2FX6A

Bovine trypsin complexed with 2-aminobenzamidazole
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title Structure-guided design of Peptide-based tryptase inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2006-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fx6A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fx6A02
1ZOMA 4NWLA 1O2RA 3QZQA 4X1QU 2VB0A 2QIQA 1J14A 1HAZB 1LHGH 5FPYA 5J4SA 1ZGVA 2J95A 3ODDA 1SL3A 4BTUB 2FPZA 4CRCA 1C4V2 2TIOA 4J1YA 4X6NA 3P17H 1MCVA 2WPLS 1MH0A 1EPTA 1PQ5A 1O2YA 2ZFSA 4O97A 4R0IA 1LTOA 3TK5A 4HI3A 2BOKA 1QRWA 2PTCE 3M5MA 1RJXB 1K28D 1TQ0B 3HKJB 2NU1E 3PB1E 4D7FA 4ZXYH 5HM2A 1HAXB 2TGPZ 2BVRH 1V3XA 3P6ZB 3RXGA 5I25A 4YLUA 2FM2A 2SGFE 5JBCS 2HPQH 2BZ6H 1GWAA 3V7TA 3S69A 1CT2E 2FWWA 3QN7A 3SU2A 3CS0A 4MPXA 2QXJA 1ZGIA 3TK9A 3LOXA 1LO6A 4OGXA 3SU1A 1F5KU 1J15A 1HBTH 1BBRE 4ZROA 4A6LA 4A92A 1C5NH 4DJZB 3M61U 2XBXA 2RA3A 3Q3YA 4TPIZ 4Q7YA 1AVWA 1C5ZB 1OXGA 5EXLA 3MO6A 3LH1A 1PYTC 1VGCC 1SMFE 3TJVA 2FO9A 1P11E 1JRTA 2BD7A 5A0BA 1IQMA 2JETB 3NXPA 2ZDMA 2NU3E 2XBWA 4UONA 4OS5A 2A5KA 1AWFH 1MQ5A 4NCYA 2PLXA 1ZZZA 1TA6A 2RG3A 4YOIA 2BLOA 1GJCB 3RC6A 1B0EA 2ALPA 1HJ8A 1TONA 4FUEA 4I31A 1CA8B 1QJ7B 1MAXA 4IS5A 2O8WA 1DPOA 3GCTF 1C2LA 2J38A 3OYPA 2ZFQH 3SV2H 3VGCC 3A88A 1GBIA 1GI0A 1SOZA 1GJ8B 3ITIA 1O3PB 2DE9A 2FYRA 4AGKA 2FOAA 3PYHA 3LJJA 1KXDA 1ARCA 1F2SE 1GJ5H 3U1IB 1MMJN 1QURH 1ARBA 1GHBG 1O0DH 4UFEH 1S6FA 3DD2H 1FY5A 1PQAA 1V2KT 3SNCA 2F91A 2D8WA 4Y79A 1W7GH 2ZGXH 3F9FA 2ZTXA 2GD4B 4GCHF 2V3HH 3ZV9A 5EGMA 3W94A 1BTXA 1TFXA 3P8OA 1BMMH 3A83A 1BMAA 4FUIA 1P9UA 1GCDA 5EOKA 2CF9H 2W7SA 1VJAU 2OP9A 1HGTH 3ATLA 2FYQA 3QTOH 1HAVB 1G3EA 1HYLA 1BRCE 4FUGA 1UTLM 1VCPA 1DWBH 2C93B 2SNWA 2Z9LA 3F9EA 5JPMH 1Z8JB 2PUXB 1QIXB 5FX5A 3RXAA 1MKWK 3TVJB 1PJPA 1DITH 1C5PA 1IQHA 2ZPRA 1Z8GA 3GYMA 2HVXA 4DIHH 2BDGA 3SHAH 1TBRH 2A5AA 1MCTA 1EJMA 2ZP0H 1AVGH 1SGQE 4NIXA 1AFEH 3I77A 1G2MA 3OY5U 1ZLRA 3D62A 2WPIS 2FOEA 3EA9A 4XOJA 1HAOH 5AVDA 2BD2A 4DCDA 1QB6A 3VFEA 1QR3E 1SPJA 5HGGA 4FXGH 2WPKS 4ISHH 2GVFA 1TOCB 2YNAA 1QBOA 3FZZA 4LZ4B 2QXHA 1QBVH 2R2MB 2CHAB 1DLKB 1XUJA 1F5RA 4WMFA 3PWBA 3RXTA 1FY8E 4I8KA 2ODQA 4ISOA 2TGAA 2O9QA 1AD8H 3MWIU 4OS6A 1QA7A 4FU9A 1CGHA 5HXFA 1PPHE 1KDQA 1OPHB 1V2TT 3EQ0H 2P3TB 1GMHF 3FP8E 2ZHQH 4Y8XA 5FAHA 1Q3XA 3D23A 2ANMH 1DSUA 3BEFB 5E0JA 5HM9A 1BCUH 4JZFH 1O2ZA 2VJ1A 3UQOA 3T26A 2BMGB 6GCHF 1FDPA 1HIAA 1OOKB 4XE4A 4IC5A 4MNXA 2EI6A 1ANBA 5E2OA 3RLYH 3NUMA 3ZYDA 3T62A 1RD3B 1GVKB 2B0FA 2XWBI 1SGPE 1H4WA 1GI7B 2H5DA 1GI3A 1GBCA 1TPPA 1C1NA 1O31A 4FUJA 3BTDE 1TLDA 3ZZBA 3K2UA 1C5SA 1KYNA 3LGTA 4FUFA 3PTBA 1AWHB 1HUTH 4ABAA 1BZXE 2CV3A 1IHSH 3GY2A 3VB5A 4YLQH 1FY3A 2Z9GA 3BF6H 2B7DH 3HK6B 4KTUA 2Y81A 1WQVH 1JBUH 2VH6A 3QK1A 1C1QA 4OS4A 4D7GA 1C2HA 3WY8A 1GJ7B 4H4FA 2ZKSA 4X6PA 2TPIZ 1INCA 1UK3A 2AMDA 2QXIA 4BAHB 2D1JA 4UD9H 3RM2H 1C4Y2 3BG4C 1IQIA 1P2MA 4BAKB 1Y5BT 4O9VA 1EX3A 1GI6A 5CE1A 3RXSA 2I6QA 1MD8A 4KELA 4SGAE 6LPRA 1MBQA 1E38B 1YCPH 3SU5A 3BTHE 1JWTA 1QGFA 2VGCC 3MH6A 1CE5A 3U8TH 2VINA 3GDSA 2VWNA 3TK6A 4ESTE 5K7RA 4NIYA 1CA0B 8GCHF 4Y76A 3S7KB 2QYIA 3SN8A 5EQRA 1ETSH 2ZC9H 1TALA 1GVLA 1AN1E 2BM2A 2P95A 1EZSC 1IAUA 4WMEA 4JZEH 2TRMA 2P16A 2AFQB 2Z9IA 1NU7B 3ZVDA 1OKXA 4LK4A 1SR5C 2GMTC 1SQOA 1P3EA 2WV5A 4ABFA 1EASA 3BTEE 3QGNB 5JBTA 1FZZA 2PWXA 2BLQA 1EP6A 2ZCHP 4Y0YE 1A3BH 1O2IA 2A2XH 2C8YB 1J16A 4Z0KA 2ZGHA 1U6QA 3OTJE 1UMAH 1A1RA 2JH5D 5FBIA 2CXVA 2JH0D 1L2EA 1BTHH 1O2WA 1KXBA 3RMOH 2HPPH 5DP5A 1A7SA 5IDKA 1NZQH 4D9QA 2W26A 4ZAEA 3SO3A 4IGDA 1GBJA 5TCCA 4F49A 1ZPBA 2H2ZA 1T31A 3KF2A 3D65E 1TA2A 4D8NA 2A5IA 1V2NT 3GCOA 1ZPCA 2BX3A 1W0ZU 3M3VA 4ZHLU 5LGOA 4Y8YA 2A32A 1K21H 3ZV8A 4RKOB 4NA7A 3M5OA 5F8TA 1NRSH 1NROH 1EATA 1BRUP 1MTWA 2ZQ1A 4GSOA 1G3CA 1YF4A 3K6YA 4MPUA 1HJAB 3GY8A 1QL9A 2W3KA 5I46H 4QT8C 1QQ4A 2HNTF 1GI4A 3ZZ5A 3EA7A 1TNKA 4VGCC 2OC7A 2QAAA 1UTJA 1N8OC 1G32B 1L1NA 7GCHG 2BQ7B 4ZUHA 2TBSA 3KQBA 1UHBA 1CHOF 3GICB 3RU4D 3E0PB 5LH8A 1WV7H 2Q6DA 3NKKA 5DGJA 2G55A 3VPKA 1Z1IA 4E06H 1O2PA 1ZJKA 1TMTH 3UOUA 2VIDA 1JRSA 1THSH 1C9PA 4R8TB 1CBWB 3ATIA 2C8WB 1AU8A 5JBBS 1EAXA 1G3BA 2P8OB 1AMHA 2ZFFH 3BTTE 4NSVA 5EQSA 1SG8B 1SGTA 4YZUA 2A4GA 5GWZA 1EKBB 1P57B 3BTGE 3SJIA 1H9LB 2JH6D 2GZ9A 1SLWB 3SW2B 3GCNA 4WF8A 1C1UH 2B8OH 2OC1A 1Z8IB 1YYY1 1MU8B 4IMQA 4DOQA 2C4FH 4K69A 4CBOA 2FOGA 1RIWB 2ZF0H 2XNIA 3C1KA 1IQJA 1A46H 3RXPA 1CGJE 1Y3XA 3A8AA 1AUTC 4I8HA 5DP8A 3BEIB 1JXPA 2ANYA 2GV6A 1IQGA 4JMYA 3LONA 4B75A 1D6WA 3RXQA 2KAIA 2PSXA 4A1VA 1SGRE 3TIUA 5EW1H 3L33A 1O5EH 3RXRA 1ELVA 3EYDA 3SV8A 1MTNC 4AORA 1Z7KA 3MOCA 3ZZCA 1BITA 1AFQB 1V2VT 1AB9C 1C1RA 3T5FH 4OGYA 5DG6A 1YPLH 3SBKA 4E05H 1TNHA 4Q2KA 1DY9A 4ZHAA 2EC9H 1T4UH 3PMAB 3AVZA 3T29A 1DM4B 1S0RA 1C5QA 1SHHB 3SGAE 2VWLA 3LU9B 1MBMA 2WPJS 1K2I1 3BEUA 5DO4H 1FI8A 1GI2A 4B71A 1P2QA 1KLIH 1QQUA 2SNVA 3UFAA 2BYAX 2IPHA 1H8DH 2VWMA 5AFYH 2A0QB 1XXDA 5FPSA 1EQ9A 3M35A 1EZXC 1HJ9A 2PGQB 1Q2WA 1DE7H 1YPHC 1UO6A 1OX1A 1WQSA 2RCEA 1ZHRA 3A7WA 1D6RA 1S82A 4ZKRU 5E0HA 4ZKNU 2FLBH 2NU4E 3FZDA 1NFYA 1BDAA 4A1XA 4U32A 1W8BH 2A4OA 1LKBA 3SGQE 1C2KA 4U01A 1SVPA 4AN7A 1C2EA 2BDYA 2ZGCA 2AGEX 4K8BA 4MNVA 3UPEA 4AB9A 1F7ZA 5GPIB 2ZQ2A 1QB9A 1EP5A 3SI3H 1LHCH 2QGRA 1G37A 1NESE 2Z7FE 1O3DA 3TJUA 1OP8A 1BBRH 4CH2B 1KTSB 1TGTA 2G81E 1GHAF 1AE5A 5C1UA 3U8RH 4JYTA 4I8LA 4BOHA 1QRXA 1HB0B 3KN2A 2QXGA 4IN2A 2QA9E 2G4UA 3A8DA 1ELFA 3KQEA 2LPRA 2WYGA 4YESB 8ESTE 2BXTH 3F68H 5F8ZA 1ZSLA 4ISIH 1QA0A 4XBCA 1C2JA 4O3TA 1PFXC 1BMNH 1ELGA 1C5WB 1O2SA 1Y5AT 2ZFRH 3QGJA 2BD9A 2JETC 3OU0A 3M5NA 1O2UA 5C5NA 5K0HA 5EW2H 2XRCA 3URCA 1V6DA 1OSSA 3S9CA 1AQ7A 3A81A 3P8FA 3RXCA 1FXYA 3OSYA 1OP2A 5ESBA 2V0BA 4CRDA 1WBGB 3UR6A 1Y5UT 2Z94A 2BQWB 1K1LA 3RUOA 3GY7A 4O03A 5A0CA 4AYVB 5F8XA 1O2QA 1YLCA 1ANCA 1TNIA 1IQFA 4X2YA 1ZHPA 1O5DH 2R0LA 1C5OH 5LPFA 1IQEA 4CBNA 3SU4A 1EPTB 3HGNA 4GHTA 1GJBB 2ZPSA 4THNH 1OYQA 2P59A 3Q00A 4CRFA 1K1IA 4AOQA 1TX8A 2HLCA 2V6NA 1S84A 3KL6A 1T8OA 4D9RA 2ZDAH 1SGDE 1LMWB 5T6FA 1UTNA 3ELAH 2ANWA 1T8LA 2F9OA 3QZRA 4Y11E 4DG4A 1GPZA 2ZZUH 1O3AA 2Z3CA 1GHYH 1BT7A 3B9FH 1TYNA 2EI7A 1TWXB 3MO9A 5L6NH 1C5TA 1L4ZA 1O3FA 1VITG 4MVNA 1FPCH 3RMNH 3SUDA 2ZHFH 1LHFH 4BAMB 2UUKB 2FOFA 1C5UA 3VEQB 1TX6A 3D49H 3ATKA 1DSTA 2H9HA 5EPNA 1DFPA 1GI8B 3ZVGA 3KIDU 4GVUA 2C3SA 5FHTA 8KME2 4INHA 3ATMA 3E90B 4K1EA 2VVVA 3E3TA 3RMLH 1O3BA 1OWIA 1E37B 2JKHA 5DP9A 2AERH 3PROA 1O3GA 4WJG2 4I33A 1MTUA 1YKTA 1UVTH 3M7TA 1DWDH 1EAUA 3V3MA 3SNDA 5H4IB 2FLRH 4A1TA 6CHAB 1LKAA 2ZGBH 2OBOA 3PO1B 5AHGH 4YT6H 2ZCLP 3ZZ7A 4BXSA 3TGIE 1FY4A 2XBYA 1BJUA 4MG3A 3U8OH 4M7GA 1MUEB 2A1DB 3T27A 3T25A 5LPEA 3M5LA 3BIUH 2FTLE 4CHAC 1E36B 1P3CA 2I6SA 3M37A 1OS8A 2CHAC 2H9TH 1NRQH 2W7UA 1O35A 2HGTH 1QB1A 1DX5M 1Z1JA 2XYAA 4BAOB 3UNQA 1O32A 2Z6BD 3FP6E 1GMDG 1QJ1B 1SGCA 1UVPA 2GGVB 2Z9JA 4ZKSU 3SU3A 1MAYA 2BZAA 4MDSA 2IJOB 1QL7A 4AFZA 2AS9A 2ANKH 1T8NA 1WTHD 1V2OT 4FVBA 1TIOA 5FPTA 2H6MA 2VVUA 1LPZB 1NS3A 1V2JT 3KQDA 2GCHF 3AW0A 1GL1A 1OWKA 1QHRB 3RXOA 4AX9H 1YPHE 3ESTA 1BRBE 1C5YB 1FUJA 4X1NU 1MTVA 1HAHH 1O33A 4JYUH 4UFFH 3A7TA 1SGFG 2PKSB 7ESTE 2STBE 1O2LA 1YPEH 1P8VC 2PV9B 4CRGA 1ZRBA 1CVWH 4UE7H 1TGSZ 3UWIA 1NT1A 3STIA 2BVSH 3I29A 3ZVCA 1W10U 2FZZA 1C2GA 1FONA 4X8UH 3GDUA 3RXHA 2XXLA 2XC0A 4U30A 2OTVA 5A8XA 2J2UA 3AW1A 2PHBA 2G5NA 1F0TA 2H1UA 3EAJA 1SGEE 2ZU4A 1QY6A 1O34A 2OINA 2GZ8A 4AB8A 1TRNA 1BQYA 1BRAA 5E2PA 2FI3E 3F1SB 1RTKA 1WYKA 5IYTA 1EZQA 1LVMA 3DFJA 3RXKA 4DVAU 1G36A 2VIWA 1C1WH 2STAE 2O8MA 4Q80A 2AIQA 2SGDE 1RS0A 2P94A 2ZNKH 2J34A 1BJVA 8LPRA 4RKJB 3PLPA 2A2QH 3V0XA 1DY8A 2F9UA 5BPEA 1LPKB 4XDEA 3TPIZ 3O8DA 4RSPA 4I32A 2AMPA 1NN6A 1C5RA 1MZDA 1KDQB 2F9NA 3LT3A 4X2VA 2CF8H 1CA0C 1TPSA 2ZA5A 5L2ZH 9ESTA 1SLUB 1YBWA 1YP9A 2UWOA 5TJXA 1ELDE 4ABGA 1HIAB 3RXBA 3MO3A 1GMCG 1V2WT 1XUHA 3HATH 1J8AA 1YCPK 3AAVA 2XTTB 2PR3A 3M3TA 5FXLA 2R2WU 3U9AH 3BN9A 5FCKA 1ZSKA 1C9TA 1PYTD 3R0FA 3RXUA 1O2KA 2G4TA 5C1YA 1YLDA 2BB4A 1GGDB 3SNBA 1VZQH 1MQ6A 2Q6FA 3UWJH 1B7XB 1A0LA 2OQ5A 1H9IE 3PTNA 1C1VH 1YC0A 3F6UH 4MPVA 1BTZA 3SHCH 3GOVB 4XBBA 4B1TA 5EXNA 1LPGB 1O5CB 5EG4A 2GDEH 3AAUA 3U98H 3RC5A 3E91A 2C90B 1O5AB 2D2DA 2ZEBA 1FLEE 3TJNA 1J9CH 5A09A 1P12E 1XKAC 2OC8A 3GY3A 2AEIH 1T7CA 2XCNA 3BSQA 4B2CA 2CMYA 4H6TA 2XCFA 4TPYA 3E1XB 1TRYA 1Y8TA 3TH2H 4NZQA 4OS2A 1W7XH 3SV9A 1DOJA 2J94A 1L1JA 2BHGA 2VIPA 3GCHB 3F9HA 1C1MA 5DP3A 2BDCA 1ZTJA 1D3PB 2ZU1A 3SV6A 3L6PA 2J92A 1ANDA 1XUIA 1HJAC 5C5OA 1O3JA 1QL8A 1S85A 1T8MA 3MNBA 5GIBA 1ELBA 1TB6H 2G8TA 3U69H 3S0NA 4I7YH 1ETRH 1UVUH 3SV7A 4YTAA 1QFKH 2FTMA 1UTOA 1TGNA 2GTBA 3GISB 4HZHA 4B73A 1AE8H 1WCZA 4NSYA 1E35B 4X8TH 3LGWA 1ZMJA 2P3FH 2HNTC 3ZZAA 1GBFA 1EB1H 4KGAA 1K1OA 3A8BA 4ISNA 3RXMA 3LIWA 1CBWC 4SGBE 4ABHA 5E8EH 4X6OA 1O2OA 1O2VA 1DUEA 2IOTA 2P8OC 1SGIB 1CSOE 2LNCA 2PTNA 2BDAA 1UVSH 3A86A 2BY5X 3TU7H 1H1BA 3GCTG 3ZZDA 2YNBA 1KTTB 1NFWA 1CO7E 1GHBF 3K6ZA 1D3TB 4ABJA 1S83A 1V2QT 2P3UB 3SZNA 3KCGH 3GY6A 1ACBE 3ODFA 3ZZ3A 1EAIA 1C2FA 1SI5H 1A2CH 1VCQA 2ZDVH 4X1SU 1DANH 1RIWC 1ZTLA 5F03A 3E16B 5DP7A 1JOUB 5HMAA 1OWHA 1ZMNA 3GY5A 3P8GA 3PLBA 1CHGA 2FOHA 4GUXA 4MLFB 1A61H 4E7RG 3P92A 4F4OC 4GCHG 1UVOA 3JZ1B 1DVAH 4INLA 1PQ8A 3DT0H 3KEEA 2Y5HA 5C1XA 1C5VA 4KP0A 1BOQA 2CGAA 2F83A 2ZIQH 2VNTA 1Q31A 4NGAH 1AFQC 1SGFA 1SLVB 6ESTA 1MU6B 4NA9H 1HAYB 1LHEH 2UWLA 1O37A 1BHXF 1LVOA 2PKAA 1XUKA 3MYWA 4CREA 4DURA 1UHBB 2EI8A 4IMZA 4B2BA 2BD3A 5GXPA 1FIZA 2FEQH 4AG1A 3HKIB 4TYDA 2UUFB 2HALA 3UTUH 1GJ4H 3EDXB 4D76A 4YOGA 3MU5A 2XW9A 1BHXB 1DS2E 3RMMH 1FMGA 1JIRA 2Z3DA 4INKA 3MH5A 1HAPH 1GCTB 2ZDLA 4MPWA 4X0WU 2QV1A 3JZ2B 2O8TA 1WU1A 1P02A 3VXEH 3OX7U 1HPGA 3SORA 1GJ6A 1K1JA 1G30B 2WPMS 4ZH8A 5GCHF 2PW8H 3TITA 3A7YA 1K1NA 1A0JA 1VITH 1C5LH 2BY9X 1GDUA 1FQ3A 1L0ZA 2Y82A 1JMOH 1HRTH 3SQEE 3V13A 1GBDA 1ORFA 3TH4H 4TWYA 3VB3A 4LZ1H 2O8UA 1FAXA 1XVOA 2F3CE 2SGAA 3M7QA 3STJA 1IQNA 4NWKA 1HXEH 3V12A 1JIMA 1A0HB 1GMHG 3SJ8A 3UNSA 5JYIA 1DUAA 1XUFA 3O8BA 1FY1A 3LC3A 3TNTA 2KAIB 4AZ2B 3B8JA 1IHTH 1O3OA 1TNJA 5PTPA 2GV7A 3EA8A 3SGBE 6GCHG 3LGVA 2A7CA 4UFGH 1IOEA 3MU8A 2AIPA 1Y3VA 7LPRA 1XMNB 3NWUA 3PLKA 3I78A 4FU7A 2ZG0H 2AMQA 4BANB 1A5IA 1O3NA 1HCGA 1GBLA 1V2ST 1P2NA 2W3IA 5EXMA 1UK2A 4BXWA 3Q76A 2ODYB 4ZXXH 2ZTYA 4ZKOU 3SNEA 1TE0A 1N6YA 1Y3UA 2DE8A 1TBZH 1SB1H 4Y8ZA 1S5SA 3LC5A 1PPZA 1ESAA 3MNSA 1AHTH 2XC4A 1O3HA 1GG6B 1QNJA 3QWCH 1FJSA 1BBRK 3A85A 2DUCA 1O3MA 1O3LA 1YPKH 2GT8A 2PGBB 5EODA 4JZDH 5JB8S 1O5BB 3RDZA 1L4DA 4B76A 1HV7A 1DXWA 5EPYA 1TABE 4LOYH 2GCTB 3KQCA 4B2AA 5F6MA 1GBMA 2Y5FA 4Y7BA 5CHAB 2QC2A 2R0KA 1FNIA 1A3EH 3R3GB 5DP4A 1RFNA 4X8VH 1O5FH 1O30A 1ZTKA 1EPTC 1P10A 1SGYE 5T3HA 4OS7A 4DY7B 1K22H 2HNTE 1ESTA 4NFFA 2VIQA 2ULLA 3SI4H 2R3UA 1W12U 1L1GA 1TBQH 2BX4A 4JZ1A 1GJ9B 1PPCE 1W3CA 2UUYA 1UCYE 3OY6U 8GCHG 1HXFH 1GI5A 1GJAB 3UIRA 1W2KH 1XX9A 2OCVB 4TWWA 1P05A 1GBTA 1BMLA 4MTBA 2BD8A 3LH3A 5DJ7A 5L30H 1A5HA 1RTFB 1YPJH 2ZGJA 1S6HA 2Y5GA 1EB2A 3UY9A 5A8ZA 3LDXH 1AUJA 3VXFH 2FOBA 1W0YH 5E0GA 1DT2A 2PFEA 1O2TA 3A7ZA 1FV9A 4Y7AA 2H9EH 3W95A 3BIVH 2J4IA 1C2MA 1C5MD 1ZJDA 5ABWA 2ZI2H 2NU0E 3CENA 6CHAC 1TMBH 2A31A 3T2NA 3PO1C 4DIIH 2F9VA 3FVFB 1UTMA 2XBVA 5ESTE 4PROA 1YCPM 2XWAA 3Q3XA 3AASA 3KGPA 1NO9H 2FI5E 1O2MA 1V2LT 2RA0A 3SJ9A 3RU4T 4HFPB 3UUZA 3O8CA 1ABJH 2C8ZB 1P9SA 4Y10E 1BTUA 3IITA 1QTFA 3A7XA 2F9BH 3B23B 3RXJA 5DK1A 1D3QB 1EZUC 1SQTA 3TJOA 1D4PB 1AY6H 1WAYB 1O3EA 2ZHWH 3E6PH 1HAVA 4NIVA 1LVBA 2A45B 1O2NA 1CU1A 4BTTB 3L3TA 1A4WH 3BTWE 3RXVA 4DW2U 1BTPA 1GDNA 1Z6EA 1THRH 7GCHF 3M7UA 3U1JB 3S9AA 3SJKA 3QO6A 4BAQB 5GJ4B 1NU9A 3MNCA 2ZCKP 2BD5A 2M5TA 1PQ7A 1VGCB 1Z8RA 5DP6A 1GL0E 3RXDA 2PKSC 1FPHH 1C1OA 5B6OA 1TX7A 2VU8E 3SUFA 1SC8U 3RXIA 3LGYA 5DKMA 4CR5A 1CHOG 3RXEA 4I8JA 1TOMH 3A8CA 3PWCA 5EU8A 4ABIA 2FDAA 1D9IA 4FUHA 3DA9B 3MNXA 4NIWA 1ZYOA 1YPMH 1YPGH 2BDIA 2O8LA 1ZHMA 3GDVA 1GJDB 1V2UT 4YT7H 1GDQA 1V2RT 1P2IA 2QF3A 2ZU3A 1C5XB 1TQ7B 1V2PT 2GP9B 2GT7A 3VGCB 1AIXH 2WV4A 4KTSA 1A5GH 1XXFA 1SFQB 3PM3A 1OP0A 1P2OA 2NU2E 1XUGA 2BDBA 4ZMAH 1CQQA 1Y3YA 2VH0A 2R9PA 3P8NA 4WMDA 5TCAA 1T32A 1O2XA 5JDUB 1BUIA 2QY0B 2HOBA 1TPAE 3VB7A 3A7VA 4I8GA 1MKWH 1H8IH 1MZAA 4FUBA 3UR9A 3FAOA 2WUBA 3HK3B 3PMHB 4UEHH 4WXVA 4YO9A 1O2GH 4UDWH 3MTYA 2BQ6B 3MH7A 1GHXH 4H42U 3SOSA 2BY6X 2FP7B 3GY4A 4IN1A 3ZZ6A 2GX4A 1EXFA 3SUEA 1K9OE 4X1RU 2ZDKA 3H7OA 3PMBB 2ZDNA 2B5TB 3LPRA 5A8YA 2R3YA 4CHAB 2G52A 2ODPA 3H7TA 4ZHMU 1BTWA 1NPMA 2BY8X 3UNRA 2A4QA 3RXLA 1ELEE 2FX4A 2AYWA 2J9NA 1V2MT 1O5GH 4WH8A 4XSKU 1X7AC 1ID5H 1ETTH 1J17T 1GHVH 5GCHG 2Y6TA 1S81A 1WUNH 1G3DA 2C8XB 1ZRKA 2HWLB 4NA8A 5FCRA 3A87A 3PMJA 4CRBA 1LQEA 4J2YB 1BB0B 1SLXB 1GHWH 3NZIA 1GBKA 4U2WA 1E0FD 4HTCH 5G4BA 1GGDC 1TPOA 1XKBC 5AF9H 2G5VA 4DGJA 3A84A 1VR1H 2ZECA 4Q7XA 1IQKA 1O2JA 4K1TA 1C1PA 1NC6A 1F0RA 1MKXK 4B74A 5JBAS 2A4RA 3SNAA 2ASUB 1UK4A 1WOFA 2Q6GA 2WINI 2RDLA 1AZZA 5BRRE 4FU8A 1RTLA 1MKXH 2ZFTA 2Y7ZA 2VWOA 2WYJA 1AI8H 1SHYA 1HFDA 2BLVA 3ZVFA 1TNGA 2UWPA 2VIVA 4TY7A 1NRRH 4CRAA 3ZZ9A 2FI4E 2FX6A 4UFDH 3T28A 1CT0E 1GBBA 1NY22 2Y80A 2OXSA 3QTVH 3ZVAA 3CS7A 4ABBA 1Y59T 2FIRH 4XFQA 1LCYA 2EEKA 1Z6JH 2GKVE 3M3SA 3MH4A 3GCHC 1ZMLA 2UUJB 1PPEE 1AO5A 5C2ZA 1DWEH 5C20A 1LDTT 1GHAG 1UTQA 2V35A 1ZSJA 1TGBA 4Y0ZE 4O3UA 2OD3B 4Y6DA 1WTGH 1SSXA 1ELTA 1NM6A 2FOCA 1FN8A 3FP7E 4WWYA 4IC6A 1CGIE 1DWCH 1DLEA 2FODA 3DHKH 4ABEA 4Q7ZA 1TRMA 3P70B 3GYLB 1F0SA 1LQDB 4TY6A 3ZVBA 1O38A 5HYOA 4FUCA 2ZU5A 3RLWH 4JYVH 4KKDA 3UREA 1F92A 4AFSA 4MNYA 2ZTZA 2SFAA 1W11U 1SFIA 2AGIX 2BTCE 3BG4B 4ASHA 4K2YA 1AKSA 1O3KA 4NZLA 2OQUA 4LXBH 1P06A 2ZWLH 1WSSH 3FANA 3LKWA 3RP2A 3NCLA 4X6MA 1KXFA 4BTIB 2VGCB 2VVCA 3ENSB 3SU0A 3FFGA 3VB4A 4YM9A 1RRKA 2W5EA 1EOJA 2CJIA 3KHVA 3MU1A 4MNWA 1O3IA 4KTCA 1KLTA 3Q77A 2GZ7A 2FMJA 2BLWA 3TNSA 4OS1A 4A5TS 1C2DA 4AG2A 3UQVA 2D26C 1GVZA 3S9BA 1P2KA 1P01A 2ESTE 3QX5H 4JCNA 3A82A 2TGTA 1C1SA 3MFJA 1EJAA 4CH8B 2SGEE 2SGPE 4Y71A 1IQLA 1VITF 1QJ6B 2ALVA 2ZPQA 3MU4A 1O3CA 1SBWA 1P04A 1Z71A 1ZPZA 1TAWA 1TGCA 3H5CB 2IN2A 1GI1A 1F5LA 4K3JA 1XM1A 1T4VH 1RXPA 2EA3A 1FN6A 1QCPA 1GBEA 5AFZH 1AKSB 3BTQE 2GMTB 1KXEA 2FESH 3E0NB 1N1LA 2ZHDA 3MMGA 3TGJE 1HNEE 1NRNH 1NTPA 1K1MA 1KXCA 1GHZA 2BXUH 4CR9A 2G00A 1ESBA 1B5GH 1H9HE 2P93A 2FS8A 3M36A 1TNLA 2YOLA 4IBLH 3IG6B 3N7OA 1HAGE 5EQQA 2OLGA 3HPTB 4GLYA 2QCYA 3HGPA 5J4QA 1NRPH 4X2XA 1MTSA 3VB6A 4AYYB 3BTKE 1GI9B 2PUQH 2WPHS 1DDJA 3BG8A 2OC0A 1OWEA 4K60A 3URDA 3EE0B 3S7HB 3C27B 1P0SH 3QDZB 4E7NA 1AVXA 1GCTC 4K8YA 4XBDA 1KIGH 5T6DA 2QN5T 4Z6AH 1C2IA 1W14U 2SGQE 1C4U2 5T6GA 3RU4E 1GBHA 3RM0H 1AZ8A 1OYTH 2A7JA 4GHQA 2ZU2A 1NFUA 1QRZA 3MHWU 1THPB 1P09A 3UOPA 3MU0A 4WY3A 2QF0A 1F0UA 3SJOA 2AGGX 1K1PA 3TH3H 3EGKH 1GMDF 1HDTH 3ATWA 2BY7X 2OBQA 1ANEA 2A7HA 1W13U 5A2MH 3SU6A 2G51A 4X2WA 1YGCH 1BIOA 1SQAA 4NG9H 1G9IE 5DPAA 3DFLA 4GAWA 4WVPE 2H5CA 5SGAE 4DT7B 3NPSA 4JK6A 4BNRA 4YOJA 2Z3EA 2FS9A 3LJOA 1P2JA 2NWNA 4JK5A 1TMUH 4A7IB 1LVYA 3ZYEA 1PPBH 2BVXH 4VGCB 3O8RA 2F9PA 1N8OB 1SGNE 3G01A 3Q3KA 2AH4X 2GCHG 4MQAA 5L2YH 1EOLA 1ABIH 1G2LA 3E8LA 2ZO3H 1VJ9U 3PV4A 5C3NA 3NK8A 1NFXA 2TGDA 2CN0H 3ZZ8A 4AFUA 3TLOA 1E34B 1P03A 2ZFPH 4X1PU 1FAKH 3LGIA 4AGJA 2V3OH 2PKAB 4JZIA 2PSYA 1DXPA 2WUCA 1Y3WA 1O2HA 3CP7A 1CT4E 3SQHE 3RXFA 5CMXH 4FUDA 2BD4A 1FIWA 1N6XA 1SOTA 5FX6A 3TGKE 2B9LA 1GG6C 3A89A 3BTME 4H6SB 1MD7A 1ELCA 2GDDA 2VIOA 4RN6A 2THFB 4K5ZA 3K9XB 2BDHA 4WH6A 3F9GA 1HAIH 1UJ1A 2FXRA 5ETXA 2XC5A 4FVDA 5C67A 1EJNA 1YM0A 2ILNA 3BV9B 3IWMA 2GCTC 1OWJA 3SUGA 1BTYA 1VCWA 3RC4A 1KSNA 5CHAC 2K1QA 5JB9S 1ELAA 2Q1JA 1UTPA 3KNXA 1PPFE 1DICA 1XVMA 1UCYK 4HGCA 4AFQA 2OUAA 2FOMB 1EUFA 1PPGE 1GBAA 1RGQA 1OWDA 1ZR0A 2Y7XA 4ISLA 3DUXH 1KXAA 4X8SH 1AGJA 3QUMP 1S0QA 7KMEH 1UCYH 2HRVA 4IW4E 1BA8B 3QLPH 1MTNB 5GDSH 3BTFE 3MI4A 3ZZ4A 1AB9B 1D3DB 1GMCF 1QBNA 1O39A 1M9UA 4WXIA 9LPRA 1O36A 4K1SA 1KLJH 2BOHB 4GPGA 3ZVEA 3K65B 4ABDA 5A0AE 1B0FA 5FBEA 2Z9KA 3LGUA 3P95A 1C1TA 1UTKA 1KY9A 1LHDH 1EAWA 5LPRA 1HLTH 2ZHEH 3A80A 4NFEA
chains in the Genus database with same CATH superfamily
1ZOMA 4NWLA 4TSFD 1O2RA 3QZQA 4X1QU 2VB0A 3UAIC 2QIQA 1J14A 1HAZB 1LHGH 5FPYA 5J4SA 1ZGVA 2J95A 3ODDA 5FL7D 1SL3A 4BTUB 2FPZA 4CRCA 1C4V2 2TIOA 3F2HA 4J1YA 4X6NA 3P17H 1MCVA 2WPLS 4P02A 1MH0A 1EPTA 1PQ5A 1O2YA 2ZFSA 4O97A 4R0IA 1LTOA 3TK5A 4HI3A 2BOKA 1QRWA 2PTCE 3M5MA 1RJXB 1K28D 1TQ0B 3HKJB 2NU1E 3PB1E 4D7FA 4ZXYH 5HM2A 1HAXB 2TGPZ 2BVRH 1V3XA 3P6ZB 3RXGA 5I25A 4YLUA 2FM2A 2SGFE 5JBCS 2HPQH 2BZ6H 1GWAA 3FOAA 3V7TA 4RI0A 3S69A 1CT2E 2FWWA 3QN7A 3SU2A 3CS0A 3OEED 4MPXA 2QXJA 4ASUD 1ZGIA 3TK9A 3LOXA 1LO6A 4OGXA 3SU1A 1F5KU 1J15A 1HBTH 1BBRE 4ZROA 4A6LA 4A92A 1C5NH 4DJZB 3M61U 2XBXA 2RA3A 3Q3YA 4TPIZ 4Q7YA 1AVWA 1C5ZB 1OXGA 2KCYA 5EXLA 3MO6A 3LH1A 1PYTC 1VGCC 1SMFE 2F4LA 3TJVA 2FO9A 4ACBA 1P11E 1JRTA 2BD7A 5A0BA 1IQMA 2JETB 3NXPA 2ZDMA 2NU3E 2XBWA 4UONA 4OS5A 2A5KA 1AWFH 1MQ5A 4NCYA 2PLXA 2JDID 1ZZZA 1TA6A 2JJ1D 2RG3A 4YOIA 2BLOA 1GJCB 3RC6A 3GS9A 1B0EA 2ALPA 1HJ8A 1TONA 4FUEA 4I31A 1CA8B 1QJ7B 1MAXA 4IS5A 2O8WA 1DPOA 3GCTF 1C2LA 2J38A 3OYPA 2ZFQH 3SV2H 3VGCC 3A88A 1GBIA 1GI0A 2KR7A 3PV2A 1SOZA 1GJ8B 3ITIA 1O3PB 2DE9A 2FYRA 4AGKA 2FOAA 3PYHA 3LJJA 1KXDA 1ARCA 1F2SE 1GJ5H 3U1IB 1MMJN 1QURH 1ARBA 1GHBG 1O0DH 4UFEH 1S6FA 3DD2H 1FY5A 1PQAA 1V2KT 3SNCA 2F91A 2D8WA 4Y79A 1W7GH 2ZGXH 3F9FA 2ZTXA 2GD4B 4GCHF 2V3HH 3ZV9A 5EGMA 3W94A 1BTXA 1E79D 1TFXA 3P8OA 1BMMH 3A83A 1BMAA 4M9FA 4FUIA 1P9UA 1GCDA 5EOKA 2CF9H 2W7SA 1VJAU 2OP9A 1HGTH 3ATLA 2FYQA 3QTOH 1HAVB 1G3EA 1HYLA 1BRCE 4FUGA 1UTLM 1VCPA 1DWBH 2C93B 2SNWA 2Z9LA 3F9EA 5JPMH 1Z8JB 3VG8A 2PUXB 1QIXB 5FX5A 3RXAA 1MKWK 3TVJB 1PJPA 1DITH 1C5PA 1IQHA 2ZPRA 1Z8GA 3GYMA 2HVXA 2K0QA 4DIHH 2BDGA 2QF5A 3SHAH 1TBRH 2A5AA 1MCTA 1EJMA 2ZP0H 1AVGH 1SGQE 4NIXA 1AFEH 4F55A 3I77A 1G2MA 3OY5U 3DSGA 1ZLRA 3D62A 2WPIS 2FOEA 3EA9A 4XOJA 1HAOH 5AVDA 2BD2A 4DCDA 1QB6A 3VFEA 1QR3E 1SPJA 5HGGA 4FXGH 2WPKS 4ISHH 2GVFA 3FN8A 1TOCB 2YNAA 1FX0B 1QBOA 3FZZA 4LZ4B 2QXHA 1QBVH 2R2MB 2CHAB 1DLKB 1XUJA 1F5RA 4WMFA 3PWBA 3RXTA 1FY8E 4I8KA 2ODQA 4ISOA 2TGAA 2O9QA 1AD8H 3MWIU 4OS6A 1QA7A 4FU9A 1CGHA 5HXFA 1PPHE 3WWFA 1KDQA 1OPHB 1V2TT 3EQ0H 2P3TB 1GMHF 3FP8E 2ZHQH 4Y8XA 5FAHA 1Q3XA 3D23A 2ANMH 1DSUA 3BEFB 5E0JA 5HM9A 1BCUH 4JZFH 1O2ZA 2VJ1A 3UQOA 3T26A 2BMGB 6GCHF 1FDPA 1HIAA 1OOKB 4XE4A 4IC5A 4MNXA 2EI6A 1ANBA 5E2OA 3RLYH 3NUMA 3ZYDA 3T62A 1RD3B 1GVKB 2B0FA 4B6FA 2XWBI 1SGPE 1H4WA 1GI7B 2H5DA 1GI3A 1GBCA 1TPPA 1C1NA 1O31A 4AC9A 4FUJA 3BTDE 1TLDA 3ZZBA 3K2UA 1C5SA 1KYNA 3LGTA 4FUFA 2J5UA 3KYFA 3PTBA 1AWHB 1HUTH 4ABAA 1BZXE 2CV3A 1IHSH 3GY2A 5DSFA 3VB5A 4YLQH 1FY3A 2Z9GA 3BF6H 2B7DH 3HK6B 4KTUA 2Y81A 1WQVH 1JBUH 2VH6A 3QK1A 1C1QA 4OS4A 4D7GA 1C2HA 3WY8A 1GJ7B 4H4FA 2ZKSA 4X6PA 2TPIZ 1INCA 1H8HD 1UK3A 2AMDA 2QXIA 4BAHB 2D1JA 4UD9H 3RM2H 1C4Y2 3BG4C 1IQIA 4TT3D 1P2MA 4BAKB 1Y5BT 4O9VA 1EX3A 1GI6A 5CE1A 3RXSA 2I6QA 1MD8A 4KELA 4SGAE 6LPRA 1MBQA 1E38B 1YCPH 1YY3A 2V3MA 3SU5A 3BTHE 2M2AA 1JWTA 1QGFA 2VGCC 3MH6A 1CE5A 3U8TH 2VINA 3GDSA 2VWNA 3TK6A 4ESTE 5K7RA 3F0PA 3PRBA 4NIYA 1CA0B 8GCHF 4Y76A 3S7KB 2QYIA 3SN8A 5EQRA 1ETSH 2ZC9H 1TALA 1GVLA 1AN1E 2BM2A 2P95A 1EZSC 1IAUA 4WMEA 4JZEH 1W0KD 2P16A 2TRMA 2AFQB 2Z9IA 1NU7B 4Q4LA 5HKKD 3ZVDA 1OKXA 4LK4A 1SR5C 2GMTC 1SQOA 1P3EA 2WV5A 4ABFA 1EASA 3BTEE 3QGNB 5JBTA 1FZZA 2PWXA 2BLQA 1EP6A 2ZCHP 4Y0YE 1A3BH 1O2IA 2A2XH 2C8YB 1J16A 4Z0KA 2ZGHA 1U6QA 3OTJE 1UMAH 1A1RA 2JH5D 5FBIA 3U28C 2CXVA 2JH0D 1L2EA 1BTHH 1O2WA 1KXBA 3RMOH 2HPPH 5DP5A 1A7SA 5IDKA 1NZQH 4D9QA 2W26A 4ZAEA 3SO3A 4IGDA 1GBJA 5TCCA 4F49A 4RT1A 1ZPBA 2H2ZA 1T31A 3KF2A 3UB0A 3D65E 1TA2A 4XRNA 4D8NA 2A5IA 2W6JD 1V2NT 3GCOA 1ZPCA 2BX3A 1W0ZU 3M3VA 4ZHLU 5LGOA 4Y8YA 2A32A 1K21H 3ZV8A 3CNRA 4RKOB 4NA7A 1E1RD 3M5OA 5F8TA 1NRSH 1NROH 1EATA 1BRUP 1MTWA 2ZQ1A 4GSOA 1G3CA 1YF4A 3DSOA 3K6YA 4MPUA 1HJAB 3GY8A 1QL9A 2W3KA 5I46H 4QT8C 1QQ4A 2HNTF 1GI4A 3ZZ5A 3EA7A 1TNKA 4VGCC 5C94A 2OC7A 2QAAA 1UTJA 1N8OC 1G32B 1L1NA 7GCHG 2BQ7B 4ZUHA 2TBSA 3KQBA 1UHBA 1CHOF 3GICB 3RU4D 3E0PB 5LH8A 1WV7H 2Q6DA 3NKKA 5DGJA 2G55A 3VPKA 1Z1IA 4E06H 1O2PA 1ZJKA 1TMTH 2KCAA 3UOUA 3OTPA 2VIDA 1JRSA 1THSH 1C9PA 4R8TB 1CBWB 3ATIA 2C8WB 1AU8A 4P00A 5JBBS 5HIZA 1EAXA 1G3BA 2P8OB 1AMHA 2ZFFH 3BTTE 4NSVA 5EQSA 1SG8B 1SGTA 4YZUA 2A4GA 5GWZA 1EKBB 1P57B 3BTGE 3SJIA 1H9LB 2JH6D 2GZ9A 1SLWB 3SW2B 3GCNA 4WF8A 3KYGA 1C1UH 2IPQX 2B8OH 2OC1A 1Z8IB 1YYY1 1MU8B 4IMQA 4DOQA 2C4FH 4K69A 4CBOA 2FOGA 1RIWB 2ZF0H 2XNIA 3C1KA 1IQJA 1A46H 3RXPA 1CGJE 1Y3XA 3A8AA 1AUTC 4I8HA 5DP8A 3BEIB 1JXPA 2ANYA 2GV6A 1IQGA 4JMYA 3LONA 4B75A 1D6WA 3RXQA 2KAIA 2PSXA 4A1VA 1SGRE 3TIUA 5EW1H 3L33A 1O5EH 3RXRA 1ELVA 1H8ED 3EYDA 3SV8A 1MTNC 5HIYA 4AORA 1Z7KA 3MOCA 3ZZCA 1BITA 1AFQB 1V2VT 1AB9C 1C1RA 3T5FH 4OGYA 5DG6A 1YPLH 3SBKA 4E05H 1TNHA 4Q2KA 1DY9A 4ZHAA 2EC9H 1T4UH 3PMAB 3AVZA 3T29A 4ZCNA 1DM4B 1S0RA 3WWBA 1C5QA 1SHHB 3SGAE 2YMSC 2VWLA 3LU9B 1MBMA 2WPJS 1K2I1 3BEUA 5DO4H 1FI8A 2W6ID 1GI2A 4B71A 1P2QA 1KLIH 1QQUA 2SNVA 3UFAA 2BYAX 2IPHA 1H8DH 2VWMA 3OFND 5AFYH 2A0QB 1XXDA 5FPSA 1EQ9A 3M35A 3NRLA 1EZXC 1HJ9A 2PGQB 1Q2WA 1DE7H 1YPHC 1UO6A 1OX1A 1WQSA 2RCEA 1ZHRA 3A7WA 1D6RA 1S82A 4ZKRU 5E0HA 4ZKNU 2FLBH 2NU4E 3FZDA 1NFYA 1BDAA 4A1XA 4U32A 1W8BH 2A4OA 1LKBA 3SGQE 5C0UA 1C2KA 4U01A 1SVPA 4AN7A 1C2EA 2BDYA 2ZGCA 2AGEX 4K8BA 4MNVA 3UPEA 4AB9A 1F7ZA 3F3BA 5GPIB 2ZQ2A 1QB9A 1EP5A 3SI3H 1LHCH 2QGRA 1G37A 1NESE 2Z7FE 1O3DA 3TJUA 1OP8A 1BBRH 4CH2B 1KTSB 1TGTA 2G81E 3MQKC 1GHAF 1AE5A 5C1UA 1OHHD 3U8RH 4JYTA 4I8LA 4BOHA 1QRXA 5EIYA 1HB0B 3KN2A 2QXGA 4IN2A 3EE7A 2QA9E 2G4UA 3A8DA 1ELFA 3KQEA 2LPRA 2WYGA 4YESB 3OEHD 8ESTE 2BXTH 3F68H 5F8ZA 1ZSLA 4ISIH 1QA0A 4XBCA 1C2JA 4O3TA 1PFXC 1BMNH 1ELGA 1C5WB 1O2SA 1Y5AT 2ZFRH 3QGJA 2BD9A 2JETC 3OU0A 3M5NA 1O2UA 5C5NA 4Q63A 5K0HA 5EW2H 2XRCA 3URCA 1V6DA 1OSSA 3S9CA 1AQ7A 3A81A 3F0OA 3P8FA 3RXCA 1FXYA 3OSYA 1OP2A 5ESBA 2V0BA 4CRDA 1WBGB 3UR6A 1Y5UT 2Z94A 2BQWB 1K1LA 3RUOA 3GY7A 4O03A 5F53A 5A0CA 4AYVB 5F8XA 3SZEA 1O2QA 4DT4A 1YLCA 2V7QD 1ANCA 1TNIA 1IQFA 4X2YA 1ZHPA 1O5DH 2R0LA 1C5OH 5LPFA 1IQEA 4CBNA 3SU4A 1EPTB 3HGNA 4GHTA 1GJBB 2ZPSA 4THNH 1OYQA 2P59A 3Q00A 3W1EA 4CRFA 1K1IA 4AOQA 3N7EA 1TX8A 2HLCA 2V6NA 1S84A 3KL6A 1T8OA 4D9RA 2ZDAH 1SGDE 1LMWB 5T6FA 1UTNA 3ELAH 2ANWA 1T8LA 2F9OA 3QZRA 4Y11E 4DG4A 1GPZA 2ZZUH 1O3AA 2Z3CA 1GHYH 1BT7A 3B9FH 1TYNA 2EI7A 1TWXB 3MO9A 5L6NH 1C5TA 1L4ZA 1O3FA 1VITG 4MVNA 1FPCH 3RMNH 3SUDA 2ZHFH 1LHFH 4BAMB 2UUKB 2FOFA 1C5UA 3VEQB 1TX6A 3D49H 3ATKA 1DSTA 2H9HA 5EPNA 1DFPA 1GI8B 3ZVGA 3KIDU 4GVUA 2C3SA 5FHTA 8KME2 4INHA 3ATMA 3E90B 4K1EA 2VVVA 3E3TA 3RMLH 1O3BA 1OWIA 1E37B 2JKHA 2QF4A 5DP9A 2AERH 3PROA 1O3GA 4WJG2 2JJ2D 4I33A 1MTUA 1YKTA 1UVTH 3M7TA 1DWDH 1EAUA 3V3MA 3SNDA 5H4IB 2FLRH 4A1TA 6CHAB 1LKAA 2ZGBH 2OBOA 3PO1B 5AHGH 4YT6H 2ZCLP 3ZZ7A 4BXSA 3TGIE 1FY4A 2XBYA 1BJUA 4MG3A 3U8OH 5KEDA 4M7GA 1MUEB 2A1DB 3T27A 3T25A 5LPEA 3M5LA 3BIUH 2FTLE 4CHAC 1E36B 1P3CA 2I6SA 3M37A 1OS8A 2CHAC 2H9TH 1NRQH 2W7UA 1O35A 2HGTH 1QB1A 1DX5M 1Z1JA 2XYAA 4BAOB 3UNQA 2KX4A 1O32A 2Z6BD 3FP6E 1GMDG 1QJ1B 1SGCA 1UVPA 2GGVB 2Z9JA 4FETA 4ZKSU 3SU3A 1MAYA 2BZAA 4MDSA 2IJOB 1QL7A 4AFZA 2AS9A 2ANKH 1T8NA 1WTHD 1V2OT 4FVBA 1TIOA 5FPTA 2H6MA 2VVUA 1LPZB 1NS3A 1V2JT 3KQDA 2GCHF 3AW0A 1GL1A 1OWKA 1QHRB 3RXOA 1BMFD 4AX9H 1YPHE 3ESTA 3OAAD 1BRBE 1C5YB 1FUJA 4X1NU 1MTVA 1HAHH 1O33A 4JYUH 4UFFH 3A7TA 1SGFG 2PKSB 7ESTE 2STBE 1O2LA 1YPEH 1P8VC 2PV9B 4CRGA 1ZRBA 1CVWH 4UE7H 1TGSZ 3UWIA 1NT1A 3STIA 2BVSH 3I29A 3ZVCA 1W10U 2FZZA 1C2GA 1FONA 4X8UH 3GDUA 3RXHA 2L74A 2IJD1 2XXLA 2XC0A 4U30A 2OTVA 5A8XA 2J2UA 3AW1A 2PHBA 2G5NA 1F0TA 2H1UA 3EAJA 1SGEE 2ZU4A 4OM9A 1QY6A 1O34A 2OINA 2GZ8A 4AB8A 1TRNA 1BQYA 1BRAA 5E2PA 2FI3E 3F1SB 1RTKA 1WYKA 5IYTA 1EZQA 1LVMA 3WW7A 3DFJA 3RXKA 4DVAU 1G36A 2VIWA 1C1WH 2STAE 2O8MA 4Q80A 2AIQA 2SGDE 1RS0A 2P94A 2ZNKH 2J34A 1BJVA 1WXRA 1YLNA 5EJLA 8LPRA 4RKJB 3PLPA 2EY4C 2A2QH 3V0XA 1DY8A 2F9UA 5BPEA 1LPKB 4XDEA 3TPIZ 3O8DA 4RSPA 4I32A 2J97A 2AMPA 5C17A 1NN6A 1C5RA 1MZDA 1KDQB 2F9NA 3LT3A 4X2VA 2CF8H 1CA0C 1TPSA 5EJZA 2ZA5A 5L2ZH 9ESTA 1S6LA 1SLUB 1YBWA 1YP9A 2UWOA 5TJXA 1ELDE 4ABGA 1HIAB 3RXBA 3MO3A 1GMCG 1V2WT 1XUHA 3HATH 1J8AA 1YCPK 3AAVA 2PP6A 2XTTB 2J98A 2PR3A 3M3TA 5FXLA 2R2WU 3U9AH 3BN9A 5FCKA 1ZSKA 1C9TA 1PYTD 3R0FA 3RXUA 1O2KA 2G4TA 5C1YA 1YLDA 2BB4A 1GGDB 3SNBA 1VZQH 1MQ6A 2Q6FA 3UWJH 1B7XB 1A0LA 2OQ5A 1H9IE 3PTNA 1C1VH 1YC0A 3F6UH 4MPVA 1BTZA 3F2GA 3SHCH 3GOVB 4XBBA 4B1TA 5EXNA 1LPGB 1O5CB 4RT0A 5EG4A 2GDEH 3AAUA 3U98H 3RC5A 3E91A 2C90B 1O5AB 2D2DA 2ZEBA 1FLEE 3TJNA 2RDEA 1J9CH 5A09A 1P12E 1XKAC 2OC8A 3GY3A 2AEIH 1T7CA 2XCNA 3BSQA 2OK5A 2CMYA 4B2CA 4H6TA 2XCFA 4TPYA 3E1XB 3PRDA 1TRYA 1Y8TA 3TH2H 4NZQA 4OS2A 1W7XH 3SV9A 1DOJA 2J94A 1L1JA 2BHGA 2VIPA 3GCHB 3F9HA 1C1MA 5DP3A 2BDCA 1ZTJA 1D3PB 2ZU1A 2JIZD 3L6PA 3SV6A 2J92A 1ANDA 1XUIA 1HJAC 5C5OA 1O3JA 1QL8A 1S85A 1T8MA 3MNBA 5GIBA 1ELBA 1TB6H 2G8TA 2L6OA 3U69H 3S0NA 4I7YH 1ETRH 1UVUH 3SV7A 4YTAA 1QFKH 2FTMA 1UTOA 1TGNA 2GTBA 3GISB 4HZHA 4B73A 1AE8H 1WCZA 4NSYA 1E35B 4X8TH 3LGWA 1ZMJA 2P3FH 2HNTC 4XD7D 3ZZAA 1GBFA 1EB1H 5B6LA 4KGAA 1K1OA 3A8BA 4ISNA 3RXMA 3LIWA 1CBWC 4SGBE 4ABHA 2WV9A 5E8EH 4X6OA 1O2OA 1YWUA 1O2VA 1DUEA 2IOTA 2P8OC 1SGIB 1CSOE 2LNCA 2PTNA 2BDAA 1UVSH 3A86A 2HVYB 2BY5X 3TU7H 1H1BA 3GCTG 3ZZDA 2YNBA 1KTTB 1NFWA 1CO7E 1GHBF 3K6ZA 1D3TB 4ABJA 1S83A 1V2QT 2P3UB 3SZNA 3KCGH 3GY6A 1ACBE 2KFWA 3ODFA 3ZZ3A 1EAIA 1C2FA 1SI5H 1A2CH 1VCQA 2ZDVH 4X1SU 1DANH 1RIWC 1ZTLA 5F03A 3E16B 5DP7A 1JOUB 5HMAA 1OWHA 1ZMNA 3GY5A 3P8GA 3PLBA 1CHGA 2FOHA 4GUXA 4MLFB 1A61H 4E7RG 3P92A 4F4OC 4GCHG 1UVOA 3JZ1B 1DVAH 4INLA 1MABB 1PQ8A 3DT0H 3KEEA 2Y5HA 5C1XA 1C5VA 4KP0A 1K0HA 1BOQA 2CGAA 2F83A 2ZIQH 2VNTA 1Q31A 4NGAH 1AFQC 1SGFA 1SLVB 6ESTA 1MU6B 4NA9H 1HAYB 1LHEH 2UWLA 1O37A 1BHXF 1LVOA 2PKAA 1XUKA 3MYWA 4CREA 4DURA 1UHBB 2EI8A 4IMZA 4B2BA 2BD3A 5GXPA 1FIZA 2FEQH 5KGOA 4AG1A 3HKIB 4TYDA 2UUFB 2HALA 3UTUH 1E1QD 1GJ4H 3EDXB 4D76A 2HLDD 4YOGA 3MU5A 2XW9A 1BHXB 1DS2E 2RFKC 3RMMH 1FMGA 1JIRA 2Z3DA 4INKA 3MH5A 1HAPH 1GCTB 2ZDLA 4MPWA 4X0WU 2QV1A 3JZ2B 2O8TA 1WU1A 1P02A 3VXEH 3ZIAD 3OX7U 1HPGA 3SORA 1GJ6A 1K1JA 1G30B 2WPMS 2LP6A 4ZH8A 5GCHF 2PW8H 3TITA 3A7YA 1K1NA 1A0JA 1NBMD 1VITH 1C5LH 2BY9X 1GDUA 1FQ3A 1L0ZA 2Y82A 1JMOH 1HRTH 3SQEE 3V13A 1GBDA 1ORFA 3TH4H 4TWYA 3VB3A 4LZ1H 2O8UA 1FAXA 1XVOA 2F3CE 2SGAA 3M7QA 3STJA 1IQNA 4NWKA 1HXEH 3V12A 1JIMA 1A0HB 1GMHG 3SJ8A 3UNSA 5JYIA 1DUAA 1XUFA 3O8BA 1FY1A 3LC3A 3TNTA 2KAIB 4AZ2B 3B8JA 1IHTH 1O3OA 1TNJA 5PTPA 2GV7A 3EA8A 3SGBE 6GCHG 3LGVA 2A7CA 4UFGH 1IOEA 3MU8A 2AIPA 1Y3VA 7LPRA 1XMNB 3NWUA 3PLKA 3I78A 4FU7A 2ZG0H 2AMQA 4BANB 1A5IA 1O3NA 1HCGA 1GBLA 1V2ST 1P2NA 2W3IA 5EXMA 1UK2A 4BXWA 3Q76A 2ODYB 4ZXXH 2ZTYA 4ZKOU 3SNEA 1TE0A 1N6YA 1Y3UA 2DE8A 1TBZH 1SB1H 4Y8ZA 2WSSD 1S5SA 3LC5A 1PPZA 1ESAA 3MNSA 1AHTH 2XC4A 1O3HA 1GG6B 1QNJA 3QWCH 5EJ1A 1FJSA 1BBRK 3A85A 2DUCA 1O3MA 1O3LA 1YPKH 2GT8A 2PGBB 5EODA 1W0JD 4JZDH 5JB8S 1O5BB 3RDZA 1L4DA 4B76A 1HV7A 1DXWA 5EPYA 1TABE 4LOYH 2GCTB 3KQCA 4B2AA 5F6MA 1GBMA 2Y5FA 4Y7BA 5CHAB 2QC2A 2R0KA 1FNIA 1A3EH 3R3GB 5DP4A 1RFNA 4X8VH 1O5FH 1O30A 1ZTKA 1EPTC 1P10A 1SGYE 5T3HA 4OS7A 4DY7B 1K22H 2HNTE 1ESTA 4NFFA 2VIQA 2ULLA 3SI4H 2R3UA 1W12U 1L1GA 1TBQH 2BX4A 4JZ1A 1GJ9B 1PPCE 1W3CA 2UUYA 1UCYE 3OY6U 8GCHG 1HXFH 1GI5A 1GJAB 3UIRA 1W2KH 1XX9A 2OCVB 4TWWA 1P05A 1GBTA 1BMLA 4MTBA 2BD8A 3LH3A 5DJ7A 5L30H 1A5HA 1RTFB 1YPJH 2ZGJA 1S6HA 2Y5GA 1EB2A 3UY9A 5A8ZA 3LDXH 1AUJA 3VXFH 2FOBA 1W0YH 5E0GA 1DT2A 2PFEA 1O2TA 3A7ZA 1FV9A 4Y7AA 2H9EH 3W95A 3BIVH 2J4IA 1C2MA 2KCPA 1C5MD 1ZJDA 5ABWA 2ZI2H 2NU0E 3CENA 6CHAC 1TMBH 2A31A 3T2NA 3PO1C 4DIIH 2F9VA 3FVFB 1UTMA 2XBVA 5ESTE 4PROA 1YCPM 2XWAA 3Q3XA 3AASA 3KGPA 1NO9H 2FI5E 1O2MA 1V2LT 2RA0A 3SJ9A 3RU4T 4HFPB 3UUZA 3O8CA 1ABJH 2C8ZB 1P9SA 4Y10E 1BTUA 3IITA 1QTFA 3A7XA 2F9BH 5CDFE 3B23B 3RXJA 5DK1A 1D3QB 1EZUC 1SQTA 3TJOA 1D4PB 1UW7A 1AY6H 1WAYB 4B6EA 1O3EA 2ZHWH 3E6PH 1HAVA 4NIVA 1LVBA 2A45B 1O2NA 1CU1A 4BTTB 3L3TA 1A4WH 3BTWE 1WDIA 3RXVA 4DW2U 1BTPA 1GDNA 1Z6EA 1THRH 7GCHF 3M7UA 3U1JB 3S9AA 3SJKA 3QO6A 4BAQB 5GJ4B 1NU9A 3MNCA 2ZCKP 2BD5A 2M5TA 1PQ7A 1VGCB 1Z8RA 5DP6A 1GL0E 3RXDA 2PKSC 1FPHH 1C1OA 5B6OA 1TX7A 2VU8E 2WHXA 1SC8U 3RXIA 3LGYA 2EQNA 3SUFA 5DKMA 4CR5A 1CHOG 3RXEA 4I8JA 1TOMH 3A8CA 3PWCA 5EU8A 4ABIA 2FDAA 1D9IA 4FUHA 3DA9B 3MNXA 4NIWA 2YMSD 1ZYOA 1YPMH 1YPGH 2BDIA 2O8LA 1ZHMA 3GDVA 1GJDB 1V2UT 4YT7H 1GDQA 1V2RT 1P2IA 2QF3A 2ZU3A 1C5XB 1TQ7B 1V2PT 2GP9B 2GT7A 3VGCB 1AIXH 2WV4A 4KTSA 1A5GH 1XXFA 3AK5A 1SFQB 3PM3A 1OP0A 1P2OA 2NU2E 1XUGA 2BDBA 4ZMAH 1CQQA 1Y3YA 2VH0A 2R9PA 3FO8D 3P8NA 4WMDA 5TCAA 1T32A 1O2XA 5JDUB 1BUIA 2QY0B 2HOBA 1TPAE 3VB7A 3A7VA 4I8GA 1MKWH 1H8IH 1MZAA 4FUBA 3UR9A 3FAOA 2WUBA 3HK3B 3PMHB 4UEHH 4WXVA 4YO9A 1O2GH 4UDWH 3MTYA 2BQ6B 3MH7A 5KECA 1GHXH 4H42U 3SOSA 2BY6X 2FP7B 3GY4A 4IN1A 4ACAA 3ZZ6A 2GX4A 1EXFA 3SUEA 1K9OE 4X1RU 1SKYE 2ZDKA 3H7OA 3PMBB 4YXWD 2ZDNA 2B5TB 3LPRA 5A8YA 2R3YA 4CHAB 2G52A 2ODPA 3H7TA 4ZHMU 1BTWA 1NPMA 2BY8X 3UNRA 2A4QA 3RXLA 1ELEE 2FX4A 2AYWA 2J9NA 1V2MT 1O5GH 4WH8A 4XSKU 1X7AC 1ID5H 1ETTH 1J17T 2K8IA 1GHVH 5GCHG 2Y6TA 1S81A 1WUNH 1G3DA 2C8XB 1ZRKA 2HWLB 4NA8A 5FCRA 4F48B 3A87A 3PMJA 4CRBA 1LQEA 4J2YB 1BB0B 1SLXB 1GHWH 3NZIA 1GBKA 4U2WA 1E0FD 4HTCH 5G4BA 1GGDC 1TPOA 1XKBC 3OE7D 5AF9H 2G5VA 4DGJA 3A84A 1VR1H 2ZECA 4Q7XA 1IQKA 1O2JA 4K1TA 1C1PA 1NC6A 1F0RA 1MKXK 4B74A 5JBAS 2A4RA 3SNAA 2ASUB 1UK4A 1WOFA 2Q6GA 2WINI 2RDLA 5C0TA 1AZZA 5BRRE 4FU8A 1RTLA 1MKXH 2ZFTA 2Y7ZA 2VWOA 2WYJA 1AI8H 1SHYA 1HFDA 2BLVA 3ZVFA 1TNGA 2UWPA 2VIVA 4TY7A 1NRRH 4CRAA 3ZZ9A 2FI4E 2FX6A 4UFDH 3T28A 1CT0E 1GBBA 3DSPA 4FOUC 1NY22 2Y80A 2KCOA 2OXSA 3QTVH 3ZVAA 3CS7A 4ABBA 1Y59T 2FIRH 4XFQA 1LCYA 2EEKA 1Z6JH 2GKVE 3M3SA 3MH4A 3GCHC 1ZMLA 2UUJB 1PPEE 1AO5A 5C2ZA 2CK3D 1DWEH 5C20A 1LDTT 1GHAG 1UTQA 2V35A 1ZSJA 1TGBA 4Y0ZE 4O3UA 2OD3B 4Y6DA 1WTGH 1SSXA 1ELTA 1NM6A 2FOCA 1FN8A 3FP7E 4WWYA 4IC6A 1CGIE 1DWCH 1DLEA 2FODA 3DHKH 4ABEA 2J98B 3PV5A 4Q7ZA 1TRMA 3P70B 3GYLB 1F0SA 1LQDB 4TY6A 3ZVBA 1O38A 5HYOA 4FUCA 2ZU5A 3RLWH 4JYVH 4KKDA 3UREA 1F92A 4AFSA 4MNYA 2ZTZA 2SFAA 5GNDA 1W11U 1SFIA 2AGIX 2BTCE 3BG4B 4ASHA 4I86A 4K2YA 1AKSA 1O3KA 4NZLA 2OQUA 5CHBA 4LXBH 1P06A 2WPDD 2ZWLH 1WSSH 3FANA 3LKWA 3RP2A 3NCLA 4X6MA 1KXFA 4BTIB 2F43B 2VGCB 2VVCA 3ENSB 3FFGA 3SU0A 3VB4A 4YM9A 1RRKA 2W5EA 1EOJA 2CJIA 3KHVA 3MU1A 4MNWA 1O3IA 2GJGA 4KTCA 1KLTA 3Q77A 2GZ7A 2FMJA 2BLWA 3TNSA 4OS1A 4A5TS 1C2DA 4AG2A 3UQVA 2D26C 1GVZA 3S9BA 1P2KA 1P01A 2QE7D 2ESTE 3QX5H 4JCNA 3A82A 5DN6D 2TGTA 1C1SA 3MFJA 1EJAA 4CH8B 2SGEE 2SGPE 4Y71A 1IQLA 1VITF 1QJ6B 2ALVA 2ZPQA 3MU4A 1KMHB 1O3CA 1SBWA 1P04A 1Z71A 1ZPZA 1TAWA 1TGCA 3H5CB 2IN2A 1GI1A 1F5LA 4K3JA 1XM1A 1T4VH 1RXPA 2EA3A 1FN6A 1QCPA 1GBEA 5AFZH 1AKSB 5T1VA 3BTQE 2GMTB 1KXEA 2FESH 3E0NB 1N1LA 2ZHDA 3MMGA 3TGJE 1HNEE 1NRNH 2KZ4A 1NTPA 1K1MA 1KXCA 1GHZA 2BXUH 4CR9A 2G00A 1ESBA 1B5GH 1H9HE 2P93A 2FS8A 3M36A 1TNLA 2YOLA 4IBLH 3IG6B 3N7OA 1HAGE 5EQQA 2OLGA 3HPTB 4GLYA 2QCYA 3HGPA 5J4QA 1NRPH 4X2XA 1MTSA 3VB6A 4AYYB 3BTKE 1GI9B 3KQ5A 2PUQH 2WPHS 1DDJA 3BG8A 2OC0A 1OWEA 4K60A 3URDA 3EE0B 3S7HB 3C27B 1P0SH 3QDZB 4E7NA 1AVXA 1GCTC 4K8YA 4XBDA 1KIGH 5T6DA 2QN5T 4Z6AH 1C2IA 1W14U 2SGQE 1C4U2 5T6GA 3RU4E 1GBHA 2AHME 1AZ8A 3RM0H 1OYTH 2A7JA 4GHQA 2ZU2A 1NFUA 1COWD 1QRZA 3MHWU 1THPB 1P09A 3N99A 3UOPA 3MU0A 4WY3A 2QF0A 1F0UA 3SJOA 2AGGX 1K1PA 3TH3H 2LELA 3EGKH 1GMDF 5IK2D 1HDTH 3ATWA 2BY7X 2OBQA 1ANEA 2A7HA 1W13U 5A2MH 3SU6A 2G51A 4X2WA 1YGCH 1BIOA 1SQAA 4NG9H 1G9IE 3N7DA 5DPAA 3DFLA 4GAWA 4WVPE 2H5CA 5SGAE 4DT7B 3NPSA 4JK6A 4BNRA 4YOJA 2KM0A 2Z3EA 4HG6A 2WZQA 2FS9A 3LJOA 1P2JA 2NWNA 3FKSD 4JK5A 3SYJA 1TMUH 3H09A 4A7IB 1VKYA 1LVYA 3ZYEA 1PPBH 2BVXH 4VGCB 3O8RA 2F9PA 1N8OB 1SGNE 3G01A 3Q3KA 2AH4X 2GCHG 4MQAA 5L2YH 1EOLA 1ABIH 1G2LA 3E8LA 2ZO3H 1VJ9U 3PV4A 5C3NA 3NK8A 1NFXA 2TGDA 2CN0H 3F2FA 3ZZ8A 4AFUA 1EFRD 3TLOA 1E34B 1P03A 2ZFPH 4X1PU 1FAKH 3LGIA 4AGJA 2V3OH 2PKAB 4JZIA 2PSYA 1DXPA 2WUCA 1Y3WA 1O2HA 2XNDD 3CP7A 1CT4E 3SQHE 3RXFA 3DCLA 5CMXH 4FUDA 2BD4A 1FIWA 1N6XA 1SOTA 5FX6A 3TGKE 2B9LA 1GG6C 3A89A 3BTME 4H6SB 1MD7A 1ELCA 2GDDA 2VIOA 1NBME 4RN6A 2THFB 4K5ZA 3K9XB 2BDHA 4WH6A 3F9GA 1HAIH 1UJ1A 2FXRA 5ETXA 2XC5A 4FVDA 5C67A 1EJNA 1YM0A 2ILNA 3BV9B 3IWMA 2GCTC 1OWJA 3SUGA 1BTYA 1VCWA 3RC4A 1KSNA 5CHAC 2VBCA 2K1QA 5JB9S 1ELAA 2Q1JA 1UTPA 3KNXA 1PPFE 1DICA 1XVMA 1UCYK 4HGCA 4AFQA 2OUAA 2FOMB 1EUFA 1PPGE 1GBAA 1RGQA 1OWDA 1ZR0A 2Y7XA 4ISLA 3DUXH 1KXAA 4X8SH 1AGJA 3QUMP 1S0QA 7KMEH 1UCYH 2HRVA 4IW4E 1BA8B 3QLPH 1MTNB 5GDSH 3BTFE 3MI4A 3ZZ4A 1AB9B 1D3DB 1GMCF 1QBNA 1O39A 1M9UA 4WXIA 9LPRA 1O36A 4K1SA 1KLJH 1SQRA 1QZ8A 2BOHB 4GPGA 3ZVEA 3K65B 4ABDA 5A0AE 1B0FA 2XOKD 5FBEA 2Z9KA 3LGUA 3P95A 1C1TA 2YMSB 1UTKA 1KY9A 1LHDH 1EAWA 5LPRA 1HLTH 2ZHEH 4Z1MD 3A80A 4NFEA
chains in the Genus database with same CATH topology
1ZOMA 4NWLA 1O2RA 3QZQA 4X1QU 2VB0A 2QIQA 1J14A 1HAZB 1LHGH 5FPYA 5J4SA 1ZGVA 2J95A 3ODDA 1SL3A 4BTUB 2FPZA 4CRCA 1C4V2 2TIOA 4J1YA 4X6NA 3P17H 1MCVA 2WPLS 1MH0A 1EPTA 1PQ5A 1O2YA 2ZFSA 4O97A 4R0IA 1LTOA 3TK5A 4HI3A 2BOKA 1QRWA 2PTCE 3M5MA 1RJXB 1K28D 1TQ0B 3HKJB 2NU1E 3PB1E 4D7FA 4ZXYH 5HM2A 1HAXB 2TGPZ 2BVRH 1V3XA 3P6ZB 3RXGA 5I25A 4YLUA 2FM2A 2SGFE 5JBCS 2HPQH 2BZ6H 1GWAA 3V7TA 3S69A 1CT2E 2FWWA 3QN7A 3SU2A 3CS0A 4MPXA 2QXJA 1ZGIA 3TK9A 3LOXA 1LO6A 4OGXA 3SU1A 1F5KU 1J15A 1HBTH 1BBRE 4ZROA 4A6LA 4A92A 1C5NH 4DJZB 3M61U 2XBXA 2RA3A 3Q3YA 4TPIZ 4Q7YA 1AVWA 1C5ZB 1OXGA 5EXLA 3MO6A 3LH1A 1PYTC 1VGCC 1SMFE 3TJVA 2FO9A 1P11E 1JRTA 2BD7A 5A0BA 1IQMA 2JETB 3NXPA 2ZDMA 2NU3E 2XBWA 4UONA 4OS5A 2A5KA 1AWFH 1MQ5A 4NCYA 2PLXA 1ZZZA 1TA6A 2RG3A 4YOIA 2BLOA 1GJCB 3RC6A 1B0EA 2ALPA 1HJ8A 1TONA 4FUEA 4I31A 1CA8B 1QJ7B 1MAXA 4IS5A 2O8WA 1DPOA 3GCTF 1C2LA 2J38A 3OYPA 2ZFQH 3SV2H 3VGCC 3A88A 1GBIA 1GI0A 1SOZA 1GJ8B 3ITIA 1O3PB 2DE9A 2FYRA 4AGKA 2FOAA 3PYHA 3LJJA 1KXDA 1ARCA 1F2SE 1GJ5H 3U1IB 1MMJN 1QURH 1ARBA 1GHBG 1O0DH 4UFEH 1S6FA 3DD2H 1FY5A 1PQAA 1V2KT 3SNCA 2F91A 2D8WA 4Y79A 1W7GH 2ZGXH 3F9FA 2ZTXA 2GD4B 4GCHF 2V3HH 3ZV9A 5EGMA 3W94A 1BTXA 1TFXA 3P8OA 1BMMH 3A83A 1BMAA 4FUIA 1P9UA 1GCDA 5EOKA 2CF9H 2W7SA 1VJAU 2OP9A 1HGTH 3ATLA 2FYQA 3QTOH 1HAVB 1G3EA 1HYLA 1BRCE 4FUGA 1UTLM 1VCPA 1DWBH 2C93B 2SNWA 2Z9LA 3F9EA 5JPMH 1Z8JB 2PUXB 1QIXB 5FX5A 3RXAA 1MKWK 3TVJB 1PJPA 1DITH 1C5PA 1IQHA 2ZPRA 1Z8GA 3GYMA 2HVXA 4DIHH 2BDGA 3SHAH 1TBRH 2A5AA 1MCTA 1EJMA 2ZP0H 1AVGH 1SGQE 4NIXA 1AFEH 3I77A 1G2MA 3OY5U 1ZLRA 3D62A 2WPIS 2FOEA 3EA9A 4XOJA 1HAOH 5AVDA 2BD2A 4DCDA 1QB6A 3VFEA 1QR3E 1SPJA 5HGGA 4FXGH 2WPKS 4ISHH 2GVFA 1TOCB 2YNAA 1QBOA 3FZZA 4LZ4B 2QXHA 1QBVH 2R2MB 2CHAB 1DLKB 1XUJA 1F5RA 4WMFA 3PWBA 3RXTA 1FY8E 4I8KA 2ODQA 4ISOA 2TGAA 2O9QA 1AD8H 3MWIU 4OS6A 1QA7A 4FU9A 1CGHA 5HXFA 1PPHE 1KDQA 1OPHB 1V2TT 3EQ0H 2P3TB 1GMHF 3FP8E 2ZHQH 4Y8XA 5FAHA 1Q3XA 3D23A 2ANMH 1DSUA 3BEFB 5E0JA 5HM9A 1BCUH 4JZFH 1O2ZA 2VJ1A 3UQOA 3T26A 2BMGB 6GCHF 1FDPA 1HIAA 1OOKB 4XE4A 4IC5A 4MNXA 2EI6A 1ANBA 5E2OA 3RLYH 3NUMA 3ZYDA 3T62A 1RD3B 1GVKB 2B0FA 2XWBI 1SGPE 1H4WA 1GI7B 2H5DA 1GI3A 1GBCA 1TPPA 1C1NA 1O31A 4FUJA 3BTDE 1TLDA 3ZZBA 3K2UA 1C5SA 1KYNA 3LGTA 4FUFA 3PTBA 1AWHB 1HUTH 4ABAA 1BZXE 2CV3A 1IHSH 3GY2A 3VB5A 4YLQH 1FY3A 2Z9GA 3BF6H 2B7DH 3HK6B 4KTUA 2Y81A 1WQVH 1JBUH 2VH6A 3QK1A 1C1QA 4OS4A 4D7GA 1C2HA 3WY8A 1GJ7B 4H4FA 2ZKSA 4X6PA 2TPIZ 1INCA 1UK3A 2AMDA 2QXIA 4BAHB 2D1JA 4UD9H 3RM2H 1C4Y2 3BG4C 1IQIA 1P2MA 4BAKB 1Y5BT 4O9VA 1EX3A 1GI6A 5CE1A 3RXSA 2I6QA 1MD8A 4KELA 4SGAE 6LPRA 1MBQA 1E38B 1YCPH 3SU5A 3BTHE 1JWTA 1QGFA 2VGCC 3MH6A 1CE5A 3U8TH 2VINA 3GDSA 2VWNA 3TK6A 4ESTE 5K7RA 4NIYA 1CA0B 8GCHF 4Y76A 3S7KB 2QYIA 3SN8A 5EQRA 1ETSH 2ZC9H 1TALA 1GVLA 1AN1E 2BM2A 2P95A 1EZSC 1IAUA 4WMEA 4JZEH 2TRMA 2P16A 2AFQB 2Z9IA 1NU7B 3ZVDA 1OKXA 4LK4A 1SR5C 2GMTC 1SQOA 1P3EA 2WV5A 4ABFA 1EASA 3BTEE 3QGNB 5JBTA 1FZZA 2PWXA 2BLQA 1EP6A 2ZCHP 4Y0YE 1A3BH 1O2IA 2A2XH 2C8YB 1J16A 4Z0KA 2ZGHA 1U6QA 3OTJE 1UMAH 1A1RA 2JH5D 5FBIA 2CXVA 2JH0D 1L2EA 1BTHH 1O2WA 1KXBA 3RMOH 2HPPH 5DP5A 1A7SA 5IDKA 1NZQH 4D9QA 2W26A 4ZAEA 3SO3A 4IGDA 1GBJA 5TCCA 4F49A 1ZPBA 2H2ZA 1T31A 3KF2A 3D65E 1TA2A 4D8NA 2A5IA 1V2NT 3GCOA 1ZPCA 2BX3A 1W0ZU 3M3VA 4ZHLU 5LGOA 4Y8YA 2A32A 1K21H 3ZV8A 4RKOB 4NA7A 3M5OA 5F8TA 1NRSH 1NROH 1EATA 1BRUP 1MTWA 2ZQ1A 4GSOA 1G3CA 1YF4A 3K6YA 4MPUA 1HJAB 3GY8A 1QL9A 2W3KA 5I46H 4QT8C 1QQ4A 2HNTF 1GI4A 3ZZ5A 3EA7A 1TNKA 4VGCC 2OC7A 2QAAA 1UTJA 1N8OC 1G32B 1L1NA 7GCHG 2BQ7B 4ZUHA 2TBSA 3KQBA 1UHBA 1CHOF 3GICB 3RU4D 3E0PB 5LH8A 1WV7H 2Q6DA 3NKKA 5DGJA 2G55A 3VPKA 1Z1IA 4E06H 1O2PA 1ZJKA 1TMTH 3UOUA 2VIDA 1JRSA 1THSH 1C9PA 4R8TB 1CBWB 3ATIA 2C8WB 1AU8A 5JBBS 1EAXA 1G3BA 2P8OB 1AMHA 2ZFFH 3BTTE 4NSVA 5EQSA 1SG8B 1SGTA 4YZUA 2A4GA 5GWZA 1EKBB 1P57B 3BTGE 3SJIA 1H9LB 2JH6D 2GZ9A 1SLWB 3SW2B 3GCNA 4WF8A 1C1UH 2B8OH 2OC1A 1Z8IB 1YYY1 1MU8B 4IMQA 4DOQA 2C4FH 4K69A 4CBOA 2FOGA 1RIWB 2ZF0H 2XNIA 3C1KA 1IQJA 1A46H 3RXPA 1CGJE 1Y3XA 3A8AA 1AUTC 4I8HA 5DP8A 3BEIB 1JXPA 2ANYA 2GV6A 1IQGA 4JMYA 3LONA 4B75A 1D6WA 3RXQA 2KAIA 2PSXA 4A1VA 1SGRE 3TIUA 5EW1H 3L33A 1O5EH 3RXRA 1ELVA 3EYDA 3SV8A 1MTNC 4AORA 1Z7KA 3MOCA 3ZZCA 1BITA 1AFQB 1V2VT 1AB9C 1C1RA 3T5FH 4OGYA 5DG6A 1YPLH 3SBKA 4E05H 1TNHA 4Q2KA 1DY9A 4ZHAA 2EC9H 1T4UH 3PMAB 3AVZA 3T29A 1DM4B 1S0RA 1C5QA 1SHHB 3SGAE 2VWLA 3LU9B 1MBMA 2WPJS 1K2I1 3BEUA 5DO4H 1FI8A 1GI2A 4B71A 1P2QA 1KLIH 1QQUA 2SNVA 3UFAA 2BYAX 2IPHA 1H8DH 2VWMA 5AFYH 2A0QB 1XXDA 5FPSA 1EQ9A 3M35A 1EZXC 1HJ9A 2PGQB 1Q2WA 1DE7H 1YPHC 1UO6A 1OX1A 1WQSA 2RCEA 1ZHRA 3A7WA 1D6RA 1S82A 4ZKRU 5E0HA 4ZKNU 2FLBH 2NU4E 3FZDA 1NFYA 1BDAA 4A1XA 4U32A 1W8BH 2A4OA 1LKBA 3SGQE 1C2KA 4U01A 1SVPA 4AN7A 1C2EA 2BDYA 2ZGCA 2AGEX 4K8BA 4MNVA 3UPEA 4AB9A 1F7ZA 5GPIB 2ZQ2A 1QB9A 1EP5A 3SI3H 1LHCH 2QGRA 1G37A 1NESE 2Z7FE 1O3DA 3TJUA 1OP8A 1BBRH 4CH2B 1KTSB 1TGTA 2G81E 1GHAF 1AE5A 5C1UA 3U8RH 4JYTA 4I8LA 4BOHA 1QRXA 1HB0B 3KN2A 2QXGA 4IN2A 2QA9E 2G4UA 3A8DA 1ELFA 3KQEA 2LPRA 2WYGA 4YESB 8ESTE 2BXTH 3F68H 5F8ZA 1ZSLA 4ISIH 1QA0A 4XBCA 1C2JA 4O3TA 1PFXC 1BMNH 1ELGA 1C5WB 1O2SA 1Y5AT 2ZFRH 3QGJA 2BD9A 2JETC 3OU0A 3M5NA 1O2UA 5C5NA 5K0HA 5EW2H 2XRCA 3URCA 1V6DA 1OSSA 3S9CA 1AQ7A 3A81A 3P8FA 3RXCA 1FXYA 3OSYA 1OP2A 5ESBA 2V0BA 4CRDA 1WBGB 3UR6A 1Y5UT 2Z94A 2BQWB 1K1LA 3RUOA 3GY7A 4O03A 5A0CA 4AYVB 5F8XA 1O2QA 1YLCA 1ANCA 1TNIA 1IQFA 4X2YA 1ZHPA 1O5DH 2R0LA 1C5OH 5LPFA 1IQEA 4CBNA 3SU4A 1EPTB 3HGNA 4GHTA 1GJBB 2ZPSA 4THNH 1OYQA 2P59A 3Q00A 4CRFA 1K1IA 4AOQA 1TX8A 2HLCA 2V6NA 1S84A 3KL6A 1T8OA 4D9RA 2ZDAH 1SGDE 1LMWB 5T6FA 1UTNA 3ELAH 2ANWA 1T8LA 2F9OA 3QZRA 4Y11E 4DG4A 1GPZA 2ZZUH 1O3AA 2Z3CA 1GHYH 1BT7A 3B9FH 1TYNA 2EI7A 1TWXB 3MO9A 5L6NH 1C5TA 1L4ZA 1O3FA 1VITG 4MVNA 1FPCH 3RMNH 3SUDA 2ZHFH 1LHFH 4BAMB 2UUKB 2FOFA 1C5UA 3VEQB 1TX6A 3D49H 3ATKA 1DSTA 2H9HA 5EPNA 1DFPA 1GI8B 3ZVGA 3KIDU 4GVUA 2C3SA 5FHTA 8KME2 4INHA 3ATMA 3E90B 4K1EA 2VVVA 3E3TA 3RMLH 1O3BA 1OWIA 1E37B 2JKHA 5DP9A 2AERH 3PROA 1O3GA 4WJG2 4I33A 1MTUA 1YKTA 1UVTH 3M7TA 1DWDH 1EAUA 3V3MA 3SNDA 5H4IB 2FLRH 4A1TA 6CHAB 1LKAA 2ZGBH 2OBOA 3PO1B 5AHGH 4YT6H 2ZCLP 3ZZ7A 4BXSA 3TGIE 1FY4A 2XBYA 1BJUA 4MG3A 3U8OH 4M7GA 1MUEB 2A1DB 3T27A 3T25A 5LPEA 3M5LA 3BIUH 2FTLE 4CHAC 1E36B 1P3CA 2I6SA 3M37A 1OS8A 2CHAC 2H9TH 1NRQH 2W7UA 1O35A 2HGTH 1QB1A 1DX5M 1Z1JA 2XYAA 4BAOB 3UNQA 1O32A 2Z6BD 3FP6E 1GMDG 1QJ1B 1SGCA 1UVPA 2GGVB 2Z9JA 4ZKSU 3SU3A 1MAYA 2BZAA 4MDSA 2IJOB 1QL7A 4AFZA 2AS9A 2ANKH 1T8NA 1WTHD 1V2OT 4FVBA 1TIOA 5FPTA 2H6MA 2VVUA 1LPZB 1NS3A 1V2JT 3KQDA 2GCHF 3AW0A 1GL1A 1OWKA 1QHRB 3RXOA 4AX9H 1YPHE 3ESTA 1BRBE 1C5YB 1FUJA 4X1NU 1MTVA 1HAHH 1O33A 4JYUH 4UFFH 3A7TA 1SGFG 2PKSB 7ESTE 2STBE 1O2LA 1YPEH 1P8VC 2PV9B 4CRGA 1ZRBA 1CVWH 4UE7H 1TGSZ 3UWIA 1NT1A 3STIA 2BVSH 3I29A 3ZVCA 1W10U 2FZZA 1C2GA 1FONA 4X8UH 3GDUA 3RXHA 2XXLA 2XC0A 4U30A 2OTVA 5A8XA 2J2UA 3AW1A 2PHBA 2G5NA 1F0TA 2H1UA 3EAJA 1SGEE 2ZU4A 1QY6A 1O34A 2OINA 2GZ8A 4AB8A 1TRNA 1BQYA 1BRAA 5E2PA 2FI3E 3F1SB 1RTKA 1WYKA 5IYTA 1EZQA 1LVMA 3DFJA 3RXKA 4DVAU 1G36A 2VIWA 1C1WH 2STAE 2O8MA 4Q80A 2AIQA 2SGDE 1RS0A 2P94A 2ZNKH 2J34A 1BJVA 8LPRA 4RKJB 3PLPA 2A2QH 3V0XA 1DY8A 2F9UA 5BPEA 1LPKB 4XDEA 3TPIZ 3O8DA 4RSPA 4I32A 2AMPA 1NN6A 1C5RA 1MZDA 1KDQB 2F9NA 3LT3A 4X2VA 2CF8H 1CA0C 1TPSA 2ZA5A 5L2ZH 9ESTA 1SLUB 1YBWA 1YP9A 2UWOA 5TJXA 1ELDE 4ABGA 1HIAB 3RXBA 3MO3A 1GMCG 1V2WT 1XUHA 3HATH 1J8AA 1YCPK 3AAVA 2XTTB 2PR3A 3M3TA 5FXLA 2R2WU 3U9AH 3BN9A 5FCKA 1ZSKA 1C9TA 1PYTD 3R0FA 3RXUA 1O2KA 2G4TA 5C1YA 1YLDA 2BB4A 1GGDB 3SNBA 1VZQH 1MQ6A 2Q6FA 3UWJH 1B7XB 1A0LA 2OQ5A 1H9IE 3PTNA 1C1VH 1YC0A 3F6UH 4MPVA 1BTZA 3SHCH 3GOVB 4XBBA 4B1TA 5EXNA 1LPGB 1O5CB 5EG4A 2GDEH 3AAUA 3U98H 3RC5A 3E91A 2C90B 1O5AB 2D2DA 2ZEBA 1FLEE 3TJNA 1J9CH 5A09A 1P12E 1XKAC 2OC8A 3GY3A 2AEIH 1T7CA 2XCNA 3BSQA 4B2CA 2CMYA 4H6TA 2XCFA 4TPYA 3E1XB 1TRYA 1Y8TA 3TH2H 4NZQA 4OS2A 1W7XH 3SV9A