3VPKA 1GGDB 2JETB 3GDVA 6LPRA 2AMPA 3H7TA 4TYDA 3SU5A 2BVSH 3QGJA 5E0HA 3B9FH 2OUAA 2QCYA 1JRSA 1KLJH 1YYY1 3TH4H 3SV2H 3HGNA 1ZYOA 1H8IH 2A0QB 1P0SH 2A5KA 2PV9B 2Y81A 1TGTA 3F68H 3A80A 1G3CA 1YLDA 4LZ1H 3Q3XA 1UCYK 1GWAA 4ZMAH 3S9BA 2H9TH 1GJ4H 1D6WA 2ILNA 2BQWB 4CHAB 1ID5H 2OP9A 1XUFA 2XCFA 1O2TA 1C1SA 4HZHA 5F8XA 3RC5A 3BEFB 2ZTYA 1O35A 1O2RA 1Z6JH 3CS0A 2ZHWH 3UR9A 2ZZUH 4Q2KA 1EX3A 1TE0A 1V2JT 2SNWA 4FUHA 2ZP0H 2VWLA 1PJPA 1TRYA 1SGNE 4R8TB 3UOUA 2CHAC 1GBIA 3M3VA 2ZA5A 3ATKA 1BJUA 2ZIQH 2A4OA 3VB5A 3T27A 1BRBE 1ARBA 1PPHE 3MU1A 4UDWH 1EOJA 1EPTA 4RKOB 1PPZA 1ZSLA 2GMTB 5HGGA 1GDUA 2ZFSA 1CQQA 3VGCC 1SBWA 4CRFA 1O2VA 3SQHE 1QL9A 1SB1H 2BY7X 1LKBA 1BB0B 1UK3A 3T28A 1J15A 6ESTA 1CT0E 3RC6A 4ZKOU 3UY9A 1YPHC 1O5DH 3RUOA 1SOTA 1DS2E 2VWNA 4B74A 2BX3A 3VB6A 2Z94A 5EW2H 1TX8A 1HAHH 3MH6A 4WMEA 4GSOA 2Q1JA 2QXIA 2KAIB 2PW8H 4YESB 3RXVA 2FX4A 1BRUP 1W12U 1ABIH 1O5FH 2D26C 1TMBH 3O8BA 3TH2H 3Q76A 2ZU3A 1ZGVA 4NWKA 5FAHA 1L4DA 2ZQ2A 1QGFA 2CXVA 3UR6A 3DFLA 3TGKE 1BTPA 1YPGH 2ZU2A 4Y0YE 4Y71A 1TQ0B 5E2OA 1FN6A 4K8BA 4YT6H 2IOTA 4D9QA 1EZXC 1DSUA 2PUQH 5EGMA 1F5KU 3RM2H 2ZHEH 5DP6A 3H7OA 1NTPA 3SNCA 1PQ7A 1UTKA 2FEQH 3MH5A 1SGFG 2CV3A 1MTNC 1O3MA 1SGDE 3MNCA 3UQOA 1VGCB 4NZQA 1TNKA 1OYTH 3V0XA 1HAOH 3ZZDA 4U01A 1PFXC 1TBRH 4IC6A 1ESTA 3FZZA 2WPHS 2ESTE 1E0FD 1G3BA 2FPZA 1NRQH 2OCVB 1W0ZU 3A89A 1EAUA 4I8JA 1MTSA 1O2NA 1HAGE 5CE1A 2BB4A 4AYYB 1BQYA 1AFQB 1GJCB 4H6TA 4O03A 1UTJA 3DUXH 1AD8H 4ZKSU 2O8LA 4OS1A 1ETTH 1XX9A 1QQ4A 1LHGH 1BBRH 1HXFH 1MQ6A 3S69A 1ARCA 2BD3A 3VXFH 1U6QA 3K65B 3A7XA 2FO9A 1V6DA 3NKKA 1PPGE 1O3BA 2ZU5A 4NG9H 4AX9H 5DP7A 3SUFA 1PPCE 1SGYE 3Q3YA 1OP8A 1ELBA 8ESTE 2BDAA 1J14A 4Y11E 1LHDH 1GBMA 2FYQA 1FXYA 3E16B 4IGDA 1D6RA 7LPRA 3ATLA 4U2WA 4ZROA 1GBAA 1YCPK 5JB9S 1Z7KA 3FANA 1ORFA 4WH8A 4ISHH 1A5IA 1RIWB 3PWCA 2QGRA 1TPSA 1UHBB 2WYJA 3KQDA 1FI8A 1PQ5A 2EI7A 1RD3B 3BEUA 3STIA 3A87A 2PUXB 1H8DH 3RXMA 4K2YA 2SGAA 3A81A 3F6UH 2QY0B 1UK4A 3C1KA 1C2LA 1XVMA 1ZMLA 2PKSC 5C67A 1MU8B 4LOYH 4DGJA 1P03A 2WV5A 3W95A 4UFDH 5JPMH 1HAPH 5A8XA 5SGAE 1HNEE 1VITG 2BOKA 1SFQB