5F8ZA

The crystal structure of human plasma kallikrein in complex with its peptide inhibitor pkalin-1
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
239
structure length
239
Chain Sequence
IVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQAPLNYTEFQKPISLPSKGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEECQKRYQDYKITQRMVCAGYKEGGKDACKGDSGGPLVCKHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDWILEKTQSSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase-hydrolase inhibitor
molecule keywords Plasma kallikrein LIGHT CHAIN
publication title The crystal structure of human Plasma Kallikrein in complex with its peptide inhibitor pkalin-1
rcsb
source organism Homo sapiens
total genus 54
structure length 239
sequence length 239
ec nomenclature ec 3.4.21.34: Plasma kallikrein.
pdb deposition date 2015-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5f8zA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5f8zA01
1HNEE 1GVZA 2J94A 1Q31A 3ZZBA 3MHWU 1E35B 3O8DA 1GI7B 3RU4E 1P2QA 5K0HA 4NWLA 2VIQA 1TRYA 3AASA 5EXMA 3TVJB 1C1PA 1MBMA 3NUMA 4IW4E 1MAYA 3QK1A 2QCYA 3RU4D 1O2UA 4TPIZ 2A4RA 1BA8B 3LIWA 4ISOA 1HGTH 4Y0ZE 4CRBA 2QC2A 1EAXA 3SNAA 2O9QA 5C1YA 4AN7A 2VINA 2FOGA 1LHFH 5DG6A 4K8YA 1SPJA 1C1OA 1V2ST 3SGAE 1AE5A 3ZVFA 2FTMA 2G4UA 1L4DA 1PPHE 3BIUH 4NFEA 1C2DA 4LOYH 3M3VA 1TQ0B 1LPZB 2OCVB 1QJ6B 4BTIB 1ELTA 1UTLM 2J34A 2ZCHP 3DHKH 3T25A 3KQEA 1XUIA 2FOHA 2RCEA 3A8CA 4NIWA 2BY6X 1UCYK 4THNH 2BDIA 1O3FA 1GBEA 2Q6FA 2XRCA 3A7ZA 1O3HA 3PTBA 3BN9A 1PYTD 2FI5E 1GI8B 3RXTA 4INKA 3RXHA 1AB9B 3TITA 1THSH 1AVWA 1C2IA 4OGYA 1SR5C 2C8ZB 1ANBA 4I8KA 1UK4A 1EOLA 2A0QB 4I8LA 1MKXH 2O8LA 2BDBA 4AFZA 2WPKS 2BLQA 3I78A 3BTWE 1GGDC 4A1VA 4U01A 2ZDNA 4ABDA 5FPSA 2UUYA 1LCYA 2ZHWH 1A46H 2VIWA 3ZZ9A 4MNWA 3GYMA 4O3UA 1BMMH 1QA7A 3RM0H 3NPSA 3RMMH 2OC0A 1NT1A 3S9BA 1SLVB 3V7TA 3SHCH 1O38A 3FP7E 2GDEH 4ZROA 1UVPA 4ABEA 3ZZAA 2ZGHA 4MPUA 1YC0A 3B23B 3P92A 4H4FA 2V3OH 5FBEA 4K2YA 1V2OT 2Q6DA 2QIQA 2OLGA 2AGGX 1BIOA 1KLIH 1NU7B 1O5AB 1LVOA 3C27B 1SG8B 3IG6B 3SNBA 1FDPA 3A84A 1G2LA 2Z9LA 1P02A 3LGUA 1E38B 4ABBA 5FXLA 1SMFE 1FONA 1A61H 1O2NA 1YPEH 3A87A 2Q6GA 2D2DA 3ZZ6A 4WH6A 3D65E 4CBOA 5GCHF 4OS6A 1O36A 2ZG0H 1TA6A 3ZZ8A 3ODFA 1EJMA 1X7AC 3PYHA 1QNJA 3VB7A 3UTUH 1ZTLA 6CHAB 1XUJA 1AZZA 1Z7KA 1B7XB 4GUXA 1RXPA 1QR3E 1Y8TA 2F91A 3R3GB 1XUHA 2GCTB 4HZHA 4X8TH 5EXNA 1SGIB 2PUXB 3BTFE 3QTOH 1TOCB 1G37A 4FUHA 2Y7XA 3E90B 3ZZ5A 4Y0YE 1KDQB 3BTME 1INCA 3MOCA 3CENA 1UVOA 3QO6A 1JIRA 4MG3A 2BMGB 4MVNA 4UFDH 1KXDA 2P59A 2HOBA 3GOVB 2A7JA 2Z3DA 4DIIH 3SU3A 3K9XB 4UFFH 1C2GA 4IC5A 4YT7H 3M5OA 1ZRBA 1OWHA 3K65B 1GHXH 4CH8B 4AG1A 2A2QH 5DGJA 2TRMA 1JXPA 1QL9A 1GJ6A 1L2EA 5BPEA 1GMDF 1SL3A 2FOAA 4H6TA 4BAMB 1WUNH 1VR1H 1QQ4A 2G52A 2BDAA 1KTSB 1KXEA 1GDQA 3R0FA 2BDHA 3SU5A 4JZFH 1S82A 3QGJA 1XVOA 3V12A 1O2RA 2G55A 1ESBA 2VWLA 1W13U 4DVAU 1S85A 3F9FA 1C5ZB 2OC8A 1FXYA 1IOEA 1DUAA 1AWFH 5DP3A 1ELVA 3O8CA 3LKWA 3HKIB 4FVDA 4TY6A 4Q7YA 2UUKB 4BAOB 1ARBA 5GCHG 4Z6AH 2WV4A 1BCUH 3KEEA 2BVXH 1ETSH 2BLWA 3QWCH 4MPXA 2OD3B 5FCRA 3UOUA 1LQDB 5E0HA 3E3TA 3BG4C 3E0PB 1QL8A 3UY9A 1A4WH 1THPB 1NRNH 4K69A 4OS1A 2JETC 1T8OA 1HB0B 1RJXB 2AMDA 4AYYB 3PLKA 5JBAS 2STBE 5A2MH 1O2WA 3GY5A 2ODPA 2R9PA 1GHWH 1P3CA 4O03A 4D7FA 2HWLB 1FIWA 3PO1C 4FU8A 1GBAA 1IQNA 1TRNA 2CGAA 5TCAA 3EYDA 2ZZUH 2AEIH 2O8UA 3A7VA 5C1UA 5JYIA 1CA8B 3M35A 1EATA 3Q76A 4IN1A 1AB9C 1O3EA 3KHVA 2FEQH 1NTPA 5GDSH 1IQJA 3PLPA 3UNQA 3RMNH 4CRGA 1IQMA 6GCHF 2EI7A 3ZV9A 2A4QA 1GMDG 4X1SU 5F8TA 8GCHF 4WJG2 3V3MA 1UHBB 5H4IB 1UTNA 1AQ7A 5DPAA 5EGMA 1UVSH 1DVAH 3URDA 3URCA 3T62A 5EW1H 3GY8A 3LGWA 2SGAA 1Y59T 1N1LA 3SOSA 2PKSB 5A8XA 1YYY1 1D9IA 1AUTC 3TIUA 1PPZA 3RC6A 2WYGA 3PMJA 2G51A 2P16A 3DUXH 3SU0A 2PGBB 1C5YB 3FZZA 1EJNA 3SNEA 2H5DA 5FX5A 4O97A 3ODDA 1KXCA 1UTOA 1Z6JH 4AFSA 1D3TB 2BDGA 1QL7A 1HAHH 2PR3A 2GP9B 3SV2H 3SU1A 4X2XA 3RXCA 1S6HA 1ANCA 2R0LA 2DE8A 1P09A 4D76A 1EPTB 3KGPA 2P3FH 3NCLA 2XWAA 1F7ZA 1O3AA 1WSSH 3CP7A 6CHAC 3SV6A 1F0TA 2P8OB 3RXLA 2BD3A 1SGFA 1GJCB 4FXGH 1H9HE 3TJOA 1LVYA 2BLOA 1O37A 1RS0A 2ALPA 1ZGIA 3U1JB 2QXGA 4AB9A 4BXSA 2BHGA 1Y5AT 5FCKA 3SGBE 4ABGA 1V2LT 4X2WA 1PPBH 1D6RA 6GCHG 2KAIB 3LH1A 1TGBA 3ZV8A 4TWYA 2B8OH 1GJ9B 1GHZA 2TGTA 3ATIA 1IQKA 1HCGA 2ZDAH 2NU3E 5CE1A 3TK5A 4NGAH 2FOBA 5GJ4B 1WBGB 1WOFA 2R3YA 1O3LA 1PPEE 3OSYA 2GVFA 3RXAA 4UDWH 4WH8A 4TY7A 3T28A 1OS8A 8LPRA 1P0SH 4Y8ZA 2D26C 4BAKB 2FOEA 2FOCA 1NO9H 5J4SA 1DUEA 3CS0A 4B1TA 5GWZA 1NRSH 5A8YA 1C1VH 1CE5A 5EQQA 1HBTH 2ZDLA 3EAJA 2PWXA 2B0FA 3SI3H 1IQHA 4ZMAH 1EJAA 3K6YA 2GTBA 1ETTH 1O5EH 1A7SA 1QTFA 2GX4A 4ZKNU 2H5CA 1YPGH 2ZGJA 4XBBA 2THFB 1ZMNA 5DP6A 3K2UA 4D9RA 1RTKA 5HXFA 3QX5H 4AFUA 1UCYE 1Z71A 2GT8A 2BOHB 3DFLA 4TWWA 1J14A 3SUEA 2TIOA 5E8EH 3HKJB 1Z1JA 3DFJA 3E16B 3QGNB 4X6PA 5T6FA 2JKHA 3GCHC 1O33A 4DOQA 1QHRB 1GBHA 1UK2A 4IGDA 2BXTH 3BF6H 3RXFA 2XC4A 3HK6B 5K7RA 4CHAB 2FOFA 1ZJDA 2GZ7A 1C5PA 1FI8A 3SU2A 1IQIA 1TMTH 3O8BA 2G00A 5ABWA 1O35A 3QUMP 4UFGH 3TLOA 1CT4E 4OS4A 2YOLA 1SBWA 1MQ5A 1E34B 3CS7A 1C5WB 2ZFPH 1ZRKA 1GI1A 3FP6E 3M61U 2GV6A 1F92A 1YCPM 1NESE 2QGRA 1ZSKA 2WUBA 1OSSA 4JK6A 4DY7B 4X1NU 1CVWH 3UUZA 1H8DH 2OTVA 4AOQA 2J2UA 2A32A 5EG4A 3SNDA 3RLWH 3GCOA 1W8BH 1Z8GA 5A0CA 3PROA 5DP8A 1XKBC 2BLVA 1KYNA 1YP9A 5T6DA 1K2I1 1PQ8A 3L3TA 2V6NA 1MMJN 3SHAH 2C4FH 3ATMA 4TPYA 2YNBA 2FX6A 1V2JT 1A1RA 1ZHRA 2SGDE 1AFQC 1C5NH 3OTJE 3RXKA 2A7HA 1CBWB 1HAVA 1LVMA 1W12U 1BRCE 1DOJA 3HGNA 1ESAA 1QQUA 1GJBB 1P06A 3RMLH 4BANB 3S69A 1O39A 3UQVA 2B9LA 4JYUH 4I7YH 1P2OA 3M37A 1TNKA 3M7TA 1O3CA 2C90B 2CHAB 1GCDA 4GLYA 4X2YA 4KELA 1CA0B 5J4QA 3U69H 3VB5A 4GCHF 1CGJE 1Z8IB 1QGFA 2XBWA 2ZEBA 4WMFA 2HNTF 5JDUB 2PUQH 3RXSA 4U32A 2A5IA 4ABJA 4YOGA 1IQLA 1TFXA 2IN2A 3LC5A 2ILNA 2WPHS 3GDVA 3MYWA 2PSXA 3A82A 4OGXA 2JH6D 1O2LA 5C5OA 1GHYH 5PTPA 4NWKA 2G81E 4PROA 2Y5HA 4H6SB 4U30A 4MTBA 4X6NA 3RXJA 1VGCC 4RKJB 1H9LB 1WV7H 4BAQB 3OU0A 1MTNB 2AS9A 2BQ7B 4A7IB 5A09A 3ESTA 2NU1E 5GXPA 5FHTA 1C2JA 3B8JA 3VGCB 3EA8A 3SJIA 3A8AA 4A1XA 3SJOA 1FAKH 1WU1A 1K1OA 5AVDA 3LGTA 1UTKA 3T2NA 3MH6A 2XXLA 3LGVA 3JZ2B 3GISB 2VIDA 1EPTA 1VJ9U 2Y5FA 2V3HH 3T26A 1PPFE 2SGFE 2BQWB 1Y3XA 5JBTA 1WCZA 1C5RA 1C4Y2 1B5GH 3OY5U 4WXVA 1MBQA 2Q1JA 3O8RA 5FPYA 1SQTA 2VIVA 4OS2A 3ZZDA 5C3NA 2ZGCA 2OINA 1PQAA 1UO6A 1ELEE 1PQ5A 1Z1IA 4B76A 4JZEH 1P2KA 2OC7A 1E37B 4JZDH 1FY5A 2XC0A 1TGNA 4B71A 2SNWA 2VU8E 4J1YA 1NRQH 1XXFA 2ZPQA 4B73A 2GT7A 3P8NA 2V35A 1GBMA 1ETRH 1ZPBA 1GMCF 1O5DH 1O31A 1O3JA 1QY6A 1SFIA 3IWMA 1N8OB 2OBOA 1OYQA 3GY2A 1BMNH 4GCHG 1F2SE 3MO3A 3TGJE 3DD2H 5L2YH 4Y8XA 1TPSA 3LOXA 1SGYE 1TB6H 4ISNA 1P10A 3RC5A 3F68H 5E0GA 3S7HB 3SNCA 2ZTXA 1SGNE 5EU8A 3TPIZ 1VITG 2ANWA 2CV3A 3A89A 4NSYA 1AD8H 2EC9H 1BRAA 1CQQA 3QTVH 1T7CA 2Z3EA 5C20A 1TALA 1GHAF 2F9NA 4FUJA 1E36B 2QAAA 2PGQB 3OYPA 3U9AH 2CMYA 1P2JA 1AWHB 4AYVB 3SUFA 1P01A 2Y82A 2BOKA 3AAUA 1NS3A 2G4TA 5AFZH 1NFXA 2ULLA 2IJOB 3SJ9A 1XVMA 4UD9H 1O5FH 3PLBA 1ZLRA 1BTYA 3HK3B 2HVXA 1AVGH 2BYAX 2BVRH 2FESH 4FU7A 2VVVA 4JZIA 1HJAC 1V2WT 1O5GH 1O2XA 4KGAA 1GBJA 1O3GA 1C1SA 2OQ5A 3GY4A 4DW2U 1AVXA 1RFNA 2AMQA 3ZZ4A 1A0JA 3RXOA 3E0NB 1O3DA 1FUJA 1ELDE 1AKSB 1S81A 4ASHA 3MU0A 2VWMA 2C93B 1C5QA 1MKXK 2ZFTA 3RXDA 1DXPA 1HAXB 1RD3B 1DITH 5GPIB 2OBQA 2ZDVH 5HGGA 4HGCA 2R2MB 1GCTB 8KME2 4Y11E 1GMCG 4AX9H 4NZLA 4Q80A 1QRXA 1SI5H 5F8XA 1GBIA 2AGIX 1KLJH 5C2ZA 3FP8E 1YF4A 2BD8A 2UUJB 4NA7A 1QFKH 3TK6A 2W5EA 2PTNA 1NROH 3UNRA 4WVPE 3MMGA 3OX7U 4Q7XA 3SQEE 4FUGA 1RIWB 4MNXA 1MUEB 2FYQA 2QXJA 1BB0B 1ZYOA 1HIAB 1YGCH 1ID5H 4K60A 4CR5A 2BX4A 5CHAB 4BNRA 1BTUA 1K1JA 2P95A 3TJUA 1BMLA 3FANA 5IYTA 1GJAB 1VZQH 1C5UA 5LPFA 1O5BB 1GHAG 3QZQA 1BHXB 3MNXA 4Q7ZA 3KQBA 1XXDA 1TGSZ 4MPVA 5TJXA 1FAXA 1SHHB 1MTVA 1O2TA 2PKAB 1C5MD 2CF9H 1C5LH 3MO9A 3QZRA 3RMOH 2ZTYA 7LPRA 2O8MA 4U2WA 1MTSA 5DP9A 1Q3XA 2BD9A 4VGCC 1AGJA 1DXWA 2ZGXH 1P57B 3SI4H 1K1LA 2WPIS 1O0DH 2H9HA 2TBSA 4M7GA 4UEHH 1MU8B 2ZFQH 3T27A 2BDYA 4UONA 3AAVA 4BXWA 1IHSH 2GMTB 1CT2E 5LPEA 1EZQA 3LGYA 2W26A 2PHBA 4UFEH 1C2KA 2R3UA 1FNIA 1P12E 3SU4A 1CHOF 3TGIE 5EPNA 2ZFRH 5FBIA 9ESTA 4X8UH 2BTCE 1GBFA 2A2XH 3RXMA 2HNTC 3GDSA 3RM2H 3VB3A 1AUJA 4X0WU 3ZVDA 4YOIA 5FAHA 2A4GA 3MNCA 3RU4T 2VGCB 1O2IA 2VB0A 3E8LA 3MH7A 3SO3A 4B75A 4BTUB 1FZZA 1O2YA 1TBRH 2ANKH 2C8YB 1OWKA 2XNIA 5LH8A 2BY5X 3BTDE 4DURA 1YCPH 2OXSA 5CMXH 1UVTH 1H1BA 1DY8A 2ZHDA 3EE0B 1GDNA 3GCNA 3VB6A 4I31A 1O34A 1YPJH 2ESTE 3A88A 1ABJH 1GI4A 4DIHH 1SGPE 3JZ1B 2NU2E 4E05H 3EGKH 3QN7A 3SV9A 1LKAA 4YT6H 1G3BA 4J2YB 1IHTH 1LHGH 1ZHPA 1J8AA 4OS5A 4DJZB 2PSYA 4GHQA 2AIPA 1O3IA 1SOTA 4JYTA 1ELAA 3BG8A 3TJVA 1DANH 3GICB 5SGAE 3U8TH 5G4BA 1P2MA 2XBYA 4ZHMU 1RTFB 1OWEA 1HV7A 1TNLA 4K1TA 4TYDA 2FLRH 4CH2B 7ESTE 1BUIA 2FX4A 1AHTH 1HDTH 3LT3A 2G5NA 1SGTA 2BD7A 2VH6A 2ZHQH 2F83A 3BTGE 1AE8H 1TABE 1HAOH 4A92A 2GCHF 1GI9B 1GHBF 1YCPK 1L0ZA 1JOUB 2QY0B 2BZ6H 2FP7B 5DP5A 4WXIA 1TPPA 2ZGBH 1CHOG 1OKXA 3BTHE 1GG6B 1GDUA 3MU4A 2A31A 3UWJH 1NN6A 2XWBI 4ABIA 1HAZB 1MD8A 2PTCE 2ZU1A 1D3DB 1Y3VA 1M9UA 1DSUA 2FIRH 1EUFA 4AGKA 1Z6EA 4WY3A 4KKDA 1QB6A 1A3EH 1C1WH 2WPMS 1C5VA 2HPQH 2ZPRA 1RRKA 4FUEA 4HTCH 5L2ZH 1D3PB 1U6QA 4YLQH 1TA2A 2GCTC 2QF3A 3UFAA 2UWLA 1Y5BT 2ZIQH 2FM2A 2ZF0H 4NA9H 2BD4A 2CJIA 1UTPA 2SFAA 3M5MA 2A1DB 1QRZA 3C1KA 2Z94A 2G8TA 3FVFB 2ANMH 2DUCA 1DX5M 2ZU5A 3KNXA 2F9UA 1TIOA 4BAHB 4IMZA 2UWOA 2ZA5A 1TRMA 3SUGA 2OUAA 3U8OH 1K1IA 2FZZA 1FIZA 2RG3A 1FN8A 3RXUA 1Y3YA 3TJNA 1S84A 2O8WA 1T4UH 4INLA 3S9CA 4ZKRU 2C8WB 3A85A 2P93A 4IMQA 1V2KT 1NZQH 1FPCH 1DWEH 3KIDU 1KDQA 1PQ7A 3M5LA 2QXIA 1BMAA 2EA3A 2FO9A 3A7XA 5T3HA 1MCTA 1HIAA 1TPOA 3UOPA 1HJ9A 1UTQA 2GCHG 4ISIH 2QF0A 2BD2A 3MO6A 1DLKB 4O9VA 1GHBG 2J9NA 2VVUA 1KSNA 1DFPA 4NCYA 1TX7A 4Z0KA 1J17T 3HGPA 4CRFA 4CBNA 2LNCA 1LTOA 3A8DA 1WQVH 4D8NA 1ORFA 1QIXB 1EB1H 2GDDA 1O2PA 1ZJKA 3E91A 3PMAB 3D23A 1HAIH 4B74A 3P8FA 3KQCA 1DE7H 2BY7X 2VVCA 4LK4A 4ZAEA 2WYJA 5L30H 5C5NA 1BDAA 1OWJA 4ISHH 3P95A 1HAGE 2ZPSA 4I32A 1YLCA 3GY3A 1K1MA 1KLTA 3ZZ7A 1A0LA 3SUDA 1MCVA 2GZ9A 4GPGA 1AFEH 3UR6A 2CN0H 4SGBE 4MNYA 3TH3H 3UQOA 2ZDMA 3AVZA 1O2KA 2XTTB 1GGDB 4IBLH 5DP7A 5LGOA 1S0QA 1AI8H 3ZZCA 1YPKH 9LPRA 2BQ6B 1C1UH 5EPYA 1EAWA 2I6QA 3D62A 3M7UA 2ZO3H 4K1EA 2G5VA 1BT7A 2XC5A 2UWPA 1GBCA 1GI3A 1MTWA 1XMNB 2LPRA 4Y8YA 1W14U 2J95A 4HFPB 1P2IA 2FDAA 1B0EA 4ISLA 3TNSA 4CRAA 2R2WU 1FPHH 3SBKA 1O2HA 3ZYEA 1LHCH 2FTLE 1HAPH 1C2FA 2J38A 1D4PB 3MNSA 1SGQE 2XCFA 1A5HA 1Y5UT 3TH4H 1CT0E 2XYAA 4KTUA 3GCTF 3TK9A 1UVUH 1SGRE 2UUFB 1B0FA 1ZR0A 2BM2A 4IC6A 3ZVGA 4ABFA 1C5OH 4CRDA 4FUDA 1BTHH 2Z3CA 5HMAA 3HPTB 1L4ZA 1P03A 4JK5A 1BTWA 1MD7A 1G36A 2QA9E 3VB4A 4INHA 2PKSC 5DKMA 3U98H 1QBNA 4AFQA 1O3MA 5GIBA 5JBBS 1NPMA 1TLDA 1JIMA 1FY8E 4XDEA 1T32A 3OY6U 2GD4B 3EDXB 5JB8S 1IQGA 1Y3UA 1UTJA 3RLYH 1TE0A 1UHBA 3NK8A 1ANDA 3LJOA 1KIGH 4I33A 5FX6A 1C1MA 1V2UT 4Y76A 1ZPZA 2FS8A 8ESTE 3GY7A 2HLCA 1FY4A 1C2EA 2Z9JA 1TNJA 5EODA 2Z6BD 2RDLA 1VJAU 4Y10E 2W3IA 1EPTC 2XW9A 1CGHA 4O3TA 1TMBH 2B7DH 1GBKA 1VITF 2ZCLP 4MDSA 2I6SA 3TNTA 3LDXH 1VITH 1T8NA 1GVKB 1GL1A 1GHVH 1V2MT 2AH4X 2GGVB 4KTCA 2P8OC 3NWUA 1DM4B 5L6NH 1ACBE 2XBXA 3TH2H 1SLXB 3SORA 3PMBB 1GI0A 1E0FD 2GZ8A 3GYLB 3LU9B 1QRWA 3KCGH 4MQAA 3ZYDA 1OWDA 2GV7A 2ZECA 3WY8A 4DCDA 4IN2A 2HPPH 3M3TA 1ELGA 4X2VA 1LVBA 5F03A 1J16A 1QJ7B 1UCYH 1O3PB 1C1QA 1W0ZU 3N7OA 2ZNKH 1BBRH 4WMDA 3ZVAA 1C4U2 1TMUH 1FY1A 1XX9A 1FN6A 3UNSA 1EQ9A 1SGCA 2TGDA 2EEKA 5A0BA 3QDZB 1O2MA 3GCTG 5EOKA 1G3CA 3SJKA 2ZQ2A 2QXHA 3RXEA 1GI5A 3P6ZB 4CREA 1G30B 2P3UB 3I77A 1KY9A 1S83A 2J4IA 3V0XA 3GDUA 4Y6DA 2IOTA 4BTTB 2F9VA 4GAWA 3SJ8A 1NFYA 1O3KA 5LPRA 1G3EA 3PB1E 3EA7A 1DT2A 2XBVA 1GJDB 1NC6A 3BG4B 1O2ZA 2DE9A 2SGQE 5BRRE 1A5GH 1XM1A 3S9AA 1MZDA 1L1GA 1ABIH 2JETB 2KAIA 5HM9A 1DSTA 1OX1A 1ZSLA 4A5TS 1FV9A 5DJ7A 3UREA 3NZIA 1O3BA 4B2AA 4AB8A 1PJPA 2Z9IA 5AFYH 3PO1B 4ZHLU 2FPZA 3W94A 1D3QB 4X8VH 1EB2A 2BXUH 4WWYA 1N6XA 1DLEA 2PW8H 1YPHC 1P05A 1BBRK 1BTXA 2GKVE 3M7QA 5C1XA 1C1NA 5DP4A 2VIPA 3W95A 1FLEE 1V2NT 4NFFA 2Y80A 1OPHB 1EP6A 4AGJA 1L1NA 2FODA 1G9IE 1F0UA 2A7CA 2SNVA 3BEUA 2VWOA 1THRH 3DT0H 4YESB 3RP2A 1C5XB 3F9HA 1J15A 4JMYA 1O32A 4CHAC 1C5SA 2F9PA 4RKOB 2ZTZA 1EZSC 2ZFSA 5EQSA 1DDJA 1W7GH 3RXVA 5ESBA 1BRUP 1TNIA 3M36A 5I25A 1ZTJA 1LMWB 4NIXA 2QYIA 1ZGVA 3RUOA 4NIYA 1LDTT 1O30A 2WINI 2WUCA 4ZH8A 1G2MA 2FYRA 4Q2KA 1QJ1B 1GBLA 2JH5D 1HXFH 3U8RH 1BHXF 1N6YA 1BJUA 1OWIA 4XFQA 5AF9H 1WTGH 4HI3A 3BEFB 3RC4A 1ZMLA 1YBWA 3STIA 2W7UA 1S5SA 4XOJA 3UPEA 5DK1A 3M3SA 1OOKB 1H8IH 1P8VC 1O2OA 4XE4A 4KP0A 1CHGA 2Y6TA 3RXPA 1TYNA 5B6OA 3KN2A 3SU6A 4AORA 3S0NA 3SGQE 1NFUA 3SW2B 1CBWC 1AU8A 1GWAA 1MKWH 2NU4E 2ZWLH 2F9OA 1S6FA 1XUGA 1VCQA 4FU9A 2WPLS 2CHAC 4IS5A 1BZXE 4MPWA 1BQYA 1C5TA 2ZFFH 4XBDA 3VEQB 1O3NA 1LO6A 2ASUB 1DWBH 1AY6H 1LPGB 3FFGA 1K28D 1CA0C 2ZHEH 1BTPA 1SGFG 1CO7E 3A81A 4XSKU 1T8LA 2ANYA 1ELBA 1YPLH 1D6WA 1IQFA 5IDKA 2FMJA 4WMEA 1NRPH 3ITIA 5I46H 5JBCS 5A0AE 3ZVCA 3DA9B 2VWNA 3ENSB 4DT7B 1F5LA 3ATKA 1HXEH 2VJ1A 1NY22 2PFEA 2BDCA 2ZQ1A 3G01A 5EQRA 1SGDE 3STJA 1OYTH 4ZXXH 4YOJA 1MTNC 2AYWA 2M5TA 3GY6A 4E7RG 1EP5A 3VGCC 1MTUA 1HLTH 2FOMB 4R8TB 1GBTA 3MNBA 3SV8A 1WAYB 3MH4A 4X6MA 1XKAC 1UJ1A 3Q3KA 1MKWK 1C1TA 1MAXA 3BSQA 1XUFA 5E0JA 3SN8A 5HM2A 2VNTA 3VXEH 2EI6A 1UK3A 2AMPA 2TPIZ 3E6PH 2FI4E 1F0RA 2OC1A 2BVSH 3Q3YA 4X1RU 2ZCKP 1S0RA 3BTKE 1ELCA 1QBOA 4GHTA 1LHDH 2QN5T 3PWBA 4QT8C 2JH0D 4JZ1A 4KTSA 3FAOA 5JB9S 1UTMA 3LJJA 1JMOH 1TOMH 1P2NA 1ESTA 5EXLA 4ZXYH 4X1QU 4ABAA 1HFDA 3ATLA 1ZHMA 2EI8A 4F4OC 3LH3A 1F0SA 4NG9H 4ZKOU 2O8TA 2P3TB 1FJSA 2ODQA 5JPMH 1P3EA 1TAWA 3ZZ3A 1SQAA 7GCHF 1YPHE 2Y81A 1DS2E 2H1UA 3GCHB 1HRTH 3KQDA 1N8OC 3SZNA 2F3CE 3MWIU 1EASA 1EOJA 2FS9A 3NXPA 3RXGA 5ESTE 1GMHF 4Y7BA 1Z8JB 1T31A 3VPKA 1ZSJA 2ZC9H 1YKTA 3P17H 4FUIA 1NM6A 1T4VH 2HALA 1HAVB 1TBZH 4RN6A 4OS7A 2WV5A 4RSPA 3BTQE 3LC3A 2V0BA 4ZUHA 3T29A 5AHGH 3VFEA 2WPJS 3TU7H 3EQ0H 1IQEA 2VIOA 1V6DA 3LONA 1O2QA 1KTTB 2A45B 2FWWA 1O2GH 1O2SA 3SV7A 3E1XB 1KXAA 3UIRA 1GJ8B 1W2KH 2ZU3A 3M5NA 1V2TT 3P8OA 4WF8A 1GBDA 1H4WA 3QLPH 1NFWA 2Z7FE 1AFQB 3U1IB 1LHEH 1KXFA 4A6LA 3RXQA 2HGTH 2FI3E 1BTZA 4K5ZA 1G32B 3A80A 3A83A 1QA0A 4YM9A 2BB4A 1EZUC 1O5CB 2FXRA 3H7OA 4I8GA 4K3JA 4AZ2B 1BITA 3F9GA 3BTTE 2NWNA 2TGAA 1FMGA 1RTLA 1BRBE 1TX6A 4Y79A 4ESTE 3AW0A 1SB1H 2NU0E 2ZU2A 3BIVH 1TPAE 4LZ4B 4UE7H 1YLDA 1FQ3A 3L6PA 4NZQA 1HJ8A 1GBBA 1GCTC 2TGPZ 4LZ1H 2H6MA 2ZDKA 1Z8RA 2H9EH 3BV9B 1MH0A 5E2PA 1QBVH 7GCHG 3MU1A 4A1TA 1K21H 3VXFH 1MZAA 2P94A 4JCNA 2SGEE 4R0IA 4I8HA 1V2PT 1MQ6A 2XCNA 1RIWC 1OP0A 1C2HA 1GMHG 1SOZA 4B2BA 1SLUB 1AN1E 1LKBA 1AKSA 1VGCB 1QB1A 1V3XA 3Q00A 1NRRH 1O2VA 2YNAA 5CHAC 2HRVA 1QB9A 3UWIA 1VCPA 1ZMJA 2BD5A 1SFQB 3MI4A 3MH5A 1TNHA 2A4OA 1A2CH 2F9BH 1AZ8A 1TGCA 6ESTA 1C2LA 1PPGE 5F8ZA 2B5TB 3D49H 3IITA 3UR9A 1GJ7B 3KF2A 4NSVA 4ZHAA 1EZXC 1WQSA 2ZU4A 5T6GA 2ZHFH 1LQEA 6LPRA 1JWTA 1K1NA 1PFXC 4H42U 3KL6A 3MTYA 3A7YA 2PLXA 8GCHG 1Q2WA 1W10U 1A3BH 1GI6A 1TBQH 1EXFA 4FUBA 1YM0A 3PM3A 4FVBA 1GI2A 1K9OE 1A5IA 1DWDH 1G3DA 1HUTH 1O3OA 4X8SH 4FUFA 2CXVA 4YO9A 1HAYB 4NA8A 1EX3A 1W0YH 1K1PA 5HYOA 2J92A 4YTAA 2GMTC 4DGJA 2HNTE 2W3KA 1SQOA 1AIXH 2ZP0H 1C9TA 3MU8A 3ZVBA 3A7WA 1ZZZA 2ODYB 2A5AA 2ZI2H 3H7TA 3BTEE 1BJVA 2PKAA 4Y71A 1ZOMA 2H9TH 1P04A 5DO4H 1TNGA 1OP2A 5TCCA 5ETXA 2QV1A 2Z9KA 1VCWA 4NIVA 1T8MA 3SQHE 1C4V2 1OXGA 1GVLA 3Q3XA 4FUCA 4GSOA 4AG2A 3F1SB 1YPMH 1PYTC 3F9EA 4YLUA 4E06H 4ZKSU 2VGCC 4JYVH 1JRTA 1F5RA 1SSXA 1TQ7B 1GL0E 1BBRE 1J9CH 3RDZA 5EW2H 3LGIA 1CSOE 1DY9A 1WYKA 1DWCH 2D8WA 2Y7ZA 1IAUA 1HPGA 3FZDA 2BY8X 3A7TA 3NKKA 1SC8U 2AFQB 2R0KA 3ELAH 1UMAH 3H5CB 1DPOA 1CGIE 1TX8A 1EAUA 1C1RA 2AIQA 3A8BA 4MNVA 4YZUA 1BOQA 3RXRA 3PWCA 4CRCA 3BEIB 2SGPE 2VH0A 1QCPA 1GJ4H 5FPTA 1ELFA 3RXBA 5C67A 4GVUA 1CU1A 1TGTA 1K22H 1H9IE 4SGAE 1W11U 1AO5A 4ABHA 1O2JA 1OP8A 1MU6B 1SVPA 4XBCA 2C8XB 1HJAB 2ALVA 3ATWA 3I29A 1C2MA 3PTNA 1A0HB 1W3CA 3F6UH 1GPZA 1SGEE 1WTHD 7KMEH 2BZAA 3Q77A 4B2CA 1P9UA 5E2OA 3B9FH 4D7GA 4CR9A 5F6MA 1V2RT 1FY3A 3MU5A 4K8BA 1P9SA 2STAE 3S7KB 1RGQA 4E7NA 2Z9GA 2BY9X 4LXBH 3T5FH 1AMHA 2Y5GA 3AW1A 4K1SA 3PV4A 2OP9A 1EKBB 1GG6C 1GJ5H 2CF8H 1XUKA 3MFJA 1JBUH 1F5KU 1JRSA 1TONA 2D1JA 3L33A 4BOHA 3LPRA 4I8JA 4D9QA 1EAIA 2H2ZA 3ZVEA 2RA0A 2RA3A 1SLWB 1TWXB 4F49A 1NU9A 3K6ZA 1KXBA 4MLFB 2OQUA 3HATH 2ZKSA 2AGEX 3PMHB 3RXIA 1HYLA 3EA9A 5A8ZA 4Y7AA 1LPKB 4X6OA 2AERH 1Y3WA 1ZTKA 1ANEA 3P70B 1W7XH 1V2QT 2FLBH 2W7SA 3TGKE 1P11E 1ARCA 3A86A 3V13A 2A5KA 1QURH 1SHYA 4X1PU 2IPHA 1V2VT 2K1QA 2PV9B 1ZPCA 1PPCE 1DICA 1L1JA 3P8GA 2BX3A 2C3SA 4VGCB 4DG4A 1C9PA
chains in the Genus database with same CATH superfamily
1HNEE 1GVZA 2J94A 1Q31A 3ZZBA 2V7QD 3MHWU 1E35B 3O8DA 1GI7B 3RU4E 1P2QA 5K0HA 2KR7A 2VIQA 4NWLA 1TRYA 3AASA 5EXMA 3TVJB 1C1PA 1MBMA 3NUMA 4IW4E 1MAYA 3QK1A 2QCYA 3RU4D 1O2UA 4TPIZ 2A4RA 1BA8B 3LIWA 4ISOA 1HGTH 4Y0ZE 4RT1A 4CRBA 2QC2A 1EAXA 3SNAA 2O9QA 5C1YA 4AN7A 2VINA 1WXRA 2FOGA 1LHFH 5DG6A 2YMSB 4K8YA 1SPJA 1C1OA 5HKKD 1V2ST 3SGAE 1AE5A 3ZVFA 2FTMA 1VKYA 2G4UA 2RDEA 1L4DA 1PPHE 3BIUH 4NFEA 1C2DA 4LOYH 3M3VA 1TQ0B 1LPZB 4XD7D 2OCVB 1QJ6B 4BTIB 1ELTA 1UTLM 2J34A 2ZCHP 3DHKH 3T25A 3KQEA 1XUIA 2FOHA 2RCEA 3A8CA 4NIWA 2BY6X 1UCYK 4THNH 2BDIA 1O3FA 1GBEA 2WPDD 2Q6FA 2XRCA 3A7ZA 1O3HA 3PTBA 3BN9A 1PYTD 2FI5E 1GI8B 3RXTA 4INKA 3RXHA 1AB9B 3TITA 1THSH 1AVWA 1C2IA 4OGYA 1SR5C 2C8ZB 1ANBA 4I8KA 1UK4A 1EOLA 2A0QB 4I8LA 1MKXH 2O8LA 3N7DA 2BDBA 4AFZA 2WPKS 2BLQA 3I78A 3BTWE 1GGDC 4A1VA 2KX4A 4U01A 2ZDNA 4ABDA 5FPSA 2UUYA 1LCYA 2ZHWH 1A46H 2VIWA 3ZZ9A 4MNWA 3GYMA 4O3UA 1BMMH 1QA7A 3RM0H 3NPSA 3RMMH 2OC0A 1NT1A 3S9BA 1SLVB 3V7TA 3SHCH 1O38A 3FP7E 2GDEH 4ZROA 4F48B 1UVPA 4ABEA 3ZZAA 2ZGHA 4MPUA 1YC0A 3B23B 3P92A 4H4FA 2V3OH 5FBEA 4K2YA 1V2OT 2Q6DA 2QIQA 2OLGA 2AGGX 1BIOA 1KLIH 1NU7B 1O5AB 1LVOA 3C27B 1SG8B 2KCOA 3F2HA 3IG6B 3SNBA 1FDPA 3A84A 1G2LA 2Z9LA 1P02A 3LGUA 1E38B 4ABBA 5FXLA 1SMFE 1FONA 2QF4A 1A61H 1O2NA 1YPEH 3A87A 2Q6GA 2D2DA 3ZZ6A 4WH6A 3D65E 4CBOA 5GCHF 4OS6A 1O36A 2ZG0H 1TA6A 3ZZ8A 3ODFA 1EJMA 1X7AC 3PYHA 1QNJA 3VB7A 3UTUH 1ZTLA 2J98B 6CHAB 1XUJA 3PRBA 1AZZA 1Z7KA 1B7XB 4GUXA 1RXPA 1QR3E 1Y8TA 2F91A 3R3GB 1XUHA 2GCTB 4HZHA 4X8TH 5EXNA 1SGIB 2PUXB 3BTFE 3OE7D 2W6JD 3QTOH 1TOCB 1G37A 4FUHA 2Y7XA 3E90B 3ZZ5A 4Y0YE 1KDQB 3BTME 3OTPA 1INCA 3MOCA 3CENA 1UVOA 3QO6A 1JIRA 4MG3A 2BMGB 4MVNA 4UFDH 1KXDA 1COWD 2P59A 2HOBA 3GOVB 2A7JA 2Z3DA 3WWBA 4DIIH 3SU3A 3K9XB 4UFFH 1C2GA 2JJ2D 4IC5A 4YT7H 3M5OA 1ZRBA 1OWHA 3K65B 1GHXH 4CH8B 4AG1A 2A2QH 5C17A 5DGJA 2TRMA 1JXPA 1QL9A 1GJ6A 1L2EA 3DSGA 5BPEA 1GMDF 1SL3A 2FOAA 4H6TA 4BAMB 1WUNH 1VR1H 1QQ4A 2G52A 2BDAA 1KTSB 1KXEA 1GDQA 3R0FA 2BDHA 2W6ID 3SU5A 4JZFH 1S82A 5IK2D 1H8HD 3QGJA 1XVOA 3V12A 1O2RA 2G55A 1ESBA 2VWLA 1W13U 4DVAU 1S85A 3F9FA 1C5ZB 1UW7A 2OC8A 1FXYA 1IOEA 1DUAA 1AWFH 4FOUC 5DP3A 1ELVA 3O8CA 3LKWA 3HKIB 4FVDA 4TY6A 4Q7YA 2UUKB 4BAOB 1ARBA 5GCHG 4Z6AH 2WV4A 1BCUH 3KEEA 2BVXH 1ETSH 2BLWA 3QWCH 4MPXA 3W1EA 2OD3B 5FCRA 3UOUA 1LQDB 5E0HA 3E3TA 3BG4C 3E0PB 1QL8A 3UY9A 1A4WH 1THPB 1NRNH 4K69A 4OS1A 5C0UA 2JETC 1T8OA 5HIYA 1HB0B 1RJXB 2AMDA 4AYYB 3PLKA 5JBAS 2STBE 5A2MH 1O2WA 3GY5A 2ODPA 2R9PA 1GHWH 1P3CA 4O03A 4D7FA 2HWLB 1FIWA 4TT3D 3PO1C 4FU8A 1GBAA 2KZ4A 1IQNA 1TRNA 2CGAA 5TCAA 3EYDA 2ZZUH 2AEIH 2O8UA 3A7VA 5C1UA 5JYIA 1CA8B 2JDID 3M35A 1EATA 3Q76A 4IN1A 1AB9C 1O3EA 3KHVA 2FEQH 1NTPA 5GDSH 1IQJA 3PLPA 3UNQA 3RMNH 4CRGA 1IQMA 6GCHF 2EI7A 3PRDA 2A4QA 3ZV9A 1GMDG 2AHME 4X1SU 5F8TA 8GCHF 4WJG2 3V3MA 1UHBB 5H4IB 1UTNA 1AQ7A 5DPAA 5EGMA 1UVSH 1DVAH 1E1RD 3URDA 3URCA 3T62A 5EW1H 3GY8A 3LGWA 2SGAA 1Y59T 1N1LA 3SOSA 2PKSB 5A8XA 1YYY1 1D9IA 1AUTC 3TIUA 1PPZA 3RC6A 2WYGA 3PMJA 2G51A 5DN6D 2P16A 3DUXH 2WV9A 3SU0A 2PGBB 1C5YB 3FZZA 1EJNA 3KYGA 3SNEA 2H5DA 5FX5A 4O97A 3ODDA 1KXCA 1UTOA 1Z6JH 4AFSA 1D3TB 2BDGA 1QL7A 1HAHH 2PR3A 2GP9B 3SV2H 3SU1A 4X2XA 3RXCA 1S6HA 1ANCA 2R0LA 2DE8A 1P09A 4D76A 1EPTB 3KGPA 4B6EA 2P3FH 3NCLA 2XWAA 1F7ZA 1O3AA 1WSSH 3CP7A 6CHAC 3SV6A 4ASUD 2KCPA 1F0TA 2P8OB 3RXLA 2BD3A 1SGFA 1GJCB 4FXGH 1H9HE 3TJOA 1LVYA 2BLOA 1O37A 2LP6A 1RS0A 2ALPA 1ZGIA 3U1JB 2QXGA 4AB9A 4BXSA 3AK5A 2BHGA 3EE7A 1Y5AT 5FCKA 3SGBE 4ABGA 1V2LT 4X2WA 1PPBH 1D6RA 6GCHG 2KAIB 3LH1A 1TGBA 3ZV8A 4TWYA 2B8OH 1GJ9B 1GHZA 2TGTA 3ATIA 1IQKA 1HCGA 1E1QD 2ZDAH 2NU3E 3UAIC 5CE1A 3TK5A 4NGAH 2FOBA 5GJ4B 1WBGB 1WOFA 2R3YA 1O3LA 1PPEE 3OSYA 2GVFA 5B6LA 3RXAA 4UDWH 4WH8A 3PV5A 4TY7A 3T28A 1OS8A 8LPRA 1P0SH 4Y8ZA 2D26C 4BAKB 2FOEA 2FOCA 1NO9H 5J4SA 1DUEA 1WDIA 3CS0A 4B1TA 5GWZA 1NRSH 5A8YA 1C1VH 1CE5A 5EQQA 1HBTH 2ZDLA 3EAJA 2PWXA 2B0FA 3SI3H 2F4LA 1IQHA 5EJ1A 4ZMAH 1EJAA 3K6YA 2GTBA 1ETTH 1O5EH 1A7SA 1QTFA 2GX4A 5F53A 4ZKNU 2H5CA 1YPGH 2ZGJA 4XBBA 2THFB 1ZMNA 5DP6A 3K2UA 4D9RA 1RTKA 5HXFA 3QX5H 4AFUA 1UCYE 1Z71A 2GT8A 2BOHB 3DFLA 4TWWA 1J14A 3SUEA 2TIOA 5E8EH 3HKJB 1Z1JA 2QE7D 3DFJA 3E16B 3QGNB 4X6PA 5T6FA 2JKHA 3GCHC 1O33A 4DOQA 1QHRB 1GBHA 1UK2A 4IGDA 2BXTH 3BF6H 3RXFA 2XC4A 3F2GA 3HK6B 4CHAB 5K7RA 2FOFA 1ZJDA 2GZ7A 1C5PA 1SKYE 1FI8A 3SU2A 1IQIA 1TMTH 3O8BA 2G00A 5ABWA 1O35A 3QUMP 4UFGH 3TLOA 1CT4E 4OS4A 2YOLA 1SBWA 2KFWA 1MQ5A 3OAAD 1E34B 3CS7A 1C5WB 2ZFPH 1ZRKA 1GI1A 3FP6E 1QZ8A 3M61U 2GV6A 1F92A 1YCPM 1NESE 2QGRA 1ZSKA 2WUBA 1OSSA 4JK6A 4DY7B 4X1NU 1CVWH 3UUZA 1H8DH 2OTVA 4AOQA 2EY4C 2J2UA 2A32A 5EG4A 3SNDA 3RLWH 3GCOA 1W8BH 1Z8GA 5A0CA 3PROA 2F43B 5DP8A 2LELA 1XKBC 5DSFA 2BLVA 1KYNA 1YP9A 5T6DA 1K2I1 2HLDD 1PQ8A 3L3TA 2V6NA 1MMJN 3SHAH 2C4FH 3ATMA 3UB0A 4TPYA 2YNBA 2FX6A 1V2JT 1A1RA 1ZHRA 2SGDE 1AFQC 1C5NH 3OTJE 3RXKA 2A7HA 1CBWB 1HAVA 1LVMA 2WZQA 1W12U 1BRCE 1DOJA 3HGNA 1ESAA 1QQUA 1GJBB 1P06A 3RMLH 4BANB 3S69A 1O39A 3UQVA 2B9LA 4JYUH 4I7YH 1P2OA 3M37A 1TNKA 3M7TA 1O3CA 2C90B 2CHAB 4AC9A 1GCDA 4GLYA 4X2YA 4KELA 5HIZA 1CA0B 5J4QA 3U69H 3VB5A 4GCHF 1CGJE 1Z8IB 1QGFA 2XBWA 2ZEBA 4WMFA 2HNTF 5JDUB 2PUQH 3RXSA 4U32A 2A5IA 4ABJA 4YOGA 1IQLA 1TFXA 2IN2A 3LC5A 2ILNA 2WPHS 3GDVA 3MYWA 2PSXA 3A82A 4OGXA 2JH6D 1O2LA 5C5OA 1GHYH 5PTPA 4NWKA 2G81E 4PROA 2Y5HA 4H6SB 4U30A 4MTBA 4X6NA 3RXJA 1VGCC 2XOKD 1H9LB 4RKJB 1WV7H 4BAQB 3OU0A 1MTNB 2AS9A 2BQ7B 4A7IB 5A09A 3ESTA 2NU1E 5GXPA 5FHTA 1C2JA 3B8JA 3VGCB 3EA8A 3SJIA 3A8AA 4A1XA 3SJOA 1FAKH 1WU1A 1K1OA 5AVDA 3LGTA 1UTKA 3T2NA 3MH6A 2XXLA 3LGVA 3JZ2B 3GISB 2VIDA 3DSOA 1EPTA 1VJ9U 2Y5FA 2V3HH 3T26A 1PPFE 2SGFE 2BQWB 1Y3XA 5JBTA 1WCZA 1C5RA 1C4Y2 1B5GH 3OY5U 4WXVA 1MBQA 2Q1JA 3O8RA 5FPYA 1SQTA 2VIVA 4OS2A 4M9FA 3ZZDA 5C3NA 2ZGCA 2OINA 1PQAA 1UO6A 1ELEE 1PQ5A 1Z1IA 4B76A 4JZEH 1P2KA 2OC7A 1E37B 4JZDH 1FY5A 2XC0A 3VG8A 1TGNA 4B71A 2SNWA 2VU8E 3FN8A 4J1YA 1NRQH 1XXFA 2ZPQA 4B73A 2GT7A 3P8NA 2V35A 1GBMA 1ETRH 1ZPBA 1GMCF 1O5DH 1O31A 1O3JA 1QY6A 1SFIA 3IWMA 1N8OB 2OBOA 1OYQA 3GY2A 1BMNH 4I86A 4GCHG 1F2SE 3MO3A 3TGJE 3DD2H 5L2YH 4Y8XA 1TPSA 3LOXA 1SGYE 1TB6H 4ISNA 1P10A 3RC5A 3F68H 3OFND 5E0GA 3S7HB 3SNCA 2ZTXA 1SGNE 5EU8A 3TPIZ 1VITG 2ANWA 2CV3A 3A89A 4NSYA 1AD8H 2EC9H 1BRAA 1CQQA 3QTVH 1T7CA 2Z3EA 5C20A 1TALA 1GHAF 2F9NA 4FUJA 1E36B 2QAAA 2PGQB 3OYPA 3U9AH 2CMYA 1P2JA 1AWHB 4AYVB 3SUFA 1P01A 2Y82A 2BOKA 3AAUA 1NS3A 2G4TA 5AFZH 3DCLA 1NFXA 2ULLA 2IJOB 3SJ9A 1XVMA 4UD9H 1O5FH 1SQRA 1ZLRA 2EQNA 3PLBA 1BTYA 3HK3B 2HVXA 1AVGH 3PV2A 2BYAX 2BVRH 2FESH 4FU7A 2VVVA 4JZIA 1HJAC 1V2WT 1O5GH 1O2XA 4KGAA 2J5UA 1GBJA 2KCAA 3ZIAD 1O3GA 1C1SA 2OQ5A 3GY4A 4DW2U 1AVXA 1RFNA 2AMQA 1H8ED 3ZZ4A 1A0JA 3RXOA 3E0NB 1O3DA 1FUJA 1ELDE 1AKSB 1S81A 4ASHA 3MU0A 2VWMA 2C93B 1C5QA 1MKXK 2ZFTA 3RXDA 1DXPA 1MABB 1HAXB 1RD3B 1DITH 5GPIB 2OBQA 2ZDVH 5HGGA 4HGCA 2R2MB 1GCTB 8KME2 4Y11E 1GMCG 4AX9H 4NZLA 4Q80A 1QRXA 1SI5H 5F8XA 1GBIA 2AGIX 1KLJH 5C2ZA 3FP8E 1YF4A 2BD8A 2UUJB 4NA7A 1QFKH 3TK6A 2W5EA 2PTNA 1NROH 3UNRA 4WVPE 3MMGA 3OX7U 4Q7XA 1FX0B 3SQEE 4FUGA 1RIWB 4MNXA 1MUEB 2FYQA 2QXJA 1BB0B 1ZYOA 1HIAB 1YGCH 1ID5H 4K60A 4CR5A 2BX4A 5CHAB 4BNRA 1BTUA 1K1JA 2P95A 3TJUA 1BMLA 3FANA 5IYTA 1GJAB 1VZQH 1C5UA 5LPFA 1O5BB 1GHAG 3QZQA 1BHXB 3MNXA 4Q7ZA 3KQBA 1XXDA 1TGSZ 4MPVA 5TJXA 1FAXA 1SHHB 1MTVA 1O2TA 3WWFA 2PKAB 1C5MD 2CF9H 1C5LH 3MO9A 3QZRA 3RMOH 2ZTYA 2OK5A 7LPRA 2O8MA 4U2WA 1MTSA 5DP9A 1Q3XA 2BD9A 4VGCC 1AGJA 1DXWA 2ZGXH 1P57B 3SI4H 1K1LA 2WPIS 1O0DH 2WSSD 2H9HA 2TBSA 4M7GA 4UEHH 1MU8B 2ZFQH 3OEHD 3T27A 2BDYA 3SYJA 4UONA 3AAVA 4BXWA 1IHSH 2GMTB 1CT2E 5LPEA 1EZQA 5C0TA 3LGYA 2W26A 2PHBA 4UFEH 1C2KA 2R3UA 1FNIA 1P12E 3SU4A 1CHOF 3TGIE 5EPNA 2ZFRH 5FBIA 9ESTA 4X8UH 2BTCE 1GBFA 2A2XH 2YMSC 3RXMA 1KMHB 2HNTC 3GDSA 3N7EA 3RM2H 3VB3A 1AUJA 4X0WU 3ZVDA 4YOIA 5FAHA 2A4GA 3MNCA 3RU4T 2VGCB 1O2IA 2VB0A 3E8LA 3MH7A 3SO3A 4B75A 4BTUB 1FZZA 1O2YA 1TBRH 2ANKH 2C8YB 1OWKA 2XNIA 5LH8A 2BY5X 3BTDE 4DURA 1YCPH 2OXSA 2J97A 2IPQX 5CMXH 1UVTH 1H1BA 1DY8A 2ZHDA 3EE0B 1GDNA 3GCNA 3VB6A 4I31A 1O34A 1YPJH 2ESTE 1YWUA 3A88A 1ABJH 1GI4A 4DIHH 1SGPE 3JZ1B 2NU2E 4E05H 3EGKH 3QN7A 4F55A 3SV9A 1LKAA 4YT6H 1G3BA 4J2YB 1IHTH 3DSPA 1LHGH 1ZHPA 1J8AA 4OS5A 4DJZB 2PSYA 4GHQA 2AIPA 1O3IA 1SOTA 4JYTA 1ELAA 3BG8A 3TJVA 1DANH 3GICB 5FL7D 3U8TH 5G4BA 5SGAE 2HVYB 1P2MA 2XBYA 4ZHMU 1RTFB 1OWEA 1HV7A 1TNLA 4K1TA 4TYDA 2FLRH 4CH2B 7ESTE 1BUIA 2FX4A 1AHTH 3FO8D 1HDTH 3LT3A 2G5NA 1SGTA 2BD7A 2VH6A 2ZHQH 2F83A 3BTGE 1AE8H 1TABE 1HAOH 4A92A 2GCHF 1GI9B 1GHBF 1YCPK 1L0ZA 1JOUB 2QY0B 2BZ6H 2FP7B 5DP5A 4WXIA 1TPPA 2ZGBH 1CHOG 1OKXA 3BTHE 1GG6B 1GDUA 3MU4A 2A31A 3UWJH 1NN6A 2XWBI 4ABIA 1HAZB 1MD8A 2PTCE 2ZU1A 1D3DB 1Y3VA 1M9UA 1DSUA 3WW7A 2FIRH 1EUFA 4AGKA 1Z6EA 4WY3A 4KKDA 1QB6A 1A3EH 1C1WH 2WPMS 1C5VA 2HPQH 2ZPRA 1RRKA 4FUEA 4HTCH 5L2ZH 1D3PB 4OM9A 3F3BA 1U6QA 4YLQH 1TA2A 2GCTC 2QF3A 3UFAA 2UWLA 1Y5BT 2ZIQH 2FM2A 2ZF0H 4NA9H 2BD4A 2CJIA 1UTPA 2SFAA 3M5MA 2A1DB 1QRZA 3C1KA 2Z94A 2G8TA 3FVFB 2ANMH 2DUCA 1DX5M 2ZU5A 3KNXA 2F9UA 1TIOA 4BAHB 4IMZA 2J98A 2UWOA 2ZA5A 1TRMA 3SUGA 2OUAA 3U8OH 1K1IA 2FZZA 1FIZA 2RG3A 1FN8A 3RXUA 1Y3YA 3TJNA 1S84A 2O8WA 1T4UH 4INLA 3S9CA 4ZKRU 2C8WB 3A85A 2P93A 4IMQA 1V2KT 5T1VA 1NZQH 1FPCH 1DWEH 3KIDU 1KDQA 1PQ7A 3M5LA 2QXIA 1BMAA 2EA3A 2FO9A 3A7XA 5T3HA 1MCTA 1HIAA 2M2AA 1TPOA 3UOPA 1HJ9A 1UTQA 2GCHG 4ISIH 2QF0A 2BD2A 3MO6A 1DLKB 4O9VA 1GHBG 2J9NA 2VVUA 1KSNA 1DFPA 4NCYA 1TX7A 4Z0KA 1J17T 3HGPA 4CRFA 4CBNA 2LNCA 1LTOA 3A8DA 1WQVH 4D8NA 1ORFA 1QIXB 1EB1H 2GDDA 1O2PA 1ZJKA 3E91A 3PMAB 3D23A 1HAIH 4B74A 3P8FA 3KQCA 1DE7H 2BY7X 2YMSD 2VVCA 4LK4A 4ZAEA 2WYJA 5L30H 5C5NA 1BDAA 1OWJA 4ISHH 3P95A 4XRNA 1HAGE 1W0KD 2ZPSA 2L6OA 4I32A 1YLCA 3GY3A 1K1MA 1KLTA 3ZZ7A 1A0LA 3SUDA 1MCVA 2GZ9A 4GPGA 1AFEH 2KCYA 3UR6A 2CN0H 4SGBE 4MNYA 3TH3H 3UQOA 2ZDMA 3AVZA 1O2KA 2XTTB 1GGDB 4IBLH 5DP7A 5LGOA 1S0QA 1AI8H 3ZZCA 1YPKH 9LPRA 2BQ6B 1C1UH 5EPYA 1EAWA 2I6QA 3D62A 3M7UA 2ZO3H 4K1EA 2G5VA 1BT7A 1EFRD 2XC5A 4Z1MD 2UWPA 1GBCA 1GI3A 1MTWA 1XMNB 2LPRA 4Y8YA 1W14U 2J95A 4HFPB 1P2IA 2FDAA 1B0EA 4ISLA 3TNSA 4B6FA 2R2WU 4CRAA 1FPHH 3SBKA 1O2HA 3ZYEA 1LHCH 2FTLE 1HAPH 1C2FA 2J38A 1D4PB 3MNSA 1SGQE 2XCFA 4ACBA 1A5HA 1Y5UT 3TH4H 1CT0E 2XYAA 4KTUA 3GCTF 3TK9A 1UVUH 1SGRE 2UUFB 1B0FA 1ZR0A 2BM2A 4IC6A 3ZVGA 4ABFA 1C5OH 4CRDA 4FUDA 1BTHH 2Z3CA 5HMAA 3HPTB 1L4ZA 1P03A 4JK5A 1BTWA 1MD7A 1G36A 2QA9E 3VB4A 4INHA 2PKSC 5DKMA 2VBCA 3U98H 3NRLA 1QBNA 4AFQA 1O3MA 5GIBA 5JBBS 1NPMA 1TLDA 5C94A 1JIMA 1FY8E 4XDEA 1T32A 3OY6U 2GD4B 3EDXB 5JB8S 1IQGA 1Y3UA 1UTJA 3RLYH 1TE0A 1UHBA 3NK8A 1ANDA 3LJOA 1KIGH 5EIYA 4I33A 5FX6A 1C1MA 1V2UT 4Y76A 1ZPZA 2FS8A 8ESTE 3GY7A 2HLCA 1FY4A 1C2EA 2Z9JA 1TNJA 5EODA 2Z6BD 2RDLA 1VJAU 4Y10E 2W3IA 1EPTC 2XW9A 1CGHA 4O3TA 1TMBH 2B7DH 1GBKA 1VITF 2ZCLP 4MDSA 2JJ1D 2I6SA 3TNTA 3LDXH 1VITH 1T8NA 1GVKB 1GL1A 1GHVH 1V2MT 2AH4X 2GGVB 4KTCA 2P8OC 4Q4LA 3NWUA 1DM4B 5L6NH 1ACBE 2XBXA 3TH2H 1SLXB 5CHBA 3SORA 5EJZA 3PMBB 1GI0A 1E0FD 2GZ8A 3GYLB 3LU9B 1QRWA 3KCGH 4MQAA 3ZYDA 1OWDA 2GV7A 2ZECA 3WY8A 4DCDA 4IN2A 2HPPH 3M3TA 1ELGA 4X2VA 1LVBA 5F03A 1J16A 1QJ7B 1UCYH 2PP6A 1O3PB 1C1QA 1W0ZU 3N7OA 2ZNKH 1BBRH 4WMDA 3ZVAA 1C4U2 1TMUH 1FY1A 1XX9A 1FN6A 3UNSA 1EQ9A 1SGCA 5KECA 2TGDA 2EEKA 5A0BA 3QDZB 1O2MA 3GCTG 5EOKA 1G3CA 3SJKA 2ZQ2A 2QXHA 3RXEA 1GI5A 3P6ZB 4CREA 1G30B 2P3UB 3I77A 1KY9A 4HG6A 1S83A 2J4IA 3U28C 3V0XA 3GDUA 4Y6DA 2IOTA 4BTTB 2F9VA 4GAWA 3SJ8A 1NFYA 1O3KA 4P02A 5LPRA 1G3EA 5EJLA 3PB1E 3EA7A 1DT2A 2XBVA 1GJDB 1NC6A 3BG4B 1O2ZA 2DE9A 2SGQE 5BRRE 1A5GH 1XM1A 3S9AA 1MZDA 1L1GA 1ABIH 2JETB 4YXWD 2KAIA 5HM9A 1DSTA 1OX1A 1ZSLA 4A5TS 1FV9A 5DJ7A 3UREA 3NZIA 2L74A 1O3BA 4B2AA 4AB8A 1PJPA 2Z9IA 5AFYH 3PO1B 4ZHLU 2FPZA 3W94A 1D3QB 4X8VH 1EB2A 2BXUH 4WWYA 1N6XA 1DLEA 2PW8H 1YPHC 1P05A 1BBRK 1BTXA 2GKVE 3M7QA 5C1XA 1C1NA 5DP4A 2VIPA 3W95A 1FLEE 1V2NT 4NFFA 2Y80A 1OPHB 1EP6A 1OHHD 4AGJA 1L1NA 2FODA 1G9IE 1F0UA 2A7CA 2SNVA 4ZCNA 3BEUA 2VWOA 1THRH 3DT0H 4YESB 3RP2A 1C5XB 3F9HA 1J15A 4JMYA 1O32A 4CHAC 1C5SA 2F9PA 4RKOB 2ZTZA 3F0PA 1EZSC 2ZFSA 1K0HA 5EQSA 1DDJA 1W7GH 3RXVA 3FOAA 3GS9A 5ESBA 1BRUP 1TNIA 3M36A 3OEED 5I25A 1ZTJA 1LMWB 4NIXA 2QYIA 1ZGVA 3RUOA 4NIYA 1LDTT 1O30A 2WINI 2WUCA 4ZH8A 1G2MA 2FYRA 2K0QA 4Q2KA 1QJ1B 1GBLA 2JH5D 1HXFH 3U8RH 1BHXF 1N6YA 1BJUA 1OWIA 4XFQA 5AF9H 1WTGH 4HI3A 3BEFB 3RC4A 1ZMLA 1YBWA 3STIA 2W7UA 1S5SA 4XOJA 3UPEA 4Q63A 5DK1A 3SZEA 3M3SA 1OOKB 1H8IH 2QF5A 1P8VC 1O2OA 4XE4A 4KP0A 3KYFA 3CNRA 1CHGA 2Y6TA 3RXPA 1TYNA 5B6OA 3KN2A 3SU6A 4AORA 3S0NA 3SGQE 1NFUA 3SW2B 1CBWC 1AU8A 2GJGA 1GWAA 1MKWH 2NU4E 2ZWLH 5CDFE 2F9OA 1S6FA 1XUGA 1VCQA 3FKSD 4FU9A 2WPLS 2CHAC 4IS5A 1BZXE 4MPWA 1BQYA 1C5TA 2ZFFH 4XBDA 3VEQB 1O3NA 1LO6A 2ASUB 1DWBH 1AY6H 1LPGB 3FFGA 1K28D 1CA0C 2ZHEH 1BTPA 1SGFG 2WHXA 1CO7E 3A81A 4XSKU 1T8LA 2ANYA 1ELBA 1YPLH 1D6WA 1IQFA 5IDKA 2FMJA 4WMEA 1NRPH 3ITIA 5I46H 5JBCS 5A0AE 3ZVCA 3DA9B 2VWNA 3ENSB 4DT7B 1F5LA 5GNDA 3ATKA 1HXEH 3KQ5A 2VJ1A 1NY22 2PFEA 2BDCA 2ZQ1A 3G01A 5EQRA 1SGDE 3STJA 1OYTH 4ZXXH 4YOJA 1MTNC 2AYWA 2M5TA 3GY6A 3N99A 1EP5A 4E7RG 3VGCC 1MTUA 1HLTH 2FOMB 4R8TB 1GBTA 3MNBA 3SV8A 1WAYB 3MH4A 4X6MA 1XKAC 1UJ1A 3Q3KA 1MKWK 1C1TA 1MAXA 3BSQA 1XUFA 5E0JA 3SN8A 5HM2A 1YLNA 2VNTA 3VXEH 2EI6A 1UK3A 2AMPA 2TPIZ 3E6PH 2FI4E 1F0RA 2CK3D 2OC1A 2BVSH 3Q3YA 4X1RU 2ZCKP 1S0RA 3BTKE 1ELCA 1QBOA 4GHTA 1LHDH 2QN5T 3PWBA 4QT8C 2JH0D 4JZ1A 4KTSA 3FAOA 5JB9S 1UTMA 1YY3A 3LJJA 1JMOH 1TOMH 1P2NA 1ESTA 5EXLA 4ZXYH 4X1QU 4ABAA 1HFDA 3ATLA 1ZHMA 2EI8A 3F2FA 4F4OC 3LH3A 1F0SA 4NG9H 4ZKOU 2O8TA 2P3TB 1FJSA 2ODQA 5JPMH 1P3EA 1TAWA 1W0JD 3ZZ3A 1SQAA 7GCHF 1YPHE 2Y81A 1DS2E 2H1UA 3GCHB 1HRTH 2RFKC 3KQDA 1N8OC 3SZNA 2F3CE 3MWIU 1EASA 1EOJA 2FS9A 3NXPA 3RXGA 5ESTE 1GMHF 4Y7BA 1Z8JB 1T31A 3VPKA 1ZSJA 2ZC9H 1YKTA 3P17H 4FUIA 1NM6A 1T4VH 2HALA 1HAVB 1TBZH 4RN6A 4OS7A 2WV5A 4RSPA 3BTQE 3LC3A 2V0BA 4ZUHA 3T29A 5AHGH 3VFEA 2WPJS 3TU7H 3EQ0H 1IQEA 2VIOA 1V6DA 3LONA 1O2QA 1KTTB 2A45B 2FWWA 1O2GH 1O2SA 3SV7A 3E1XB 1KXAA 3UIRA 1GJ8B 1W2KH 2ZU3A 3M5NA 1V2TT 3P8OA 4WF8A 1GBDA 1H4WA 3QLPH 1NFWA 2Z7FE 1AFQB 3U1IB 1LHEH 1KXFA 4A6LA 3RXQA 2HGTH 2FI3E 1BTZA 4K5ZA 1G32B 3A80A 3A83A 1QA0A 4YM9A 2BB4A 1EZUC 1O5CB 2FXRA 3H7OA 4I8GA 4K3JA 4AZ2B 1BITA 3F9GA 3BTTE 2NWNA 2TGAA 1FMGA 1RTLA 1BRBE 1TX6A 4Y79A 4ESTE 3AW0A 3F0OA 1SB1H 2NU0E 2ZU2A 2K8IA 3BIVH 1TPAE 4LZ4B 4UE7H 1YLDA 1FQ3A 3L6PA 4NZQA 1HJ8A 1GBBA 1GCTC 2TGPZ 4LZ1H 2H6MA 2ZDKA 1Z8RA 2H9EH 3BV9B 4ACAA 1MH0A 5KEDA 5E2PA 1QBVH 7GCHG 3MU1A 4A1TA 1K21H 3VXFH 1MZAA 2P94A 4JCNA 2SGEE 4R0IA 4I8HA 1V2PT 1MQ6A 2XCNA 1RIWC 1OP0A 1C2HA 1GMHG 1SOZA 4B2BA 1SLUB 1AN1E 1LKBA 1AKSA 1VGCB 1QB1A 1V3XA 3Q00A 1NRRH 1O2VA 2YNAA 5CHAC 2HRVA 1QB9A 3UWIA 1VCPA 1ZMJA 2BD5A 1SFQB 3MI4A 3MH5A 1TNHA 2A4OA 1A2CH 2F9BH 1AZ8A 1TGCA 6ESTA 1C2LA 1PPGE 5F8ZA 2B5TB 3D49H 3IITA 3UR9A 1GJ7B 3KF2A 4NSVA 4ZHAA 1EZXC 1WQSA 2ZU4A 3H09A 2ZHFH 5T6GA 1LQEA 6LPRA 1JWTA 1K1NA 1PFXC 4H42U 3KL6A 3MTYA 3A7YA 2PLXA 8GCHG 1Q2WA 1W10U 1A3BH 1GI6A 1TBQH 1EXFA 4FUBA 1YM0A 3PM3A 4FVBA 1GI2A 1K9OE 1A5IA 1DWDH 1G3DA 1HUTH 1O3OA 4X8SH 4FUFA 2CXVA 4YO9A 1HAYB 4NA8A 1EX3A 1W0YH 1K1PA 5HYOA 2J92A 4YTAA 2GMTC 4DGJA 2HNTE 2W3KA 1SQOA 1AIXH 2ZP0H 1C9TA 3MU8A 3ZVBA 3A7WA 1ZZZA 2ODYB 2A5AA 2ZI2H 3H7TA 3BTEE 1BJVA 2PKAA 4Y71A 2XNDD 4DT4A 1ZOMA 2H9TH 1P04A 5DO4H 1TNGA 1OP2A 5TCCA 5ETXA 2QV1A 2Z9KA 1VCWA 4NIVA 1T8MA 3SQHE 1C4V2 4TSFD 1OXGA 1GVLA 3Q3XA 4FUCA 4GSOA 4AG2A 3F1SB 1YPMH 1PYTC 3F9EA 4YLUA 4E06H 4ZKSU 2VGCC 4JYVH 1JRTA 1F5RA 1SSXA 1TQ7B 1GL0E 1BBRE 1J9CH 3RDZA 5EW2H 3LGIA 1CSOE 1DY9A 1NBME 1WYKA 1DWCH 2D8WA 2Y7ZA 1IAUA 1HPGA 1BMFD 3FZDA 2BY8X 3A7TA 3NKKA 1SC8U 2AFQB 2R0KA 2IJD1 3ELAH 1NBMD 1UMAH 3H5CB 1DPOA 1CGIE 1TX8A 1EAUA 2JIZD 1C1RA 2AIQA 3A8BA 4MNVA 4YZUA 1BOQA 3RXRA 3PWCA 4CRCA 3MQKC 3BEIB 2SGPE 2VH0A 1QCPA 1GJ4H 5FPTA 1ELFA 3RXBA 5C67A 4GVUA 1CU1A 1TGTA 5KGOA 1K22H 1H9IE 4SGAE 1W11U 1AO5A 4ABHA 1O2JA 1OP8A 1MU6B 1SVPA 4XBCA 2C8XB 1HJAB 2ALVA 3ATWA 3I29A 1C2MA 3PTNA 1A0HB 1W3CA 3F6UH 1GPZA 1SGEE 1WTHD 7KMEH 2BZAA 3Q77A 4B2CA 1P9UA 5E2OA 3B9FH 4D7GA 1S6LA 4CR9A 5F6MA 1V2RT 1FY3A 3MU5A 4K8BA 1P9SA 2STAE 3S7KB 1RGQA 4E7NA 2Z9GA 2BY9X 4LXBH 3T5FH 1AMHA 2Y5GA 3AW1A 4K1SA 3PV4A 2OP9A 2KM0A 1EKBB 4P00A 1GG6C 1GJ5H 2CF8H 1XUKA 3MFJA 1JBUH 1F5KU 1E79D 1JRSA 1TONA 2D1JA 3L33A 4BOHA 3LPRA 4I8JA 4D9QA 1EAIA 2H2ZA 3ZVEA 2RA0A 2RA3A 1SLWB 1TWXB 4F49A 1NU9A 3K6ZA 1KXBA 4MLFB 2OQUA 3HATH 2ZKSA 2AGEX 3PMHB 3RXIA 1HYLA 3EA9A 5A8ZA 4Y7AA 1LPKB 4X6OA 2AERH 1Y3WA 1ZTKA 4RT0A 1ANEA 3P70B 1W7XH 1V2QT 2FLBH 4FETA 2W7SA 3TGKE 1P11E 1ARCA 2V3MA 3A86A 3V13A 2A5KA 4RI0A 1QURH 1SHYA 4X1PU 2IPHA 1V2VT 2K1QA 2PV9B 1ZPCA 1PPCE 1DICA 1L1JA 3P8GA 2BX3A 2C3SA 4VGCB 4DG4A 1C9PA
chains in the Genus database with same CATH topology
1HNEE 1GVZA 2J94A 1Q31A 3ZZBA 3MHWU 1E35B 3O8DA 1GI7B 3RU4E 1P2QA 5K0HA 4NWLA 2VIQA 1TRYA 3AASA 5EXMA 3TVJB 1C1PA 1MBMA 3NUMA 4IW4E 1MAYA 3QK1A 2QCYA 3RU4D 1O2UA 4TPIZ 2A4RA 1BA8B 3LIWA 4ISOA 1HGTH 4Y0ZE 4CRBA 2QC2A 1EAXA 3SNAA 2O9QA 5C1YA 4AN7A 2VINA 2FOGA 1LHFH 5DG6A 4K8YA 1SPJA 1C1OA 1V2ST 3SGAE 1AE5A 3ZVFA 2FTMA 2G4UA 1L4DA 1PPHE 3BIUH 4NFEA 1C2DA 4LOYH 3M3VA 1TQ0B 1LPZB 2OCVB 1QJ6B 4BTIB 1ELTA 1UTLM 2J34A 2ZCHP 3DHKH 3T25A 3KQEA 1XUIA 2FOHA 2RCEA 3A8CA 4NIWA 2BY6X 1UCYK 4THNH 2BDIA 1O3FA 1GBEA 2Q6FA 2XRCA 3A7ZA 1O3HA 3PTBA 3BN9A 1PYTD 2FI5E 1GI8B 3RXTA 4INKA 3RXHA 1AB9B 3TITA 1THSH 1AVWA 1C2IA 4OGYA 1SR5C 2C8ZB 1ANBA 4I8KA 1UK4A 1EOLA 2A0QB 4I8LA 1MKXH 2O8LA 2BDBA 4AFZA 2WPKS 2BLQA 3I78A 3BTWE 1GGDC 4A1VA 4U01A 2ZDNA 4ABDA 5FPSA 2UUYA 1LCYA 2ZHWH 1A46H 2VIWA 3ZZ9A 4MNWA 3GYMA 4O3UA 1BMMH 1QA7A 3RM0H 3NPSA 3RMMH 2OC0A 1NT1A 3S9BA 1SLVB 3V7TA 3SHCH 1O38A 3FP7E 2GDEH 4ZROA 1UVPA 4ABEA 3ZZAA 2ZGHA 4MPUA 1YC0A 3B23B 3P92A 4H4FA 2V3OH 5FBEA 4K2YA 1V2OT 2Q6DA 2QIQA 2OLGA 2AGGX 1BIOA 1KLIH 1NU7B 1O5AB 1LVOA 3C27B 1SG8B 3IG6B 3SNBA 1FDPA 3A84A 1G2LA 2Z9LA 1P02A 3LGUA 1E38B 4ABBA 5FXLA 1SMFE 1FONA 1A61H 1O2NA 1YPEH 3A87A 2Q6GA 2D2DA 3ZZ6A 4WH6A 3D65E 4CBOA 5GCHF 4OS6A 1O36A 2ZG0H 1TA6A 3ZZ8A 3ODFA 1EJMA 1X7AC 3PYHA 1QNJA 3VB7A 3UTUH 1ZTLA 6CHAB 1XUJA 1AZZA 1Z7KA 1B7XB 4GUXA 1RXPA 1QR3E 1Y8TA 2F91A 3R3GB 1XUHA 2GCTB 4HZHA 4X8TH 5EXNA 1SGIB 2PUXB 3BTFE 3QTOH 1TOCB 1G37A 4FUHA 2Y7XA 3E90B 3ZZ5A 4Y0YE 1KDQB 3BTME 1INCA 3MOCA 3CENA 1UVOA 3QO6A 1JIRA 4MG3A 2BMGB 4MVNA 4UFDH 1KXDA 2P59A 2HOBA 3GOVB 2A7JA 2Z3DA 4DIIH 3SU3A 3K9XB 4UFFH 1C2GA 4IC5A 4YT7H 3M5OA 1ZRBA 1OWHA 3K65B 1GHXH 4CH8B 4AG1A 2A2QH 5DGJA 2TRMA 1JXPA 1QL9A 1GJ6A 1L2EA 5BPEA 1GMDF 1SL3A 2FOAA 4H6TA 4BAMB 1WUNH 1VR1H 1QQ4A 2G52A 2BDAA 1KTSB 1KXEA 1GDQA 3R0FA 2BDHA 3SU5A 4JZFH 1S82A 3QGJA 1XVOA 3V12A 1O2RA 2G55A 1ESBA 2VWLA 1W13U 4DVAU 1S85A 3F9FA 1C5ZB 2OC8A 1FXYA 1IOEA 1DUAA 1AWFH 5DP3A 1ELVA 3O8CA 3LKWA 3HKIB 4FVDA 4TY6A 4Q7YA 2UUKB 4BAOB 1ARBA 5GCHG 4Z6AH 2WV4A 1BCUH 3KEEA 2BVXH 1ETSH 2BLWA 3QWCH 4MPXA 2OD3B 5FCRA 3UOUA 1LQDB 5E0HA 3E3TA 3BG4C 3E0PB 1QL8A 3UY9A 1A4WH 1THPB 1NRNH 4K69A 4OS1A 2JETC 1T8OA 1HB0B 1RJXB 2AMDA 4AYYB 3PLKA 5JBAS 2STBE 5A2MH 1O2WA 3GY5A 2ODPA 2R9PA 1GHWH 1P3CA 4O03A 4D7FA 2HWLB 1FIWA 3PO1C 4FU8A 1GBAA 1IQNA 1TRNA 2CGAA 5TCAA 3EYDA 2ZZUH 2AEIH 2O8UA 3A7VA 5C1UA 5JYIA 1CA8B 3M35A 1EATA 3Q76A 4IN1A 1AB9C 1O3EA 3KHVA 2FEQH 1NTPA 5GDSH 1IQJA 3PLPA 3UNQA 3RMNH 4CRGA 1IQMA 6GCHF 2EI7A 3ZV9A 2A4QA 1GMDG 4X1SU 5F8TA 8GCHF 4WJG2 3V3MA 1UHBB 5H4IB 1UTNA 1AQ7A 5DPAA 5EGMA 1UVSH 1DVAH 3URDA 3URCA 3T62A 5EW1H 3GY8A 3LGWA 2SGAA 1Y59T 1N1LA 3SOSA 2PKSB 5A8XA 1YYY1 1D9IA 1AUTC 3TIUA 1PPZA 3RC6A 2WYGA 3PMJA 2G51A 2P16A 3DUXH 3SU0A 2PGBB 1C5YB 3FZZA 1EJNA 3SNEA 2H5DA 5FX5A 4O97A 3ODDA 1KXCA 1UTOA 1Z6JH 4AFSA 1D3TB 2BDGA 1QL7A 1HAHH 2PR3A 2GP9B 3SV2H 3SU1A 4X2XA 3RXCA 1S6HA 1ANCA 2R0LA 2DE8A 1P09A 4D76A 1EPTB 3KGPA 2P3FH 3NCLA 2XWAA 1F7ZA 1O3AA 1WSSH 3CP7A 6CHAC 3SV6A 1F0TA 2P8OB 3RXLA 2BD3A 1SGFA 1GJCB 4FXGH 1H9HE 3TJOA 1LVYA 2BLOA 1O37A 1RS0A 2ALPA 1ZGIA 3U1JB 2QXGA 4AB9A 4BXSA 2BHGA 1Y5AT 5FCKA 3SGBE 4ABGA 1V2LT 4X2WA 1PPBH 1D6RA 6GCHG 2KAIB 3LH1A 1TGBA 3ZV8A 4TWYA 2B8OH 1GJ9B 1GHZA 2TGTA 3ATIA 1IQKA 1HCGA 2ZDAH 2NU3E 5CE1A 3TK5A 4NGAH 2FOBA 5GJ4B 1WBGB 1WOFA 2R3YA 1O3LA 1PPEE 3OSYA 2GVFA 3RXAA 4UDWH 4WH8A 4TY7A 3T28A 1OS8A 8LPRA 1P0SH 4Y8ZA 2D26C 4BAKB 2FOEA 2FOCA 1NO9H 5J4SA 1DUEA 3CS0A 4B1TA 5GWZA 1NRSH 5A8YA 1C1VH 1CE5A 5EQQA 1HBTH 2ZDLA 3EAJA 2PWXA 2B0FA 3SI3H 1IQHA 4ZMAH 1EJAA 3K6YA 2GTBA 1ETTH 1O5EH 1A7SA 1QTFA 2GX4A 4ZKNU 2H5CA 1YPGH 2ZGJA 4XBBA 2THFB 1ZMNA 5DP6A 3K2UA 4D9RA 1RTKA 5HXFA 3QX5H 4AFUA 1UCYE 1Z71A 2GT8A 2BOHB 3DFLA 4TWWA 1J14A 3SUEA 2TIOA 5E8EH 3HKJB 1Z1JA 3DFJA 3E16B 3QGNB 4X6PA 5T6FA 2JKHA 3GCHC 1O33A 4DOQA 1QHRB 1GBHA 1UK2A 4IGDA 2BXTH 3BF6H 3RXFA 2XC4A 3HK6B 5K7RA 4CHAB 2FOFA 1ZJDA 2GZ7A 1C5PA 1FI8A 3SU2A 1IQIA 1TMTH 3O8BA 2G00A 5ABWA 1O35A 3QUMP 4UFGH 3TLOA 1CT4E 4OS4A 2YOLA 1SBWA 1MQ5A 1E34B 3CS7A 1C5WB 2ZFPH 1ZRKA 1GI1A 3FP6E 3M61U 2GV6A 1F92A 1YCPM 1NESE 2QGRA 1ZSKA 2WUBA 1OSSA 4JK6A 4DY7B 4X1NU 1CVWH 3UUZA 1H8DH 2OTVA 4AOQA 2J2UA 2A32A 5EG4A 3SNDA 3RLWH 3GCOA 1W8BH 1Z8GA 5A0CA 3PROA 5DP8A 1XKBC 2BLVA 1KYNA 1YP9A 5T6DA 1K2I1 1PQ8A 3L3TA 2V6NA 1MMJN 3SHAH 2C4FH 3ATMA 4TPYA 2YNBA 2FX6A 1V2JT 1A1RA 1ZHRA 2SGDE 1AFQC 1C5NH 3OTJE 3RXKA 2A7HA 1CBWB 1HAVA 1LVMA 1W12U 1BRCE 1DOJA 3HGNA 1ESAA 1QQUA 1GJBB 1P06A 3RMLH 4BANB 3S69A 1O39A 3UQVA 2B9LA 4JYUH 4I7YH 1P2OA 3M37A 1TNKA 3M7TA 1O3CA 2C90B 2CHAB 1GCDA 4GLYA 4X2YA 4KELA 1CA0B 5J4QA 3U69H 3VB5A 4GCHF 1CGJE 1Z8IB 1QGFA 2XBWA 2ZEBA 4WMFA 2HNTF 5JDUB 2PUQH 3RXSA 4U32A 2A5IA 4ABJA 4YOGA 1IQLA 1TFXA 2IN2A 3LC5A 2ILNA 2WPHS 3GDVA 3MYWA 2PSXA 3A82A 4OGXA 2JH6D 1O2LA 5C5OA 1GHYH 5PTPA 4NWKA 2G81E 4PROA 2Y5HA 4H6SB 4U30A 4MTBA 4X6NA 3RXJA 1VGCC 4RKJB 1H9LB 1WV7H 4BAQB 3OU0A 1MTNB 2AS9A 2BQ7B 4A7IB 5A09A 3ESTA 2NU1E 5GXPA 5FHTA 1C2JA 3B8JA 3VGCB 3EA8A 3SJIA 3A8AA 4A1XA 3SJOA 1FAKH 1WU1A 1K1OA 5AVDA 3LGTA 1UTKA 3T2NA 3MH6A 2XXLA 3LGVA 3JZ2B 3GISB 2VIDA 1EPTA 1VJ9U 2Y5FA 2V3HH 3T26A 1PPFE 2SGFE 2BQWB 1Y3XA 5JBTA 1WCZA 1C5RA 1C4Y2 1B5GH 3OY5U 4WXVA 1MBQA 2Q1JA 3O8RA 5FPYA 1SQTA 2VIVA 4OS2A 3ZZDA 5C3NA 2ZGCA 2OINA 1PQAA 1UO6A 1ELEE 1PQ5A 1Z1IA 4B76A 4JZEH 1P2KA 2OC7A 1E37B 4JZDH 1FY5A 2XC0A 1TGNA 4B71A 2SNWA 2VU8E 4J1YA 1NRQH 1XXFA 2ZPQA 4B73A 2GT7A 3P8NA 2V35A 1GBMA 1ETRH 1ZPBA 1GMCF 1O5DH 1O31A 1O3JA 1QY6A 1SFIA 3IWMA 1N8OB 2OBOA 1OYQA 3GY2A 1BMNH 4GCHG 1F2SE 3MO3A 3TGJE 3DD2H 5L2YH 4Y8XA 1TPSA 3LOXA 1SGYE 1TB6H 4ISNA 1P10A 3RC5A 3F68H 5E0GA 3S7HB 3SNCA 2ZTXA 1SGNE 5EU8A 3TPIZ 1VITG 2ANWA 2CV3A 3A89A 4NSYA 1AD8H 2EC9H 1BRAA 1CQQA 3QTVH 1T7CA 2Z3EA 5C20A 1TALA 1GHAF 2F9NA 4FUJA 1E36B 2QAAA 2PGQB 3OYPA 3U9AH 2CMYA 1P2JA 1AWHB 4AYVB 3SUFA 1P01A 2Y82A 2BOKA 3AAUA 1NS3A 2G4TA 5AFZH 1NFXA 2ULLA 2IJOB 3SJ9A 1XVMA 4UD9H 1O5FH 3PLBA 1ZLRA 1BTYA 3HK3B 2HVXA 1AVGH 2BYAX 2BVRH 2FESH 4FU7A 2VVVA 4JZIA 1HJAC 1V2WT 1O5GH 1O2XA 4KGAA 1GBJA 1O3GA 1C1SA 2OQ5A 3GY4A 4DW2U 1AVXA 1RFNA 2AMQA 3ZZ4A 1A0JA 3RXOA 3E0NB 1O3DA 1FUJA 1ELDE 1AKSB 1S81A 4ASHA 3MU0A 2VWMA 2C93B 1C5QA 1MKXK 2ZFTA 3RXDA 1DXPA 1HAXB 1RD3B 1DITH 5GPIB 2OBQA 2ZDVH 5HGGA 4HGCA 2R2MB 1GCTB 8KME2 4Y11E 1GMCG 4AX9H 4NZLA 4Q80A 1QRXA 1SI5H 5F8XA 1GBIA 2AGIX 1KLJH 5C2ZA 3FP8E 1YF4A 2BD8A 2UUJB 4NA7A 1QFKH 3TK6A 2W5EA 2PTNA 1NROH 3UNRA 4WVPE 3MMGA 3OX7U 4Q7XA 3SQEE 4FUGA 1RIWB 4MNXA 1MUEB 2FYQA 2QXJA 1BB0B 1ZYOA 1HIAB 1YGCH 1ID5H 4K60A 4CR5A 2BX4A 5CHAB 4BNRA 1BTUA 1K1JA 2P95A 3TJUA 1BMLA 3FANA 5IYTA 1GJAB 1VZQH 1C5UA 5LPFA 1O5BB 1GHAG 3QZQA 1BHXB 3MNXA 4Q7ZA 3KQBA 1XXDA 1TGSZ 4MPVA 5TJXA 1FAXA 1SHHB 1MTVA 1O2TA 2PKAB 1C5MD 2CF9H 1C5LH 3MO9A 3QZRA 3RMOH 2ZTYA 7LPRA 2O8MA 4U2WA 1MTSA 5DP9A 1Q3XA 2BD9A 4VGCC 1AGJA 1DXWA 2ZGXH 1P57B 3SI4H 1K1LA 2WPIS 1O0DH 2H9HA 2TBSA 4M7GA 4UEHH 1MU8B 2ZFQH 3T27A 2BDYA 4UONA 3AAVA 4BXWA 1IHSH 2GMTB 1CT2E 5LPEA 1EZQA 3LGYA 2W26A 2PHBA 4UFEH 1C2KA 2R3UA 1FNIA 1P12E 3SU4A 1CHOF 3TGIE 5EPNA 2ZFRH 5FBIA 9ESTA 4X8UH 2BTCE 1GBFA 2A2XH 3RXMA 2HNTC 3GDSA 3RM2H 3VB3A 1AUJA 4X0WU 3ZVDA 4YOIA 5FAHA 2A4GA 3MNCA 3RU4T 2VGCB 1O2IA 2VB0A 3E8LA 3MH7A 3SO3A 4B75A 4BTUB 1FZZA 1O2YA 1TBRH 2ANKH 2C8YB 1OWKA 2XNIA 5LH8A 2BY5X 3BTDE 4DURA 1YCPH 2OXSA 5CMXH 1UVTH 1H1BA 1DY8A 2ZHDA 3EE0B 1GDNA 3GCNA 3VB6A 4I31A 1O34A 1YPJH 2ESTE 3A88A 1ABJH 1GI4A 4DIHH 1SGPE 3JZ1B 2NU2E 4E05H 3EGKH 3QN7A 3SV9A 1LKAA 4YT6H 1G3BA 4J2YB 1IHTH 1LHGH 1ZHPA 1J8AA 4OS5A 4DJZB 2PSYA 4GHQA 2AIPA 1O3IA 1SOTA 4JYTA 1ELAA 3BG8A 3TJVA 1DANH 3GICB 5SGAE 3U8TH 5G4BA 1P2MA 2XBYA 4ZHMU 1RTFB 1OWEA 1HV7A 1TNLA 4K1TA 4TYDA 2FLRH 4CH2B 7ESTE 1BUIA 2FX4A 1AHTH 1HDTH 3LT3A 2G5NA 1SGTA 2BD7A 2VH6A 2ZHQH 2F83A 3BTGE 1AE8H 1TABE 1HAOH 4A92A 2GCHF 1GI9B 1GHBF 1YCPK 1L0ZA 1JOUB 2QY0B 2BZ6H 2FP7B 5DP5A 4WXIA 1TPPA 2ZGBH 1CHOG 1OKXA 3BTHE