3LPRA

Structural basis for broad specificity in alpha-lytic protease mutants
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACAGRGDSGGSWITSAGQAQGVMSGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ALPHA-LYTIC PROTEASE
publication title Structural basis for broad specificity in alpha-lytic protease mutants.
pubmed doi rcsb
source organism Lysobacter enzymogenes
total genus 53
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1991-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3lprA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3lprA01
1GBBA 1IHTH 1C5SA 1ABIH 1LPZB 1C5PA 3BIUH 2A5AA 2NU4E 4I8HA 1F0TA 2ZF0H 2HLCA 2OC1A 1YPGH 1V2MT 5DP6A 1N8OC 2ZHWH 2ZFFH 3ENSB 3RXJA 3KQCA 3RMLH 3A83A 1WU1A 1L0ZA 4K2YA 3GCTG 2TRMA 4JYTA 2C3SA 2VIOA 2BHGA 4UFDH 2ZGJA 3BF6H 5DKMA 1BT7A 1AE5A 1LO6A 3T27A 4AZ2B 1V2UT 1FY1A 3F6UH 2OCVB 4ZHLU 5JBCS 1YC0A 2XCNA 1C1SA 1GCTC 1P04A 3TIUA 2HRVA 2GVFA 1ZSKA 1T4UH 1TRYA 5GJ4B 2FI5E 3VFEA 4AG1A 8ESTE 1O36A 1NZQH 1S0QA 1ZZZA 2XXLA 3LGUA 4E05H 1C2FA 1RFNA 3QGJA 4KELA 3A89A 1C5YB 3B8JA 2IJOB 2HWLB 3NCLA 1H9HE 2WV5A 3A84A 3V3MA 1HIAB 4DG4A 1JRTA 1TBZH 2FTLE 3RXFA 4X8TH 1NS3A 1XXDA 3ODDA 1KLIH 4OS7A 5DG6A 3MU4A 4D8NA 1O2KA 2Y80A 3K2UA 1MCVA 2WPLS 2AFQB 1H4WA 2G00A 2BY9X 1N6YA 4Y0YE 4Y8YA 1CU1A 1PPHE 2FOBA 1SGYE 2GTBA 3O8CA 4CRAA 3PM3A 1ZTKA 4INHA 3QWCH 2QF3A 1NRRH 1O37A 3CP7A 1J16A 3UY9A 4IN2A 3DD2H 1TX6A 3E8LA 1JWTA 2QXJA 4IN1A 2P94A 2Z9IA 5DP4A 1AFQB 1N1LA 2A7HA 2OXSA 2SNWA 2ZQ2A 1EQ9A 2Q6FA 3LONA 5JPMH 1HFDA 3I77A 1PPCE 4MNWA 1FY8E 1DLEA 1TAWA 3F9FA 5E8EH 2BM2A 5L2ZH 2CF9H 2QCYA 4WXVA 4NG9H 1GBTA 2AERH 4IMQA 4K60A 1O5AB 1XVOA 1C5TA 1ZPBA 1FAXA 2B8OH 2ULLA 2SGFE 1SFIA 1CSOE 1KXEA 1O2SA 5EOKA 3MNSA 1MKWH 2QV1A 2PGQB 1HUTH 2VIWA 2OC0A 2BOKA 4BANB 1ZJKA 5F6MA 2ZGXH 1Q2WA 3SV9A 1FMGA 1Z1IA 3PO1C 1FONA 1Z6JH 3BEIB 4B1TA 2BY6X 1Z8GA 1UK2A 4ISHH 1FPHH 1OWEA 3U1IB 4D9QA 2ZCKP 4AFZA 1GBMA 5E0JA 1GL0E 3PYHA 2ANWA 2PTNA 5A8XA 1C5LH 1A1RA 3SW2B 1L4DA 5SGAE 5IDKA 3T2NA 1ZLRA 2P8OB 1UJ1A 4YOGA 5FPYA 1EAUA 3LH3A 1AVWA 4JZEH 1V2WT 2GV6A 1LTOA 3RXPA 3OY6U 3TNSA 2EA3A 1DITH 2XYAA 4I8LA 1YPLH 2FM2A 4LXBH 1O5FH 2OINA 3RXEA 1AGJA 1KDQA 4THNH 2A1DB 4MTBA 2Z9LA 3ZZDA 2ZPSA 1RD3B 3TNTA 1K2I1 5GIBA 1J8AA 3DUXH 2CHAB 1SLXB 7KMEH 2GCHG 3IG6B 2A2XH 1LDTT 1L1NA 1OX1A 2FESH 1BTWA 2V35A 1YCPK 1O32A 2P16A 3EAJA 1KSNA 2HOBA 2ZHDA 4OS5A 1FAKH 1ELFA 1ZMNA 3T25A 3HGPA 1TYNA 4LZ1H 3M3TA 4MG3A 4MPVA 2FP7B 1BBRH 1GI3A 5GCHG 1GHAF 1P3CA 2FPZA 2XBYA 5AF9H 2TGAA 2VWOA 1BUIA 1BMNH 1SQOA 2LNCA 2R0KA 4JK6A 2VIVA 1GI7B 4UEHH 1XM1A 1Z8JB 3RXSA 1A2CH 2BLOA 2ZPQA 2Z9GA 3WY8A 1MD8A 3ZZBA 4ISLA 3ATWA 3SNBA 1V2JT 1P05A 3PTNA 1UVOA 2A45B 1TPAE 2PR3A 1C2HA 1P01A 1UCYK 1DX5M 1KXBA 1SBWA 4MNYA 2FI3E 2A31A 3ZYDA 4DIHH 4AGJA 3SNDA 1T31A 4AG2A 3STJA 2AGEX 3OU0A 4X2WA 3MU1A 4XBBA 4O3UA 2BLWA 3M3SA 1H8IH 2BQ6B 4A6LA 1P11E 3K9XB 3KQDA 4U01A 5JYIA 2HPQH 3G01A 3GCOA 4ZXXH 2ZFTA 1W0ZU 4NSVA 4K1SA 4X1SU 4R8TB 2P93A 4UFFH 1KLJH 4ZHMU 1RRKA 3RUOA 1O3BA 3P8GA 4JK5A 3SUFA 5HXFA 3SORA 1C9TA 1P8VC 1YPKH 1CT4E 1EASA 1TWXB 3SUDA 2PFEA 4GPGA 5FPSA 3KIDU 4NSYA 5E0HA 4RSPA 3W94A 3M61U 2PV9B 3QTOH 1QQUA 4IMZA 4DW2U 1W13U 2QY0B 5AVDA 3Q3YA 3FP7E 2GMTB 1C5OH 1F2SE 3GCHC 3VB6A 5DP3A 3ELAH 1AO5A 1QCPA 3MNXA 1OS8A 3QK1A 4Y8ZA 1AB9C 1AKSA 2GD4B 3MO6A 1T8OA 1CO7E 1ZGVA 2P3FH 1DSUA 1AHTH 1BTUA 1W10U 3TPIZ 2J9NA 3F68H 1CHGA 1ELEE 1O2UA 4ZKRU 4UONA 4CH8B 5A0BA 1XUKA 4O3TA 3LJOA 1S0RA 4FUDA 1QTFA 1E37B 1LKBA 1PPFE 1G32B 4DVAU 1YP9A 4JYUH 1GI9B 1DOJA 3BN9A 1KDQB 5AFZH 4BTUB 5CE1A 2WV4A 1THPB 3RXLA 1C2DA 3T62A 1FIWA 3LGYA 1NRQH 3UIRA 2ZDLA 1MTUA 5ESBA 1MAYA 3E0NB 1IQGA 3E0PB 1LVYA 2G4UA 2SGQE 3B9FH 2TPIZ 3D49H 4GHTA 2XCFA 1DXPA 3F9HA 1BTYA 1GDNA 1C5WB 2GCHF 1TIOA 1XX9A 2FX4A 3RM2H 1GBCA 1MD7A 1BJUA 1Q31A 1ZR0A 2P59A 2R0LA 3Q77A 1NRPH 1OWKA 1UVPA 4ZAEA 1OWHA 4NIVA 3UNSA 1EOJA 1GI1A 3T5FH 5I46H 1ZGIA 3ZZAA 1QBOA 1BZXE 4Q80A 4I7YH 1V2QT 1HAXB 1CVWH 4IGDA 5DJ7A 3ZZ5A 2GZ7A 1BITA 1YLDA 1ELGA 3AAVA 4MNVA 4LZ4B 3LJJA 2OD3B 2V3HH 2SGPE 6GCHF 4X6MA 2FX6A 1FPCH 1SGEE 8GCHG 2BD3A 4QT8C 1SQAA 1W2KH 1TNJA 2UUJB 3SV7A 2BZAA 1AD8H 2ZCHP 3TITA 1BJVA 1HCGA 2IOTA 1T7CA 1TQ7B 2ALPA 1O3OA 6CHAC 4K5ZA 4OS1A 1EPTA 1GHBF 3VPKA 2XBWA 1E0FD 2G4TA 3LPRA 3FZZA 3AASA 1AIXH 4B76A 2OLGA 3BTGE 4HFPB 3BG4B 1W7GH 2VJ1A 1MTSA 4XOJA 4FUHA 4UFEH 3VXEH 4MNXA 1C4V2 1SOZA 5L30H 5EQRA 3D23A 4B75A 3RU4T 1HJAC 3OTJE 5DP7A 1D3PB 1ESBA 2EI7A 1TOMH 4K69A 5T6FA 1DXWA 5LGOA 1EB2A 1PFXC 3IITA 3UNQA 2WYJA 2ZTXA 5HM9A 2I6QA 2F9UA 1FJSA 3E3TA 4D9RA 3MU8A 4BNRA 2XC4A 4GAWA 1TFXA 1GG6C 1TRNA 2D26C 2O8WA 1QIXB 1O3FA 1AKSB 1L4ZA 2SGEE 1P09A 4A1XA 2HALA 5A8ZA 4DT7B 4BAQB 1C1OA 2W7UA 1DSTA 3L3TA 3UOUA 1GCDA 2ZU5A 4Z0KA 2J34A 1ZHMA 5EW2H 3IWMA 2XC0A 2V6NA 1AUJA 1C5NH 1V2ST 3A7ZA 1SPJA 1S6HA 5DK1A 1NT1A 4SGAE 3ZYEA 5EQSA 4KTCA 2GZ8A 3P92A 1QRWA 1T32A 3HK6B 1HV7A 1EJAA 1MU8B 2ZO3H 1YF4A 3B23B 1NRNH 1LKAA 1ZRBA 3BTME 5C3NA 2QXGA 1O39A 3E6PH 2W26A 1P03A 2XWAA 5FBIA 1O35A 3FAOA 3AVZA 4BAKB 4BTIB 1YPHC 1GHXH 3SU1A 1Y8TA 5PTPA 1MQ6A 1PPBH 3UWIA 2D2DA 3PMAB 1C2KA 1UK4A 1GDUA 1AUTC 1SB1H 2BLVA 1QL7A 4TPIZ 1DWBH 4B74A 2THFB 4E06H 1THSH 1CA8B 1T4VH 4O9VA 1BDAA 2VIPA 2AIQA 3RXVA 1DS2E 3RXAA 1A0HB 1QFKH 1Y3WA 4DIIH 1WV7H 2PW8H 4HI3A 1ID5H 2QXIA 4KTUA 1P2IA 2OTVA 3UR9A 1DPOA 4K8YA 1EJNA 1G30B 1Z8IB 1HNEE 3K6ZA 2FOFA 3VB5A 3SOSA 3P8OA 2BMGB 1C2MA 1YCPM 1B0EA 1A5HA 1W12U 1GJ8B 1P06A 1P57B 4OS2A 2A4OA 9LPRA 1AWFH 1P2JA 2Q6DA 1NFXA 1SI5H 1LHDH 1EPTB 4FUGA 4Q7XA 2ZQ1A 2ZFSA 1P2QA 2F9NA 4FU7A 2XNIA 2Y5GA 2A7CA 3S9CA 1A4WH 1EOLA 1AVGH 2DUCA 3LU9B 1GJBB 1CBWC 4H4FA 3SU5A 1IQKA 1GI6A 3UFAA 1KXDA 2QA9E 3A7YA 1GI8B 2IN2A 3RXDA 3GY7A 1JIMA 3MTYA 1SHHB 2FIRH 2PHBA 2UUFB 1TX8A 1O2LA 2PWXA 1F0RA 1U6QA 4JZFH 2F91A 4RN6A 4CRFA 1NTPA 1UTLM 1V2VT 3SO3A 1FZZA 1UVTH 1G36A 1O5BB 1AZZA 3U8TH 3E16B 1GBKA 1AN1E 1XUGA 3HKIB 4AFSA 1TBQH 1BMLA 5JDUB 1SLWB 1EATA 2FOHA 3RXIA 2FYRA 1BRAA 3DFJA 1MU6B 4FUBA 1AMHA 2BX4A 1GI4A 1RXPA 2VWMA 2VINA 1C2EA 4YOIA 1HAIH 3OSYA 1GHAG 1TNKA 3EA7A 1T8LA 1Z6EA 2AMDA 1SQTA 2PGBB 4GCHG 1HJ9A 3SJOA 1W11U 3BV9B 2Y5HA 1E36B 3RU4E 2YNBA 3SN8A 4KGAA 1UCYE 1UTQA 2ZDAH 3V7TA 2H9TH 3QN7A 1CHOF 2KAIA 5FAHA 1C4Y2 1MZDA 1DE7H 1QL8A 1TNLA 4YLUA 2ALVA 1DWCH 1FQ3A 3D65E 1BTPA 1SFQB 1LPGB 2BX3A 3QUMP 3SU6A 1BRCE 3CS7A 1O3MA 3UREA 2NU2E 5ETXA 1GJAB 1UMAH 4YO9A 2FOMB 2ANKH 3KNXA 1DY9A 5H4IB 3Q3KA 3BTTE 1O0DH 1LVMA 2FO9A 2ODYB 1XKBC 3SNAA 2F9OA 1QJ7B 1J17T 2A7JA 2EEKA 1GDQA 2ZNKH 3ZZ3A 1T8NA 2VIQA 2H5CA 3RC5A 4CHAC 1S84A 1VITF 2BQ7B 4AN7A 4XE4A 2P8OC 4INKA 1P9UA 1HPGA 2R3UA 4ZH8A 4BTTB 3S9AA 2Z9JA 1UHBA 1VZQH 2Y82A 3RC4A 1FY4A 1O3KA 1V6DA 1KXCA 1QR3E 3VGCC 1YBWA 2GDEH 3GY3A 3FVFB 3PB1E 4FU8A 1QRXA 3DFLA 1GMHF 1CT0E 2FLBH 7LPRA 4CR5A 4J1YA 2IPHA 1GVKB 2CHAC 2ZI2H 4B2CA 1PPGE 2BD5A 1YPJH 2BDAA 3M5NA 4GSOA 1A0LA 3H5CB 4H6SB 1ELBA 1C1PA 1XKAC 4YZUA 2ZU3A 3RXTA 2RDLA 2VGCC 2BB4A 3GYLB 4Q7YA 1L1GA 3KEEA 2AS9A 4FUEA 1GL1A 3ATMA 3P6ZB 2Y6TA 1BHXB 1HXEH 2BOHB 1O2MA 1OPHB 3AW1A 3MH6A 1GMDF 3NWUA 4FUJA 8KME2 2F9VA 1EAIA 2TGPZ 3K65B 1O2QA 1JOUB 1O3JA 4K3JA 5GDSH 1G3DA 4AOQA 2BD4A 2HGTH 1O2PA 1HB0B 1FIZA 2Z3DA 3H7OA 1AI8H 1ZTLA 3E1XB 4NIXA 2VVUA 3K6YA 3TGIE 4YTAA 1IAUA 1O38A 3V0XA 1A61H 4WH8A 4MPWA 4ABFA 2ZDKA 1D6WA 1V2NT 3LC5A 4INLA 1UVSH 5FX5A 5EU8A 3SJIA 1K21H 3ATKA 2FYQA 3TK9A 3LGTA 4F49A 1VITH 1TNIA 2PLXA 1UTMA 4I32A 1C1NA 5LPRA 3E91A 4NGAH 1IQNA 1GBLA 1SGTA 2ZTYA 1TE0A 2AIPA 5EQQA 1O3NA 5J4QA 5GWZA 3UNRA 3AAUA 1YPEH 1EAWA 1K1PA 5EXNA 1P3EA 2JH6D 3MMGA 3RLYH 5EXLA 3L6PA 1UTOA 3R3GB 4MQAA 4VGCB 2KAIB 3A8CA 5DP8A 3LGWA 4GCHF 3SNEA 3SU3A 6GCHG 3NK8A 4AX9H 1C9PA 3M7UA 4AB9A 1BA8B 3E90B 1D3TB 1MBMA 2ZECA 3PO1B 1WCZA 1PPEE 2UUYA 2ZHEH 3O8DA 4JZIA 2HNTE 4WH6A 3ZZ8A 1CE5A 1INCA 3RLWH 1KTTB 1TMTH 5FPTA 2QC2A 1G9IE 2UWPA 3PMJA 3SGBE 2EI8A 1ZYOA 2GMTC 2TBSA 3JZ1B 1ACBE 3RXCA 1T8MA 2P3UB 1C5XB 2VB0A 1TGCA 1ARBA 1HLTH 1GHBG 2HPPH 1QBVH 4RKOB 2ZU4A 1FUJA 1OYQA 2XBVA 3TH2H 4H6TA 1UHBB 1GGDC 1IQHA 4MPXA 4LK4A 1O34A 4AORA 5BPEA 1O2TA 2STAE 1AE8H 3M35A 4UD9H 1F5LA 4IC5A 1ANEA 4J2YB 1IOEA 2FOGA 3A87A 2SGDE 1RTKA 3M5MA 1KIGH 2Y81A 1GBIA 3ZVEA 2BYAX 3ZVDA 1GI0A 2PKAA 1S81A 1Z1JA 3SGQE 3P17H 3KL6A 2Q1JA 1GHZA 4Y0ZE 4KP0A 1QGFA 1XUHA 1O2NA 2ZFRH 1EZSC 5F03A 3SHAH 3SJKA 3A8BA 2F83A 1MTVA 2EI6A 1EZUC 1C2GA 1QB9A 1FY5A 1KTSB 1O2RA 5DGJA 2DE8A 2ZC9H 3U9AH 2FZZA 1IQIA 1GBAA 4E7NA 1PQ5A 3URCA 2UUKB 3F9GA 4A5TS 1QHRB 3T29A 3M3VA 2H2ZA 1OWDA 1JMOH 5I25A 3Q00A 4AB8A 1LQEA 2F9PA 1TGNA 4K8BA 3A7XA 2R2WU 3RXOA 1O5CB 2J2UA 1V2LT 2SNVA 3PTBA 3F9EA 1MUEB 4UE7H 3FANA 4PROA 4A1TA 3TJOA 4JMYA 1PQ7A 3P70B 1YM0A 3V12A 4NIWA 1AZ8A 3SI3H 1PYTC 1PYTD 2AEIH 4Y7BA 1B5GH 2ESTE 1SGNE 4X2XA 2ZKSA 3HKJB 4ZKOU 1BTZA 3A7VA 4UFGH 1W0YH 3ITIA 3SU0A 4WMEA 1QBNA 2A2QH 5C1YA 4Y8XA 4DY7B 5TCCA 1CGHA 6LPRA 4D7GA 3TU7H 1FLEE 1AQ7A 1O3DA 1V3XA 1EP6A 1VGCC 1P2KA 1TONA 2H9EH 1E35B 4CBNA 5FXLA 3SQHE 2QIQA 4X0WU 1XUIA 2XBXA 1K1LA 2R9PA 1VCWA 1UTNA 2GGVB 2ILNA 4D76A 1SGRE 1DT2A 5C5NA 1G3BA 3BTKE 2CV3A 1W14U 4TYDA 5LPEA 1RS0A 4RKJB 1XXFA 1ETRH 3EDXB 4A1VA 1C4U2 1EAXA 1QY6A 5JB9S 3SU2A 3GY2A 2BD8A 4ESTE 4Y6DA 2ZHFH 1C2JA 2H1UA 2ZDNA 3M7QA 1TMBH 2G52A 2C8XB 2BZ6H 1DWDH 3GISB 1A0JA 3P8FA 1WTHD 2BVXH 2B9LA 1DY8A 3S7HB 1D9IA 3Q3XA 4BOHA 1RJXB 1LPKB 3ZZ9A 5EG4A 4ABJA 1YCPH 3SZNA 2Q6GA 2BTCE 2FMJA 1H1BA 1QA0A 2VU8E 4ABEA 1CA0B 1ZTJA 1ESAA 1HAVB 5C67A 2JETC 1ELVA 2I6SA 4YT6H 1NM6A 2Z7FE 3FP8E 2AMPA 1EKBB 5EXMA 1TALA 2V3OH 2J4IA 1QB6A 3VXFH 1TMUH 3OY5U 1ANCA 4FUFA 1W8BH 2PKAB 1OOKB 1SC8U 3U1JB 4CRCA 4B71A 1ZPZA 3JZ2B 1MKXH 4Y11E 5C5OA 1GBJA 2O9QA 3M5OA 2HNTC 1UCYH 2TGTA 6ESTA 3QLPH 3MO3A 1F5KU 1UO6A 3GY6A 1LHFH 1FV9A 2P3TB 3MU5A 5A8YA 5A0CA 1YLCA 1X7AC 7ESTE 3BTDE 1J9CH 2FWWA 1QL9A 5EW1H 1HGTH 1C5UA 2ZTZA 3RMMH 1YYY1 1O33A 1SGFG 1CHOG 4Y10E 4CH2B 2QYIA 1Y5AT 4ABGA 4MPUA 3Q76A 2SGAA 1QA7A 1W7XH 3A8DA 1LHGH 1K1NA 2NWNA 1C2LA 1XMNB 2XC5A 1NFWA 1H9LB 1MTNB 3CS0A 4OS6A 5HM2A 1OSSA 4ABDA 4ZUHA 3U98H 1Z8RA 3ZVFA 1BTXA 1GMCG 2RA0A 3A80A 2BD7A 2P95A 1LVOA 4FVBA 4JCNA 1ANDA 1GJ6A 1WTGH 2FS9A 1CQQA 3VEQB 2ZPRA 3GICB 1C1RA 2BXUH 3PWBA 1MQ5A 1IQEA 4H42U 1VITG 4IS5A 3ATLA 1C1UH 1EPTC 3S7KB 4IC6A 2ZDVH 1O2ZA 3MO9A 1S5SA 3MH7A 5HGGA 1RIWB 4AYVB 2FOCA 1E38B 1S6FA 1BTHH 1YGCH 5T3HA 1GBHA 4DJZB 1MKWK 3PMBB 5C2ZA 3EA8A 2PKSB 2ANYA 3OYPA 4TPYA 3PROA 3ZVAA 1BQYA 1ZSLA 2PUQH 2CGAA 4WMFA 1KLTA 1GMHG 3KGPA 3HATH 4HTCH 2FLRH 2A0QB 1SHYA 1XVMA 4GVUA 1F7ZA 1PQ8A 1HBTH 2G5NA 5CHAB 3S9BA 4AGKA 2OQUA 1TRMA 3LOXA 4TWYA 4E7RG 2R3YA 5C1UA 4ISNA 1GG6B 2GCTB 2QGRA 4K1EA 2OUAA 1GBFA 1WBGB 4MLFB 1GI2A 1SGCA 1B0FA 3GY4A 2G55A 2H6MA 1O5GH 3SUGA 1SG8B 3ZV8A 2C8ZB 3TK5A 4ASHA 3ODFA 3LGIA 1O3PB 5BRRE 1MMJN 4ZROA 1GMDG 3A8AA 5A0AE 3EE0B 4WY3A 4CRBA 2VNTA 4DCDA 3BIVH 1TLDA 1HAHH 2NU1E 3UUZA 2A4RA 1MZAA 3GYMA 1Z7KA 3TK6A 5AHGH 2G51A 1BB0B 3SV8A 2Z6BD 3EYDA 1LQDB 1O2XA 4XBDA 3DHKH 1JRSA 1IQMA 1P12E 1O3GA 4KTSA 4YESB 1K22H 4CRGA 1GJ4H 1S85A 2PSXA 4LOYH 3M7TA 1BBRK 1K28D 4BXWA 1YPMH 1N6XA 1DM4B 2OBOA 3V13A 1D3QB 2BY7X 1OWJA 1ARCA 1SLVB 1PJPA 2G5VA 1GHYH 4X6PA 4Z6AH 2O8MA 2Y7XA 3RXRA 1OXGA 3TJVA 1AFQC 2ZHQH 2GT8A 1KY9A 4A7IB 4WXIA 2FOAA 4SGBE 1EXFA 1EP5A 1DWEH 1D6RA 3BEUA 2VH6A 1LHEH 1TBRH 1VCPA 2A5IA 1WSSH 4AFQA 3ZV9A 1BRBE 2BDGA 5TJXA 2ZP0H 3OX7U 1NROH 2YNAA 2AGGX 3A88A 1ZPCA 3MYWA 1JIRA 1YKTA 2OP9A 4NCYA 1Y59T 3NPSA 1DVAH 1C1WH 1G3CA 2BDYA 3UTUH 4X8UH 4D7FA 2OQ5A 2YOLA 2M5TA 2ANMH 2BDCA 2F3CE 2FTMA 1LCYA 1O3CA 1GHWH 4B2BA 4DOQA 1O2HA 1SGIB 1TA6A 1O30A 3MU0A 5ABWA 1J15A 1O5EH 1GWAA 3PMHB 3MFJA 1CBWB 1GMCF 1SGDE 3SJ8A 1O2YA 8LPRA 3QGNB 2TGDA 1CGIE 1NC6A 1G3EA 2G8TA 3CENA 3ZZ7A 1AY6H 1TABE 3TLOA 3HGNA 1Y5UT 1RTFB 3BTQE 1TGTA 1N8OB 4FVDA 1HYLA 2STBE 4BAHB 1D4PB 2Z94A 3BTHE 4HGCA 1P10A 1BMAA 1C5RA 1DUAA 3R0FA 1P02A 3SU4A 3UQVA 4A92A 3TVJB 1S82A 4MDSA 1O2VA 4NFEA 2W5EA 3PV4A 1GCTB 1Z71A 1FI8A 1DFPA 2VWLA 1C5ZB 4I33A 1IHSH 4ZXYH 3VB3A 2NU3E 2PSYA 4ABBA 2BD9A 2PUXB 5FCKA 1ZRKA 1NESE 5EPYA 1NO9H 2BY8X 2FS8A 1FN6A 3P95A 3SGAE 2WPJS 3VB7A 7GCHF 3S0NA 1BIOA 2J38A 3P8NA 2TIOA 2CN0H 4X8SH 3LH1A 3GY8A 4ZMAH 3PLKA 2NU0E 4DURA 2FI4E 1O3IA 2GV7A 3LC3A 1OWIA 2BVRH 3O8BA 4VGCC 3SV2H 2HVXA 4ISIH 4X8VH 1UTKA 1Y3XA 3LT3A 3ESTA 3SHCH 2BY5X 3QZQA 2ASUB 1O2IA 3SQEE 1F0UA 1TNHA 3KF2A 1CGJE 1SGPE 5DP5A 3FZDA 1ETSH 3NKKA 2WPMS 1DICA 1BCUH 2ZFQH 4JYVH 2A5KA 3RC6A 1BHXF 1GJCB 4M7GA 2GT7A 1ZHRA 1O3LA 3NZIA 1C2IA 4O03A 3MOCA 4OS4A 1SSXA 3T26A 4CHAB 1D3DB 3RXMA 2JH5D 3KHVA 4MVNA 4ABHA 4ISOA 2XRCA 3KQBA 1O2JA 4NWLA 1C1MA 4BAOB 1C5MD 3RM0H 3ZVCA 1UVUH 2ZEBA 3VGCB 1C1QA 1WOFA 1C1VH 3BTEE 5JBBS 5FX6A 9ESTA 2C93B 3L33A 1AFEH 3BTWE 5T6GA 1THRH 3SUEA 2JKHA 5A09A 5E0GA 2BDIA 4X2YA 1K1OA 3MHWU 3F1SB 3GCTF 1SGQE 1TNGA 1O2GH 4U30A 2CJIA 1VCQA 3EA9A 2C90B 2VGCB 2GX4A 3A82A 3ZZ6A 1J14A 1GPZA 4XSKU 2BQWB 1P9SA 4AFUA 1HAPH 4GLYA 2W3KA 2A4GA 5CMXH 2BLQA 3QZRA 1TGSZ 1RGQA 2VWNA 1TPSA 2B5TB 1FXYA 1QURH 4I8JA 1Y5BT 2J95A 2CXVA 1NU7B 1CT2E 1ELTA 1GBEA 1O2WA 3QO6A 3UWJH 3M5LA 1IQLA 1KXFA 1SVPA 1W3CA 5JBAS 1P2NA 2ZDMA 1O3HA 2WPHS 1C1TA 1JXPA 1PQAA 2QN5T 1MKXK 4ABIA 4U32A 3PLPA 1TB6H 1P2MA 2AMQA 3PWCA 2UWLA 3I78A 1HAVA 5C20A 2ZU2A 3GOVB 1EZQA 3RU4D 5F8ZA 5DO4H 2K1QA 2AH4X 1SL3A 3S69A 2JH0D 1ZMJA 1QQ4A 4B73A 4FUIA 2J92A 1WAYB 3SBKA 3RXGA 1V2TT 3DT0H 3C1KA 4I31A 3ATIA 4I8GA 3GDSA 5LH8A 4Y76A 4NA8A 4OGXA 4JZDH 1SLUB 3KN2A 4ZKNU 5J4SA 1MBQA 3UOPA 1F0SA 1WQVH 1ABJH 3UR6A 1BMMH 1TOCB 3M37A 1NPMA 2FODA 4B2AA 5ESTE 3A81A 2RA3A 4YOJA 2V0BA 5F8XA 1QRZA 2W3IA 4X1NU 1YPHE 1OP0A 3GDUA 2VIDA 3RMOH 1LVBA 1H9IE 1OKXA 2OC8A 1O3EA 4ABAA 1ELCA 2ZIQH 5FCRA 5FHTA 3UPEA 1DANH 1OYTH 2GKVE 2CMYA 3SI4H 1EZXC 5F8TA 3ZVGA 2ZA5A 4YM9A 4X1QU 2XW9A 3GCNA 3STIA 2CF8H 1G2LA 5TCAA 1L1JA 1NN6A 1WYKA 2BDBA 2QF0A 4NZQA 1GGDB 1HDTH 2B7DH 4OGYA 4TWWA 1AVXA 5K7RA 1TQ0B 1ZHPA 2VVCA 1TGBA 1BOQA 4K1TA 3TGJE 1CA0C 1DUEA 4GUXA 5GXPA 1FNIA 3BTFE 1L2EA 3U8OH 1AU8A 1ZMLA 4XDEA 5JB8S 4FU9A 2ZU1A 5EODA 3D62A 1O5DH 2A32A 3LDXH 4NZLA 3U69H 1Q3XA 3BG4C 1B7XB 3A7TA 4IW4E 2GZ9A 1C5VA 2Z3CA 4YT7H 5L2YH 1GVLA 3SNCA 1HAYB 4CREA 3FFGA 2WINI 3RP2A 1MH0A 5JBTA 2WPIS 3GCHB 1A5GH 3ZVBA 1NRSH 1AB9B 4HZHA 2Z3EA 1ZOMA 3T28A 1IQJA 1GBDA 3QTVH 4CR9A 1A3EH 2ZFPH 4Y71A 4FXGH 4WVPE 1ETTH 3M36A 4O97A 2R2MB 3RXBA 5E2PA 2LPRA 5GCHF 3KCGH 2B0FA 4I8KA 3N7OA 4NA9H 1RTLA 2QXHA 1NFYA 1V2KT 3PLBA 1DDJA 3EGKH 4XFQA 1UK3A 1LMWB 2WUBA 3H7TA 2C4FH 1HJ8A 3NXPA 3TJUA 5A2MH 1VJAU 1BBRE 2W7SA 1GJ5H 1E34B 1GI5A 5G4BA 1EX3A 1LHCH 1MTNC 3U8RH 2A4QA 1EUFA 4NIYA 2WYGA 1BRUP 1Y3YA 1ELDE 4GHQA 1A7SA 3GY5A 1VGCB 1JBUH 4WJG2 2ZZUH 2ZG0H 2ODQA 2VH0A 2DE9A 1MCTA 1KXAA 4Y7AA 5HMAA 1HAGE 2O8TA 3A85A 3HPTB 1ELAA 1HXFH 3MI4A 4NWKA 5EGMA 5B6OA 4CBOA 2EC9H 1QB1A 1K1IA 4NA7A 3EQ0H 5T6DA 2WPKS 3QDZB 1RIWC 2BVSH 5FBEA 1GJ9B 1F5RA 4XBCA 4BXSA 2PKSC 1AWHB 2G81E 4X1RU 1SR5C 1HRTH 1NFUA 2FXRA 1P2OA 4X6NA 1FDPA 3C27B 2ODPA 2C8WB 5CHAC 2WUCA 1HAZB 1OP2A 1TPPA 3BG8A 1MAXA 5IYTA 1GHVH 2FEQH 2GCTC 2D1JA 3A7WA 4KKDA 1SGFA 4WF8A 1O2OA 1WQSA 1Y3UA 4U2WA 1K1MA 1SOTA 2O8UA 1XUJA 1MTWA 4FUCA 1EJMA 5AFYH 1A5IA 3TGKE 3URDA 6CHAB 3MNCA 1V2RT 3RXKA 2JETB 1GVZA 1QJ1B 4X1PU 3W95A 3O8RA 1HAOH 2RCEA 1ESTA 4AYYB 1P0SH 4JZ1A 3LIWA 3TJNA 4F4OC 2Y7ZA 4DGJA 1QNJA 3HK3B 2SFAA 3DA9B 2XTTB 3RXHA 1OP8A 1HIAA 1SMFE 3KQEA 1FN8A 2FOEA 1TX7A 1V2OT 2XWBI 3VB4A 1NY22 2C8YB 1H8DH 1ZSJA 1V2PT 3RMNH 3TH4H 3NUMA 1HJAB 3AW0A 1XUFA 1EB1H 2VVVA 1G37A 2D8WA 2F9BH 4X2VA 1UTPA 2HNTF 1QJ6B 3MWIU 2OC7A 4TY6A 3SV6A 1A46H 1O3AA 3TH3H 2BXTH 1GJDB 3GDVA 2ZWLH 1Y3VA 2Z9KA 5GPIB 1UTJA 2OBQA 5HYOA 4TY7A 3SJ9A 5DPAA 3MH5A 3BEFB 2BD2A 5E2OA 4WWYA 2H9HA 4R0IA 1IQFA 3I29A 1VR1H 7GCHG 3MNBA 4ZHAA 5L6NH 3LGVA 3UQOA 2QAAA 1O31A 1M9UA 1ANBA 2O8LA 1VJ9U 3LKWA 2GP9B 3A86A 4YLQH 3RXQA 4ZKSU 3FP6E 1ORFA 1FY3A 2J94A 2RG3A 2AGIX 1K1JA 4CRDA 1GJ7B 2ZGHA 1WUNH 4WMDA 2H5DA 5EPNA 4BAMB 4Q7ZA 1KYNA 4Q2KA 5C1XA 4IBLH 1TPOA 8GCHF 4X6OA 1PPZA 2Y5FA 1G2MA 1A3BH 3RDZA 1C5QA 1S83A 2ZGCA 4UDWH 2UWOA 4NFFA 1DLKB 3QX5H 3ZZCA 1TA2A 2PTCE 2BDHA 1F92A 4Y79A 5LPFA 3ZZ4A 2GDDA 2FDAA 1NU9A 2AYWA 3BSQA 3MH4A 3RXUA 1ZJDA 5K0HA 5DP9A 2ZGBH 1K9OE 2ZCLP
chains in the Genus database with same CATH superfamily
1GBBA 1IHTH 1C5SA 1ABIH 1LPZB 1C5PA 3BIUH 2A5AA 2NU4E 4I8HA 1F0TA 2ZF0H 2RDEA 2HLCA 2OC1A 1YPGH 1V2MT 5DP6A 1N8OC 2ZHWH 2ZFFH 3ENSB 3RXJA 3KQCA 3RMLH 3A83A 1WU1A 1L0ZA 4K2YA 3GCTG 2TRMA 3OFND 2C3SA 4JYTA 2VIOA 2BHGA 4UFDH 2ZGJA 3BF6H 5DKMA 1BT7A 1AE5A 1LO6A 3T27A 4AZ2B 1V2UT 1FY1A 3F6UH 2OCVB 4ZHLU 5JBCS 1YC0A 2XCNA 1C1SA 1GCTC 1P04A 3TIUA 2HRVA 2GVFA 1ZSKA 1T4UH 1TRYA 2F43B 5GJ4B 2FI5E 3VFEA 4AG1A 8ESTE 1O36A 1NZQH 1S0QA 1ZZZA 2XXLA 3LGUA 4E05H 1C2FA 1RFNA 3QGJA 4KELA 3A89A 1C5YB 3B8JA 2IJOB 2HWLB 3NCLA 1H9HE 3PV5A 2WV5A 3A84A 3V3MA 1HIAB 4DG4A 1JRTA 1TBZH 2FTLE 3RXFA 4X8TH 1NS3A 1XXDA 3ODDA 1KLIH 4OS7A 5DG6A 3MU4A 4D8NA 1O2KA 2Y80A 3K2UA 1MCVA 2WPLS 2AFQB 1H4WA 2G00A 2BY9X 1N6YA 3WWBA 4Y0YE 4Y8YA 1CU1A 1PPHE 2FOBA 1SGYE 2GTBA 3O8CA 4CRAA 2KFWA 3PM3A 1ZTKA 2WZQA 4INHA 3QWCH 2QF3A 1NRRH 1O37A 3CP7A 1J16A 3UY9A 4IN2A 3DD2H 1TX6A 3E8LA 1JWTA 2QXJA 4IN1A 2P94A 2Z9IA 5DP4A 1AFQB 1N1LA 2A7HA 5KECA 2OXSA 2SNWA 2ZQ2A 1EQ9A 2Q6FA 3LONA 5JPMH 1HFDA 3I77A 1PPCE 4MNWA 1FY8E 1DLEA 1TAWA 3F9FA 5E8EH 2BM2A 5L2ZH 2CF9H 2QCYA 4WXVA 4NG9H 2JJ1D 1GBTA 2AERH 4IMQA 4K60A 1O5AB 2IJD1 1XVOA 1C5TA 1ZPBA 1FAXA 2B8OH 2ULLA 2SGFE 1SFIA 1CSOE 1KXEA 1O2SA 5EOKA 3MNSA 1MKWH 2QV1A 2PGQB 1HUTH 2VIWA 2OC0A 2XNDD 2BOKA 4BANB 2EQNA 1ZJKA 5F6MA 2ZGXH 1Q2WA 3SV9A 1FMGA 1Z1IA 3PO1C 1FONA 2W6ID 1Z6JH 3BEIB 4B1TA 2BY6X 1Z8GA 1UK2A 4ISHH 1FPHH 1OWEA 3U1IB 4D9QA 2ZCKP 4AFZA 1GBMA 5E0JA 1GL0E 3PYHA 2ANWA 2PTNA 5A8XA 1C5LH 1A1RA 2JJ2D 3SW2B 1L4DA 5SGAE 5IDKA 3T2NA 1ZLRA 2P8OB 1UJ1A 4YOGA 5FPYA 1EAUA 3LH3A 1AVWA 4JZEH 1V2WT 2GV6A 1LTOA 3RXPA 3OY6U 2CK3D 3TNSA 5GNDA 2EA3A 1DITH 2XYAA 2VBCA 4I8LA 1YPLH 2FM2A 4LXBH 1O5FH 2OINA 3RXEA 1AGJA 1H8ED 1KDQA 4THNH 2A1DB 4MTBA 2Z9LA 3ZZDA 2ZPSA 1RD3B 3TNTA 1K2I1 5GIBA 1J8AA 3DUXH 2CHAB 1SLXB 7KMEH 2GCHG 3IG6B 2A2XH 1LDTT 1L1NA 1OX1A 2FESH 1BTWA 2V35A 1YCPK 1O32A 2P16A 3EAJA 1KSNA 4YXWD 2HOBA 2ZHDA 4OS5A 1FAKH 1ELFA 1ZMNA 3T25A 3HGPA 1TYNA 4LZ1H 3M3TA 4MG3A 4MPVA 2FP7B 1BBRH 1GI3A 5GCHG 1GHAF 1P3CA 2FPZA 2XBYA 2K0QA 5AF9H 2J97A 2TGAA 1K0HA 2VWOA 1BUIA 1BMNH 1SQOA 2LNCA 2R0KA 4JK6A 2VIVA 1GI7B 4UEHH 1XM1A 1Z8JB 3RXSA 1A2CH 2GJGA 2BLOA 2ZPQA 2Z9GA 3WY8A 1MD8A 3ZZBA 4ISLA 3ATWA 3SNBA 1V2JT 1P05A 3PTNA 1UVOA 2A45B 1TPAE 2PR3A 1C2HA 1P01A 1UCYK 1DX5M 1KXBA 1OHHD 1SBWA 4MNYA 2FI3E 2A31A 3ZYDA 4DIHH 4AGJA 3SNDA 1T31A 4AG2A 3STJA 5HIYA 2AGEX 3OU0A 4X2WA 3MU1A 4XBBA 4O3UA 2BLWA 4Q4LA 3M3SA 1H8IH 2BQ6B 4A6LA 1P11E 3K9XB 3KQDA 2V7QD 4U01A 5JYIA 2HPQH 3G01A 3GCOA 4ZXXH 2ZFTA 1W0ZU 4NSVA 4K1SA 4X1SU 4R8TB 2P93A 3PV2A 4UFFH 1KLJH 4ZHMU 1RRKA 3RUOA 1O3BA 3P8GA 4JK5A 2KX4A 3SUFA 5HXFA 3SORA 1C9TA 1P8VC 1YPKH 1CT4E 1EASA 1TWXB 3SUDA 2PFEA 3U28C 4GPGA 5FPSA 2IPQX 3KIDU 4NSYA 5E0HA 4RSPA 3W94A 3M61U 2PV9B 3QTOH 1QQUA 4IMZA 4DW2U 1W13U 2QY0B 5AVDA 3Q3YA 3FP7E 2GMTB 1C5OH 1F2SE 3GCHC 3VB6A 5DP3A 3ELAH 1AO5A 1QCPA 3MNXA 1OS8A 3QK1A 4Y8ZA 1AB9C 1AKSA 2GD4B 3MO6A 1T8OA 1CO7E 1ZGVA 2P3FH 1DSUA 1AHTH 1BTUA 1W10U 3TPIZ 2J9NA 3F68H 1CHGA 1ELEE 1FX0B 1O2UA 4ZKRU 4UONA 4CH8B 5A0BA 1XUKA 4O3TA 3LJOA 1S0RA 4FUDA 1QTFA 1E37B 1LKBA 1PPFE 1G32B 4DVAU 1YP9A 4JYUH 1GI9B 1DOJA 3BN9A 1KDQB 5AFZH 4BTUB 5CE1A 2WV4A 1THPB 3RXLA 1C2DA 3T62A 1FIWA 1WDIA 1NRQH 3LGYA 2KZ4A 3UIRA 2ZDLA 1MTUA 5ESBA 1MAYA 3E0NB 1IQGA 3E0PB 1LVYA 2G4UA 2SGQE 3B9FH 2TPIZ 3D49H 4GHTA 2XCFA 1DXPA 3F9HA 1BTYA 4RI0A 1GDNA 1C5WB 2GCHF 5DSFA 3DSOA 1TIOA 1XX9A 2FX4A 3RM2H 1GBCA 3DSPA 1MD7A 1BJUA 1Q31A 1ZR0A 2P59A 2R0LA 3Q77A 1NRPH 1OWKA 1UVPA 4ZAEA 1OWHA 4NIVA 3UNSA 1EOJA 1GI1A 2JDID 3T5FH 5I46H 1ZGIA 3ZZAA 1QBOA 1BZXE 4Q80A 4I7YH 1V2QT 1HAXB 1CVWH 4IGDA 5DJ7A 3ZZ5A 2GZ7A 1BITA 1YLDA 1ELGA 3AAVA 4MNVA 4ZCNA 4LZ4B 3LJJA 2OD3B 2V3HH 2SGPE 6GCHF 4X6MA 2FX6A 1FPCH 1SGEE 8GCHG 2BD3A 4QT8C 1SQAA 1W2KH 1TNJA 2UUJB 3SV7A 2BZAA 1AD8H 2ZCHP 3TITA 1BJVA 1HCGA 2IOTA 5C17A 1T7CA 1TQ7B 2ALPA 1O3OA 5HIZA 6CHAC 4K5ZA 4OS1A 3F0PA 1EPTA 2KCYA 1GHBF 3VPKA 2XBWA 1E0FD 5EJ1A 2QF4A 2G4TA 3LPRA 3FZZA 3AASA 1AIXH 4B76A 2OLGA 3BTGE 4HFPB 3BG4B 1W7GH 2VJ1A 1MTSA 4XOJA 4FUHA 4UFEH 3VXEH 4MNXA 4AC9A 1C4V2 1SOZA 5L30H 2L6OA 5EQRA 3D23A 4B75A 3RU4T 1HJAC 3OTJE 5DP7A 1D3PB 1ESBA 2EI7A 4FOUC 1TOMH 4K69A 5T6FA 1DXWA 5LGOA 1EB2A 1PFXC 3IITA 4HG6A 3UNQA 2WYJA 2ZTXA 5HM9A 2I6QA 2F9UA 1FJSA 3E3TA 4D9RA 3MU8A 4BNRA 2XC4A 4GAWA 1TFXA 1GG6C 1TRNA 2D26C 2O8WA 1QIXB 1O3FA 1AKSB 1L4ZA 2SGEE 2EY4C 1P09A 4A1XA 2HALA 5A8ZA 4DT7B 4BAQB 1C1OA 2W7UA 1DSTA 3L3TA 3UOUA 1GCDA 2ZU5A 4Z0KA 4B6EA 2J34A 1ZHMA 5EW2H 3IWMA 2XC0A 2V6NA 1AUJA 1C5NH 5HKKD 1V2ST 3A7ZA 1SPJA 1S6HA 5DK1A 1NT1A 4SGAE 3ZYEA 5EQSA 4KTCA 2GZ8A 3P92A 1QRWA 1T32A 3HK6B 1HV7A 1EJAA 1MU8B 2ZO3H 1YF4A 3B23B 1NRNH 3EE7A 1LKAA 1ZRBA 3BTME 3ZIAD 5C3NA 2QXGA 1O39A 3E6PH 2W26A 1P03A 2XWAA 5FBIA 1O35A 3FAOA 3AVZA 4BAKB 4BTIB 1YPHC 1GHXH 3SU1A 1Y8TA 5PTPA 1MQ6A 1PPBH 3UWIA 2D2DA 3PMAB 1C2KA 1UK4A 1GDUA 1WXRA 1AUTC 1SB1H 2BLVA 1QL7A 4TPIZ 1DWBH 1BMFD 4B74A 2THFB 4E06H 1THSH 1CA8B 5B6LA 1T4VH 4O9VA 1BDAA 2VIPA 2AIQA 3RXVA 1DS2E 3RXAA 1A0HB 1QFKH 1Y3WA 4DIIH 1WV7H 2WHXA 2PW8H 4HI3A 1ID5H 2QXIA 4KTUA 1P2IA 2OTVA 2V3MA 3UR9A 1DPOA 4K8YA 1EJNA 1G30B 1Z8IB 1HNEE 3K6ZA 2FOFA 3VB5A 3SOSA 3P8OA 2BMGB 1C2MA 1YCPM 1B0EA 1A5HA 1W12U 1GJ8B 1P06A 1P57B 4OS2A 2A4OA 9LPRA 1AWFH 1P2JA 2Q6DA 1NFXA 1SI5H 1LHDH 1EPTB 4FUGA 4Q7XA 2ZQ1A 2ZFSA 1P2QA 2F9NA 4FU7A 1YLNA 2QF5A 2XNIA 2Y5GA 2A7CA 3S9CA 1A4WH 1EOLA 1AVGH 2DUCA 3LU9B 1GJBB 1CBWC 4H4FA 3CNRA 3SU5A 1IQKA 1GI6A 3UFAA 1KXDA 2QA9E 3A7YA 1GI8B 2IN2A 3RXDA 3GY7A 1JIMA 3MTYA 1SHHB 2FIRH 2PHBA 2UUFB 1TX8A 1O2LA 2PWXA 1F0RA 1U6QA 4JZFH 2F91A 3F3BA 4RN6A 3OAAD 4CRFA 1NTPA 1UTLM 1V2VT 3SO3A 1FZZA 1UVTH 1G36A 1O5BB 1AZZA 3U8TH 3E16B 4P02A 1GBKA 1AN1E 1XUGA 3HKIB 4AFSA 2KCOA 1TBQH 1BMLA 5JDUB 1SLWB 1EATA 2FOHA 3RXIA 2FYRA 1BRAA 3DFJA 1MU6B 4FUBA 1AMHA 2BX4A 1GI4A 1RXPA 2VWMA 2VINA 1C2EA 4YOIA 1HAIH 3OSYA 5T1VA 1GHAG 1TNKA 3EA7A 1T8LA 1Z6EA 2AMDA 1SQTA 2PGBB 4GCHG 1HJ9A 3SJOA 1W11U 3BV9B 2Y5HA 1E36B 3RU4E 2YNBA 3SN8A 4KGAA 1UCYE 1UTQA 2ZDAH 3V7TA 2H9TH 3QN7A 1CHOF 2KAIA 5FAHA 1C4Y2 1MZDA 1DE7H 1QL8A 1TNLA 4YLUA 2ALVA 1DWCH 1FQ3A 3D65E 1BTPA 1SFQB 1LPGB 2BX3A 3QUMP 3FOAA 3SU6A 1BRCE 3CS7A 1O3MA 3UREA 2NU2E 5ETXA 1GJAB 1UMAH 4YO9A 2FOMB 2ANKH 3KNXA 1DY9A 2J5UA 5H4IB 3Q3KA 4ASUD 1UW7A 3BTTE 1O0DH 1LVMA 2FO9A 2ODYB 1XKBC 3SNAA 2F9OA 1QJ7B 1J17T 2A7JA 2EEKA 1GDQA 2ZNKH 3ZZ3A 1T8NA 2VIQA 2H5CA 3RC5A 4CHAC 1S84A 1VITF 2BQ7B 4AN7A 4XE4A 2P8OC 1QZ8A 4INKA 1P9UA 1HPGA 2R3UA 4ZH8A 4BTTB 3S9AA 2Z9JA 1UHBA 1VZQH 2Y82A 3RC4A 1FY4A 1O3KA 1V6DA 1KXCA 1QR3E 3VGCC 1YBWA 2GDEH 3GY3A 3FVFB 5C0UA 3PB1E 4FU8A 1QRXA 3DFLA 1GMHF 1CT0E 2FLBH 7LPRA 4CR5A 4J1YA 2IPHA 1GVKB 2CHAC 1W0JD 2ZI2H 4B2CA 1PPGE 2BD5A 1YPJH 2BDAA 3M5NA 5C94A 4GSOA 1A0LA 3H5CB 4H6SB 1ELBA 1C1PA 1XKAC 4YZUA 2ZU3A 3RXTA 2RDLA 2VGCC 2BB4A 3GYLB 4Q7YA 1L1GA 3KEEA 2AS9A 4FUEA 1GL1A 3ATMA 3P6ZB 2Y6TA 1BHXB 1HXEH 2KM0A 2BOHB 3UAIC 1O2MA 1OPHB 3AW1A 3MH6A 1GMDF 2J98A 3NWUA 4FUJA 8KME2 2F9VA 1EAIA 2TGPZ 3K65B 1O2QA 1JOUB 1O3JA 4K3JA 5GDSH 1G3DA 4AOQA 2BD4A 2HGTH 1O2PA 1HB0B 1FIZA 2Z3DA 3H7OA 1AI8H 1ZTLA 3E1XB 4NIXA 2VVUA 3K6YA 4B6FA 3TGIE 4YTAA 1IAUA 1O38A 3V0XA 1A61H 4WH8A 4MPWA 4ABFA 2ZDKA 1D6WA 1V2NT 3LC5A 4INLA 1UVSH 5FX5A 5EU8A 3SJIA 1K21H 3ATKA 4F48B 2FYQA 3OEED 3TK9A 3LGTA 2WPDD 4F49A 1VITH 1TNIA 2PLXA 3DSGA 1UTMA 4I32A 1C1NA 5LPRA 3E91A 4NGAH 1IQNA 1GBLA 1SGTA 2ZTYA 2YMSB 1TE0A 2AIPA 5EQQA 1O3NA 5J4QA 5GWZA 3UNRA 3AAUA 1YPEH 1EAWA 1K1PA 5EXNA 1P3EA 2JH6D 3MMGA 3RLYH 5EXLA 3L6PA 1UTOA 3R3GB 4MQAA 4VGCB 2KAIB 3A8CA 5DP8A 3LGWA 4GCHF 3SNEA 3SU3A 6GCHG 3NK8A 4AX9H 1C9PA 3M7UA 4AB9A 1BA8B 3E90B 1D3TB 1MBMA 2ZECA 3PO1B 1WCZA 1PPEE 2UUYA 2ZHEH 3O8DA 4JZIA 2HNTE 4WH6A 3ZZ8A 1CE5A 1INCA 3RLWH 2M2AA 1KTTB 1TMTH 3N7DA 5FPTA 2QC2A 1G9IE 2UWPA 3PMJA 3SGBE 2EI8A 1ZYOA 2GMTC 2TBSA 3JZ1B 3H09A 1ACBE 3RXCA 1T8MA 2P3UB 1C5XB 2VB0A 1TGCA 1ARBA 1HLTH 1GHBG 1YY3A 2HPPH 1QBVH 4RKOB 2ZU4A 1FUJA 1OYQA 2XBVA 3TH2H 5EJZA 4H6TA 1UHBB 1GGDC 1IQHA 4MPXA 4LK4A 1O34A 4AORA 5BPEA 1O2TA 2STAE 1AE8H 3M35A 4UD9H 1F5LA 4IC5A 1ANEA 4J2YB 1IOEA 2FOGA 3A87A 2SGDE 1RTKA 3M5MA 1KIGH 2Y81A 1GBIA 3ZVEA 2BYAX 3ZVDA 1GI0A 2PKAA 1S81A 1Z1JA 3SGQE 3P17H 3KL6A 2Q1JA 1E1RD 1GHZA 4Q63A 4Y0ZE 4KP0A 1QGFA 1XUHA 1O2NA 2ZFRH 1EZSC 5F03A 3SHAH 3SJKA 3A8BA 2F83A 1MTVA 2EI6A 1EZUC 1C2GA 1QB9A 1FY5A 1KTSB 1O2RA 5DGJA 2DE8A 2ZC9H 3U9AH 2FZZA 1IQIA 1GBAA 4E7NA 1PQ5A 3URCA 2UUKB 3F9GA 4A5TS 1QHRB 3T29A 3M3VA 2JIZD 2H2ZA 1OWDA 1JMOH 5I25A 3Q00A 4AB8A 1LQEA 2F9PA 1TGNA 4K8BA 2J98B 3A7XA 2R2WU 3RXOA 1O5CB 2J2UA 2KR7A 1V2LT 2SNVA 3PTBA 3F9EA 1MUEB 4UE7H 3FANA 4PROA 4A1TA 3TJOA 4JMYA 1PQ7A 3P70B 1YM0A 4OM9A 3V12A 4NIWA 1AZ8A 3SI3H 2QE7D 1PYTC 1PYTD 2AEIH 4Y7BA 1B5GH 2ESTE 1SGNE 4X2XA 2ZKSA 3HKJB 4ZKOU 1BTZA 3A7VA 4UFGH 1W0YH 3ITIA 3SU0A 4WMEA 1QBNA 2A2QH 5C1YA 4Y8XA 4DY7B 5TCCA 3WWFA 1CGHA 6LPRA 4D7GA 3TU7H 1FLEE 1AQ7A 1O3DA 1V3XA 1EP6A 1VGCC 1P2KA 1TONA 2H9EH 1E35B 4CBNA 5FXLA 3SQHE 2QIQA 3WW7A 4F55A 4X0WU 1XUIA 2XBXA 1K1LA 2R9PA 1VCWA 1UTNA 2GGVB 2ILNA 4D76A 1SGRE 1DT2A 4TSFD 5C5NA 1G3BA 3BTKE 2CV3A 1W14U 4TYDA 5LPEA 1RS0A 4RKJB 1XXFA 1ETRH 3EDXB 4A1VA 1C4U2 1EAXA 1QY6A 5JB9S 3SU2A 3GY2A 4M9FA 2BD8A 4ESTE 4Y6DA 2ZHFH 1C2JA 2H1UA 2WV9A 2ZDNA 3M7QA 1TMBH 2G52A 2C8XB 2BZ6H 3KYGA 1DWDH 3GISB 1A0JA 3P8FA 1WTHD 2BVXH 2B9LA 1DY8A 3S7HB 1D9IA 3Q3XA 4BOHA 1RJXB 1LPKB 3ZZ9A 4FETA 5EG4A 4ABJA 1YCPH 3SZNA 2Q6GA 2BTCE 2FMJA 1H1BA 1QA0A 2VU8E 4ABEA 1CA0B 1ZTJA 1ESAA 1HAVB 5C67A 2JETC 1ELVA 2I6SA 4YT6H 1NM6A 2Z7FE 3FP8E 2AMPA 2WSSD 1EKBB 5EXMA 1TALA 2V3OH 2J4IA 1QB6A 3VXFH 1TMUH 3OY5U 1ANCA 4FUFA 1W8BH 2PKAB 1OOKB 1SC8U 3U1JB 4CRCA 4B71A 1ZPZA 3JZ2B 1MKXH 4Y11E 5C5OA 1GBJA 2O9QA 3M5OA 2HNTC 1UCYH 2TGTA 6ESTA 3QLPH 3MO3A 1F5KU 1UO6A 3GY6A 1LHFH 1FV9A 2P3TB 3MU5A 5A8YA 5A0CA 1YLCA 1X7AC 7ESTE 3BTDE 1J9CH 2FWWA 1QL9A 5EW1H 1HGTH 5EJLA 1C5UA 2ZTZA 3RMMH 1YYY1 1O33A 1SGFG 1CHOG 4Y10E 4CH2B 2QYIA 1Y5AT 4ABGA 4MPUA 3Q76A 2SGAA 1QA7A 1W7XH 3A8DA 1LHGH 1K1NA 2NWNA 1C2LA 1XMNB 2XC5A 1NFWA 1H9LB 1MTNB 3CS0A 4OS6A 5HM2A 1OSSA 4ABDA 4ZUHA 3U98H 1Z8RA 3ZVFA 1BTXA 1GMCG 2RA0A 3A80A 2BD7A 2P95A 1LVOA 4FVBA 4JCNA 1ANDA 3W1EA 1GJ6A 1WTGH 2FS9A 1CQQA 3VEQB 2ZPRA 3GICB 1C1RA 2BXUH 3PWBA 1MQ5A 1IQEA 4H42U 1VITG 4IS5A 3ATLA 1C1UH 1EPTC 3S7KB 4IC6A 2ZDVH 1O2ZA 3MO9A 1S5SA 3MH7A 2KCPA 5HGGA 1RIWB 2HLDD 2FOCA 4AYVB 1E38B 1S6FA 1BTHH 1YGCH 5T3HA 1GBHA 4DJZB 1MKWK 3PMBB 3OE7D 5C2ZA 3EA8A 2PKSB 2ANYA 3OYPA 4TPYA 3PROA 3ZVAA 1BQYA 1ZSLA 2PUQH 2CGAA 4WMFA 1KLTA 1GMHG 3KGPA 3HATH 4HTCH 2FLRH 2A0QB 1SHYA 1XVMA 4GVUA 1F7ZA 3KYFA 1PQ8A 1HBTH 2G5NA 5CHAB 3S9BA 4AGKA 2OQUA 1TRMA 3LOXA 4TWYA 4E7RG 2R3YA 5C1UA 4ISNA 1GG6B 2GCTB 2QGRA 4K1EA 3GS9A 2OUAA 1GBFA 1WBGB 1YWUA 4MLFB 1GI2A 1SGCA 1B0FA 3GY4A 2G55A 2H6MA 1O5GH 3SUGA 1SG8B 3ZV8A 1W0KD 2C8ZB 3TK5A 4ASHA 3ODFA 3LGIA 1O3PB 5BRRE 1MMJN 5CDFE 4ZROA 1GMDG 3A8AA 2XOKD 5A0AE 3EE0B 4WY3A 4CRBA 2VNTA 4DCDA 4RT0A 3BIVH 1TLDA 1HAHH 3MQKC 2NU1E 3UUZA 2A4RA 1MZAA 3GYMA 1Z7KA 3TK6A 5AHGH 2G51A 1BB0B 3SV8A 2Z6BD 3EYDA 1LQDB 1O2XA 4XBDA 3DHKH 1JRSA 1IQMA 1P12E 3OEHD 3OTPA 1O3GA 4KTSA 4YESB 1K22H 4CRGA 1GJ4H 1S85A 2PSXA 4LOYH 3M7TA 1BBRK 1K28D 4BXWA 1YPMH 1N6XA 1DM4B 2OBOA 3V13A 1D3QB 2BY7X 1OWJA 1ARCA 1SLVB 1PJPA 2G5VA 1GHYH 4X6PA 4Z6AH 2O8MA 2Y7XA 3RXRA 1OXGA 2AHME 3TJVA 1AFQC 2ZHQH 2GT8A 1KY9A 4A7IB 4WXIA 2FOAA 4SGBE 1EXFA 1EP5A 1DWEH 1D6RA 3BEUA 2VH6A 1LHEH 1TBRH 1VCPA 2A5IA 1WSSH 4AFQA 3ZV9A 1BRBE 2BDGA 5TJXA 2ZP0H 3OX7U 1NROH 2YNAA 2AGGX 3A88A 1ZPCA 3MYWA 1JIRA 1YKTA 2OP9A 4NCYA 1Y59T 3NPSA 1DVAH 1C1WH 1G3CA 2BDYA 3UTUH 4X8UH 4D7FA 2OQ5A 2YOLA 2M5TA 2ANMH 2BDCA 2F3CE 2FTMA 1LCYA 1O3CA 1GHWH 4B2BA 1H8HD 4DOQA 1O2HA 1SGIB 1TA6A 1O30A 3MU0A 5ABWA 1J15A 1O5EH 1GWAA 3PMHB 3MFJA 1CBWB 1GMCF 1SGDE 3SJ8A 3FO8D 1O2YA 8LPRA 3QGNB 2TGDA 3PRDA 3F2HA 1CGIE 1NC6A 1G3EA 2G8TA 3CENA 3ZZ7A 1AY6H 1TABE 3TLOA 3HGNA 3FN8A 1Y5UT 1RTFB 3BTQE 1TGTA 1N8OB 4FVDA 1HYLA 2STBE 4BAHB 1D4PB 2Z94A 3BTHE 4HGCA 1P10A 1BMAA 1C5RA 1DUAA 3R0FA 1P02A 2PP6A 1NBME 3SU4A 3UQVA 4A92A 3F2FA 3TVJB 1S82A 4MDSA 1O2VA 4NFEA 2W5EA 3PV4A 1GCTB 1Z71A 1FI8A 1DFPA 2VWLA 1C5ZB 4I33A 1IHSH 4ZXYH 3VB3A 2LELA 2NU3E 2L74A 2PSYA 4ABBA 2BD9A 2PUXB 5FCKA 1ZRKA 1NESE 5EPYA 1NO9H 2BY8X 2FS8A 1FN6A 3P95A 3SGAE 2WPJS 3VB7A 7GCHF 3S0NA 2YMSD 2YMSC 1BIOA 4DT4A 2J38A 3P8NA 2TIOA 2CN0H 4X8SH 3LH1A 2LP6A 3GY8A 4ZMAH 3PLKA 5IK2D 2NU0E 4DURA 2FI4E 1O3IA 2GV7A 3LC3A 1OWIA 2BVRH 3O8BA 4VGCC 4P00A 3SV2H 2HVXA 4ISIH 4X8VH 1UTKA 1MABB 1Y3XA 3ESTA 3LT3A 3SHCH 2BY5X 3QZQA 2ASUB 1O2IA 3SQEE 1F0UA 1TNHA 3KF2A 1CGJE 3N99A 1SGPE 5DP5A 3FZDA 1ETSH 3NKKA 2WPMS 1DICA 1BCUH 2ZFQH 4JYVH 4ACBA 2A5KA 3RC6A 1BHXF 1GJCB 4M7GA 2GT7A 1ZHRA 1O3LA 3NZIA 1C2IA 4O03A 3MOCA 4OS4A 2KCAA 1SSXA 3T26A 4CHAB 1D3DB 3RXMA 2JH5D 3KHVA 4MVNA 4ABHA 4ISOA 2XRCA 3KQBA 1O2JA 4NWLA 1C1MA 4BAOB 3NRLA 1C5MD 3RM0H 3ZVCA 1UVUH 2ZEBA 3VGCB 1C1QA 1WOFA 1C1VH 3BTEE 5JBBS 4XRNA 5FX6A 2C93B 9ESTA 3L33A 1AFEH 3BTWE 5T6GA 1THRH 3SUEA 2JKHA 1SQRA 3F0OA 5A09A 5E0GA 2BDIA 4X2YA 5C0TA 1K1OA 3MHWU 3F1SB 3GCTF 1SGQE 1TNGA 3DCLA 1O2GH 4U30A 2CJIA 1VCQA 3EA9A 2C90B 2VGCB 4TT3D 2GX4A 3A82A 3ZZ6A 1J14A 1GPZA 4XSKU 2BQWB 1P9SA 4AFUA 1HAPH 4GLYA 2W3KA 2A4GA 5CMXH 2BLQA 4RT1A 3QZRA 1TGSZ 1RGQA 2VWNA 1TPSA 2B5TB 1FXYA 1QURH 4I8JA 1Y5BT 2J95A 5CHBA 2CXVA 3F2GA 1NU7B 1CT2E 1ELTA 1GBEA 1O2WA 3QO6A 3UWJH 3M5LA 1IQLA 1KXFA 1SVPA 1W3CA 5JBAS 1P2NA 2ZDMA 1O3HA 2WPHS 2W6JD 1C1TA 1JXPA 1PQAA 2QN5T 1MKXK 4ABIA 4U32A 3PLPA 1TB6H 1P2MA 3PRBA 2AMQA 3PWCA 2UWLA 3I78A 1HAVA 5C20A 2ZU2A 3GOVB 1EZQA 2HVYB 3RU4D 5F8ZA 3N7EA 5DO4H 2K1QA 2AH4X 1SL3A 3S69A 2JH0D 1ZMJA 1QQ4A 4B73A 4FUIA 2J92A 1WAYB 3SBKA 3RXGA 1V2TT 3DT0H 3C1KA 4I31A 3ATIA 4I8GA 3VG8A 3GDSA 5LH8A 4Y76A 4NA8A 4OGXA 4JZDH 1SLUB 3KN2A 4ZKNU 5J4SA 1MBQA 3FKSD 1F0SA 1WQVH 3UOPA 1ABJH 3UR6A 1BMMH 1TOCB 3M37A 1NPMA 2FODA 4B2AA 5ESTE 3A81A 2RA3A 4YOJA 2V0BA 5F8XA 1QRZA 2W3IA 4X1NU 1YPHE 1OP0A 3GDUA 2VIDA 3RMOH 1LVBA 1H9IE 1OKXA 2OC8A 5EIYA 1O3EA 4ABAA 1ELCA 2ZIQH 5FCRA 5FHTA 3UPEA 1NBMD 1DANH 1OYTH 2GKVE 2CMYA 3SI4H 1EZXC 5F8TA 3ZVGA 2ZA5A 4YM9A 4X1QU 2XW9A 3GCNA 3STIA 2CF8H 1G2LA 5TCAA 1L1JA 1NN6A 1WYKA 2BDBA 2K8IA 2QF0A 4NZQA 1GGDB 1HDTH 2B7DH 4OGYA 4TWWA 1AVXA 5K7RA 1TQ0B 3SZEA 1ZHPA 2VVCA 1TGBA 1BOQA 4K1TA 3TGJE 1CA0C 1DUEA 4GUXA 5GXPA 1FNIA 3BTFE 1L2EA 3U8OH 1AU8A 1ZMLA 4XDEA 4ACAA 5JB8S 4FU9A 2ZU1A 5EODA 3D62A 1O5DH 2A32A 3LDXH 4NZLA 3U69H 1Q3XA 3BG4C 1B7XB 3A7TA 5KEDA 4IW4E 2GZ9A 1C5VA 2Z3CA 4YT7H 5L2YH 1GVLA 3SNCA 1HAYB 4CREA 3FFGA 2WINI 3RP2A 1MH0A 5JBTA 2WPIS 3GCHB 1A5GH 3ZVBA 1NRSH 3UB0A 1AB9B 4HZHA 2Z3EA 1ZOMA 3T28A 1IQJA 1GBDA 3QTVH 4CR9A 1A3EH 2ZFPH 4Y71A 4FXGH 4WVPE 1ETTH 3M36A 4O97A 2R2MB 3RXBA 4Z1MD 5E2PA 3SYJA 2LPRA 5GCHF 3KCGH 2B0FA 4I8KA 3N7OA 4NA9H 1RTLA 2QXHA 1NFYA 1V2KT 3PLBA 1DDJA 3EGKH 4XFQA 1UK3A 1LMWB 2WUBA 3H7TA 2C4FH 1HJ8A 3NXPA 3TJUA 5A2MH 2RFKC 1VJAU 1BBRE 2OK5A 2W7SA 1GJ5H 1E34B 1GI5A 5G4BA 1EX3A 1LHCH 1MTNC 3U8RH 5KGOA 2A4QA 1EUFA 4NIYA 2WYGA 1BRUP 1Y3YA 1ELDE 4GHQA 1A7SA 3GY5A 1VGCB 1JBUH 4WJG2 5F53A 2ZZUH 2ZG0H 2ODQA 1SKYE 2VH0A 2DE9A 1MCTA 5FL7D 1KXAA 4Y7AA 5HMAA 1HAGE 2O8TA 3A85A 3HPTB 1ELAA 1HXFH 3MI4A 4NWKA 5EGMA 5B6OA 4CBOA 2EC9H 1QB1A 1K1IA 4NA7A 3EQ0H 5T6DA 2WPKS 3QDZB 1RIWC 1VKYA 2BVSH 5FBEA 1GJ9B 1F5RA 4XBCA 4BXSA 2PKSC 1AWHB 2G81E 4X1RU 1SR5C 1HRTH 1NFUA 2FXRA 1P2OA 4X6NA 1FDPA 3C27B 2ODPA 2C8WB 5CHAC 2WUCA 1HAZB 3KQ5A 1OP2A 1TPPA 3BG8A 1MAXA 5IYTA 1GHVH 1KMHB 2FEQH 2GCTC 2D1JA 3A7WA 4KKDA 4XD7D 5DN6D 1SGFA 4WF8A 1O2OA 1WQSA 1Y3UA 4U2WA 1K1MA 1SOTA 2O8UA 1XUJA 1MTWA 4FUCA 1EJMA 5AFYH 1A5IA 3TGKE 3URDA 6CHAB 3MNCA 1V2RT 3RXKA 2JETB 1GVZA 1QJ1B 4X1PU 1S6LA 3W95A 3O8RA 1HAOH 2RCEA 1ESTA 4AYYB 1P0SH 4JZ1A 3LIWA 3TJNA 4F4OC 2Y7ZA 4DGJA 1QNJA 1E79D 3HK3B 2SFAA 3DA9B 2XTTB 3RXHA 3AK5A 1OP8A 1HIAA 1SMFE 3KQEA 1FN8A 2FOEA 1TX7A 1V2OT 1EFRD 2XWBI 3VB4A 1NY22 2C8YB 1H8DH 1ZSJA 1V2PT 3RMNH 3TH4H 3NUMA 1HJAB 3AW0A 1XUFA 1EB1H 2VVVA 1G37A 2D8WA 2F9BH 4X2VA 1UTPA 2HNTF 1QJ6B 3MWIU 2OC7A 4TY6A 3SV6A 1A46H 1O3AA 3TH3H 2BXTH 1GJDB 3GDVA 2ZWLH 1Y3VA 2Z9KA 5GPIB 1UTJA 2OBQA 5HYOA 4TY7A 3SJ9A 5DPAA 3MH5A 3BEFB 2BD2A 5E2OA 4WWYA 2H9HA 4R0IA 1IQFA 3I29A 1VR1H 7GCHG 3MNBA 4ZHAA 5L6NH 3LGVA 3UQOA 2QAAA 1O31A 1M9UA 1ANBA 2O8LA 1VJ9U 3LKWA 2GP9B 3A86A 4YLQH 3RXQA 4ZKSU 3FP6E 1ORFA 4I86A 1FY3A 2J94A 2RG3A 2AGIX 1K1JA 4CRDA 1COWD 1GJ7B 2ZGHA 1WUNH 4WMDA 2H5DA 2F4LA 5EPNA 4BAMB 4Q7ZA 1KYNA 4Q2KA 5C1XA 4IBLH 1E1QD 1TPOA 8GCHF 4X6OA 1PPZA 2Y5FA 1G2MA 1A3BH 3RDZA 1C5QA 1S83A 2ZGCA 4UDWH 2UWOA 4NFFA 1DLKB 3QX5H 3ZZCA 1TA2A 2PTCE 2BDHA 1F92A 4Y79A 5LPFA 3ZZ4A 2GDDA 2FDAA 1NU9A 2AYWA 3BSQA 3MH4A 3RXUA 1ZJDA 5K0HA 5DP9A 2ZGBH 1K9OE 2ZCLP
chains in the Genus database with same CATH topology
1GBBA 1IHTH 1C5SA 1ABIH 1LPZB 1C5PA 3BIUH 2A5AA 2NU4E 4I8HA 1F0TA 2ZF0H 2HLCA 2OC1A 1YPGH 1V2MT 5DP6A 1N8OC 2ZHWH 2ZFFH 3ENSB 3RXJA 3KQCA 3RMLH 3A83A 1WU1A 1L0ZA 4K2YA 3GCTG 2TRMA 4JYTA 2C3SA 2VIOA 2BHGA 4UFDH 2ZGJA 3BF6H 5DKMA 1BT7A 1AE5A 1LO6A 3T27A 4AZ2B 1V2UT 1FY1A 3F6UH 2OCVB 4ZHLU 5JBCS 1YC0A 2XCNA 1C1SA 1GCTC 1P04A 3TIUA 2HRVA 2GVFA 1ZSKA 1T4UH 1TRYA 5GJ4B 2FI5E 3VFEA 4AG1A 8ESTE 1O36A 1NZQH 1S0QA 1ZZZA 2XXLA 3LGUA 4E05H 1C2FA 1RFNA 3QGJA 4KELA 3A89A 1C5YB 3B8JA 2IJOB 2HWLB 3NCLA 1H9HE 2WV5A 3A84A 3V3MA 1HIAB 4DG4A 1JRTA 1TBZH 2FTLE 3RXFA 4X8TH 1NS3A 1XXDA 3ODDA 1KLIH 4OS7A 5DG6A 3MU4A 4D8NA 1O2KA 2Y80A 3K2UA 1MCVA 2WPLS 2AFQB 1H4WA 2G00A 2BY9X 1N6YA 4Y0YE 4Y8YA 1CU1A 1PPHE 2FOBA 1SGYE 2GTBA 3O8CA 4CRAA 3PM3A 1ZTKA 4INHA 3QWCH 2QF3A 1NRRH 1O37A 3CP7A 1J16A 3UY9A 4IN2A 3DD2H 1TX6A 3E8LA 1JWTA 2QXJA 4IN1A 2P94A 2Z9IA 5DP4A 1AFQB 1N1LA 2A7HA 2OXSA 2SNWA 2ZQ2A 1EQ9A 2Q6FA 3LONA 5JPMH 1HFDA 3I77A 1PPCE 4MNWA 1FY8E 1DLEA 1TAWA 3F9FA 5E8EH 2BM2A 5L2ZH 2CF9H 2QCYA 4WXVA 4NG9H 1GBTA 2AERH 4IMQA 4K60A 1O5AB 1XVOA 1C5TA 1ZPBA 1FAXA 2B8OH 2ULLA 2SGFE 1SFIA 1CSOE 1KXEA 1O2SA 5EOKA 3MNSA 1MKWH 2QV1A 2PGQB 1HUTH 2VIWA 2OC0A 2BOKA 4BANB 1ZJKA 5F6MA 2ZGXH 1Q2WA 3SV9A 1FMGA 1Z1IA 3PO1C 1FONA 1Z6JH 3BEIB 4B1TA 2BY6X 1Z8GA 1UK2A 4ISHH 1FPHH 1OWEA 3U1IB 4D9QA 2ZCKP 4AFZA 1GBMA 5E0JA 1GL0E 3PYHA 2ANWA 2PTNA 5A8XA 1C5LH 1A1RA 3SW2B 1L4DA 5SGAE 5IDKA 3T2NA 1ZLRA 2P8OB 1UJ1A 4YOGA 5FPYA 1EAUA 3LH3A 1AVWA 4JZEH 1V2WT 2GV6A 1LTOA 3RXPA 3OY6U 3TNSA 2EA3A 1DITH 2XYAA 4I8LA 1YPLH 2FM2A 4LXBH 1O5FH 2OINA 3RXEA 1AGJA 1KDQA 4THNH 2A1DB 4MTBA 2Z9LA 3ZZDA 2ZPSA 1RD3B 3TNTA 1K2I1 5GIBA 1J8AA 3DUXH 2CHAB 1SLXB 7KMEH 2GCHG 3IG6B 2A2XH 1LDTT 1L1NA 1OX1A 2FESH 1BTWA 2V35A 1YCPK 1O32A 2P16A 3EAJA 1KSNA 2HOBA 2ZHDA 4OS5A 1FAKH 1ELFA 1ZMNA 3T25A 3HGPA 1TYNA 4LZ1H 3M3TA 4MG3A 4MPVA 2FP7B 1BBRH 1GI3A 5GCHG 1GHAF 1P3CA 2FPZA 2XBYA 5AF9H 2TGAA 2VWOA 1BUIA 1BMNH 1SQOA 2LNCA 2R0KA 4JK6A 2VIVA 1GI7B 4UEHH 1XM1A 1Z8JB 3RXSA 1A2CH 2BLOA 2ZPQA 2Z9GA 3WY8A 1MD8A 3ZZBA 4ISLA 3ATWA 3SNBA 1V2JT 1P05A 3PTNA 1UVOA 2A45B 1TPAE 2PR3A 1C2HA 1P01A 1UCYK 1DX5M 1KXBA 1SBWA 4MNYA 2FI3E 2A31A 3ZYDA 4DIHH 4AGJA 3SNDA 1T31A 4AG2A 3STJA 2AGEX 3OU0A 4X2WA 3MU1A 4XBBA 4O3UA 2BLWA 3M3SA 1H8IH 2BQ6B 4A6LA 1P11E 3K9XB 3KQDA 4U01A 5JYIA 2HPQH 3G01A 3GCOA 4ZXXH 2ZFTA 1W0ZU 4NSVA 4K1SA 4X1SU 4R8TB 2P93A 4UFFH 1KLJH 4ZHMU 1RRKA 3RUOA 1O3BA 3P8GA 4JK5A 3SUFA 5HXFA 3SORA 1C9TA 1P8VC 1YPKH 1CT4E 1EASA 1TWXB 3SUDA 2PFEA 4GPGA 5FPSA 3KIDU 4NSYA 5E0HA 4RSPA 3W94A 3M61U 2PV9B 3QTOH 1QQUA 4IMZA 4DW2U 1W13U 2QY0B 5AVDA 3Q3YA 3FP7E 2GMTB 1C5OH 1F2SE 3GCHC 3VB6A 5DP3A 3ELAH 1AO5A 1QCPA 3MNXA 1OS8A 3QK1A 4Y8ZA 1AB9C 1AKSA 2GD4B 3MO6A 1T8OA 1CO7E 1ZGVA 2P3FH 1DSUA 1AHTH 1BTUA 1W10U 3TPIZ 2J9NA 3F68H 1CHGA 1ELEE 1O2UA 4ZKRU 4UONA 4CH8B 5A0BA 1XUKA 4O3TA 3LJOA 1S0RA 4FUDA 1QTFA 1E37B 1LKBA 1PPFE 1G32B 4DVAU 1YP9A 4JYUH 1GI9B 1DOJA 3BN9A 1KDQB 5AFZH 4BTUB 5CE1A 2WV4A 1THPB 3RXLA 1C2DA 3T62A 1FIWA 3LGYA 1NRQH 3UIRA 2ZDLA 1MTUA 5ESBA 1MAYA 3E0NB 1IQGA 3E0PB 1LVYA 2G4UA 2SGQE 3B9FH 2TPIZ 3D49H 4GHTA 2XCFA 1DXPA 3F9HA 1BTYA 1GDNA 1C5WB 2GCHF 1TIOA 1XX9A 2FX4A 3RM2H 1GBCA 1MD7A 1BJUA 1Q31A 1ZR0A 2P59A 2R0LA 3Q77A 1NRPH 1OWKA 1UVPA 4ZAEA 1OWHA 4NIVA 3UNSA 1EOJA 1GI1A 3T5FH 5I46H 1ZGIA 3ZZAA 1QBOA 1BZXE 4Q80A 4I7YH 1V2QT 1HAXB 1CVWH 4IGDA 5DJ7A 3ZZ5A 2GZ7A 1BITA 1YLDA 1ELGA 3AAVA 4MNVA 4LZ4B 3LJJA 2OD3B 2V3HH 2SGPE 6GCHF 4X6MA 2FX6A 1FPCH 1SGEE 8GCHG 2BD3A 4QT8C 1SQAA 1W2KH 1TNJA 2UUJB 3SV7A 2BZAA 1AD8H 2ZCHP 3TITA 1BJVA 1HCGA 2IOTA 1T7CA 1TQ7B 2ALPA 1O3OA 6CHAC 4K5ZA 4OS1A 1EPTA 1GHBF 3VPKA 2XBWA 1E0FD 2G4TA 3LPRA 3FZZA 3AASA 1AIXH 4B76A 2OLGA 3BTGE 4HFPB 3BG4B 1W7GH 2VJ1A 1MTSA 4XOJA 4FUHA 4UFEH 3VXEH 4MNXA 1C4V2 1SOZA 5L30H 5EQRA 3D23A 4B75A 3RU4T 1HJAC 3OTJE 5DP7A 1D3PB 1ESBA 2EI7A 1TOMH 4K69A 5T6FA 1DXWA 5LGOA 1EB2A 1PFXC 3IITA 3UNQA 2WYJA 2ZTXA 5HM9A 2I6QA 2F9UA 1FJSA 3E3TA 4D9RA 3MU8A 4BNRA 2XC4A 4GAWA 1TFXA 1GG6C 1TRNA 2D26C 2O8WA 1QIXB 1O3FA 1AKSB 1L4ZA 2SGEE 1P09A 4A1XA 2HALA 5A8ZA 4DT7B 4BAQB 1C1OA 2W7UA 1DSTA 3L3TA 3UOUA 1GCDA 2ZU5A 4Z0KA 2J34A 1ZHMA 5EW2H 3IWMA 2XC0A 2V6NA 1AUJA 1C5NH 1V2ST 3A7ZA 1SPJA 1S6HA 5DK1A 1NT1A 4SGAE 3ZYEA 5EQSA 4KTCA 2GZ8A 3P92A 1QRWA 1T32A 3HK6B 1HV7A 1EJAA 1MU8B 2ZO3H 1YF4A 3B23B 1NRNH 1LKAA 1ZRBA 3BTME 5C3NA 2QXGA 1O39A 3E6PH 2W26A 1P03A 2XWAA 5FBIA 1O35A 3FAOA 3AVZA 4BAKB 4BTIB 1YPHC 1GHXH 3SU1A 1Y8TA 5PTPA 1MQ6A 1PPBH 3UWIA 2D2DA 3PMAB 1C2KA 1UK4A 1GDUA 1AUTC 1SB1H 2BLVA 1QL7A 4TPIZ 1DWBH 4B74A 2THFB 4E06H 1THSH 1CA8B 1T4VH 4O9VA 1BDAA 2VIPA 2AIQA 3RXVA 1DS2E 3RXAA 1A0HB 1QFKH 1Y3WA 4DIIH 1WV7H 2PW8H 4HI3A 1ID5H 2QXIA 4KTUA 1P2IA 2OTVA 3UR9A 1DPOA 4K8YA 1EJNA 1G30B 1Z8IB 1HNEE 3K6ZA 2FOFA 3VB5A 3SOSA 3P8OA 2BMGB 1C2MA 1YCPM 1B0EA 1A5HA 1W12U 1GJ8B 1P06A 1P57B 4OS2A 2A4OA 9LPRA 1AWFH 1P2JA 2Q6DA 1NFXA 1SI5H 1LHDH 1EPTB 4FUGA 4Q7XA 2ZQ1A 2ZFSA 1P2QA 2F9NA 4FU7A 2XNIA 2Y5GA 2A7CA 3S9CA 1A4WH 1EOLA 1AVGH 2DUCA 3LU9B 1GJBB 1CBWC 4H4FA 3SU5A 1IQKA 1GI6A 3UFAA 1KXDA 2QA9E 3A7YA 1GI8B 2IN2A 3RXDA 3GY7A 1JIMA 3MTYA 1SHHB 2FIRH 2PHBA 2UUFB 1TX8A 1O2LA 2PWXA 1F0RA 1U6QA 4JZFH 2F91A 4RN6A 4CRFA 1NTPA 1UTLM 1V2VT 3SO3A 1FZZA 1UVTH 1G36A 1O5BB 1AZZA 3U8TH 3E16B 1GBKA 1AN1E 1XUGA 3HKIB 4AFSA 1TBQH 1BMLA 5JDUB 1SLWB 1EATA 2FOHA 3RXIA 2FYRA 1BRAA 3DFJA 1MU6B 4FUBA 1AMHA 2BX4A 1GI4A 1RXPA 2VWMA 2VINA 1C2EA 4YOIA 1HAIH 3OSYA 1GHAG 1TNKA 3EA7A 1T8LA 1Z6EA 2AMDA 1SQTA 2PGBB 4GCHG 1HJ9A 3SJOA 1W11U 3BV9B 2Y5HA 1E36B 3RU4E 2YNBA 3SN8A 4KGAA 1UCYE 1UTQA 2ZDAH 3V7TA 2H9TH 3QN7A 1CHOF 2KAIA 5FAHA 1C4Y2 1MZDA 1DE7H 1QL8A 1TNLA 4YLUA 2ALVA 1DWCH 1FQ3A 3D65E 1BTPA 1SFQB 1LPGB 2BX3A 3QUMP 3SU6A 1BRCE 3CS7A 1O3MA 3UREA 2NU2E 5ETXA 1GJAB 1UMAH 4YO9A 2FOMB 2ANKH 3KNXA 1DY9A 5H4IB 3Q3KA 3BTTE 1O0DH 1LVMA 2FO9A 2ODYB 1XKBC 3SNAA 2F9OA 1QJ7B 1J17T 2A7JA 2EEKA 1GDQA 2ZNKH 3ZZ3A 1T8NA 2VIQA 2H5CA 3RC5A 4CHAC 1S84A 1VITF 2BQ7B 4AN7A 4XE4A 2P8OC 4INKA 1P9UA 1HPGA 2R3UA 4ZH8A 4BTTB 3S9AA 2Z9JA 1UHBA 1VZQH 2Y82A 3RC4A 1FY4A 1O3KA 1V6DA 1KXCA 1QR3E 3VGCC 1YBWA 2GDEH 3GY3A 3FVFB 3PB1E 4FU8A 1QRXA 3DFLA 1GMHF 1CT0E 2FLBH 7LPRA 4CR5A 4J1YA 2IPHA 1GVKB 2CHAC 2ZI2H 4B2CA 1PPGE 2BD5A 1YPJH 2BDAA 3M5NA 4GSOA 1A0LA 3H5CB 4H6SB 1ELBA 1C1PA 1XKAC 4YZUA 2ZU3A 3RXTA 2RDLA 2VGCC 2BB4A 3GYLB 4Q7YA 1L1GA 3KEEA 2AS9A 4FUEA 1GL1A 3ATMA 3P6ZB 2Y6TA 1BHXB 1HXEH 2BOHB 1O2MA 1OPHB 3AW1A 3MH6A 1GMDF 3NWUA 4FUJA 8KME2 2F9VA 1EAIA 2TGPZ 3K65B 1O2QA 1JOUB 1O3JA 4K3JA 5GDSH 1G3DA 4AOQA 2BD4A 2HGTH 1O2PA 1HB0B 1FIZA 2Z3DA 3H7OA 1AI8H 1ZTLA 3E1XB 4NIXA 2VVUA 3K6YA 3TGIE 4YTAA 1IAUA 1O38A 3V0XA 1A61H 4WH8A 4MPWA 4ABFA 2ZDKA 1D6WA 1V2NT 3LC5A 4INLA 1UVSH 5FX5A 5EU8A 3SJIA 1K21H 3ATKA 2FYQA 3TK9A 3LGTA 4F49A 1VITH 1TNIA 2PLXA 1UTMA 4I32A 1C1NA 5LPRA 3E91A 4NGAH 1IQNA 1GBLA 1SGTA 2ZTYA 1TE0A 2AIPA 5EQQA 1O3NA 5J4QA 5GWZA 3UNRA 3AAUA 1YPEH 1EAWA 1K1PA 5EXNA 1P3EA 2JH6D 3MMGA 3RLYH 5EXLA 3L6PA 1UTOA 3R3GB 4MQAA 4VGCB 2KAIB 3A8CA 5DP8A 3LGWA 4GCHF 3SNEA 3SU3A 6GCHG 3NK8A 4AX9H 1C9PA 3M7UA 4AB9A 1BA8B 3E90B 1D3TB 1MBMA 2ZECA 3PO1B 1WCZA 1PPEE 2UUYA 2ZHEH 3O8DA 4JZIA 2HNTE 4WH6A 3ZZ8A 1CE5A 1INCA 3RLWH 1KTTB 1TMTH 5FPTA 2QC2A 1G9IE 2UWPA 3PMJA 3SGBE 2EI8A 1ZYOA 2GMTC 2TBSA 3JZ1B 1ACBE 3RXCA 1T8MA 2P3UB 1C5XB 2VB0A 1TGCA 1ARBA 1HLTH 1GHBG 2HPPH 1QBVH 4RKOB 2ZU4A 1FUJA 1OYQA 2XBVA 3TH2H 4H6TA 1UHBB 1GGDC 1IQHA 4MPXA 4LK4A 1O34A 4AORA 5BPEA 1O2TA 2STAE 1AE8H 3M35A 4UD9H 1F5LA 4IC5A 1ANEA 4J2YB 1IOEA 2FOGA 3A87A 2SGDE 1RTKA 3M5MA 1KIGH 2Y81A 1GBIA 3ZVEA 2BYAX 3ZVDA 1GI0A 2PKAA 1S81A 1Z1JA 3SGQE 3P17H 3KL6A 2Q1JA 1GHZA 4Y0ZE 4KP0A 1QGFA 1XUHA 1O2NA 2ZFRH 1EZSC 5F03A 3SHAH 3SJKA 3A8BA 2F83A 1MTVA 2EI6A 1EZUC 1C2GA 1QB9A 1FY5A 1KTSB 1O2RA 5DGJA 2DE8A 2ZC9H 3U9AH 2FZZA 1IQIA 1GBAA 4E7NA 1PQ5A 3URCA 2UUKB 3F9GA 4A5TS 1QHRB 3T29A 3M3VA 2H2ZA 1OWDA 1JMOH 5I25A 3Q00A 4AB8A 1LQEA 2F9PA