3LPRA

Structural basis for broad specificity in alpha-lytic protease mutants
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
198
structure length
198
Chain Sequence
b'ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACAGRGDSGGSWITSAGQAQGVMSGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-LYTIC PROTEASE
publication title Structural basis for broad specificity in alpha-lytic protease mutants.
pubmed doi rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase/hydrolase inhibitor
total genus 53
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1991-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3lprA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3lprA01
4ZXXH 1RIWC 1XUKA 1HB0B 1DX5M 2QCYA 1O2PA 1SGQE 4CH8B 1EP5A 5EODA 1A3BH 1AKSB 2OTVA 2P94A 1GCDA 3SGQE 3UFAA 1AB9B 1YC0A 3B23B 2PKSC 4MPVA 3UQVA 1TA2A 1IHSH 1GJ6A 5EQQA 2V3OH 5JDUB 1AGJA 3F9FA 3RXIA 1BMMH 1P2QA 1C1SA 1XMNB 5HM2A 1TNLA 4TPYA 3SU1A 3PO1B 3UNRA 5DP6A 5FXLA 1LMWB 3TNTA 1C1QA 2FODA 3GYLB 1W10U 4M7GA 3SV6A 3MU5A 4IC5A 2P95A 3SJ8A 3SOSA 1NS3A 1O5GH 1KDQB 1ANCA 1QB6A 2BTCE 1V2PT 1PYTC 4TWYA 4GHTA 3ZZCA 1O30A 1GI3A 5C5NA 2LNCA 1XKBC 2ZDNA 1KXAA 3MO6A 1BMNH 3MU1A 2FS9A 1MMJN 3Q00A 3VB4A 3E1XB 3EGKH 3K2UA 3SBKA 2ZHEH 3RXCA 2CHAC 2Q1JA 1GL1A 2ZZUH 3LGWA 1PPBH 3LGIA 1SGDE 4X6NA 3AAUA 1ELAA 3GY6A 4ISNA 1EOJA 2VIDA 3LC5A 5C1YA 1CO7E 2PFEA 3E0NB 2ZHDA 5TCCA 4O3TA 2GZ8A 2BDCA 4UD9H 1EQ9A 2I6SA 1QCPA 3A80A 1HAYB 1DWCH 1K28D 1O3HA 1ZSJA 3BN9A 1PPFE 1W7XH 1Y3XA 1INCA 1UTPA 1G3DA 1C9PA 1P11E 2P8OB 1GI0A 1O2YA 1GDUA 2BY8X 1UCYK 5DP9A 3ZYEA 1SGEE 4THNH 1MQ5A 1J9CH 3SI3H 3SNAA 4U2WA 1SBWA 1IHTH 1BRUP 1NFXA 3RP2A 4D7FA 1YCPM 1O3LA 1THSH 4SGAE 4LZ1H 2SGAA 2C90B 4YOGA 3M7UA 3PTNA 4K69A 1TBRH 1LVBA 3GY7A 5C2ZA 1QFKH 4WXVA 1QA0A 1P3EA 2JETB 3M3VA 1G36A 1DWEH 3S9AA 2ZIQH 4YLQH 3UOUA 1BRAA 1P3CA 1MKWK 3L6PA 3SU2A 1C5TA 3MO9A 2DE8A 2VIOA 4D9QA 2Z6BD 1W14U 3M3SA 2GVFA 3T62A 1UHBA 4E05H 3P8OA 3DFJA 6CHAB 2NU4E 2HNTE 1GCTB 2H9EH 3RXGA 2WPKS 1UTNA 5ETXA 1GBJA 3EA9A 3W95A 2VWOA 1MAXA 4NWKA 8GCHG 1Z6EA 2EI8A 5FCRA 3A84A 1EAWA 1EZUC 4A92A 4ZKSU 4AOQA 4NZLA 4F4OC 3AW1A 2ULLA 2XC4A 1HAPH 4HTCH 4X1RU 1WAYB 4ABIA 3UQOA 4LOYH 1C9TA 3A7YA 1G2LA 2V35A 1W0ZU 2QXHA 1AWFH 2VGCC 1AKSA 3SQEE 5HGGA 3MNBA 2GD4B 4CHAC 1LPZB 1O2GH 4GUXA 4ZKOU 1PPGE 2SGQE 2FWWA 2Y81A 1S6FA 4I8GA 2PWXA 2XC5A 3NPSA 3V13A 1C4U2 3R0FA 5JBTA 2BXTH 1WTHD 2P3UB 4YT7H 4E7RG 2GCTC 4MTBA 2A5KA 1UK4A 2LPRA 1KXCA 1V2JT 4NZQA 1UTKA 3FP8E 1C2HA 1W2KH 9ESTA 3QUMP 1DS2E 1GHZA 1YPHE 1ELVA 2J34A 1G32B 1BDAA 4TPIZ 5L2ZH 3B9FH 1QJ6B 3BTME 5FX5A 1VCWA 4HGCA 1TGNA 1A2CH 3RXJA 5FPYA 2OC8A 1HFDA 1FPCH 3TPIZ 3E0PB 3NZIA 1PJPA 1O3MA 2W7SA 1AN1E 1C2FA 1L1JA 1YPMH 4Y79A 4IW4E 3ZVGA 4ABDA 1AFQC 1GMCG 2W3IA 3KHVA 1TGCA 3T28A 5GJ4B 1MKWH 1Y5AT 1C5RA 1HAXB 1BTXA 1QY6A 4ZH8A 3RXBA 1GMHG 4KGAA 2VH6A 4MDSA 3SJ9A 1ZOMA 4DW2U 5H4IB 1SGFA 1K9OE 3EAJA 4D8NA 1V2QT 3GCNA 4QT8C 4BXSA 3CP7A 1O5EH 2Y7ZA 1GHWH 5LGOA 2Q6FA 2A7JA 4DOQA 2G5NA 2XBWA 1P09A 2FLRH 2A45B 5EQSA 2ZPSA 5EPNA 2OC1A 2ZGJA 4AFZA 2FTMA 3QO6A 1SFQB 3Q3YA 1O36A 3AAVA 1C5QA 3N7OA 3PV4A 2FEQH 2TBSA 1L4DA 3F9EA 2OINA 4VGCB 1P9SA 3UR6A 1XUFA 3RMOH 2A4QA 2G4TA 1GBMA 2J95A 3RXMA 2Y5HA 1JRTA 2ASUB 4HFPB 3MH5A 3S9CA 1Y5BT 1MH0A 3PLPA 3UWIA 1HUTH 4U32A 2PGBB 1KXEA 1TA6A 4Y0ZE 2FPZA 1DXWA 1D3PB 2HPPH 4FUBA 3MH6A 1O39A 3BIUH 2BVRH 1F5KU 1UVOA 3V0XA 1GG6C 1NM6A 1TLDA 1BA8B 3ITIA 1IQLA 1C1NA 3ZVCA 4D76A 5L2YH 4DCDA 4BOHA 4AN7A 1WCZA 4O9VA 1O3DA 4NSVA 4KTCA 4O3UA 3D65E 3DUXH 1DUAA 1A3EH 2AIQA 1ZTLA 5EU8A 2PLXA 3GICB 2BLWA 1VR1H 1D3QB 1O2RA 1ZGIA 1ELDE 2FOEA 1D3DB 4NIXA 1ZGVA 2AMPA 3MHWU 1D6RA 2CF8H 1PPCE 4JZ1A 3H7TA 1UTJA 1TNGA 1ZR0A 4TY7A 1K1LA 2BD9A 8ESTE 2A1DB 2R2MB 4KELA 4BTTB 1SLXB 4B2CA 1BBRH 1UMAH 4BAQB 3BTEE 2B8OH 1K2I1 1SHHB 1X7AC 1EAUA 3MH7A 1JIRA 2O8WA 1GMDG 5JB8S 1LVYA 1B0FA 1A0LA 2ZDVH 4WH8A 4B75A 1J8AA 1LPKB 2WUBA 5JYIA 5T3HA 3VB3A 4XBBA 3A89A 1E35B 1PPZA 2TGPZ 3BTWE 1V2OT 3P70B 3LGUA 3RXLA 4CREA 1GBTA 4NA9H 1H9HE 1YPEH 2BLOA 5EXLA 1LO6A 5GIBA 4JYTA 2FLBH 3ODDA 3TGKE 3CENA 4XE4A 2ZTYA 1H1BA 6ESTA 1GJ4H 3S9BA 1ZMNA 4R8TB 2ZGHA 2C8YB 3FANA 4B2AA 3P8NA 3QGNB 5EGMA 3MMGA 2O8MA 3QTVH 2OP9A 1EB2A 3ATLA 1HYLA 3UNQA 1FQ3A 2EI6A 4IGDA 3LDXH 1KSNA 2SGPE 1SLVB 4X6PA 2BD8A 1HAZB 3TU7H 3LC3A 1QB1A 4I8KA 2ODQA 1AMHA 1UK3A 3SW2B 1ABIH 3KQCA 5LH8A 1GVKB 3RU4T 4DJZB 2FXRA 1HAOH 4Q80A 1Z8RA 3GY2A 5K0HA 3SV8A 1SGRE 2Q6GA 4IBLH 3ZV8A 4ZKRU 1C2JA 4Y71A 4RN6A 2B9LA 2VH0A 3RC4A 1QL8A 3I29A 3RU4E 1BTPA 2BB4A 1ABJH 1QBNA 1GHXH 4CRDA 1PQ5A 1RGQA 3ATWA 5AFYH 2B7DH 5TJXA 1TNJA 1KIGH 2UWOA 2XW9A 1DE7H 1CA8B 4X6OA 1TABE 2FOGA 2FMJA 2ZG0H 3KEEA 4IS5A 3E91A 3KIDU 4ABBA 3LGVA 2V6NA 1QRXA 1MKXK 1D9IA 2OD3B 2FOHA 2D26C 1A61H 1BOQA 2PTNA 1W8BH 1UTMA 4FUDA 1KY9A 1Q3XA 1YYY1 3ZZ3A 5A8XA 4RSPA 2AERH 3RC6A 1IAUA 1P2KA 3URDA 1ESAA 2IJOB 1N1LA 3O8DA 4UFGH 4X1SU 5GDSH 3T5FH 5C3NA 3SHCH 1ZJDA 2YNBA 2G5VA 3MH4A 4B76A 3E6PH 1NRSH 4B73A 1FY1A 2WPLS 3LT3A 3RC5A 2XXLA 4ABFA 2HGTH 1SQAA 4FU8A 1GBKA 3F68H 1CA0B 2P16A 4MPWA 1E36B 1BRCE 1GHYH 1GJ9B 4X6MA 3RXHA 1GJ7B 1ZYOA 1XVOA 1DSUA 1GJDB 3HATH 4FUGA 4FUFA 1PPHE 1AB9C 1NPMA 2ZEBA 2XWBI 3Q76A 5AVDA 2DE9A 1E0FD 4DY7B 1V3XA 3RU4D 2GX4A 2ZGCA 1OOKB 4X2WA 5I46H 3GYMA 3RXDA 3BV9B 2SGDE 3PO1C 2ZNKH 8GCHF 1NC6A 1C1VH 4YOIA 3ZVBA 2R9PA 1AWHB 2TPIZ 4JK5A 4NIWA 2BLQA 4NCYA 3RLWH 2PTCE 1TNKA 5F6MA 3ZVDA 4MNYA 3GDUA 2D8WA 2AMDA 1YF4A 1S83A 4NIVA 3PWBA 1EXFA 2KAIA 3RXFA 4U30A 3S69A 3TK9A 4CR5A 1CQQA 1YCPK 3TGJE 3KN2A 3M36A 1SQTA 4ISIH 3LGTA 1TRNA 4ZUHA 1EAXA 1NRNH 1VITF 4LXBH 1AU8A 1LHEH 4K1EA 5DKMA 1P10A 4AFSA 2BD5A 3F9GA 1K1PA 1SB1H 3EA8A 2FIRH 2HWLB 2PGQB 1Z1JA 1NRRH 3TGIE 1MKXH 4CBOA 1WUNH 1GJ8B 1A0HB 1ZSLA 2DUCA 2RA3A 2XBYA 1OXGA 5DPAA 1O32A 1DXPA 3BG8A 4DT7B 3M7QA 1ANDA 3PROA 3MFJA 1FY5A 4YTAA 1KLIH 3PMBB 1EASA 1HXFH 1V6DA 2Z3DA 4KP0A 5EQRA 1FUJA 1NTPA 4ASHA 4X8TH 4OGYA 4DIHH 1FN6A 1XUGA 3I77A 1O2SA 2G4UA 1C5UA 2VWNA 3HKJB 2NU1E 5DP8A 1Q2WA 3A7XA 2QC2A 3C27B 3H7OA 2QGRA 3T27A 1O2VA 3KQDA 5AFZH 1HV7A 4WMEA 3ATKA 1C2GA 1JXPA 2R3YA 2P3TB 3P17H 2P8OC 3RM0H 1W7GH 3VB6A 1XVMA 4BTIB 1IQIA 4WMDA 2ZTXA 1GMCF 2F9OA 2H6MA 2VU8E 1ESBA 2FO9A 2Z9GA 1C1TA 1MZAA 2C8WB 1TQ0B 2Z94A 2FOBA 1GMHF 3HGPA 1FMGA 1ELFA 2BOHB 1O2IA 4CRGA 1THRH 4BAHB 3S0NA 1LVOA 1C5ZB 1LCYA 1QR3E 3KQBA 3DT0H 3TJUA 5FPTA 1GHBG 2ZDLA 2JETC 2CF9H 2BHGA 1SGNE 4H4FA 4CRFA 7GCHG 3TJNA 1CBWB 1QRZA 1F5LA 3TJOA 5JB9S 1ESTA 1AE5A 1V2RT 2ANYA 2GTBA 2ZFTA 3H5CB 4JZFH 3GCTG 1P0SH 3KQEA 6CHAC 1P9UA 1GCTC 4H6SB 2F9PA 1O3FA 4JZDH 4BAMB 1K21H 1C1UH 5TCAA 4H6TA 1S5SA 1C1WH 2AYWA 1MTVA 4GAWA 2D1JA 3UOPA 1A5HA 1BHXB 1ACBE 2AEIH 5C20A 4FU9A 1TX6A 1Y3VA 2BDHA 1HAGE 3A83A 4I31A 3NK8A 1AIXH 1LHGH 1C5XB 5A0AE 1B0EA 2ZCHP 3RM2H 3VGCB 2FDAA 1T4VH 1WQVH 3FP7E 2RCEA 2ZFFH 3IWMA 4B71A 1BT7A 2XCNA 1B5GH 4R0IA 3OU0A 4K8YA 2FX6A 4Y8XA 1AUJA 2BD2A 1C1MA 4Q7XA 3UY9A 5IDKA 1OWDA 1ZTJA 4I7YH 3K6ZA 4SGBE 1GI8B 1Z8IB 1C2LA 1O2NA 2ZDKA 2Y80A 2SGFE 4MLFB 1RFNA 5LPEA 2OC7A 2VVUA 1ELTA 2XBXA 1GMDF 5ESTE 2WV4A 1FY8E 1TMTH 3SNCA 1SFIA 3PLBA 3BTFE 5LPFA 2AIPA 4MNVA 2VVCA 2NWNA 5DK1A 1BMAA 5HXFA 3E8LA 4AGKA 1GBCA 3W94A 3LU9B 2G52A 1C5LH 1GBIA 1BQYA 1NU7B 1TAWA 4XBDA 2PHBA 1MBQA 1TRMA 1N8OB 2D2DA 1Z1IA 3OTJE 1P04A 3SUGA 3AW0A 1MU8B 1YLCA 1EATA 2ZFPH 7ESTE 2QXIA 3LJJA 1A0JA 2ZC9H 5CMXH 2Y7XA 3TK6A 2ZFSA 1CSOE 1JMOH 1XUIA 1P2NA 1C5MD 2Z9KA 1ZMLA 3V7TA 4AFQA 2XTTB 2B5TB 4ABHA 2W3KA 3D23A 1FZZA 3TVJB 1K22H 1ZSKA 2ZI2H 1K1NA 1BTUA 1NY22 4VGCC 1BIOA 3A85A 2AGEX 1WU1A 4DG4A 3M5LA 1CU1A 2HVXA 1C4Y2 2UWLA 1EZQA 4FXGH 1YGCH 3K9XB 1IQEA 1O3NA 4JCNA 3OY6U 4K60A 4A5TS 2YOLA 5GCHG 1QB9A 1P02A 2IOTA 2BDYA 3A81A 1ZPBA 3KF2A 3UIRA 3GDVA 1OP0A 1RTKA 2PSXA 1UCYH 2JKHA 3GCHB 4NIYA 4FVDA 2ZO3H 1DVAH 3ZZAA 1SLUB 8KME2 1C2DA 1GL0E 2OLGA 3E90B 1HRTH 3BEFB 5C67A 2GKVE 1H9IE 4TY6A 1AUTC 4ZHAA 2ZCLP 1K1JA 1QTFA 1AY6H 1FI8A 1GWAA 3EYDA 1OYQA 1KXBA 2FOAA 2STBE 4KKDA 3VPKA 5EXMA 1GI4A 1V2NT 1KTSB 2EC9H 3A86A 3P6ZB 4AB8A 1D4PB 3PMAB 1ANEA 2HRVA 2UWPA 1MUEB 3WY8A 1GBLA 5K7RA 4HZHA 3SV7A 2G51A 2WPIS 3NWUA 4XSKU 1Z6JH 4A1VA 1G37A 2G81E 3TH3H 1IQGA 4K3JA 2FOCA 3RDZA 2YNAA 1VITH 1SL3A 2F3CE 1XXFA 1O38A 2H5CA 1CGJE 2QXJA 4MQAA 2ZHFH 3QGJA 2AH4X 3KNXA 3UREA 5B6OA 3VB7A 1HIAB 2FX4A 1AFEH 4Q7YA 1MTUA 3M35A 4JZEH 1YPJH 4K5ZA 1MD8A 3PM3A 3SN8A 4BXWA 5F03A 5ESBA 3VEQB 1HPGA 2F9UA 4IN1A 3ZZ8A 1ARCA 3UPEA 3RLYH 1HGTH 1TOMH 1G9IE 2GV7A 1EZXC 3G01A 3PB1E 1FXYA 1OYTH 2BX3A 3AVZA 3BTKE 3M5MA 3KGPA 2BX4A 2F9NA 1EB1H 3TJVA 1N6YA 5DJ7A 6LPRA 1MTNB 2XCFA 3PLKA 1ETSH 2BDIA 1EUFA 1OP8A 3P92A 1PPEE 4ZHLU 1BTHH 2ZU3A 3U1IB 5EPYA 3QZRA 3JZ1B 4I8JA 1UVTH 1O0DH 5E0HA 3MNCA 3MTYA 3PTBA 5FBIA 4XDEA 1A7SA 1QQUA 3TK5A 3MO3A 2CN0H 4X8SH 3RMMH 3VXEH 3GDSA 3QK1A 3NUMA 3GY4A 4KTSA 1F0SA 2Z3CA 1TGTA 1F0TA 1RD3B 1SGTA 2TRMA 2KAIB 3O8CA 1C1PA 1F0UA 5HYOA 2ZFRH 5GWZA 1Z7KA 3QWCH 3ZZDA 3EA7A 1ZLRA 4F49A 5ABWA 1DM4B 2HPQH 3KL6A 2FTLE 2R0KA 2ZU5A 2GP9B 4LZ4B 2BM2A 2J4IA 2O8UA 1UO6A 7LPRA 1PFXC 5I25A 4JZIA 5FBEA 1C5OH 3ZZ9A 4FUHA 1F7ZA 3K65B 3FFGA 2WV5A 3ZV9A 1TONA 2J92A 2BZ6H 3M37A 3SJKA 3QX5H 3MU4A 1TYNA 1JWTA 1GHBF 2J94A 4YZUA 4O97A 2F83A 2JH0D 2XNIA 1IQNA 1OX1A 1TPSA 1OWKA 2BY5X 4UFFH 1YBWA 7GCHF 1TBZH 1CA0C 1CHGA 2TGTA 1O3OA 5FPSA 2Q6DA 4A1XA 1JOUB 2AGIX 4B1TA 1P2JA 1VGCB 5L6NH 1F5RA 1T8MA 3Q3XA 1V2VT 1TGSZ 4I33A 3A8AA 1BJVA 3GCTF 1UTLM 4WJG2 4Q2KA 2ZTZA 4NSYA 2FP7B 3SHAH 4DGJA 1PYTD 1GDNA 1CE5A 1Y3WA 1Y3UA 2GMTB 3QN7A 5F8ZA 2P93A 1DUEA 1GJBB 2C8XB 2CV3A 4ZKNU 3U98H 3RXUA 4WXIA 3V3MA 1OWHA 3URCA 3CS0A 1HAIH 2QYIA 1B7XB 2QXGA 1NRQH 2VJ1A 3O8RA 2QY0B 4X8UH 2A5AA 2QA9E 2WPJS 1W11U 2ZHWH 1DFPA 1TQ7B 1F0RA 1SGIB 2BZAA 2XRCA 1BBRE 1TIOA 4I8LA 4JYUH 4AG1A 4DIIH 1L1GA 3OY5U 5E2OA 5GXPA 1Z71A 3DA9B 3IG6B 3PMJA 1GBBA 3BEUA 2BQ7B 1BTYA 1HJ9A 1WSSH 1W3CA 1HCGA 3F1SB 3D49H 1O2ZA 3ZYDA 2BD3A 4Q7ZA 4LK4A 5DGJA 1MTSA 1SOZA 1HIAA 1BJUA 4I8HA 4B74A 3F9HA 2HNTC 4WVPE 2BY6X 4X8VH 2BVSH 5J4SA 1QRWA 3ZZ7A 4UEHH 4YO9A 1QGFA 5A0CA 3RUOA 2C8ZB 3BTDE 3NCLA 1W13U 1QURH 2ZECA 3OSYA 4X1NU 4B2BA 1CHOG 1CVWH 3SJOA 3PYHA 4Y7AA 3BTTE 3ATIA 1SPJA 2P3FH 6GCHG 2BD7A 1HDTH 4AORA 5JBAS 1NRPH 2J2UA 1LPGB 3SGAE 1GBHA 1V2UT 1O3CA 1WBGB 2ZF0H 1P01A 1S84A 2EA3A 1JIMA 1BITA 1EAIA 1S0RA 2AFQB 1OSSA 1RXPA 1PQAA 1A1RA 4GHQA 4FUEA 3U69H 4YOJA 4X2VA 1C4V2 3VXFH 1J14A 5CHAB 4MVNA 2XC0A 2GT8A 3A82A 3TH2H 1CBWC 4BAOB 1UVUH 1RJXB 1TE0A 1GBAA 1FONA 1E38B 1GVZA 1TBQH 3T25A 1D3TB 1SC8U 4A6LA 3BG4B 1AD8H 3M7TA 1GI7B 3BF6H 3ELAH 3HPTB 1TNIA 2STAE 3KCGH 1MCTA 1K1MA 4XOJA 5BRRE 1SQOA 1OP2A 1U6QA 4U01A 5GCHF 1BB0B 4FUCA 2ZQ2A 2OBQA 1WQSA 3HK6B 5AHGH 4D7GA 1GJAB 1IQHA 1GJCB 2AGGX 1O3AA 1EPTB 3M5OA 1O3KA 4JYVH 1L4ZA 4NGAH 1AVXA 1DWDH 4GSOA 4X1PU 4CH2B 5T6FA 2PW8H 2Z9IA 2JH6D 3EQ0H 1ELCA 1MBMA 3DD2H 1C5NH 2FI5E 1P12E 3Q3KA 3SGBE 3STIA 1NROH 3P8FA 1AZZA 3DFLA 1ZTKA 3ZZBA 1S82A 2C93B 2QAAA 2FOMB 1O2KA 3B8JA 4ABEA 3VGCC 1ELGA 1T8LA 1IQMA 3GY8A 3MU0A 3MU8A 1LDTT 4X1QU 1A4WH 2Z9LA 4YM9A 1P2MA 1VJ9U 3T2NA 4ISOA 4BTUB 1P57B 2PKAA 4OS5A 1O5CB 1TGBA 3UWJH 2THFB 1LKAA 1HAVA 1HJAB 2RG3A 5JPMH 3UUZA 1QL7A 3SUDA 1TOCB 3SU3A 4AYYB 2ZDAH 5L30H 1DY8A 2VVVA 4ABGA 2H9HA 2UUJB 3VFEA 2ESTE 3DHKH 2A7HA 4GCHG 3RXPA 2CGAA 3U8RH 1NT1A 1AI8H 1O3JA 1GBEA 2AS9A 1FDPA 5EXNA 1MZDA 1VCPA 1L0ZA 2NU0E 1YP9A 1D6WA 2ZU4A 4NA7A 1VCQA 4AYVB 1KTTB 2QF3A 1WTGH 2ANWA 1ZMJA 2FM2A 4A7IB 1SHYA 2VIPA 1AVGH 4Y8ZA 2Y5GA 1BCUH 3ENSB 4A1TA 1HBTH 2QN5T 2ZQ1A 5E8EH 1OWEA 3SV2H 2TGDA 1DANH 1HXEH 1N8OC 1OWJA 4GLYA 3I78A 3LH3A 1KXFA 3RXRA 4Z6AH 3UR9A 2BD4A 2GDEH 2R3UA 4AX9H 5DO4H 1GHAG 1YCPH 3MNSA 4NWLA 4YESB 4ESTE 1GHVH 1QA7A 2ZPQA 5T6GA 2SNVA 4Y8YA 3ZZ6A 1C2EA 1CT2E 1WOFA 3MOCA 2WPHS 1EJNA 4OS7A 2IPHA 3ZZ5A 4O03A 2A4RA 1EZSC 1BTZA 1LVMA 1DT2A 4ZAEA 3GCOA 1O2MA 5E0GA 4UONA 2PSYA 1OWIA 3ZZ4A 1AQ7A 2O9QA 1O5AB 2HALA 3ATMA 4WH6A 1E34B 1QBVH 5FHTA 1O3GA 1SGYE 3QZQA 5GPIB 3MNXA 4MPXA 1VZQH 5JBBS 1GGDB 1TMBH 2XBVA 1O34A 4BNRA 2OCVB 1O2LA 2C3SA 1YM0A 1AO5A 1JBUH 1HNEE 1XKAC 4K8BA 3GY3A 2ODPA 1SVPA 4IN2A 1ID5H 2W5EA 1V2MT 3RMNH 2ZCKP 2SNWA 1O37A 1LHDH 2FS8A 4GVUA 1SGPE 3A87A 3NKKA 1J17T 1K1IA 3NXPA 2FI3E 5C5OA 2CJIA 1GDQA 3P95A 1FAKH 3GCHC 2RA0A 1MQ6A 3RXAA 5DP4A 1T4UH 1SGFG 1ZJKA 1A5GH 1RIWB 5IYTA 1BRBE 2OQUA 1O2UA 1E37B 3K6YA 1DICA 3F6UH 1KLJH 1O35A 2ZHQH 1P06A 2PKSB 3QLPH 3RXQA 2UUKB 2V3HH 2A4OA 1V2WT 1O3BA 1GI6A 1KLTA 1NFUA 2Y6TA 3TITA 1HAHH 2TIOA 2GCHG 2JH5D 4IMQA 1ELBA 1TX8A 1UK2A 3GISB 1YPLH 2ZKSA 1EPTA 2BDGA 1V2TT 1P2OA 2WPMS 2ANMH 1KYNA 2GT7A 2H5DA 4XFQA 4OGXA 1NFWA 2BLVA 4BANB 1G30B 1C1OA 2ZGXH 3OX7U 3BTQE 3FP6E 3ODFA 2C4FH 2ZPRA 4ABJA 1T8OA 2NU3E 1IQFA 3UNSA 2FOFA 3SJIA 4ZHMU 4CRBA 1WYKA 2VIQA 2CMYA 2OXSA 4AFUA 1A46H 2F9BH 3E16B 1NN6A 1S6HA 1O5FH 5PTPA 2CHAB 3RXTA 4ZXYH 2I6QA 2FYQA 2RDLA 1LQDB 1IOEA 1TWXB 1GVLA 1CT4E 2PUQH 5E2PA 2A4GA 3BTGE 3FZZA 3D62A 2BQWB 1V2ST 2M5TA 3TNSA 4JK6A 5DP7A 1VITG 3RXEA 1S81A 1SR5C 1ETTH 3A8BA 2GZ9A 1O31A 1HLTH 1GBFA 1MTNC 1O2XA 3C1KA 4ZROA 4E7NA 4INKA 1H8DH 3EE0B 1FV9A 4UFEH 5LPRA 1DDJA 1H8IH 1G3CA 2PV9B 3SZNA 4MNXA 3MWIU 2XYAA 4MPUA 4JMYA 2H1UA 4K1SA 1C5YB 3FZDA 1Y5UT 1KDQA 2PR3A 1DWBH 1Z8JB 1MAYA 3TIUA 1DPOA 1PQ7A 1W12U 1ZRBA 1NO9H 1TMUH 3SU6A 2VWMA 1CHOF 4ZMAH 1YLDA 1NZQH 1UVPA 2K1QA 2CXVA 1P05A 2G8TA 1O5BB 1Y3YA 2W7UA 6GCHF 4CRCA 1SGCA 2ZDMA 1BBRK 1ZPZA 1CGHA 3LOXA 5EOKA 2WYGA 1M9UA 3U8TH 1K1OA 3S7KB 1BTWA 1J15A 1Q31A 2BXUH 1TRYA 3IITA 2VINA 5A8ZA 2A5IA 2BQ6B 2ILNA 4ISLA 1A5IA 4ABAA 2TGAA 4DURA 3ZVFA 4OS1A 1LQEA 1LTOA 3UTUH 1F2SE 4J2YB 3A8DA 1UJ1A 1QHRB 5F8TA 4K2YA 2O8TA 1F92A 1SSXA 4FVBA 2UUYA 3LKWA 3SORA 3T26A 4H42U 2A31A 2HLCA 3LONA 2SGEE 5CE1A 2OUAA 1ANBA 1V2KT 1EP6A 3Q77A 3E3TA 1VGCC 2VIVA 3HKIB 2F9VA 1UCYE 1THPB 4Z0KA 2VGCB 3VB5A 4CHAB 1SI5H 3RXOA 1C5SA 2ALPA 2Z9JA 1ELEE 2J9NA 2GMTC 1L1NA 1OPHB 4X2YA 2G55A 3TH4H 1LHCH 1O2HA 1MTWA 5DP3A 4XBCA 1UTQA 4RKJB 4KTUA 1ARBA 4FUJA 4NG9H 2GCTB 1OS8A 1J16A 4FU7A 1C5PA 1MD7A 2UUFB 2VNTA 2ZWLH 3RXKA 1XXDA 1TALA 3P8GA 1LKBA 4Y0YE 1O2TA 2H2ZA 5T6DA 4UFDH 2BY9X 1W0YH 2SFAA 1OKXA 2QF0A 1RTLA 5E0JA 3RXVA 1SMFE 1C2IA 4OS6A 1DLKB 5DG6A 2NU2E 2A0QB 3PMHB 1QNJA 1T8NA 5HM9A 3GOVB 1MU6B 1AFQB 3SI4H 3A7VA 4TYDA 1ZHPA 5BPEA 3U8OH 4CBNA 2Z3EA 1XM1A 2F91A 4HI3A 3MYWA 4MNWA 1NESE 4INLA 2FI4E 1H4WA 2HNTF 4GCHF 1QJ1B 1AZ8A 1SLWB 1ZPCA 5A8YA 2P59A 2G00A 3RMLH 1TPPA 3SUFA 5JBCS 3HGNA 2A7CA 3FVFB 2ZGBH 2Y5FA 4OS2A 4AB9A 2ALVA 2GV6A 1TB6H 1YPGH 3CS7A 1O2QA 1FY3A 3RXSA 1QJ7B 2BVXH 2WUCA 1Y59T 3O8BA 4DVAU 2FYRA 4UDWH 1N6XA 2AMQA 3V12A 5DP5A 1UVSH 3BSQA 3L3TA 3A7TA 4IMZA 4UE7H 3TLOA 4K1TA 3M5NA 4WWYA 3QDZB 1BZXE 2PKAB 3T29A 3LPRA 4D9RA 5C1UA 2J38A 1GHAF 1RTFB 1HAVB 3ZVAA 1XUHA 1ZHRA 9LPRA 1BMLA 3M61U 1GI2A 1XX9A 5HMAA 1QIXB 4Y76A 1C2MA 2B0FA 1AVWA 1KXDA 3SNBA 1S85A 5FX6A 5FCKA 1AHTH 3BTHE 4IC6A 3MI4A 1P03A 1GG6B 1O2OA 3PWCA 1IQJA 2QIQA 1IQKA 5CHAC 1HJ8A 1C5WB 1TPAE 2Z7FE 3SV9A 4WF8A 4I32A 1EJMA 1TNHA 1MCVA 1DITH 3BG4C 2HOBA 3U1JB 2BOKA 4YT6H 3A7ZA 2XWAA 3GY5A 5A0BA 1O3PB 4AZ2B 1GI9B 1TX7A 2BYAX 1V2LT 2OBOA 2ZU2A 2A2QH 3STJA 1UTOA 3SNEA 3L33A 1FY4A 2ANKH 5A09A 1EPTC 4Y7BA 7KMEH 5F8XA 1EOLA 1G3BA 2GZ7A 4ISHH 3ZVEA 1FN8A 4E06H 1T32A 2A2XH 2A32A 4X0WU 2BDBA 1BHXF 1FIWA 1SOTA 1CT0E 1XUJA 1TFXA 2VWLA 3ESTA 2VB0A 3M3TA 2H9TH 1JRSA 2R0LA 2R2WU 3FAOA 2FESH 3SNDA 1GI5A 1C2KA 1FPHH 4FUIA 1GJ5H 3SU0A 1WV7H 4Y6DA 4AGJA 1GPZA 2ZA5A 1EKBB 1HJAC 2GCHF 4CRAA 2W26A 3A7WA 1RS0A 1TPOA 3S7HB 1DOJA 1QL9A 2BMGB 2ZP0H 5FAHA 2O8LA 2BY7X 3U9AH 4WMFA 1RRKA 3A8CA 4Y11E 4YLUA 3SO3A 2ZFQH 4MG3A 3SU5A 1FNIA 2IN2A 2ODYB 4GPGA 4INHA 1EX3A 2V0BA 3A88A 1O2WA 1CGIE 2OC0A 1PQ8A 3LH1A 8LPRA 2EEKA 2WYJA 3OYPA 1Y8TA 4OS4A 4RKOB 1EJAA 2PUXB 4Y10E 1ORFA 4NA8A 1AE8H 1O3EA 1P2IA 1T31A 1NFYA 3HK3B 1ZRKA 4WY3A 1YPHC 1ZHMA 1ZZZA 1DY9A 1FAXA 1GBDA 5AF9H 5J4QA 3LIWA 1O5DH 3LGYA 1LHFH 1QBOA 1H9LB 1FLEE 1SG8B 1ETRH 1YKTA 1BUIA 3EDXB 2FZZA 3SQHE 3QTOH 1C5VA 1FJSA 3BEIB 1S0QA 4J1YA 5SGAE 3R3GB 1Z8GA 4PROA 5A2MH 5EW2H 1VJAU 2OQ5A 1FIZA 3LJOA 3BIVH 1GGDC 1G3EA 4CR9A 5C1XA 2GGVB 1UHBB 1QQ4A 1O2JA 4X2XA 3SUEA 2BDAA 1C1RA 4TWWA 1GI1A 5G4BA 1L2EA 1NU9A 4NFFA 4NFEA 2VIWA 5EG4A 3JZ2B 1O3IA 1G2MA 1T7CA 4BAKB 2EI7A 1DSTA 2QV1A 2WINI 1DLEA 4AG2A 1YPKH 2Y82A 3SU4A 1P8VC 5EW1H 2ZU1A 3AASA 2GDDA 1O33A
chains in the Genus database with same CATH superfamily
4ZXXH 1RIWC 1XUKA 1HB0B 1DX5M 2QCYA 1O2PA 1SGQE 4CH8B 1EP5A 5EODA 1A3BH 1AKSB 2OTVA 2P94A 1GCDA 3SGQE 3FO8D 3UFAA 1AB9B 1YC0A 3B23B 2PKSC 4MPVA 3UQVA 1TA2A 1IHSH 3W1EA 1GJ6A 5EQQA 2V3OH 5JDUB 1AGJA 3F9FA 3RXIA 1BMMH 1P2QA 1C1SA 1XMNB 5HM2A 1TNLA 4TPYA 3SU1A 3PO1B 3UNRA 5DP6A 5FXLA 1LMWB 3TNTA 1C1QA 2FODA 3GYLB 1W10U 1NBMD 4M7GA 3SV6A 3MU5A 4IC5A 2P95A 3SJ8A 3SOSA 2EY4C 1NS3A 1O5GH 1KDQB 1ANCA 1QB6A 1E1QD 2BTCE 1V2PT 4Q4LA 1PYTC 3OEED 4TWYA 4GHTA 3ZZCA 1O30A 1GI3A 5C5NA 2LNCA 1XKBC 2ZDNA 1KXAA 4FOUC 3MO6A 1BMNH 3MU1A 2FS9A 1MMJN 3Q00A 3VB4A 3E1XB 3EGKH 3K2UA 3SBKA 2ZHEH 3RXCA 2CHAC 2Q1JA 1GL1A 2ZZUH 3LGWA 3F0OA 1PPBH 3LGIA 1SGDE 4X6NA 3AAUA 1ELAA 5KECA 3GY6A 4ISNA 1EOJA 2VIDA 3LC5A 5C1YA 1CO7E 2PFEA 3E0NB 2ZHDA 5TCCA 4O3TA 2GZ8A 2BDCA 4UD9H 1EQ9A 2I6SA 1QCPA 5HIYA 4YXWD 3A80A 1HAYB 1DWCH 1K28D 1O3HA 1ZSJA 3BN9A 1PPFE 1W7XH 2M2AA 1Y3XA 1INCA 1UTPA 1G3DA 1C9PA 1P11E 2P8OB 1GI0A 1O2YA 1GDUA 2BY8X 1UCYK 5DP9A 5DSFA 3ZYEA 1SGEE 4THNH 1MQ5A 1J9CH 3F3BA 3SI3H 3SNAA 4U2WA 1SBWA 1H8HD 3CNRA 1IHTH 1BRUP 1NFXA 3RP2A 4D7FA 1YCPM 1O3LA 1THSH 4SGAE 4LZ1H 2JJ2D 2SGAA 2C90B 4Z1MD 4P02A 4YOGA 3M7UA 3PTNA 4K69A 1TBRH 5C94A 1LVBA 3GY7A 5C2ZA 1QFKH 4WXVA 1QA0A 4RT1A 1P3EA 2JETB 3M3VA 1G36A 1DWEH 3S9AA 2ZIQH 4YLQH 3UOUA 1BRAA 1P3CA 1MKWK 3L6PA 3SU2A 1C5TA 3MO9A 2DE8A 2VIOA 4D9QA 2Z6BD 1W14U 3M3SA 2GVFA 3T62A 1UHBA 4E05H 3P8OA 3DFJA 6CHAB 2NU4E 2HNTE 1GCTB 2H9EH 3RXGA 5HIZA 2WPKS 1UTNA 5ETXA 1GBJA 4I86A 3EA9A 3W95A 2VWOA 1MAXA 4NWKA 8GCHG 1Z6EA 2EI8A 5FCRA 3A84A 1EAWA 1EZUC 3ZIAD 4ZKSU 4A92A 2L74A 4AOQA 4NZLA 4F4OC 3AW1A 2ULLA 2XC4A 1HAPH 4HTCH 4X1RU 1WAYB 4ABIA 3UQOA 4LOYH 1C9TA 3A7YA 1G2LA 2V35A 1W0ZU 2QXHA 2KFWA 1AWFH 2VGCC 1AKSA 3SQEE 5HGGA 3MNBA 2GD4B 4CHAC 1LPZB 1O2GH 4GUXA 4ZKOU 1PPGE 2SGQE 2FWWA 2Y81A 1S6FA 4I8GA 2PWXA 2XC5A 3NPSA 3V13A 1C4U2 3R0FA 1EFRD 5JBTA 2BXTH 1WTHD 2P3UB 4YT7H 4E7RG 2GCTC 4MTBA 2A5KA 1UK4A 2LPRA 1KXCA 1V2JT 4NZQA 1UTKA 3FP8E 1C2HA 1W2KH 9ESTA 3QUMP 1DS2E 1GHZA 1YPHE 1ELVA 2J34A 1G32B 1BDAA 4TPIZ 5L2ZH 3B9FH 1QJ6B 3BTME 5FX5A 1VCWA 4HGCA 1TGNA 1A2CH 3RXJA 5FPYA 2OC8A 1HFDA 1FPCH 3TPIZ 3E0PB 3NZIA 1PJPA 1O3MA 2W7SA 1AN1E 1C2FA 1L1JA 1YPMH 4Y79A 4IW4E 3ZVGA 4ABDA 1AFQC 1GMCG 2W3IA 3KHVA 1TGCA 3T28A 5GJ4B 1MKWH 1Y5AT 1C5RA 1HAXB 1BTXA 1QY6A 4ZH8A 3RXBA 1GMHG 4KGAA 2VH6A 4MDSA 3U28C 3EE7A 3SJ9A 1ZOMA 4DW2U 5H4IB 1SGFA 1K9OE 3EAJA 4D8NA 1V2QT 3GCNA 4QT8C 4BXSA 3CP7A 1O5EH 2Y7ZA 1GHWH 5LGOA 2Q6FA 2A7JA 4DOQA 2G5NA 2XBWA 1P09A 2FLRH 2A45B 5EQSA 2ZPSA 5EPNA 5CHBA 2OC1A 2ZGJA 4AFZA 2FTMA 3QO6A 1SFQB 3Q3YA 1O36A 3AAVA 1C5QA 3N7OA 3PV4A 2FEQH 2TBSA 1L4DA 3F9EA 2OINA 1OHHD 4VGCB 1P9SA 3UR6A 2GJGA 1XUFA 2KR7A 2A4QA 3RMOH 2G4TA 1GBMA 2J95A 3RXMA 2Y5HA 1JRTA 2ASUB 4HFPB 5CDFE 3MH5A 3S9CA 1Y5BT 1MH0A 3PLPA 3UWIA 1HUTH 4U32A 2PGBB 1KXEA 1TA6A 4Y0ZE 2FPZA 1DXWA 1D3PB 2HPPH 4FUBA 3MH6A 1O39A 3BIUH 2BVRH 1F5KU 1UVOA 3FKSD 3V0XA 1GG6C 1NM6A 1TLDA 1BA8B 3ITIA 1IQLA 1C1NA 1W0JD 3ZVCA 4D76A 5L2YH 4DCDA 4BOHA 4AN7A 1WCZA 4O9VA 1O3DA 4NSVA 4F48B 4KTCA 4O3UA 3D65E 3DUXH 1DUAA 1A3EH 2AIQA 1ZTLA 5EU8A 2PLXA 3GICB 2BLWA 1VR1H 2RDEA 1D3QB 1O2RA 1ZGIA 1ELDE 2FOEA 1D3DB 1H8ED 4NIXA 1ZGVA 2AMPA 3MHWU 1D6RA 2CF8H 1PPCE 4JZ1A 3H7TA 1UTJA 1TNGA 1ZR0A 4TY7A 1K1LA 2BD9A 8ESTE 2A1DB 2R2MB 4KELA 4BTTB 1SLXB 4B2CA 1BBRH 1UMAH 4BAQB 3BTEE 2B8OH 1K2I1 1SHHB 1X7AC 1EAUA 3MH7A 2QF4A 1JIRA 2O8WA 1GMDG 5JB8S 1LVYA 1B0FA 1A0LA 2ZDVH 4WH8A 4B75A 1J8AA 1LPKB 2WUBA 5JYIA 5T3HA 3VB3A 4XBBA 3A89A 1E35B 1PPZA 2TGPZ 3BTWE 1V2OT 3P70B 3LGUA 3RXLA 4CREA 1GBTA 4NA9H 2WHXA 4XRNA 1H9HE 1YPEH 2BLOA 5EXLA 1LO6A 5GIBA 4JYTA 2FLBH 3ODDA 3TGKE 3CENA 4XE4A 2ZTYA 1H1BA 6ESTA 1GJ4H 4TT3D 3S9BA 5B6LA 1ZMNA 4R8TB 2ZGHA 2C8YB 3FANA 4B2AA 3P8NA 3QGNB 3H09A 3MMGA 5EGMA 2O8MA 3QTVH 2OP9A 1EB2A 3ATLA 1HYLA 3UNQA 1FQ3A 2EI6A 4IGDA 3LDXH 1KSNA 2SGPE 1SLVB 4X6PA 2BD8A 1HAZB 3TU7H 3LC3A 1QB1A 4I8KA 2ODQA 1AMHA 1UK3A 3SW2B 1ABIH 3KQCA 5LH8A 1GVKB 3RU4T 4DJZB 2FXRA 1HAOH 4Q80A 1Z8RA 3GY2A 5K0HA 3SV8A 1SGRE 2Q6GA 4IBLH 3ZV8A 4ZKRU 1C2JA 4Y71A 4RN6A 2B9LA 2VH0A 3RC4A 1QL8A 3I29A 3RU4E 1BTPA 2BB4A 1ABJH 1QBNA 1GHXH 4CRDA 1PQ5A 1RGQA 3ATWA 5AFYH 2B7DH 5TJXA 1TNJA 1KIGH 2UWOA 2XW9A 1DE7H 1CA8B 4X6OA 1TABE 2FOGA 2FMJA 2ZG0H 3KEEA 4IS5A 3E91A 3KIDU 4ABBA 3LGVA 2V6NA 1QRXA 1MKXK 1D9IA 2OD3B 2FOHA 2D26C 1A61H 1BOQA 2PTNA 1W8BH 1UTMA 5HKKD 4FUDA 1KY9A 1Q3XA 1YYY1 3ZZ3A 5A8XA 4RSPA 2AERH 3RC6A 1IAUA 1P2KA 3URDA 1ESAA 2IJOB 1N1LA 3O8DA 4UFGH 4X1SU 5GDSH 3T5FH 5C3NA 3SHCH 1ZJDA 2YNBA 2G5VA 3MH4A 4B76A 3E6PH 1NRSH 4B73A 1FY1A 2WPLS 3LT3A 3RC5A 2XXLA 4ABFA 2HGTH 1SQAA 4FU8A 1GBKA 3F68H 1CA0B 2P16A 4MPWA 2J5UA 1E36B 1BRCE 1GHYH 1GJ9B 4X6MA 3RXHA 1GJ7B 1ZYOA 1XVOA 1DSUA 1GJDB 3HATH 4FUGA 4FUFA 1PPHE 1AB9C 1NPMA 2ZEBA 2XWBI 3Q76A 5AVDA 2DE9A 1E0FD 4DY7B 1V3XA 3RU4D 2GX4A 2ZGCA 1OOKB 4X2WA 5I46H 5EIYA 3GYMA 3RXDA 3BV9B 2SGDE 3PO1C 2ZNKH 5C0TA 8GCHF 1NC6A 1C1VH 4YOIA 3ZVBA 2R9PA 1AWHB 2TPIZ 4JK5A 4NIWA 1COWD 2BLQA 4NCYA 3RLWH 2PTCE 1TNKA 5F6MA 3ZVDA 4MNYA 3GDUA 2D8WA 2AMDA 1YF4A 1S83A 4NIVA 3PWBA 1EXFA 2KAIA 3RXFA 4U30A 3S69A 3TK9A 4CR5A 1CQQA 1YCPK 3TGJE 3KN2A 1NBME 3M36A 1SQTA 4ISIH 3LGTA 1TRNA 4ZUHA 1EAXA 1NRNH 1VITF 4LXBH 1AU8A 1LHEH 4K1EA 5DKMA 1P10A 4AFSA 2BD5A 3F9GA 1K1PA 1SB1H 3EA8A 2FIRH 2HWLB 2PGQB 2W6ID 1Z1JA 1NRRH 3TGIE 1MKXH 4CBOA 1WUNH 3DSPA 1GJ8B 1A0HB 1ZSLA 2DUCA 2RA3A 2XBYA 3UAIC 1OXGA 5DPAA 1O32A 1DXPA 3BG8A 4DT7B 3M7QA 1ANDA 3PROA 3MFJA 1FY5A 4YTAA 1KLIH 3PMBB 1EASA 1HXFH 1V6DA 2Z3DA 3FN8A 4KP0A 5EQRA 1FUJA 1NTPA 4ASHA 4X8TH 4OGYA 4DIHH 1FN6A 1XUGA 3I77A 1O2SA 2G4UA 1C5UA 2VWNA 3HKJB 2NU1E 5DP8A 1Q2WA 3A7XA 2QC2A 3C27B 3H7OA 2QGRA 3T27A 1O2VA 3KQDA 5AFZH 1HV7A 4WMEA 3ATKA 1C2GA 1JXPA 2R3YA 2P3TB 3PV5A 3P17H 2P8OC 3RM0H 1W7GH 3VB6A 1XVMA 4BTIB 1IQIA 4WMDA 2ZTXA 1GMCF 2F9OA 2H6MA 2VU8E 1ESBA 2YMSB 2FO9A 2Z9GA 1C1TA 1MZAA 2C8WB 1TQ0B 2Z94A 2FOBA 1GMHF 2KCOA 3HGPA 5F53A 1FMGA 1ELFA 2BOHB 1O2IA 4CRGA 3OE7D 1THRH 1WDIA 4BAHB 3S0NA 1LVOA 1C5ZB 1LCYA 1QR3E 3KQBA 3WW7A 3DT0H 3TJUA 5FPTA 1FX0B 1GHBG 2ZDLA 2JETC 2CF9H 2BHGA 1SGNE 4H4FA 4CRFA 2KZ4A 7GCHG 3TJNA 1CBWB 1QRZA 1F5LA 3TJOA 5JB9S 1ESTA 1AE5A 1V2RT 4ACAA 2ANYA 2GTBA 2ZFTA 3F2FA 3H5CB 4JZFH 3GCTG 1P0SH 3KQEA 6CHAC 1P9UA 1GCTC 4H6SB 2F9PA 1O3FA 4JZDH 4BAMB 1K21H 1C1UH 5TCAA 4H6TA 1S5SA 1C1WH 2AYWA 1MTVA 4GAWA 2D1JA 3UOPA 1A5HA 1BHXB 1ACBE 2AEIH 5C20A 4FU9A 1TX6A 1Y3VA 2BDHA 1HAGE 1KMHB 3A83A 4I31A 3NK8A 1AIXH 5C0UA 1LHGH 1C5XB 5A0AE 1B0EA 2ZCHP 3RM2H 3VGCB 2FDAA 1T4VH 1WQVH 3FP7E 2RCEA 2ZFFH 3IWMA 5EJZA 4B71A 3WWBA 1BT7A 2XCNA 1B5GH 4R0IA 3OU0A 4XD7D 4K8YA 2FX6A 4Y8XA 1AUJA 2BD2A 1C1MA 4Q7XA 3UY9A 5IDKA 1OWDA 1ZTJA 4I7YH 3K6ZA 4SGBE 1GI8B 1Z8IB 1C2LA 1O2NA 2ZDKA 2Y80A 2SGFE 4MLFB 1RFNA 5LPEA 2OC7A 2VVUA 1ELTA 2XBXA 1GMDF 5ESTE 2WV4A 1FY8E 1TMTH 3SNCA 1SFIA 3PLBA 3BTFE 5LPFA 2AIPA 4MNVA 2VVCA 2KCAA 2NWNA 1BMAA 5DK1A 4DT4A 5HXFA 3E8LA 4AGKA 1GBCA 3W94A 3LU9B 4RI0A 2G52A 1C5LH 1GBIA 1BQYA 1NU7B 1TAWA 4XBDA 1BMFD 2IJD1 2PHBA 1MBQA 1TRMA 1N8OB 2D2DA 1Z1IA 3OTJE 1P04A 3SUGA 3AW0A 1MU8B 1YLCA 1EATA 2ZFPH 7ESTE 2QXIA 3LJJA 1A0JA 2ZC9H 4TSFD 5CMXH 2Y7XA 3TK6A 1SQRA 2ZFSA 1CSOE 1JMOH 1XUIA 1P2NA 1C5MD 2Z9KA 1ZMLA 3V7TA 4AFQA 2XTTB 4M9FA 3F2GA 3PRBA 2B5TB 4ABHA 2W3KA 3D23A 1FZZA 3TVJB 1K22H 1ZSKA 2ZI2H 1K1NA 1BTUA 1NY22 2WSSD 4VGCC 1BIOA 3A85A 2AGEX 1WU1A 4DG4A 3M5LA 1CU1A 2HVXA 1C4Y2 2UWLA 1EZQA 4FXGH 1YGCH 3K9XB 1IQEA 1O3NA 4JCNA 3OY6U 4K60A 4A5TS 2YOLA 5GCHG 1QB9A 1P02A 2IOTA 2BDYA 3A81A 1ZPBA 3KF2A 3N7EA 3UIRA 3GDVA 1OP0A 1RTKA 2PSXA 1UCYH 2JKHA 3GCHB 4NIYA 4FVDA 2JDID 2ZO3H 1DVAH 2WV9A 3ZZAA 1SLUB 8KME2 1C2DA 1GL0E 3AK5A 2OLGA 3E90B 1HRTH 3BEFB 5C67A 2GKVE 1H9IE 4TY6A 1AUTC 4ZHAA 2ZCLP 1K1JA 1QTFA 1AY6H 1FI8A 1GWAA 3EYDA 1OYQA 1KXBA 2FOAA 2STBE 4KKDA 3VPKA 5EXMA 1GI4A 1V2NT 1KTSB 2EC9H 3A86A 3P6ZB 4AB8A 1D4PB 3PMAB 5T1VA 1ANEA 2HRVA 2UWPA 1MUEB 3WY8A 1GBLA 5K7RA 4HZHA 3SV7A 2G51A 2WPIS 3NWUA 4XSKU 3KYGA 1Z6JH 4A1VA 1G37A 2G81E 3TH3H 1IQGA 4K3JA 2FOCA 3RDZA 2YNAA 1VITH 1SL3A 2F3CE 1XXFA 1O38A 3DSGA 2H5CA 1CGJE 2QXJA 4MQAA 2ZHFH 3QGJA 2AH4X 3KNXA 2KM0A 3UREA 2QE7D 5B6OA 3VB7A 1HIAB 2FX4A 1AFEH 4Q7YA 1MTUA 3M35A 4JZEH 1YPJH 4K5ZA 1MD8A 3PM3A 3SN8A 4BXWA 5F03A 5ESBA 3VEQB 1HPGA 2F9UA 4IN1A 3ZZ8A 1ARCA 3UPEA 3RLYH 1HGTH 1TOMH 1G9IE 2GV7A 1EZXC 3G01A 3PB1E 1FXYA 1OYTH 2BX3A 3AVZA 3BTKE 3M5MA 3KGPA 2BX4A 2F9NA 1EB1H 3TJVA 1N6YA 5DJ7A 6LPRA 1MTNB 2XCFA 3PLKA 5FL7D 1ETSH 2BDIA 1EUFA 1OP8A 3P92A 1PPEE 4ZHLU 1BTHH 2ZU3A 3U1IB 5EPYA 3QZRA 3JZ1B 4I8JA 1UVTH 1O0DH 5E0HA 3MNCA 3MTYA 3PTBA 2KCYA 5FBIA 4XDEA 1A7SA 1QQUA 3TK5A 3MO3A 1UW7A 2CN0H 4X8SH 3RMMH 3VXEH 3GDSA 2EQNA 3QK1A 3NUMA 1QZ8A 3GY4A 4KTSA 1F0SA 2Z3CA 1TGTA 1F0TA 1RD3B 1SGTA 2TRMA 2KAIB 3O8CA 1C1PA 1F0UA 5HYOA 2ZFRH 5GWZA 1Z7KA 3QWCH 3ZZDA 3EA7A 1ZLRA 4F49A 5ABWA 1DM4B 2HPQH 3KL6A 2FTLE 2R0KA 2ZU5A 2GP9B 4LZ4B 2BM2A 2J4IA 2O8UA 3OFND 1UO6A 7LPRA 1PFXC 5I25A 4JZIA 5FBEA 1C5OH 2XNDD 3ZZ9A 4FUHA 1F7ZA 3K65B 3FFGA 2WV5A 3ZV9A 1TONA 2J92A 2BZ6H 3GS9A 3M37A 3SJKA 3QX5H 3MU4A 1TYNA 1JWTA 4RT0A 1GHBF 2J94A 4YZUA 4O97A 2F83A 2JH0D 2XNIA 1IQNA 1OX1A 1TPSA 1OWKA 2BY5X 4UFFH 1YBWA 7GCHF 1TBZH 1CA0C 4OM9A 1CHGA 2TGTA 1O3OA 5FPSA 2Q6DA 4A1XA 1JOUB 2AGIX 4B1TA 1P2JA 1VGCB 5L6NH 1F5RA 1T8MA 3Q3XA 1V2VT 1TGSZ 4I33A 3A8AA 1BJVA 3GCTF 1UTLM 2W6JD 4WJG2 4Q2KA 2ZTZA 4NSYA 2FP7B 3SHAH 4DGJA 3OEHD 1PYTD 1GDNA 1CE5A 1Y3WA 1Y3UA 2GMTB 3QN7A 5F8ZA 2P93A 1DUEA 2J98B 1GJBB 2C8XB 2CV3A 4ZKNU 3U98H 4Q63A 3RXUA 4WXIA 3V3MA 1OWHA 3URCA 3CS0A 1HAIH 3PV2A 2QYIA 1B7XB 2QXGA 1NRQH 2VJ1A 3O8RA 2QY0B 4X8UH 2A5AA 2QA9E 2WPJS 1W11U 2ZHWH 1DFPA 1TQ7B 1F0RA 1SGIB 2BZAA 2XRCA 1BBRE 3F2HA 1TIOA 4I8LA 4JYUH 2JIZD 4AG1A 4DIIH 1L1GA 3OY5U 5E2OA 5GXPA 1Z71A 3DA9B 3IG6B 3PMJA 1S6LA 1GBBA 3BEUA 5C17A 2BQ7B 1BTYA 1HJ9A 1WSSH 1W3CA 1HCGA 3F1SB 3D49H 1O2ZA 3ZYDA 2BD3A 4Q7ZA 4LK4A 5DGJA 1MTSA 1SOZA 1HIAA 1BJUA 4I8HA 4ACBA 4B74A 3F9HA 2HNTC 4WVPE 2VBCA 2L6OA 2BY6X 2OK5A 4X8VH 2BVSH 5J4SA 1QRWA 3ZZ7A 4HG6A 4UEHH 4YO9A 1QGFA 5A0CA 3RUOA 2C8ZB 3BTDE 3NCLA 1W13U 1QURH 2ZECA 3OSYA 4X1NU 4B2BA 1CHOG 1CVWH 3SJOA 3PYHA 4Y7AA 3BTTE 3ATIA 1SPJA 2P3FH 2J97A 6GCHG 2BD7A 1HDTH 4AORA 5JBAS 1NRPH 2J2UA 1LPGB 3SGAE 1GBHA 1V2UT 2YMSC 1O3CA 1WBGB 3MQKC 2ZF0H 1P01A 1S84A 2EA3A 1JIMA 1BITA 1EAIA 1S0RA 2AFQB 1OSSA 1RXPA 1PQAA 2IPQX 1A1RA 4GHQA 4FUEA 3U69H 4AC9A 4YOJA 4X2VA 1C4V2 3VXFH 1J14A 5CHAB 2LP6A 4MVNA 2XC0A 2GT8A 3A82A 3TH2H 1CBWC 4BAOB 1UVUH 1RJXB 2QF5A 1TE0A 1GBAA 1FONA 1E38B 1GVZA 1TBQH 3T25A 1D3TB 1SC8U 4A6LA 3BG4B 1AD8H 3M7TA 1GI7B 3BF6H 3ELAH 3HPTB 3WWFA 1TNIA 2STAE 3KCGH 1MCTA 1K1MA 4XOJA 5BRRE 1SQOA 1OP2A 1U6QA 4U01A 5GCHF 1BB0B 4FUCA 2ZQ2A 2OBQA 1WQSA 3HK6B 5AHGH 4D7GA 1GJAB 1IQHA 1GJCB 2AGGX 1O3AA 1EPTB 5GNDA 2PP6A 3M5OA 1O3KA 4JYVH 1L4ZA 4NGAH 1AVXA 1DWDH 4GSOA 4X1PU 4CH2B 5T6FA 2PW8H 2Z9IA 2JH6D 3EQ0H 2F43B 1ELCA 1MBMA 3DD2H 1C5NH 2FI5E 1P12E 3Q3KA 3SGBE 3STIA 1NROH 3P8FA 1AZZA 3DFLA 1ZTKA 3ZZBA 1S82A 2C93B 2QAAA 2FOMB 1O2KA 3B8JA 4ABEA 3VGCC 1ELGA 1T8LA 1IQMA 3GY8A 3MU0A 3MU8A 1LDTT 4X1QU 1W0KD 1A4WH 2KCPA 2Z9LA 4YM9A 1P2MA 1VJ9U 3T2NA 4ISOA 4BTUB 2V7QD 1P57B 2PKAA 4OS5A 1O5CB 1TGBA 3UWJH 2THFB 1LKAA 1HAVA 1HJAB 2RG3A 5JPMH 3UUZA 1QL7A 3SUDA 1TOCB 3SU3A 2K8IA 4AYYB 2ZDAH 5L30H 2J98A 1DY8A 2VVVA 4ABGA 1MABB 2H9HA 2UUJB 3VFEA 2ESTE 3DHKH 2A7HA 4GCHG 3RXPA 2CGAA 3U8RH 1NT1A 1AI8H 1O3JA 3KQ5A 1GBEA 2AS9A 5EJ1A 1FDPA 5EXNA 1MZDA 1VCPA 1L0ZA 2NU0E 1YP9A 1D6WA 2ZU4A 4NA7A 1E1RD 1VCQA 4AYVB 1KTTB 2QF3A 1WTGH 2ANWA 1ZMJA 2FM2A 4A7IB 3FOAA 1SHYA 2VIPA 1AVGH 4Y8ZA 2Y5GA 1BCUH 3ENSB 4A1TA 1HBTH 2QN5T 2ZQ1A 5E8EH 1OWEA 3SV2H 2TGDA 1DANH 2JJ1D 1HXEH 1N8OC 1OWJA 4GLYA 3I78A 3LH3A 1KXFA 3RXRA 4Z6AH 3UR9A 2HLDD 2BD4A 2GDEH 2R3UA 4AX9H 5DO4H 1GHAG 1YCPH 3MNSA 4NWLA 4YESB 4ESTE 1GHVH 1QA7A 2ZPQA 5T6GA 2SNVA 4Y8YA 3ZZ6A 1C2EA 1CT2E 1WOFA 3MOCA 5KEDA 2WPHS 1EJNA 4OS7A 2IPHA 3ZZ5A 4O03A 2A4RA 1EZSC 1BTZA 1LVMA 1DT2A 4ZAEA 2F4LA 3GCOA 1O2MA 5E0GA 4UONA 2PSYA 1OWIA 3ZZ4A 1AQ7A 2O9QA 1O5AB 2HALA 3ATMA 4WH6A 1E34B 1QBVH 5FHTA 1O3GA 1SGYE 3QZQA 5GPIB 3MNXA 4MPXA 1VZQH 5JBBS 1GGDB 1TMBH 2XBVA 1O34A 4BNRA 2OCVB 1O2LA 2AHME 5KGOA 2C3SA 1YM0A 1AO5A 1JBUH 1HNEE 1XKAC 4K8BA 3GY3A 2ODPA 1SVPA 4IN2A 1ID5H 2W5EA 1V2MT 3RMNH 2ZCKP 2SNWA 1O37A 1LHDH 2FS8A 4GVUA 1SGPE 3A87A 3NKKA 1J17T 1K1IA 3NXPA 2FI3E 5C5OA 2CJIA 3DSOA 1GDQA 3P95A 1FAKH 3GCHC 2RA0A 1MQ6A 3RXAA 5DP4A 1T4UH 1SGFG 1ZJKA 1A5GH 1RIWB 1YY3A 5EJLA 5IYTA 1BRBE 2OQUA 1O2UA 1E37B 3K6YA 1DICA 3F6UH 5DN6D 1KLJH 1O35A 2ZHQH 1P06A 2PKSB 3SZEA 3QLPH 3RXQA 2UUKB 2V3HH 2A4OA 1V2WT 1O3BA 1GI6A 1KLTA 1NFUA 2Y6TA 3TITA 1HAHH 2TIOA 2GCHG 2JH5D 4IMQA 1ELBA 1TX8A 1UK2A 3GISB 1YPLH 2ZKSA 1EPTA 2BDGA 1V2TT 1P2OA 2WPMS 2ANMH 1KYNA 2GT7A 2H5DA 4XFQA 4OGXA 1NFWA 2BLVA 4BANB 1G30B 1C1OA 2ZGXH 3OX7U 3BTQE 3FP6E 3ODFA 2C4FH 2ZPRA 4ABJA 1T8OA 2NU3E 1IQFA 3UNSA 2FOFA 3SJIA 4ZHMU 4CRBA 1WYKA 2VIQA 2CMYA 2OXSA 4AFUA 1A46H 2F9BH 3E16B 1NN6A 1S6HA 1O5FH 5PTPA 5IK2D 2CHAB 3RXTA 4ZXYH 2I6QA 2FYQA 2RDLA 1LQDB 1IOEA 1TWXB 2CK3D 1GVLA 1CT4E 2PUQH 5E2PA 2A4GA 3BTGE 3FZZA 3D62A 2BQWB 1V2ST 3KYFA 2M5TA 3TNSA 4JK6A 3PRDA 5DP7A 1VITG 3RXEA 1S81A 1SR5C 1ETTH 3A8BA 2GZ9A 1O31A 4F55A 1HLTH 1GBFA 1MTNC 1O2XA 3C1KA 4ZROA 4E7NA 4INKA 1H8DH 3EE0B 1FV9A 4UFEH 5LPRA 1DDJA 1H8IH 2HVYB 1G3CA 2PV9B 3SZNA 4MNXA 3MWIU 2XYAA 4MPUA 4JMYA 2H1UA 4K1SA 2XOKD 1C5YB 3FZDA 1Y5UT 1KDQA 2PR3A 1DWBH 1Z8JB 3SYJA 1MAYA 3TIUA 1DPOA 1PQ7A 1W12U 1ZRBA 1NO9H 1TMUH 3SU6A 2VWMA 1CHOF 4ZMAH 1YLDA 1NZQH 1UVPA 2K1QA 2CXVA 1P05A 2G8TA 1O5BB 1Y3YA 4FETA 2W7UA 6GCHF 4CRCA 1SGCA 2ZDMA 1BBRK 1ZPZA 1CGHA 3LOXA 5EOKA 2WYGA 1M9UA 3U8TH 1K1OA 3S7KB 1BTWA 1J15A 1Q31A 2BXUH 1TRYA 3IITA 2VINA 5A8ZA 2A5IA 2BQ6B 2ILNA 4ISLA 1A5IA 4ABAA 2TGAA 3N99A 3ZVFA 4DURA 4OS1A 1LQEA 1LTOA 3UTUH 1F2SE 2YMSD 4J2YB 3A8DA 1UJ1A 1QHRB 5F8TA 4K2YA 2O8TA 1F92A 2WZQA 1SSXA 4FVBA 2UUYA 3LKWA 3SORA 3T26A 4H42U 3F0PA 2A31A 2HLCA 3LONA 2SGEE 5CE1A 2OUAA 1ANBA 1V2KT 1EP6A 3Q77A 3E3TA 1VGCC 2VIVA 3OTPA 3HKIB 2F9VA 1UCYE 1THPB 4Z0KA 2VGCB 3VB5A 4CHAB 1SI5H 3RXOA 1C5SA 2ALPA 2Z9JA 1ELEE 2J9NA 2GMTC 1L1NA 1OPHB 4X2YA 2G55A 3TH4H 1LHCH 1O2HA 1MTWA 5DP3A 4XBCA 1UTQA 4RKJB 4KTUA 1ARBA 4FUJA 4NG9H 2GCTB 1OS8A 1J16A 4FU7A 1C5PA 1MD7A 2UUFB 2VNTA 2ZWLH 3RXKA 1XXDA 1TALA 3P8GA 1LKBA 4Y0YE 1O2TA 2H2ZA 2WPDD 4UFDH 5T6DA 2BY9X 1W0YH 2SFAA 1OKXA 2QF0A 1RTLA 5E0JA 3RXVA 1SMFE 1C2IA 4OS6A 1DLKB 2V3MA 5DG6A 2NU2E 2A0QB 3PMHB 1QNJA 1T8NA 5HM9A 3GOVB 1MU6B 1AFQB 3SI4H 3A7VA 4TYDA 3VG8A 1ZHPA 5BPEA 3UB0A 3U8OH 4CBNA 2Z3EA 1XM1A 2F91A 4HI3A 3MYWA 4MNWA 1NESE 4INLA 2FI4E 1H4WA 2HNTF 4GCHF 1QJ1B 1AZ8A 1SLWB 1ZPCA 5A8YA 2P59A 2G00A 3RMLH 1VKYA 1TPPA 3SUFA 5JBCS 3HGNA 2A7CA 3FVFB 2ZGBH 2Y5FA 4OS2A 4AB9A 2ALVA 2GV6A 1TB6H 1YPGH 3CS7A 1O2QA 1FY3A 3RXSA 1QJ7B 2BVXH 2WUCA 1Y59T 3O8BA 4DVAU 2FYRA 4UDWH 1N6XA 2AMQA 3V12A 5DP5A 1UVSH 3NRLA 2KX4A 3BSQA 3L3TA 3A7TA 4IMZA 4UE7H 3TLOA 4K1TA 3M5NA 4WWYA 3QDZB 1BZXE 2PKAB 3T29A 3LPRA 4D9RA 5C1UA 2J38A 1GHAF 1RTFB 1HAVB 3ZVAA 1XUHA 1ZHRA 9LPRA 1BMLA 3M61U 1GI2A 1XX9A 5HMAA 1QIXB 1SKYE 1C2MA 3N7DA 4Y76A 2B0FA 1AVWA 1KXDA 3SNBA 1S85A 5FX6A 5FCKA 3OAAD 1AHTH 3BTHE 4IC6A 3MI4A 1P03A 1GG6B 1O2OA 3PWCA 1IQJA 2QIQA 1IQKA 5CHAC 1HJ8A 1C5WB 1TPAE 2Z7FE 3SV9A 4WF8A 4I32A 1EJMA 1E79D 1TNHA 1MCVA 1DITH 3BG4C 2HOBA 3U1JB 2BOKA 4YT6H 3A7ZA 2XWAA 3GY5A 5A0BA 1O3PB 4AZ2B 1GI9B 1TX7A 2BYAX 1V2LT 2OBOA 2ZU2A 2A2QH 3STJA 1UTOA 3SNEA 3L33A 1FY4A 2ANKH 5A09A 1EPTC 4Y7BA 7KMEH 5F8XA 1EOLA 1G3BA 2GZ7A 4ISHH 3ZVEA 1FN8A 4E06H 1T32A 2A2XH 2A32A 4X0WU 4ZCNA 2BDBA 1BHXF 1FIWA 1SOTA 1CT0E 1XUJA 1YLNA 1TFXA 2VWLA 3ESTA 2VB0A 3M3TA 2H9TH 1JRSA 2R0LA 2R2WU 3FAOA 2FESH 3SNDA 1GI5A 1C2KA 1FPHH 4FUIA 1GJ5H 3SU0A 1WV7H 4Y6DA 4AGJA 1GPZA 2ZA5A 1EKBB 1HJAC 2GCHF 4CRAA 2W26A 3A7WA 1RS0A 1TPOA 3S7HB 1DOJA 1QL9A 2RFKC 2BMGB 2ZP0H 5FAHA 2O8LA 2BY7X 3U9AH 4WMFA 1RRKA 3A8CA 4Y11E 4YLUA 3SO3A 2ZFQH 4MG3A 3SU5A 1FNIA 2IN2A 2ODYB 4GPGA 4INHA 1EX3A 2V0BA 3A88A 1O2WA 1CGIE 2OC0A 1PQ8A 3LH1A 8LPRA 2EEKA 2WYJA 3OYPA 1Y8TA 4OS4A 4RKOB 1EJAA 2PUXB 4Y10E 1ORFA 4NA8A 1AE8H 1O3EA 1P2IA 1T31A 1NFYA 3HK3B 1ZRKA 4WY3A 1YPHC 1ZHMA 1ZZZA 1DY9A 1FAXA 1GBDA 5AF9H 5J4QA 3LIWA 1O5DH 3LGYA 1LHFH 1QBOA 1H9LB 1FLEE 1SG8B 1ETRH 1YKTA 1BUIA 3EDXB 2FZZA 3SQHE 3QTOH 4ASUD 1C5VA 1FJSA 3BEIB 1S0QA 3DCLA 4J1YA 4B6EA 4P00A 5SGAE 3R3GB 1Z8GA 2K0QA 4B6FA 4PROA 5A2MH 5EW2H 1VJAU 2OQ5A 1FIZA 3LJOA 3BIVH 1GGDC 1G3EA 4CR9A 5C1XA 2GGVB 1UHBB 1QQ4A 1O2JA 4X2XA 1YWUA 3SUEA 2BDAA 1C1RA 4TWWA 1GI1A 5G4BA 1L2EA 1NU9A 4NFFA 1WXRA 4NFEA 2VIWA 5EG4A 3JZ2B 1O3IA 2LELA 1G2MA 1T7CA 4BAKB 1K0HA 2EI7A 1DSTA 2QV1A 2WINI 1DLEA 4AG2A 1YPKH 2Y82A 3SU4A 1P8VC 5EW1H 2ZU1A 3AASA 2GDDA 1O33A
chains in the Genus database with same CATH topology
4ZXXH 1RIWC 1XUKA 1HB0B 1DX5M 2QCYA 1O2PA 1SGQE 4CH8B 1EP5A 5EODA 1A3BH 1AKSB 2OTVA 2P94A 1GCDA 3SGQE 3UFAA 1AB9B 1YC0A 3B23B 2PKSC 4MPVA 3UQVA 1TA2A 1IHSH 1GJ6A 5EQQA 2V3OH 5JDUB 1AGJA 3F9FA 3RXIA 1BMMH 1P2QA 1C1SA 1XMNB 5HM2A 1TNLA 4TPYA 3SU1A 3PO1B 3UNRA 5DP6A 5FXLA 1LMWB 3TNTA 1C1QA 2FODA 3GYLB 1W10U 4M7GA 3SV6A 3MU5A 4IC5A 2P95A 3SJ8A 3SOSA 1NS3A 1O5GH 1KDQB 1ANCA 1QB6A 2BTCE 1V2PT 1PYTC 4TWYA 4GHTA 3ZZCA 1O30A 1GI3A 5C5NA 2LNCA 1XKBC 2ZDNA 1KXAA 3MO6A 1BMNH 3MU1A 2FS9A 1MMJN 3Q00A 3VB4A 3E1XB 3EGKH 3K2UA 3SBKA 2ZHEH 3RXCA 2CHAC 2Q1JA 1GL1A 2ZZUH 3LGWA 1PPBH 3LGIA 1SGDE 4X6NA 3AAUA 1ELAA 3GY6A 4ISNA 1EOJA 2VIDA 3LC5A 5C1YA 1CO7E 2PFEA 3E0NB 2ZHDA 5TCCA 4O3TA 2GZ8A 2BDCA 4UD9H 1EQ9A 2I6SA 1QCPA 3A80A 1HAYB 1DWCH 1K28D 1O3HA 1ZSJA 3BN9A 1PPFE 1W7XH 1Y3XA 1INCA 1UTPA 1G3DA 1C9PA 1P11E 2P8OB 1GI0A 1O2YA 1GDUA 2BY8X 1UCYK 5DP9A 3ZYEA 1SGEE 4THNH 1MQ5A 1J9CH 3SI3H 3SNAA 4U2WA 1SBWA 1IHTH 1BRUP 1NFXA 3RP2A 4D7FA 1YCPM 1O3LA 1THSH 4SGAE 4LZ1H 2SGAA 2C90B 4YOGA 3M7UA 3PTNA 4K69A 1TBRH 1LVBA 3GY7A 5C2ZA 1QFKH 4WXVA 1QA0A 1P3EA 2JETB 3M3VA 1G36A 1DWEH 3S9AA 2ZIQH 4YLQH 3UOUA 1BRAA 1P3CA 1MKWK 3L6PA 3SU2A 1C5TA 3MO9A 2DE8A 2VIOA 4D9QA 2Z6BD 1W14U 3M3SA 2GVFA 3T62A 1UHBA 4E05H 3P8OA 3DFJA 6CHAB 2NU4E 2HNTE 1GCTB 2H9EH 3RXGA 2WPKS 1UTNA 5ETXA 1GBJA 3EA9A 3W95A 2VWOA 1MAXA 4NWKA 8GCHG 1Z6EA 2EI8A 5FCRA 3A84A 1EAWA 1EZUC 4A92A 4ZKSU 4AOQA 4NZLA 4F4OC 3AW1A 2ULLA 2XC4A 1HAPH 4HTCH 4X1RU 1WAYB 4ABIA 3UQOA 4LOYH 1C9TA 3A7YA 1G2LA 2V35A 1W0ZU 2QXHA 1AWFH 2VGCC 1AKSA 3SQEE 5HGGA 3MNBA 2GD4B 4CHAC 1LPZB 1O2GH 4GUXA 4ZKOU 1PPGE 2SGQE 2FWWA 2Y81A 1S6FA 4I8GA 2PWXA 2XC5A 3NPSA 3V13A 1C4U2 3R0FA 5JBTA 2BXTH 1WTHD 2P3UB 4YT7H 4E7RG 2GCTC 4MTBA 2A5KA 1UK4A 2LPRA 1KXCA 1V2JT 4NZQA 1UTKA 3FP8E 1C2HA 1W2KH 9ESTA 3QUMP 1DS2E 1GHZA 1YPHE 1ELVA 2J34A 1G32B 1BDAA 4TPIZ 5L2ZH 3B9FH 1QJ6B 3BTME 5FX5A 1VCWA 4HGCA 1TGNA 1A2CH 3RXJA 5FPYA 2OC8A 1HFDA 1FPCH 3TPIZ 3E0PB 3NZIA 1PJPA 1O3MA 2W7SA 1AN1E 1C2FA 1L1JA 1YPMH 4Y79A 4IW4E 3ZVGA 4ABDA 1AFQC 1GMCG 2W3IA 3KHVA 1TGCA 3T28A 5GJ4B 1MKWH 1Y5AT 1C5RA 1HAXB 1BTXA 1QY6A 4ZH8A 3RXBA 1GMHG 4KGAA 2VH6A 4MDSA 3SJ9A 1ZOMA 4DW2U 5H4IB 1SGFA 1K9OE 3EAJA 4D8NA 1V2QT 3GCNA 4QT8C 4BXSA 3CP7A 1O5EH 2Y7ZA 1GHWH 5LGOA 2Q6FA 2A7JA 4DOQA 2G5NA 2XBWA 1P09A 2FLRH 2A45B 5EQSA 2ZPSA 5EPNA 2OC1A 2ZGJA 4AFZA 2FTMA 3QO6A 1SFQB 3Q3YA 1O36A 3AAVA 1C5QA 3N7OA 3PV4A 2FEQH 2TBSA 1L4DA 3F9EA 2OINA 4VGCB 1P9SA 3UR6A 1XUFA 3RMOH 2A4QA 2G4TA 1GBMA 2J95A 3RXMA 2Y5HA 1JRTA 2ASUB 4HFPB 3MH5A 3S9CA 1Y5BT 1MH0A 3PLPA 3UWIA 1HUTH 4U32A 2PGBB 1KXEA 1TA6A 4Y0ZE 2FPZA 1DXWA 1D3PB 2HPPH 4FUBA 3MH6A 1O39A 3BIUH 2BVRH 1F5KU 1UVOA 3V0XA 1GG6C 1NM6A 1TLDA 1BA8B 3ITIA 1IQLA 1C1NA 3ZVCA 4D76A 5L2YH 4DCDA 4BOHA 4AN7A 1WCZA 4O9VA 1O3DA 4NSVA 4KTCA 4O3UA 3D65E 3DUXH 1DUAA 1A3EH 2AIQA 1ZTLA 5EU8A 2PLXA 3GICB 2BLWA 1VR1H 1D3QB 1O2RA 1ZGIA 1ELDE 2FOEA 1D3DB 4NIXA 1ZGVA 2AMPA 3MHWU 1D6RA 2CF8H 1PPCE 4JZ1A 3H7TA 1UTJA 1TNGA 1ZR0A 4TY7A 1K1LA 2BD9A 8ESTE 2A1DB 2R2MB 4KELA 4BTTB 1SLXB 4B2CA 1BBRH 1UMAH 4BAQB 3BTEE 2B8OH 1K2I1 1SHHB 1X7AC 1EAUA 3MH7A 1JIRA 2O8WA 1GMDG 5JB8S 1LVYA 1B0FA 1A0LA 2ZDVH 4WH8A 4B75A 1J8AA 1LPKB 2WUBA 5JYIA 5T3HA 3VB3A 4XBBA 3A89A 1E35B 1PPZA 2TGPZ 3BTWE 1V2OT 3P70B 3LGUA 3RXLA 4CREA 1GBTA 4NA9H 1H9HE 1YPEH 2BLOA 5EXLA 1LO6A 5GIBA 4JYTA 2FLBH 3ODDA 3TGKE 3CENA 4XE4A 2ZTYA 1H1BA 6ESTA 1GJ4H 3S9BA 1ZMNA 4R8TB 2ZGHA 2C8YB 3FANA 4B2AA 3P8NA 3QGNB 5EGMA 3MMGA 2O8MA 3QTVH 2OP9A 1EB2A 3ATLA 1HYLA 3UNQA 1FQ3A 2EI6A 4IGDA 3LDXH 1KSNA 2SGPE 1SLVB 4X6PA 2BD8A 1HAZB 3TU7H 3LC3A 1QB1A 4I8KA 2ODQA 1AMHA 1UK3A 3SW2B 1ABIH 3KQCA 5LH8A 1GVKB 3RU4T 4DJZB 2FXRA 1HAOH 4Q80A 1Z8RA 3GY2A 5K0HA 3SV8A 1SGRE 2Q6GA 4IBLH 3ZV8A 4ZKRU 1C2JA 4Y71A 4RN6A 2B9LA 2VH0A 3RC4A 1QL8A 3I29A 3RU4E 1BTPA 2BB4A 1ABJH 1QBNA 1GHXH 4CRDA 1PQ5A 1RGQA 3ATWA 5AFYH 2B7DH 5TJXA 1TNJA 1KIGH 2UWOA 2XW9A 1DE7H 1CA8B 4X6OA 1TABE 2FOGA 2FMJA 2ZG0H 3KEEA 4IS5A 3E91A 3KIDU 4ABBA 3LGVA 2V6NA 1QRXA 1MKXK 1D9IA 2OD3B 2FOHA 2D26C 1A61H 1BOQA 2PTNA 1W8BH 1UTMA 4FUDA 1KY9A 1Q3XA 1YYY1 3ZZ3A 5A8XA 4RSPA 2AERH 3RC6A 1IAUA 1P2KA 3URDA 1ESAA 2IJOB 1N1LA 3O8DA 4UFGH 4X1SU 5GDSH 3T5FH 5C3NA 3SHCH 1ZJDA 2YNBA 2G5VA 3MH4A 4B76A 3E6PH 1NRSH 4B73A 1FY1A 2WPLS 3LT3A 3RC5A 2XXLA 4ABFA 2HGTH 1SQAA 4FU8A 1GBKA 3F68H 1CA0B 2P16A 4MPWA 1E36B 1BRCE 1GHYH 1GJ9B 4X6MA 3RXHA 1GJ7B 1ZYOA 1XVOA 1DSUA 1GJDB 3HATH 4FUGA 4FUFA 1PPHE 1AB9C 1NPMA 2ZEBA 2XWBI 3Q76A 5AVDA 2DE9A 1E0FD 4DY7B 1V3XA 3RU4D 2GX4A 2ZGCA 1OOKB 4X2WA 5I46H 3GYMA 3RXDA 3BV9B 2SGDE 3PO1C 2ZNKH 8GCHF 1NC6A 1C1VH 4YOIA 3ZVBA 2R9PA 1AWHB 2TPIZ 4JK5A 4NIWA 2BLQA 4NCYA 3RLWH 2PTCE 1TNKA 5F6MA 3ZVDA 4MNYA 3GDUA 2D8WA 2AMDA 1YF4A 1S83A 4NIVA 3PWBA 1EXFA 2KAIA 3RXFA 4U30A 3S69A 3TK9A 4CR5A 1CQQA 1YCPK 3TGJE 3KN2A 3M36A 1SQTA 4ISIH 3LGTA 1TRNA 4ZUHA 1EAXA 1NRNH 1VITF 4LXBH 1AU8A 1LHEH 4K1EA 5DKMA 1P10A 4AFSA 2BD5A 3F9GA 1K1PA 1SB1H 3EA8A 2FIRH 2HWLB 2PGQB 1Z1JA 1NRRH 3TGIE 1MKXH 4CBOA 1WUNH 1GJ8B 1A0HB 1ZSLA 2DUCA 2RA3A 2XBYA 1OXGA 5DPAA 1O32A 1DXPA 3BG8A 4DT7B 3M7QA 1ANDA 3PROA 3MFJA 1FY5A 4YTAA 1KLIH 3PMBB 1EASA 1HXFH 1V6DA 2Z3DA 4KP0A 5EQRA 1FUJA 1NTPA 4ASHA 4X8TH 4OGYA 4DIHH 1FN6A 1XUGA 3I77A 1O2SA 2G4UA 1C5UA 2VWNA 3HKJB 2NU1E 5DP8A 1Q2WA 3A7XA 2QC2A 3C27B 3H7OA 2QGRA 3T27A 1O2VA 3KQDA 5AFZH 1HV7A 4WMEA 3ATKA 1C2GA 1JXPA 2R3YA 2P3TB 3P17H 2P8OC 3RM0H 1W7GH 3VB6A 1XVMA 4BTIB 1IQIA 4WMDA 2ZTXA 1GMCF 2F9OA 2H6MA 2VU8E 1ESBA 2FO9A 2Z9GA 1C1TA 1MZAA 2C8WB 1TQ0B 2Z94A 2FOBA 1GMHF 3HGPA 1FMGA 1ELFA 2BOHB 1O2IA 4CRGA 1THRH 4BAHB 3S0NA 1LVOA 1C5ZB 1LCYA 1QR3E 3KQBA 3DT0H 3TJUA 5FPTA 1GHBG 2ZDLA 2JETC 2CF9H 2BHGA 1SGNE 4H4FA 4CRFA 7GCHG 3TJNA 1CBWB 1QRZA 1F5LA 3TJOA 5JB9S 1ESTA 1AE5A 1V2RT 2ANYA 2GTBA 2ZFTA 3H5CB 4JZFH 3GCTG 1P0SH 3KQEA 6CHAC 1P9UA 1GCTC 4H6SB 2F9PA 1O3FA 4JZDH 4BAMB 1K21H 1C1UH 5TCAA 4H6TA 1S5SA 1C1WH 2AYWA 1MTVA 4GAWA 2D1JA 3UOPA 1A5HA 1BHXB 1ACBE 2AEIH 5C20A 4FU9A 1TX6A 1Y3VA 2BDHA 1HAGE 3A83A 4I31A 3NK8A 1AIXH 1LHGH 1C5XB 5A0AE 1B0EA 2ZCHP 3RM2H 3VGCB 2FDAA 1T4VH 1WQVH 3FP7E 2RCEA 2ZFFH 3IWMA 4B71A 1BT7A 2XCNA 1B5GH 4R0IA 3OU0A 4K8YA 2FX6A 4Y8XA 1AUJA 2BD2A 1C1MA 4Q7XA 3UY9A 5IDKA 1OWDA 1ZTJA 4I7YH 3K6ZA 4SGBE 1GI8B 1Z8IB 1C2LA 1O2NA 2ZDKA 2Y80A 2SGFE 4MLFB 1RFNA 5LPEA 2OC7A 2VVUA 1ELTA 2XBXA 1GMDF 5ESTE 2WV4A 1FY8E 1TMTH 3SNCA 1SFIA 3PLBA 3BTFE 5LPFA 2AIPA 4MNVA 2VVCA 2NWNA 5DK1A 1BMAA 5HXFA 3E8LA 4AGKA 1GBCA 3W94A 3LU9B 2G52A 1C5LH 1GBIA 1BQYA 1NU7B 1TAWA 4XBDA 2PHBA 1MBQA 1TRMA 1N8OB 2D2DA 1Z1IA 3OTJE 1P04A 3SUGA 3AW0A 1MU8B 1YLCA 1EATA 2ZFPH 7ESTE 2QXIA 3LJJA 1A0JA 2ZC9H 5CMXH 2Y7XA 3TK6A 2ZFSA 1CSOE 1JMOH 1XUIA 1P2NA 1C5MD 2Z9KA 1ZMLA 3V7TA 4AFQA 2XTTB 2B5TB 4ABHA 2W3KA 3D23A 1FZZA 3TVJB 1K22H 1ZSKA 2ZI2H 1K1NA 1BTUA 1NY22 4VGCC 1BIOA 3A85A 2AGEX 1WU1A 4DG4A 3M5LA 1CU1A 2HVXA 1C4Y2 2UWLA 1EZQA 4FXGH 1YGCH 3K9XB 1IQEA 1O3NA 4JCNA 3OY6U 4K60A 4A5TS 2YOLA 5GCHG 1QB9A 1P02A 2IOTA 2BDYA 3A81A 1ZPBA 3KF2A 3UIRA 3GDVA 1OP0A 1RTKA 2PSXA 1UCYH 2JKHA 3GCHB 4NIYA 4FVDA 2ZO3H 1DVAH 3ZZAA 1SLUB 8KME2 1C2DA 1GL0E 2OLGA 3E90B 1HRTH 3BEFB 5C67A 2GKVE 1H9IE 4TY6A 1AUTC 4ZHAA 2ZCLP 1K1JA 1QTFA 1AY6H 1FI8A 1GWAA 3EYDA 1OYQA 1KXBA 2FOAA 2STBE 4KKDA 3VPKA 5EXMA 1GI4A 1V2NT 1KTSB 2EC9H 3A86A 3P6ZB 4AB8A 1D4PB 3PMAB 1ANEA 2HRVA 2UWPA 1MUEB 3WY8A 1GBLA 5K7RA 4HZHA 3SV7A 2G51A 2WPIS 3NWUA 4XSKU 1Z6JH 4A1VA 1G37A 2G81E 3TH3H 1IQGA 4K3JA 2FOCA 3RDZA 2YNAA 1VITH 1SL3A 2F3CE 1XXFA 1O38A 2H5CA 1CGJE 2QXJA 4MQAA 2ZHFH 3QGJA 2AH4X 3KNXA 3UREA 5B6OA 3VB7A 1HIAB 2FX4A 1AFEH 4Q7YA 1MTUA 3M35A 4JZEH 1YPJH 4K5ZA 1MD8A 3PM3A 3SN8A 4BXWA 5F03A 5ESBA 3VEQB 1HPGA 2F9UA 4IN1A 3ZZ8A 1ARCA 3UPEA 3RLYH 1HGTH 1TOMH 1G9IE 2GV7A 1EZXC 3G01A 3PB1E 1FXYA 1OYTH 2BX3A 3AVZA 3BTKE 3M5MA 3KGPA 2BX4A 2F9NA 1EB1H 3TJVA 1N6YA 5DJ7A 6LPRA 1MTNB 2XCFA 3PLKA 1ETSH 2BDIA 1EUFA 1OP8A 3P92A 1PPEE 4ZHLU 1BTHH 2ZU3A 3U1IB 5EPYA 3QZRA 3JZ1