2LPRA

Structural basis for broad specificity in alpha-lytic protease mutants
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACAGRGDSGGSWITSAGQAQGVMSGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ALPHA-LYTIC PROTEASE
publication title Structural basis for broad specificity in alpha-lytic protease mutants.
pubmed doi rcsb
source organism Lysobacter enzymogenes
total genus 53
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1991-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2lprA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2lprA01
2GGVB 5LGOA 1S0QA 3ODDA 5IYTA 1EAUA 1A1RA 2XC0A 4I31A 2Y82A 4FUIA 1B0FA 4FUDA 8LPRA 5E0HA 2F83A 1P2IA 3VGCB 1ZOMA 1TBQH 1GGDB 1GVZA 2I6SA 5LPRA 3EGKH 4Y7AA 3SJKA 1VJAU 2VNTA 4JYUH 3FFGA 2ZPSA 1W12U 2R3YA 3GCOA 4RKOB 5EG4A 1LHDH 4E06H 1EATA 4OS4A 1Y3YA 4Y71A 3MH5A 4WXVA 4NWLA 2CV3A 1NRPH 1FLEE 1B7XB 1O5CB 4CREA 1ZSJA 1K1PA 1AZZA 3KGPA 3EA7A 1PFXC 4ISLA 4Y8YA 3EDXB 1SGIB 1AI8H 1YLCA 1LVYA 1DWEH 4ISHH 5TJXA 5F8TA 3UREA 2R2MB 1HAZB 4H42U 1GCDA 2PV9B 2V3HH 2C93B 1V6DA 3I29A 1Z8JB 2STBE 1WOFA 5HMAA 1EJMA 3ATIA 5DP6A 1GVKB 3ZVBA 1FIWA 1P04A 3SNDA 1W7GH 3SN8A 3H7OA 2WPHS 1K1JA 2PUQH 4MPUA 1HAGE 1TX6A 1GMDG 5DP3A 4FVDA 3UWJH 3ZV8A 5GCHF 1ANCA 1GBBA 1WYKA 1D3QB 2XW9A 1GWAA 5T6FA 1TOCB 3T26A 8ESTE 1C5UA 1LVMA 3QGJA 1BA8B 3H5CB 3T2NA 1S0RA 2VH6A 1O3GA 2O8TA 7ESTE 1BIOA 1BJVA 2VWLA 1T31A 1TRMA 2SGPE 1T32A 3RU4D 1MBMA 1TMTH 4CR9A 4BAMB 1ZPZA 1CBWB 2F9OA 3ZZ9A 2AS9A 2J2UA 2Z3CA 3H7TA 1H4WA 1CO7E 2GT7A 1WAYB 4MNVA 3K6ZA 4J1YA 2Q6GA 4Q80A 4X1RU 2H2ZA 3BIVH 1F0TA 4LK4A 4VGCC 3VEQB 1T8OA 4ABJA 2ZCKP 3LOXA 1PYTC 1MTNB 4XE4A 3I77A 4BAKB 2BY6X 2Z9LA 4Y0ZE 3GOVB 3M5OA 3KQDA 1NRNH 1UHBB 5A8XA 1IQGA 1XXFA 4WH8A 3BTEE 1BQYA 3V0XA 2Z3EA 1S84A 1PPCE 1C1SA 2BD5A 3MU8A 2TRMA 3RMOH 2WPIS 3SV2H 1AB9B 1QTFA 1UHBA 4JYVH 4NZQA 5GJ4B 3RC6A 4JZDH 1HNEE 1E34B 2HVXA 1QL8A 2FYQA 4A5TS 1CA0B 1EQ9A 1O5GH 2FYRA 2TBSA 1C1QA 1OWHA 1UTOA 1O35A 4NA9H 5CMXH 3K65B 8GCHG 3P92A 4D9QA 1ELCA 2A4QA 4MPVA 3A7WA 3QZRA 5EQQA 1PPEE 4NWKA 5FXLA 3EE0B 3BEUA 1P01A 2AGIX 5FBIA 2O8LA 2C3SA 1SGYE 3EYDA 1FUJA 3MO9A 1SLUB 1GL0E 4NFFA 1S6FA 3DFLA 2GV6A 1AKSB 1O2HA 2ZA5A 3O8BA 1QA7A 3G01A 1SLVB 4AN7A 9LPRA 1GI7B 2G55A 1LQDB 1KXEA 4GHQA 1C2EA 3U98H 1Z6JH 2ZGJA 3SV7A 1AKSA 2OINA 2PW8H 3RU4T 4CHAC 3HGPA 2PHBA 1O2IA 1LVBA 1NFWA 3EQ0H 4DURA 2EEKA 2WUCA 2RG3A 5JDUB 4DCDA 2BY8X 3GCTF 2G4UA 1QA0A 1GBMA 2EI8A 2AIPA 3QN7A 3AAUA 1GL1A 1TABE 3RXDA 2Y5HA 3DFJA 4AFZA 1W11U 2BQWB 4UONA 3RXHA 2W7SA 4IGDA 2AIQA 3RMLH 1EZQA 1J16A 1C5VA 1N6XA 2VIOA 2FOGA 3ATLA 9ESTA 4WMFA 2W3IA 4X1PU 3SHCH 1PPBH 3A85A 2VVUA 1O3NA 1TRYA 1WCZA 3GDVA 1BITA 2WUBA 2FZZA 4R0IA 3M35A 3UFAA 1ESTA 1RIWC 3A82A 1O3PB 2XBWA 4X8TH 3SV6A 1WQVH 1UK2A 3AVZA 1OS8A 1OP0A 1SFIA 1YC0A 5A2MH 2ZI2H 1LKAA 1V2NT 5DP5A 1C5MD 4CRFA 4XBBA 4X8SH 7LPRA 2OQ5A 1PQ7A 4CR5A 2ANWA 1ZHRA 5C1YA 1TPSA 2R0LA 5EU8A 6LPRA 3HKIB 5DP8A 2XXLA 5DK1A 2BDYA 1TONA 2ODYB 3M5MA 3TH4H 4DVAU 4BNRA 4ZROA 3F9GA 1BTUA 4BANB 3LDXH 3S7KB 4B2AA 3NKKA 1ZMLA 1V2MT 1N1LA 3MU4A 1C2LA 5E2OA 5ETXA 1AUJA 2V35A 2ZWLH 1EAIA 1C5OH 1DT2A 4PROA 2TIOA 2I6QA 2THFB 1BBRK 4YOGA 5C5NA 1O2XA 4UDWH 1Q2WA 4CRGA 3URDA 2BY9X 3F9HA 4MG3A 1C1UH 1O32A 2QXIA 3LJJA 3SNCA 4Q2KA 3RXJA 1JWTA 4IN2A 1MUEB 4K2YA 3RMMH 3STJA 1O2ZA 3ATMA 2SGEE 1IQMA 5C5OA 3BG4B 1GHBG 3RXOA 1ELBA 4FXGH 4I7YH 3HK6B 1BTHH 3ZZBA 1T8NA 2AMQA 4CBOA 1EPTC 1TBRH 2XC4A 3RXCA 3MNXA 3ZZ6A 1F5LA 2W26A 4ABEA 4O03A 5JPMH 3M37A 2ZDKA 3A84A 5A0AE 1P10A 2HRVA 2ANKH 3TJOA 3FP6E 1H9LB 1HJAC 3ZVCA 1MZDA 2BX3A 5F6MA 5LPFA 3OY5U 1SB1H 3ESTA 1YPGH 4AOQA 1DWCH 3CP7A 4B75A 2ZDAH 1AO5A 1PQAA 1K1IA 2OTVA 5C20A 2PSXA 3NUMA 2H5DA 1O36A 3UWIA 2CMYA 4NA7A 6CHAC 1WSSH 3DD2H 4IW4E 1BHXB 2C90B 2GDEH 2PFEA 2HPPH 1J9CH 1ELDE 1EZUC 1O38A 3KIDU 1L1GA 1HFDA 1QY6A 1CGHA 1FPCH 1YCPM 1BMNH 2A4RA 2ZFPH 3A89A 2HNTF 1GG6B 1BUIA 3MH7A 1SQAA 3Q3XA 2HNTC 2PGQB 4NIVA 2CF8H 1NESE 5ESBA 5T6DA 2J38A 1S81A 5FHTA 1NU9A 1GI4A 2OC8A 2PGBB 4Z6AH 1TNGA 3RU4E 4OGYA 1QB9A 2ZNKH 1GMDF 4K8BA 2LPRA 3B23B 1KDQB 3RXUA 1LCYA 2P8OC 4NG9H 1TALA 3BSQA 1XMNB 2P3FH 1DWDH 2XBVA 2OQUA 1KXDA 1E37B 1ESBA 4LXBH 4ABAA 2ZHDA 2PKSC 1F92A 1KY9A 1D6RA 1NM6A 4K5ZA 2VJ1A 1G3EA 5DGJA 3VXFH 1KDQA 2SGAA 1C5YB 1ABJH 1ELFA 4OS7A 1BJUA 2FI3E 1BMMH 2CHAC 1Z8GA 2OUAA 5JBCS 1HJ9A 3NWUA 3HPTB 4K8YA 1HRTH 1HYLA 1SR5C 2JH5D 4A1TA 1C9PA 1Y3VA 1ZJDA 4OGXA 2FTMA 5E2PA 3V13A 3BIUH 2Z6BD 3KNXA 1UCYH 3GY4A 4BXSA 5GPIB 2FS9A 1FZZA 5CHAB 1P06A 2BYAX 5EXMA 1ZHPA 2QIQA 1D6WA 4ABDA 2KAIB 2O8MA 1MAYA 2ZCHP 1ARBA 1E35B 3M5NA 1O3IA 3T25A 1AFQB 1ZSLA 1G3BA 1KLTA 3W94A 3B8JA 1MTWA 3U8RH 2W5EA 1KTSB 4SGBE 1O2JA 2GKVE 1TQ7B 2KAIA 1P3CA 1SMFE 1XUIA 5A8YA 4ISNA 2GTBA 2BVSH 1YPKH 1K9OE 3QGNB 5JBAS 3BF6H 2W3KA 2QV1A 2BLWA 1DX5M 3QLPH 1C9TA 1HLTH 2OD3B 1SLWB 1RRKA 1C1WH 4F4OC 1UVUH 8GCHF 4UFDH 4A6LA 1W10U 1L2EA 4O3TA 2F91A 1ZPCA 1PPHE 4WXIA 2TPIZ 3GY3A 3LJOA 4ABBA 1GI0A 4AFUA 2BVRH 1SGTA 2YNAA 2QF0A 2HLCA 2FXRA 2YNBA 1TGCA 2P93A 3DT0H 1UVPA 1ZHMA 4Y0YE 1VCQA 3TJUA 2QF3A 4X2VA 3RC5A 2WPLS 5F8ZA 1BRAA 3SI3H 2VVCA 1D9IA 4NGAH 1FY3A 2Z9GA 1NN6A 5LPEA 4ZKRU 2Y5FA 1ZTKA 3QTVH 3MU0A 2ZGCA 1VCPA 1CVWH 3PMAB 4WF8A 2PLXA 1UMAH 3L6PA 1DXPA 1C5ZB 2ZPQA 1MKWH 3NCLA 3ZYEA 3Q76A 3Q77A 4YESB 1CA8B 1FI8A 2BTCE 2PSYA 5AFYH 3P17H 2J92A 4TPIZ 4ZHAA 1YCPH 1UVTH 2GZ7A 2H6MA 5L2YH 4BTTB 3M3TA 4R8TB 2A5KA 3U1JB 1AQ7A 2BXTH 4I8LA 2FX4A 1RD3B 1EB2A 4ZXXH 2TGPZ 4K69A 4E7NA 3SU4A 1NPMA 1THPB 2V0BA 4DT7B 3KN2A 2F9PA 2ZECA 1IQEA 3KEEA 1GDQA 3TU7H 4RKJB 3PROA 2OLGA 1TQ0B 4INKA 1IQIA 1TMUH 1W13U 1QBVH 3SQHE 1NRQH 1T7CA 4XOJA 1TGTA 4D9RA 1U6QA 2A7HA 4IS5A 2C8WB 3QTOH 1J14A 1QJ7B 1G9IE 1BTXA 1NRRH 4Q7XA 1OWEA 1DDJA 4NIXA 3RXGA 3BG8A 1W0ZU 5FCKA 1TFXA 1QFKH 1DSTA 2SNWA 2XWBI 3AW0A 5GDSH 3S0NA 2G5VA 5L30H 1O33A 2BLQA 2Z3DA 3SU0A 3S69A 1O5BB 1QL9A 2CXVA 1P2KA 1W8BH 3UQOA 3RM2H 1CHOG 1QB6A 1TX7A 4BTUB 3Q3KA 3ZZ5A 1E0FD 1FQ3A 2Q6FA 2V3OH 5TCAA 4E7RG 1WBGB 4A1XA 4B73A 2BD2A 3LGWA 1O2SA 2BOHB 5EXLA 1HAOH 4XSKU 4NSYA 2PUXB 1A5IA 1HAYB 3ZZ8A 5HM2A 1O2TA 1C4V2 2PWXA 1GHBF 3LIWA 1P02A 1G30B 3MU1A 5C2ZA 1A0LA 1TWXB 2GMTB 2VGCC 3CS7A 4I8GA 1P03A 2FDAA 2XRCA 5EXNA 1SG8B 2Y80A 1O3FA 2FESH 3MNCA 1BRBE 5DP4A 1G3DA 3M7TA 3CENA 3OU0A 3K6YA 4B1TA 1YF4A 2J95A 4YZUA 1AMHA 2UWLA 1O3DA 3MO3A 2SGDE 2BD3A 1C5NH 4I8KA 3VGCC 1FN6A 5EW2H 3ZZDA 1GGDC 1O3KA 1PPFE 1TOMH 3MO6A 4X6PA 2ZZUH 1SQOA 2B0FA 3E8LA 3PLBA 2D2DA 2EC9H 2ZTXA 2G4TA 1EJNA 1C1RA 4X1SU 3RM0H 3SBKA 1O2UA 2ZHWH 2ZQ1A 2ZDNA 1NRSH 3F9EA 1P9UA 3LPRA 1DFPA 1P0SH 2G52A 4B2BA 1ZTLA 1KXAA 2HGTH 3LH3A 4A92A 3PO1C 5EPYA 1O2QA 3BEFB 1DANH 1C5TA 1BCUH 1F7ZA 1HBTH 1LHGH 1S83A 1NFXA 3ATWA 4SGAE 6GCHG 1HAPH 1P2OA 2FX6A 2OCVB 1SGQE 1GDUA 1ESAA 4X0WU 1K22H 1W3CA 5AFZH 1QQ4A 1DY9A 4ISOA 3GICB 3VB5A 4AFQA 4NA8A 1LVOA 2FS8A 3DHKH 2RDLA 1ELEE 5AF9H 1SBWA 2G81E 3HK3B 4X1NU 3A7ZA 4LZ1H 1N6YA 2ZFQH 3PLPA 1TNKA 1VGCB 1V2JT 5BPEA 3VXEH 1O5DH 3A7TA 2QXJA 5DP7A 3SU3A 2BOKA 4I8HA 1SGRE 1P2JA 4ZH8A 1UK4A 2QCYA 4GCHG 1O2OA 3EA9A 3LC5A 3PMBB 3A80A 4CHAB 1C5WB 3SU2A 1O3MA 4IBLH 3TITA 1CBWC 2A32A 4BTIB 4ABHA 3FP7E 3BTHE 2BY7X 1DE7H 6ESTA 2WYGA 3N7OA 2EI7A 1AU8A 4ZAEA 2R2WU 1WV7H 3ZVFA 2QGRA 3GY5A 4FUEA 2VINA 2AYWA 1C5SA 1GHZA 1MTNC 2ANYA 2HOBA 1CT2E 3T5FH 5ABWA 2A4GA 5C1UA 1KYNA 4A1VA 2JETB 4Z0KA 2VIDA 1SL3A 1GBKA 1JOUB 3RXBA 1TRNA 3JZ2B 5DG6A 1A46H 1QR3E 1SGFA 1QBOA 1ZGVA 3O8CA 5FCRA 2F9BH 1UCYK 2FI4E 3UNQA 1AB9C 1O3LA 3P6ZB 4D76A 1ZRBA 3TNTA 1V2PT 1G37A 2GZ8A 3A7VA 4JK5A 3RXSA 1HUTH 1MQ5A 4MLFB 1GCTB 1DICA 4Q7ZA 1LPGB 3K9XB 3KQCA 3SV8A 1O5EH 1ELGA 2R0KA 1UTLM 3TH3H 2DUCA 3TVJB 1IQHA 2A45B 3SNAA 1JXPA 1AHTH 2BD9A 4OS5A 1Z7KA 1LHEH 1FPHH 1S5SA 3RXKA 1EJAA 3BV9B 4KTSA 2FOEA 1GDNA 1K2I1 3M7QA 4I8JA 1FMGA 3RXEA 1C2HA 1MTVA 3ATKA 2BQ6B 1Y3WA 1MCVA 4X2YA 3T28A 2J9NA 3GY6A 1O3JA 4RN6A 2IOTA 1RTFB 4U32A 3SU5A 2OXSA 1O3EA 4WVPE 3FAOA 1GBAA 4DW2U 3M3VA 1L4ZA 1EOLA 3IG6B 1W14U 2DE9A 2Q6DA 2HNTE 4ZMAH 3BEIB 3OTJE 4X2WA 1QJ1B 1YPHC 1EPTB 1UTQA 1TGNA 4K1EA 4LZ4B 1PQ5A 4K60A 5L6NH 1GJAB 2NU3E 5HM9A 1UK3A 1PYTD 4AORA 1M9UA 1P2QA 2OBOA 1MQ6A 1THSH 2V6NA 1TNLA 3RXPA 3TPIZ 1GHYH 4Q7YA 4YOJA 2WPJS 2QA9E 5TCCA 3MYWA 4YTAA 3BTFE 1VITG 1GJ9B 2NU2E 3V7TA 2XYAA 2ZO3H 1V2UT 4K3JA 3LH1A 5DPAA 3WY8A 1DPOA 2PTNA 1Y8TA 4I33A 1MKWK 3QK1A 1H8DH 1GVLA 5HYOA 3IITA 3ENSB 4HZHA 1Q31A 2GCTB 2ZF0H 1EXFA 2XNIA 3TJNA 1QQUA 1NFUA 1G32B 2WINI 4FVBA 1GI1A 1SQTA 1YCPK 3E0NB 5FPTA 1BTPA 1O3AA 1RJXB 2VWMA 4AYVB 1ETTH 4QT8C 3ZZAA 3PWCA 2FP7B 2J94A 3NZIA 1K1NA 1CGJE 6CHAB 1TE0A 1V3XA 4X6MA 1QHRB 1CT4E 1LMWB 1JRTA 4KTCA 3U8OH 1O3CA 3P70B 4AG1A 1O0DH 1C2IA 3T27A 3W95A 1B5GH 1C2FA 1OP2A 3MWIU 3RLYH 1P12E 1A3BH 3BN9A 2BD8A 3SJIA 1GBIA 3OYPA 5EQRA 2K1QA 3BTME 4ZXYH 5FAHA 3PWBA 4NSVA 3F68H 1CHOF 5JYIA 1V2QT 4AGKA 3HATH 2FODA 1S82A 1AVXA 2P8OB 1A3EH 1F5RA 1IQLA 2SGQE 1O2RA 2WPKS 5FBEA 1C4U2 3GCHB 3MOCA 1BMLA 1AFEH 3PMJA 4UE7H 1D3PB 3A8BA 1QGFA 1MCTA 1FAXA 2G00A 3U1IB 1C2DA 1C2GA 1C5RA 1IQNA 2FTLE 4Y8ZA 1SPJA 1KXFA 1GJ4H 1TPOA 4FU9A 4K1SA 1EZXC 3HGNA 1PPGE 1GBHA 3TNSA 2P3TB 1ARCA 2ALVA 1GHAG 3AASA 2ZC9H 4AB9A 4U2WA 4NCYA 2BD4A 1FAKH 2BX4A 2ZDVH 2AEIH 2B9LA 1OKXA 4KELA 1AGJA 1C1PA 2BDCA 1BDAA 1C2KA 2ZDLA 1AVWA 3CS0A 1DUEA 1O5FH 1GBJA 1FY8E 4Y6DA 3S9BA 3A8DA 1BRCE 4YT6H 1AUTC 1V2WT 3A7XA 4XFQA 3TIUA 1Y5UT 3D23A 2SNVA 1TNHA 1KXCA 3FP8E 5DO4H 5DJ7A 1P2MA 1TNIA 2EA3A 3SO3A 3RXVA 1LHCH 6GCHF 1L4DA 3RMNH 2FOMB 1IOEA 2FO9A 2ZIQH 4OS1A 1RXPA 3U69H 3ZZCA 1CHGA 1GG6C 5SGAE 1GBDA 2XTTB 4D7FA 1ORFA 1HDTH 2B5TB 5EQSA 1MH0A 3C1KA 1ZSKA 1L1JA 1ELAA 3F1SB 3C27B 1VCWA 3A88A 2BLOA 1GJDB 4INLA 5A0BA 1Y59T 1JIRA 3UR9A 2G51A 4WMEA 1QJ6B 2D1JA 1YBWA 4FUJA 1MAXA 4ABGA 4CRBA 3VB7A 2Z9KA 1TGSZ 4ISIH 1C1OA 2TGAA 1KLJH 2FOCA 4YLUA 3F6UH 4GCHF 2VVVA 3EA8A 2C8XB 2DE8A 2ALPA 2BHGA 1T4VH 4GHTA 3OSYA 3GCTG 3RC4A 1J15A 2VIVA 1P57B 3E3TA 2WV4A 1GHXH 4UEHH 1CT0E 2FIRH 1N8OB 5LH8A 3TGIE 1QNJA 1H1BA 1HIAB 1Z1IA 3GDUA 1SGFG 4X1QU 3SNBA 1J17T 2BY5X 1BBRE 4JZEH 3DUXH 1Z8RA 5GXPA 1TPAE 1GMHG 3PYHA 3SJOA 2ZCLP 4JZ1A 3UNRA 1O30A 1AIXH 1P9SA 1G36A 2VWOA 4MTBA 2PKAB 3QUMP 4YLQH 2NU1E 1NT1A 2Z9IA 1ETRH 2NU4E 2ZFRH 2ZU3A 1AY6H 2W7UA 1VITH 4HGCA 1OYQA 2HPQH 2JH6D 2O9QA 2Z9JA 1XUKA 1OSSA 1DOJA 1F2SE 1GJ8B 2ZU4A 4OS6A 1C2JA 2F9UA 1IHSH 3P95A 1FY1A 1UO6A 1F0UA 1YM0A 1F0RA 1PQ8A 4DIIH 5C67A 4B2CA 1ANEA 3MH4A 4JMYA 1O2NA 1OWIA 1V2RT 1KSNA 1ZLRA 1ELTA 2ESTE 4IC6A 4CH8B 2ILNA 1EAWA 8KME2 2LNCA 1L0ZA 1X7AC 1VZQH 2H9EH 1O2YA 5JBTA 4FUCA 4AB8A 1ELVA 1NS3A 2BMGB 3L33A 2Y5GA 4K1TA 4KTUA 3SUFA 1HAIH 1G3CA 3QZQA 3R3GB 1W2KH 5EGMA 3E90B 3BTDE 2VIQA 2FMJA 4DIHH 5PTPA 1AWHB 4DG4A 1L1NA 1RFNA 1TGBA 4H6TA 2CF9H 4X2XA 1TMBH 2ANMH 1LKBA 1JIMA 2B7DH 2P59A 3LKWA 1OXGA 1VR1H 2QXHA 1FDPA 4Y7BA 1SI5H 3MMGA 1EP5A 1P3EA 2BDHA 4Y11E 1K28D 3V3MA 4MPWA 1MMJN 1TYNA 2A5IA 4B74A 3PV4A 3S7HB 1HPGA 3A8CA 1YPLH 1OWJA 3VB6A 4FUHA 5T3HA 1FY5A 4YM9A 1SLXB 2VGCB 1YP9A 1WU1A 2FWWA 1AWFH 4NIWA 1MD8A 3TK6A 1NFYA 1O2WA 2STAE 3GDSA 3GY2A 1CGIE 2D8WA 1LDTT 4AGJA 1V2OT 1SGCA 1A5HA 1VITF 2A0QB 1XM1A 4HTCH 1WTHD 1QBNA 3FANA 3RDZA 1LPZB 3AW1A 4U01A 1FIZA 2GDDA 3ZVEA 1SGDE 1A5GH 1TNJA 1TA6A 1EB1H 3E1XB 2AFQB 1EKBB 1DS2E 4BOHA 3PTBA 4GSOA 3TGJE 1QRXA 3SGQE 1INCA 3KHVA 3FVFB 2ZHFH 2F3CE 1A61H 2ZKSA 1KIGH 2A31A 2Z94A 2ZTYA 1Y5AT 2Y6TA 5DKMA 3PO1B 4GUXA 2GVFA 1ZR0A 1ACBE 4ZUHA 2IPHA 4ABFA 1KTTB 1C1NA 1O2GH 3D49H 3M36A 3NK8A 2H9HA 4VGCB 3Q3YA 1KLIH 1OYTH 1QRWA 4BAOB 3UQVA 1GI6A 3KQEA 3VFEA 2XC5A 1DWBH 1Y3XA 2BQ7B 4AX9H 5C3NA 4AG2A 2BDGA 1OWDA 4MNXA 3M61U 3PTNA 1NROH 1O39A 3B9FH 1MTSA 1MBQA 3ODFA 1W7XH 3E0PB 3NPSA 4HFPB 3BTTE 3LC3A 2RA0A 1HB0B 1O2LA 3OX7U 1AZ8A 4TPYA 5EW1H 2M5TA 3ITIA 1ZMJA 2P3UB 3LT3A 1XUFA 2AH4X 1SSXA 4M7GA 3ZVDA 4YOIA 1O31A 3RXIA 1MU8B 1YGCH 3KL6A 2Q1JA 5H4IB 4Y76A 4DOQA 2NWNA 2O8WA 1GI8B 2XBYA 3U9AH 2OBQA 2ZFFH 2ODPA 4FU8A 3R0FA 2UUJB 3V12A 2GMTC 2FOBA 3LONA 4KP0A 7GCHG 3E91A 4J2YB 1T8LA 4FUBA 1ZZZA 1C1MA 2BDIA 1FXYA 2GZ9A 4Y79A 1QL7A 2ZHQH 3JZ1B 4XBDA 4MPXA 1SVPA 2A1DB 2ZU1A 1JMOH 2B8OH 1GHAF 1XXDA 2FOFA 1ZGIA 4ESTE 4DY7B 4MQAA 1RS0A 4JYTA 1AD8H 1RTKA 2FI5E 1SFQB 2GCHG 2GV7A 3RXFA 1J8AA 1YPHE 4RSPA 4THNH 1O3BA 3BTQE 1ABIH 2AGGX 3A81A 2PTCE 5FX6A 1BOQA 1GBTA 3ZZ7A 1GI5A 2J34A 4X8UH 2O8UA 3SOSA 2D26C 2AMPA 3LGYA 1OOKB 3ZVGA 3KQBA 2C8YB 1YLDA 1DY8A 1GMCG 1QURH 5GIBA 1FN8A 1FY4A 3SU6A 1MKXH 2UWOA 4GPGA 1BTYA 1BMAA 3D65E 1JBUH 1RTLA 2Y7ZA 1V2TT 2A2XH 1XVMA 3P8OA 1GBCA 5F03A 1WTGH 1QB1A 1SGPE 2CJIA 2ZFSA 3MHWU 3UY9A 1LPKB 4A7IB 3GCNA 1Y5BT 5L2ZH 1P09A 4DGJA 2FLRH 1RIWB 2FOHA 2ZGBH 3IWMA 2ZHEH 4UFFH 1D3DB 1UTJA 1DM4B 4LOYH 1K1OA 1AVGH 3QO6A 1O2PA 1TIOA 4YT7H 1GI9B 3L3TA 1YKTA 1VGCC 1XUJA 1XUHA 5T6GA 1H8IH 3UIRA 1CA0C 1P05A 4TWWA 2QYIA 5J4QA 4CBNA 1UTMA 1GI2A 1OX1A 2XWAA 4MNWA 3UOPA 1O34A 2IJOB 1A4WH 3SUEA 4IMZA 4D8NA 1OPHB 3P8FA 1BRUP 5ESTE 3SI4H 3UTUH 1EX3A 3BTGE 2H5CA 3QWCH 1HAVB 4ZKSU 3SZNA 3HKJB 1DLEA 1QCPA 3RXMA 2BDAA 1DUAA 2OC0A 3GY8A 1UTPA 1YPEH 2QY0B 3M3SA 2Y81A 5B6OA 3STIA 4CRCA 1C5XB 1GMHF 3SV9A 1HAVA 7KMEH 1O3HA 2FM2A 3FZZA 2IN2A 4HI3A 2JETC 4B71A 2OC7A 1G2MA 3RP2A 3RXAA 2P95A 2UUFB 1Z1JA 5GWZA 2A5AA 3TJVA 3T62A 1MD7A 1E38B 4JZIA 1EAXA 4XBCA 4Y8XA 1LO6A 3UNSA 3RXLA 3M7UA 3MFJA 2FPZA 1ANBA 1T8MA 1PJPA 4KGAA 3QDZB 3U8TH 1GCTC 1Z6EA 2A7CA 4JZFH 3OY6U 5FX5A 1XVOA 4AYYB 2H9TH 1K1LA 1H9HE 4H6SB 4MVNA 1SOZA 2BXUH 3PLKA 2QN5T 1YPJH 1UVOA 2VIPA 1SHHB 1C5PA 1EPTA 3I78A 1HGTH 4I32A 3RXTA 3ZVAA 3UR6A 2UUYA 1TBZH 2F9VA 4O9VA 4ASHA 1Z8IB 1TPPA 5G4BA 1YPMH 1HJAB 1A0JA 1S85A 5E0GA 5EOKA 4NFEA 4WJG2 3VB4A 2C8ZB 3SJ9A 2ZU5A 2UUKB 2P94A 3A7YA 3A8AA 4TYDA 3UOUA 2ZGHA 1NY22 3LGIA 1NO9H 4IC5A 3T29A 4JK6A 1A7SA 4XDEA 2OC1A 1ZYOA 2TGTA 3SU1A 1KXBA 1O2MA 2VB0A 2JH0D 1TX8A 3E6PH 3F9FA 4INHA 2ZDMA 4NIYA 1H9IE 1XUGA 1BZXE 3TK9A 5BRRE 1CE5A 1E36B 3ZZ4A 1C2MA 1HCGA 1O5AB 3GYLB 1FONA 1F0SA 3VB3A 1HV7A 1GBFA 1BTZA 4WY3A 1THRH 3ZYDA 2AERH 3TLOA 3SHAH 3LGVA 2P16A 2NU0E 1D4PB 5GCHG 1NC6A 2CN0H 2R3UA 3MTYA 1W0YH 3URCA 5I46H 5HXFA 1QRZA 4X6NA 1DLKB 2BVXH 2ZEBA 1MU6B 5AVDA 2PKSB 3PMHB 2GX4A 2GCTC 1SHYA 2RCEA 1VJ9U 3BG4C 1NZQH 1SOTA 4CRDA 1GBLA 1ETSH 1V2LT 5A0CA 2A4OA 1ZRKA 3ELAH 4UFEH 1V2VT 2CHAB 2ZU2A 3GY7A 1IQKA 1EP6A 3S9AA 1XKBC 1AE5A 3DA9B 2JKHA 2FOAA 4Y10E 5K0HA 2XCFA 5EODA 2BB4A 1OP8A 4TWYA 2QXGA 2RA3A 3MNBA 4ZHLU 1WQSA 1RGQA 3AAVA 2VWNA 3QX5H 3M5LA 3MU5A 4DJZB 2BZAA 1P2NA 4U30A 4O97A 4E05H 1LTOA 4MDSA 1LHFH 2R9PA 1IHTH 1XX9A 4AZ2B 3RXQA 5EPNA 2SGFE 2ZP0H 2AGEX 1JRSA 5DP9A 5FPYA 3TK5A 1P11E 1UCYE 1MZAA 3EAJA 3RLWH 2A2QH 1AN1E 1D3TB 4FU7A 2CGAA 1HAXB 1SGNE 3SUDA 2GP9B 3MH6A 2WYJA 1Y3UA 3PM3A 3P8GA 1BHXF 1NU7B 1SC8U 1TAWA 4JCNA 3GCHC 4WMDA 2BD7A 1C4Y2 1A0HB 1O37A 1UJ1A 1TB6H 1FNIA 2XBXA 3KCGH 4X8VH 2ZTZA 2VIWA 1G2LA 1ZMNA 2TGDA 3GYMA 4BXWA 1GBEA 2VU8E 4H4FA 5E0JA 7GCHF 2YOLA 1DITH 1TA2A 3A87A 2AMDA 2ODQA 4MNYA 3SGAE 2ASUB 1HJ8A 4BAHB 2A7JA 2WPMS 4D7GA 2BZ6H 2HALA 1C1VH 3SUGA 4TY6A 2BDBA 1C5LH 1P8VC 1ID5H 1YYY1 2ZQ2A 1S6HA 3Q00A 5J4SA 5F8XA 1C5QA 2GCHF 1CSOE 1Z71A 1V2KT 1MTUA 1XKAC 4WH6A 3ZV9A 5JBBS 4ZKNU 1C1TA 1GHWH 1EZSC 1O3OA 3NXPA 1T4UH 3D62A 2FEQH 5K7RA 1HXFH 1UTKA 1GJ5H 1SGEE 1CU1A 4YO9A 1GMCF 4ABIA 3P8NA 3VPKA 4X6OA 1EOJA 4ZKOU 3TH2H 5CHAC 4GLYA 4B76A 1O2VA 2GD4B 3O8RA 3RUOA 3SW2B 1AE8H 1UVSH 1BTWA 4ZHMU 3UPEA 4UD9H 1AFQC 2SFAA 1DVAH 1HAHH 1HIAA 1LQEA 2UWPA 3MNSA 2XCNA 2QAAA 3K2UA 1EUFA 4IN1A 2ZGXH 3SQEE 4CH2B 1UTNA 5FPSA 2Z7FE 1GJ7B 1PPZA 3LGUA 4IMQA 1MKXK 5A09A 1NTPA 1HXEH 4F49A 3UUZA 5JB8S 4GVUA 5A8ZA 2PKAA 2GT8A 4AFSA 1ZJKA 2G8TA 3LU9B 3SJ8A 1GHVH 1CQQA 1GJCB 2ZPRA 2F9NA 3LGTA 2OP9A 1IQJA 1WUNH 3PB1E 3SORA 5AHGH 3TGKE 1BBRH 2BM2A 1ZPBA 3ZZ3A 3GISB 3BTWE 3A86A 2HWLB 5IDKA 3MI4A 1A2CH 2QC2A 2J4IA 1Q3XA 1EASA 1DSUA 5E8EH 1V2ST 1O2KA 1N8OC 1FJSA 3S9CA 3KF2A 4CRAA 2EI6A 5C1XA 1GJ6A 2WV5A 1F5KU 1FV9A 1K21H 3E16B 1GI3A 3RXRA 4UFGH 2Y7XA 2ZFTA 2H1UA 5I25A 3A83A 2PR3A 1GPZA 4GAWA 4WWYA 1K1MA 1GJBB 2ZG0H 1TLDA 3SNEA 2ULLA 2FLBH 5JB9S 5HGGA 1DXWA 4NZLA 4KKDA 3FZDA 4FUGA 1IQFA 4BAQB 1B0EA 4O3UA 4TY7A 5CE1A 3SGBE 1ZTJA 2G5NA 1QIXB 1ANDA 1IAUA 1BT7A 1OWKA 4FUFA 1BB0B 4OS2A 3BTKE 2BLVA 2C4FH 3O8DA 2VH0A
chains in the Genus database with same CATH superfamily
2GGVB 5LGOA 1S0QA 3ODDA 5IYTA 1EAUA 1A1RA 3PRBA 2XC0A 4I31A 3KQ5A 2Y82A 4FUIA 1B0FA 4FUDA 8LPRA 5E0HA 2F83A 1P2IA 3VGCB 1ZOMA 1TBQH 1GGDB 1GVZA 2I6SA 5LPRA 3EGKH 4Y7AA 3SJKA 1VJAU 2VNTA 4JYUH 3FFGA 2ZPSA 1W12U 2R3YA 3GCOA 4RKOB 5EG4A 1LHDH 4E06H 1EATA 3F3BA 4OS4A 1Y3YA 4Y71A 3MH5A 4ACAA 4WXVA 4NWLA 2CV3A 1NRPH 1FLEE 1B7XB 1O5CB 4CREA 1ZSJA 1K1PA 1AZZA 3KGPA 3EA7A 1PFXC 4ISLA 4Y8YA 3EDXB 1SGIB 2JIZD 2IPQX 1AI8H 1YLCA 1LVYA 1DWEH 3KYFA 4ISHH 5TJXA 5F8TA 3UREA 2R2MB 1HAZB 4H42U 1GCDA 2PV9B 2V3HH 2C93B 3FN8A 1V6DA 3F2HA 3I29A 1Z8JB 2STBE 1WOFA 5HMAA 1EJMA 3ATIA 5DP6A 1GVKB 3ZVBA 1FIWA 1P04A 3SNDA 1W7GH 3SN8A 3H7OA 2WPHS 5KEDA 1K1JA 2PUQH 4MPUA 1HAGE 1TX6A 1GMDG 5DP3A 4FVDA 3UWJH 3ZV8A 5GCHF 1ANCA 1GBBA 1WYKA 1YLNA 1D3QB 2XW9A 1GWAA 5T6FA 1TOCB 3T26A 8ESTE 1C5UA 1LVMA 3QGJA 1BA8B 3H5CB 3T2NA 1S0RA 2VH6A 1O3GA 2O8TA 7ESTE 1BIOA 1BJVA 2VWLA 1T31A 1TRMA 2SGPE 1T32A 3RU4D 1MBMA 1TMTH 4CR9A 4BAMB 1ZPZA 1CBWB 2F9OA 3ZZ9A 2AS9A 2J2UA 2Z3CA 3H7TA 1H4WA 2XNDD 1CO7E 2PP6A 2GT7A 1WAYB 4MNVA 3K6ZA 4J1YA 2Q6GA 4Q80A 4X1RU 2H2ZA 3BIVH 3WWBA 3SZEA 1F0TA 4LK4A 4VGCC 3VEQB 1T8OA 4RT0A 2ZCKP 4ABJA 3LOXA 1PYTC 1MTNB 4XE4A 3I77A 4BAKB 2BY6X 2Z9LA 4Y0ZE 3GOVB 3M5OA 1UW7A 3KQDA 1NRNH 1UHBB 4OM9A 5A8XA 1IQGA 1XXFA 4WH8A 3BTEE 1BQYA 1SKYE 3V0XA 2Z3EA 2WPDD 1S84A 1PPCE 1C1SA 2BD5A 3MU8A 2TRMA 3RMOH 2WPIS 3SV2H 1AB9B 1QTFA 1UHBA 4JYVH 4NZQA 5GJ4B 3RC6A 4JZDH 1HNEE 1E34B 2HVXA 1QL8A 2FYQA 4FOUC 4A5TS 1CA0B 1EQ9A 1O5GH 2FYRA 2TBSA 1C1QA 3DCLA 1OWHA 1UTOA 1O35A 4NA9H 5CMXH 3K65B 8GCHG 3P92A 4D9QA 1ELCA 2A4QA 4MPVA 3A7WA 3QZRA 5EQQA 1PPEE 4NWKA 5FXLA 2JJ2D 3EE0B 3BEUA 1P01A 2AGIX 5FBIA 2O8LA 2C3SA 1SGYE 3EYDA 1FUJA 3MO9A 1SLUB 1GL0E 4NFFA 1S6FA 3DFLA 2GV6A 1AKSB 1WXRA 1O2HA 2ZA5A 3O8BA 1QA7A 3G01A 1SLVB 4AN7A 9LPRA 4ASUD 1GI7B 2G55A 1LQDB 1KXEA 4GHQA 1C2EA 3U98H 1Z6JH 2ZGJA 3SV7A 1AKSA 2OINA 2PW8H 3RU4T 4CHAC 3HGPA 1O2IA 1LVBA 2PHBA 1EFRD 1NFWA 3EQ0H 2EEKA 4DURA 2WUCA 2RG3A 5JDUB 4DCDA 2BY8X 3GCTF 2G4UA 1QA0A 4B6FA 1GBMA 2EI8A 2AIPA 3QN7A 3AAUA 1GL1A 1TABE 3RXDA 2Y5HA 3DFJA 4AFZA 1W11U 2BQWB 4UONA 5EIYA 3RXHA 2W7SA 4IGDA 2AIQA 3RMLH 1EZQA 1J16A 1C5VA 1N6XA 2VIOA 2FOGA 3ATLA 9ESTA 4WMFA 2W3IA 3N7EA 4X1PU 3SHCH 1PPBH 3A85A 2VVUA 1O3NA 1TRYA 1WCZA 3GDVA 1BITA 2WUBA 2FZZA 4R0IA 3M35A 3UFAA 1ESTA 1RIWC 2J98B 3A82A 1O3PB 2XBWA 4X8TH 4TT3D 3SV6A 1WQVH 1UK2A 3AVZA 1OS8A 1OP0A 1SFIA 3OE7D 1YC0A 5A2MH 2ZI2H 1LKAA 1V2NT 5DP5A 1C5MD 4CRFA 2J98A 4XBBA 4X8SH 7LPRA 2OQ5A 1PQ7A 4CR5A 2ANWA 1ZHRA 5C1YA 1TPSA 2R0LA 5EU8A 3F2FA 6LPRA 3HKIB 5DP8A 2XXLA 5DK1A 2BDYA 1TONA 2ODYB 3M5MA 3TH4H 4DVAU 4BNRA 4ZROA 3F9GA 1BTUA 4BANB 3LDXH 3S7KB 4B2AA 3NKKA 1ZMLA 2F4LA 1V2MT 1N1LA 3MU4A 1C2LA 5E2OA 5ETXA 4HG6A 1AUJA 2V35A 2ZWLH 1EAIA 1C5OH 1DT2A 4PROA 2TIOA 2I6QA 2THFB 1BBRK 4YOGA 5C5NA 1O2XA 4UDWH 1Q2WA 4CRGA 3URDA 2BY9X 3F9HA 4MG3A 1C1UH 1O32A 2QXIA 3LJJA 3SNCA 4Q2KA 3RXJA 1JWTA 4IN2A 1MUEB 4K2YA 3RMMH 3STJA 1O2ZA 3ATMA 2SGEE 1IQMA 5C5OA 3BG4B 1GHBG 3RXOA 1ELBA 4FXGH 4I7YH 3HK6B 1BTHH 3ZZBA 1T8NA 2AMQA 4CBOA 1EPTC 1TBRH 2XC4A 3RXCA 3MNXA 3ZZ6A 1F5LA 3F2GA 2W26A 4ABEA 3OTPA 4O03A 5JPMH 3M37A 2ZDKA 3A84A 5A0AE 1P10A 2HRVA 2ANKH 3TJOA 3FP6E 1H9LB 1HJAC 3ZVCA 1MZDA 2BX3A 5F6MA 5LPFA 3OY5U 1SB1H 3ESTA 1YPGH 4AOQA 1DWCH 3CP7A 4B75A 2ZDAH 1AO5A 1PQAA 1K1IA 3PV5A 2OTVA 5C20A 2PSXA 3NUMA 2H5DA 1E79D 1O36A 3UWIA 2CMYA 4NA7A 6CHAC 1WSSH 3DD2H 4IW4E 1BHXB 2C90B 2GDEH 2PFEA 2HPPH 1J9CH 1ELDE 1EZUC 1O38A 3KIDU 1L1GA 1HFDA 1QY6A 1CGHA 1FPCH 1YCPM 2JJ1D 1BMNH 2A4RA 2ZFPH 3A89A 2HNTF 1GG6B 1BUIA 5C94A 3MH7A 1SQAA 3Q3XA 2HNTC 2PGQB 4NIVA 2CF8H 1NESE 5ESBA 5T6DA 2J38A 1S81A 5FHTA 1NU9A 1GI4A 2OC8A 2PGBB 4Z6AH 1TNGA 3RU4E 4OGYA 1QB9A 2ZNKH 1GMDF 4K8BA 2LPRA 3B23B 1KDQB 3RXUA 1LCYA 2P8OC 4NG9H 1TALA 3BSQA 1XMNB 2P3FH 1DWDH 2XBVA 2OQUA 1KXDA 1E37B 1ESBA 4LXBH 4ABAA 2ZHDA 2PKSC 1F92A 1KY9A 3PRDA 4P02A 1D6RA 1NM6A 4K5ZA 2VJ1A 1G3EA 5HKKD 5DGJA 3VXFH 1KDQA 2SGAA 1C5YB 1ABJH 1ELFA 4OS7A 1BJUA 2FI3E 1BMMH 2CHAC 1Z8GA 2OUAA 5JBCS 1HJ9A 3NWUA 3HPTB 4K8YA 1HRTH 1HYLA 1SR5C 2JH5D 4A1TA 1C9PA 1Y3VA 1ZJDA 4OGXA 2FTMA 5E2PA 3V13A 3BIUH 2Z6BD 3KNXA 1UCYH 3GY4A 2YMSD 4BXSA 5GPIB 2FS9A 1FZZA 5CHAB 1P06A 2BYAX 5EXMA 1ZHPA 2QIQA 1D6WA 4ABDA 2KAIB 2O8MA 1MAYA 2ZCHP 1ARBA 1E35B 3M5NA 1O3IA 3T25A 1AFQB 1ZSLA 1G3BA 1KLTA 3W94A 3B8JA 3UB0A 1MTWA 3U8RH 2W5EA 1KTSB 4SGBE 1O2JA 2GKVE 1TQ7B 2KAIA 1P3CA 1SMFE 1XUIA 5A8YA 4ISNA 2GTBA 2BVSH 1YPKH 1K9OE 3QGNB 5JBAS 3BF6H 3AK5A 2W3KA 2QV1A 2BLWA 1DX5M 3QLPH 1C9TA 1HLTH 2OD3B 1SLWB 1RRKA 1C1WH 4F4OC 1UVUH 8GCHF 4UFDH 4A6LA 1W10U 1L2EA 4O3TA 2F91A 1ZPCA 1PPHE 4WXIA 2TPIZ 3GY3A 3LJOA 4ABBA 1GI0A 4AFUA 2BVRH 1SGTA 2YNAA 2QF0A 2HLCA 2FXRA 2YNBA 1TGCA 4RT1A 2P93A 3DT0H 1UVPA 1ZHMA 4Y0YE 1VCQA 3TJUA 2QF3A 4X2VA 3RC5A 2WPLS 5F8ZA 5KECA 1BRAA 3SI3H 2VVCA 1D9IA 4NGAH 1FY3A 2Z9GA 1NN6A 5LPEA 4ZKRU 2Y5FA 1ZTKA 3QTVH 3MU0A 2ZGCA 1VCPA 1CVWH 3PMAB 4WF8A 2PLXA 5EJZA 1UMAH 3L6PA 1DXPA 1C5ZB 2ZPQA 1MKWH 3NCLA 3ZYEA 3Q76A 3Q77A 4YESB 1CA8B 1FI8A 2BTCE 2PSYA 5AFYH 3P17H 2J92A 4TPIZ 4ZHAA 1YCPH 1UVTH 2GZ7A 2H6MA 5L2YH 4BTTB 3M3TA 4R8TB 2A5KA 3U1JB 1AQ7A 2BXTH 4I8LA 2FX4A 1RD3B 1KMHB 1EB2A 4ZXXH 2V7QD 2TGPZ 4K69A 4E7NA 3SU4A 1NPMA 1THPB 2V0BA 4DT7B 3KN2A 2F9PA 2ZECA 1IQEA 3KEEA 1GDQA 3TU7H 4RKJB 3PROA 2OLGA 4YXWD 1TQ0B 4INKA 1IQIA 1TMUH 1W13U 1QBVH 3SQHE 1NRQH 1T7CA 4XOJA 1TGTA 4D9RA 1U6QA 2A7HA 4FETA 4IS5A 2C8WB 3QTOH 1J14A 1QJ7B 1G9IE 1BTXA 1NRRH 4Q7XA 1OWEA 1DDJA 4NIXA 3RXGA 1W0JD 3BG8A 1W0ZU 5FCKA 1TFXA 1QFKH 1DSTA 2SNWA 2XWBI 3AW0A 5GDSH 3S0NA 2J5UA 2G5VA 5L30H 4I86A 1O33A 2BLQA 3W1EA 2Z3DA 3SU0A 3S69A 1O5BB 1QL9A 2CXVA 1P2KA 1W8BH 3UQOA 3RM2H 1CHOG 1QB6A 1TX7A 4BTUB 3Q3KA 3ZZ5A 1E0FD 1FQ3A 2Q6FA 2V3OH 5TCAA 4E7RG 1WBGB 4A1XA 4B73A 2BD2A 3LGWA 1O2SA 2BOHB 5EXLA 1HAOH 4XSKU 4NSYA 2PUXB 1A5IA 1HAYB 3ZZ8A 5HM2A 1O2TA 1C4V2 2PWXA 1GHBF 3LIWA 1P02A 1G30B 3MU1A 4XRNA 5C2ZA 1A0LA 1TWXB 2GMTB 2VGCC 3CS7A 4I8GA 1P03A 2FDAA 2XRCA 5EXNA 1SG8B 2Y80A 1O3FA 2FESH 3MNCA 1BRBE 5DP4A 1G3DA 3M7TA 3CENA 3OU0A 3K6YA 4B1TA 1YF4A 2J95A 4YZUA 1AMHA 2UWLA 1O3DA 3MO3A 2SGDE 2BD3A 1C5NH 4I8KA 3VGCC 1FN6A 5EW2H 3ZZDA 1GGDC 1O3KA 1PPFE 1TOMH 3MO6A 4X6PA 2ZZUH 1SQOA 2B0FA 3E8LA 3PLBA 1S6LA 2D2DA 2EC9H 5DSFA 2ZTXA 2G4TA 1EJNA 1C1RA 4X1SU 3RM0H 3SBKA 1O2UA 2ZHWH 2ZQ1A 2ZDNA 1NRSH 3F9EA 1P9UA 3LPRA 1DFPA 1P0SH 2G52A 4B2BA 1ZTLA 1KXAA 2HGTH 3LH3A 4A92A 2K0QA 3PO1C 5EPYA 1O2QA 3BEFB 1DANH 1C5TA 1BCUH 1F7ZA 1HBTH 1LHGH 1S83A 1NFXA 3ATWA 2CK3D 4SGAE 6GCHG 1HAPH 1P2OA 2FX6A 2OCVB 1SGQE 1GDUA 1ESAA 3H09A 4X0WU 1K22H 1W3CA 2WV9A 5AFZH 1QQ4A 1DY9A 4ISOA 3GICB 3VB5A 4AFQA 4NA8A 1LVOA 2FS8A 4F48B 3DHKH 2RDLA 1ELEE 5AF9H 1E1RD 1SBWA 2G81E 3HK3B 4X1NU 3A7ZA 4LZ1H 1N6YA 2ZFQH 3PLPA 1TNKA 1VGCB 1V2JT 5BPEA 3VXEH 1O5DH 3A7TA 2QXJA 5DP7A 3SU3A 2BOKA 4I8HA 1SGRE 1P2JA 4ZH8A 1UK4A 2QCYA 4GCHG 1O2OA 3EA9A 3LC5A 3PMBB 3A80A 4CHAB 1C5WB 3SU2A 1O3MA 4IBLH 3TITA 3DSPA 1CBWC 2A32A 4BTIB 4ABHA 1H8HD 3FP7E 3BTHE 2BY7X 1DE7H 6ESTA 3OEED 1YY3A 2WYGA 3N7OA 2EI7A 1AU8A 4ZAEA 2R2WU 1WV7H 3ZVFA 2QGRA 3GY5A 4FUEA 5EJ1A 2VINA 2AYWA 1C5SA 1GHZA 1MTNC 4ZCNA 2ANYA 2HOBA 1CT2E 3T5FH 5ABWA 2A4GA 5C1UA 1KYNA 4A1VA 2JETB 4Z0KA 2VIDA 1SL3A 1GBKA 2IJD1 1JOUB 3RXBA 1TRNA 3JZ2B 5DG6A 1A46H 1QR3E 1SGFA 1QBOA 1ZGVA 3O8CA 5FCRA 2F9BH 1UCYK 2FI4E 3UNQA 1AB9C 1O3LA 3P6ZB 4D76A 1ZRBA 3TNTA 1V2PT 1G37A 2GZ8A 3A7VA 4JK5A 3RXSA 1HUTH 1MQ5A 4MLFB 1GCTB 1DICA 4Q7ZA 1LPGB 3K9XB 3KQCA 3SV8A 1O5EH 1ELGA 2R0KA 1UTLM 3TH3H 4Z1MD 2KFWA 2DUCA 3TVJB 1IQHA 2A45B 3SNAA 1JXPA 1AHTH 1VKYA 2BD9A 4OS5A 2YMSB 1Z7KA 1LHEH 1FPHH 1S5SA 3RXKA 1EJAA 3BV9B 4KTSA 2FOEA 1GDNA 1K2I1 3M7QA 4I8JA 1FMGA 3RXEA 1C2HA 1MTVA 3ATKA 2BQ6B 1Y3WA 1MCVA 4X2YA 3T28A 2J9NA 2QF4A 3GY6A 1O3JA 4RN6A 2IOTA 1RTFB 4U32A 3SU5A 2OXSA 1O3EA 4WVPE 3FAOA 1GBAA 4DW2U 3M3VA 1L4ZA 1EOLA 3IG6B 1W14U 2DE9A 2Q6DA 5F53A 2HNTE 4ZMAH 3BEIB 3OTJE 4X2WA 1QJ1B 1YPHC 1EPTB 1UTQA 1TGNA 2K8IA 4K1EA 3ZIAD 4LZ4B 1PQ5A 4K60A 5L6NH 1GJAB 2NU3E 3FOAA 5HM9A 4ACBA 1UK3A 1PYTD 5HIZA 1M9UA 4AORA 1P2QA 2OBOA 1MQ6A 1THSH 2V6NA 1TNLA 3RXPA 3TPIZ 1GHYH 4Q7YA 4YOJA 2WPJS 2QA9E 5TCCA 3MYWA 4YTAA 3BTFE 1VITG 1GJ9B 2NU2E 3V7TA 2XYAA 2ZO3H 1V2UT 4K3JA 3LH1A 2HVYB 5DPAA 3WY8A 1DPOA 2PTNA 1Y8TA 4I33A 1MKWK 3QK1A 1H8DH 1GVLA 5HYOA 3IITA 3ENSB 4HZHA 1Q31A 2GCTB 2ZF0H 1EXFA 2XNIA 3TJNA 1QQUA 1NFUA 1G32B 2WINI 4FVBA 1GI1A 1SQTA 1YCPK 3E0NB 5FPTA 1BTPA 1O3AA 1RJXB 2VWMA 4AYVB 1ETTH 4QT8C 3ZZAA 3PWCA 2FP7B 2J94A 3NZIA 1K1NA 1CGJE 6CHAB 1TE0A 1V3XA 4X6MA 1QHRB 1CT4E 1LMWB 1JRTA 2KCPA 4KTCA 3U8OH 3UAIC 1O3CA 3P70B 3F0PA 4AG1A 1O0DH 1C2IA 3T27A 3DSOA 3W95A 1B5GH 1C2FA 1OP2A 3MWIU 3RLYH 1P12E 1A3BH 3EE7A 3BN9A 2BD8A 3SJIA 3PV2A 1GBIA 3OYPA 5EQRA 2K1QA 3BTME 4ZXYH 5FAHA 3PWBA 4NSVA 3F68H 1CHOF 5T1VA 5JYIA 1V2QT 4AGKA 3HATH 2FODA 1S82A 1AVXA 2P8OB 1A3EH 1F5RA 1IQLA 2SGQE 2L6OA 1O2RA 2WPKS 5FBEA 1C4U2 3GCHB 3MOCA 1BMLA 1AFEH 3PMJA 4UE7H 1D3PB 3A8BA 1QGFA 1MCTA 1FAXA 2G00A 3U1IB 5C0TA 1C2DA 1C2GA 3MQKC 1C5RA 1IQNA 2FTLE 4Y8ZA 1SPJA 1QZ8A 1E1QD 1KXFA 1GJ4H 1TPOA 4FU9A 4K1SA 1EZXC 3HGNA 1PPGE 1GBHA 3TNSA 2P3TB 1ARCA 2ALVA 1GHAG 3AASA 3FO8D 2W6JD 2ZC9H 4AB9A 4U2WA 4NCYA 2BD4A 1FAKH 2BX4A 2ZDVH 2AEIH 2B9LA 1OKXA 4KELA 1AGJA 1C1PA 2BDCA 1BDAA 1C2KA 2ZDLA 1AVWA 3CS0A 1DUEA 1O5FH 1GBJA 1FY8E 4Y6DA 3S9BA 3A8DA 1BRCE 4YT6H 1AUTC 1V2WT 3A7XA 4XFQA 3TIUA 1Y5UT 3D23A 2SNVA 1TNHA 1KXCA 3FP8E 5CHBA 5DO4H 5DJ7A 1P2MA 1TNIA 2EA3A 3SO3A 3RXVA 1LHCH 5B6LA 6GCHF 1L4DA 3RMNH 2FOMB 1IOEA 2FO9A 2ZIQH 4OS1A 2KCAA 1RXPA 3U69H 3ZZCA 1CHGA 1GG6C 2RDEA 5SGAE 1GBDA 2XTTB 4D7FA 1ORFA 1HDTH 2B5TB 5EQSA 1MH0A 3C1KA 1ZSKA 1L1JA 1ELAA 3F1SB 3C27B 1VCWA 3A88A 2BLOA 1GJDB 4INLA 5A0BA 1Y59T 4XD7D 1JIRA 3UR9A 2G51A 4WMEA 1QJ6B 2D1JA 1YBWA 4FUJA 1MAXA 4ABGA 4CRBA 3VB7A 2Z9KA 1TGSZ 4ISIH 1C1OA 2TGAA 1KLJH 2FOCA 4YLUA 3F6UH 4GCHF 2VVVA 3EA8A 2C8XB 2DE8A 2ALPA 2BHGA 1T4VH 4GHTA 3OSYA 5C0UA 3GCTG 3RC4A 1J15A 2VIVA 1P57B 3E3TA 2WV4A 1GHXH 4UEHH 1CT0E 2FIRH 1N8OB 5LH8A 3TGIE 1QNJA 1H1BA 1HIAB 1Z1IA 3GDUA 1SGFG 4X1QU 3SNBA 1J17T 2BY5X 1BBRE 4JZEH 3DUXH 1Z8RA 5GXPA 1TPAE 1GMHG 3PYHA 3SJOA 2ZCLP 4JZ1A 3UNRA 1O30A 1AIXH 1P9SA 1G36A 1MABB 2VWOA 4MTBA 2V3MA 2PKAB 3QUMP 4YLQH 2NU1E 1NT1A 2Z9IA 1ETRH 2NU4E 2ZFRH 2ZU3A 1AY6H 2W7UA 1VITH 4HGCA 1OYQA 2HPQH 2JH6D 2O9QA 2Z9JA 1XUKA 1OSSA 1DOJA 1F2SE 1GJ8B 2ZU4A 4OS6A 1C2JA 2F9UA 1IHSH 3P95A 1FY1A 1UO6A 1F0UA 1YM0A 1F0RA 1PQ8A 4DIIH 5C67A 4B2CA 1ANEA 3MH4A 4JMYA 1O2NA 1OWIA 1V2RT 1WDIA 1KSNA 1ZLRA 1ELTA 2ESTE 4IC6A 4CH8B 2ILNA 1EAWA 8KME2 2LNCA 1L0ZA 1X7AC 1VZQH 2H9EH 1O2YA 5JBTA 4FUCA 4AB8A 1ELVA 1NS3A 2BMGB 3L33A 2Y5GA 4K1TA 4KTUA 3SUFA 4F55A 1HAIH 2GJGA 1G3CA 3QZQA 3R3GB 1YWUA 1W2KH 5EGMA 3E90B 4RI0A 3BTDE 2VIQA 2FMJA 4DIHH 5PTPA 1AWHB 4DG4A 1L1NA 1RFNA 1TGBA 4H6TA 2CF9H 4X2XA 1TMBH 2ANMH 1LKBA 1JIMA 2B7DH 2P59A 3LKWA 1OXGA 1VR1H 2QXHA 1FDPA 4Y7BA 1SI5H 3MMGA 2OK5A 1OHHD 1EP5A 1P3EA 2BDHA 4Y11E 1K28D 3V3MA 4MPWA 1MMJN 1TYNA 2A5IA 4B74A 3KYGA 3PV4A 3S7HB 1HPGA 3A8CA 1YPLH 1OWJA 3VB6A 4FUHA 5T3HA 1FY5A 4YM9A 1SLXB 2VGCB 1YP9A 1WU1A 2FWWA 1AWFH 4NIWA 1MD8A 3TK6A 1K0HA 1NFYA 4B6EA 1O2WA 2STAE 3GDSA 3GY2A 1CGIE 2D8WA 1LDTT 4AGJA 1V2OT 1SGCA 1A5HA 1VITF 2A0QB 1XM1A 4HTCH 1WTHD 1QBNA 3FANA 5FL7D 3RDZA 1LPZB 3AW1A 4U01A 1FIZA 2GDDA 3ZVEA 1SGDE 1A5GH 1TNJA 2W6ID 1TA6A 1EB1H 3E1XB 2AFQB 1EKBB 5KGOA 1DS2E 4BOHA 3PTBA 4GSOA 3TGJE 1QRXA 3SGQE 1INCA 3KHVA 3FVFB 2ZHFH 2F3CE 1A61H 2ZKSA 1KIGH 2A31A 2Z94A 2ZTYA 1Y5AT 2Y6TA 5DKMA 3PO1B 4GUXA 2GVFA 1ZR0A 1ACBE 4ZUHA 2IPHA 4AC9A 4ABFA 1KTTB 1C1NA 1O2GH 3D49H 3M36A 3NK8A 2H9HA 4VGCB 3Q3YA 1KLIH 1OYTH 1QRWA 4BAOB 3UQVA 1GI6A 3KQEA 5C17A 3VFEA 2XC5A 1DWBH 1Y3XA 2BQ7B 4AX9H 5C3NA 4AG2A 2BDGA 1OWDA 4MNXA 3M61U 3PTNA 1NROH 1O39A 3B9FH 1MTSA 1MBQA 2AHME 3ODFA 1W7XH 3E0PB 3NPSA 4HFPB 3BTTE 3LC3A 2RA0A 1HB0B 1O2LA 3OX7U 1AZ8A 4TPYA 5EW1H 2M5TA 3ITIA 1ZMJA 2P3UB 3LT3A 1XUFA 2AH4X 1SSXA 4M7GA 3ZVDA 4YOIA 1O31A 3RXIA 1MU8B 1YGCH 3KL6A 2Q1JA 5H4IB 2WSSD 4Y76A 4DOQA 2KCYA 2NWNA 2O8WA 1GI8B 2XBYA 3U9AH 2OBQA 2ZFFH 2ODPA 4FU8A 3R0FA 2UUJB 3V12A 2GMTC 2FOBA 3LONA 4KP0A 7GCHG 3E91A 4J2YB 1T8LA 4FUBA 1ZZZA 1C1MA 2BDIA 1FXYA 1H8ED 3U28C 2GZ9A 4Y79A 1QL7A 2QE7D 2M2AA 2ZHQH 3JZ1B 4XBDA 4MPXA 1SVPA 2A1DB 2ZU1A 1JMOH 2B8OH 1GHAF 1XXDA 2FOFA 1ZGIA 4ESTE 4DY7B 4MQAA 1RS0A 4JYTA 2KCOA 1AD8H 1RTKA 2FI5E 1SFQB 2GCHG 2GV7A 3RXFA 1J8AA 1YPHE 4RSPA 4THNH 1O3BA 3BTQE 1ABIH 2AGGX 3A81A 2PTCE 5FX6A 1BOQA 1GBTA 3ZZ7A 1GI5A 2J34A 4X8UH 2O8UA 3SOSA 2D26C 2AMPA 3LGYA 1OOKB 3ZVGA 3KQBA 2C8YB 1YLDA 1DY8A 1GMCG 1QURH 5GIBA 1FN8A 1FY4A 3SU6A 1MKXH 2UWOA 4GPGA 1BTYA 1BMAA 3D65E 1JBUH 1RTLA 2Y7ZA 1V2TT 2F43B 2A2XH 1XVMA 3P8OA 1GBCA 5F03A 1WTGH 1QB1A 1SGPE 2CJIA 2ZFSA 3MHWU 3UY9A 1LPKB 4A7IB 3GCNA 1Y5BT 5L2ZH 1P09A 4DGJA 2FLRH 1RIWB 2FOHA 2ZGBH 3IWMA 2ZHEH 4UFFH 1D3DB 1UTJA 1DM4B 2QF5A 1K1OA 4LOYH 1AVGH 3QO6A 2WHXA 1O2PA 1TIOA 4YT7H 1GI9B 3L3TA 1YKTA 1VGCC 1XUJA 3OFND 1XUHA 5T6GA 1H8IH 3UIRA 1CA0C 1P05A 4TWWA 2QYIA 5J4QA 4CBNA 1UTMA 1GI2A 1OX1A 2XWAA 3OEHD 4MNWA 3UOPA 2RFKC 1O34A 2IJOB 1A4WH 3GS9A 3SUEA 4IMZA 4D8NA 1OPHB 3P8FA 1BRUP 5ESTE 3SI4H 3UTUH 4Q4LA 1EX3A 3BTGE 2H5CA 3QWCH 1HAVB 4ZKSU 3SZNA 3HKJB 1DLEA 1QCPA 3RXMA 2BDAA 1DUAA 2OC0A 3GY8A 1UTPA 1YPEH 2QY0B 3M3SA 2Y81A 5B6OA 3STIA 1NBMD 4CRCA 1C5XB 1GMHF 1FX0B 3SV9A 1HAVA 7KMEH 1O3HA 2FM2A 3FZZA 2IN2A 4HI3A 2JETC 4B71A 2OC7A 1G2MA 3RP2A 3RXAA 2P95A 2UUFB 1Z1JA 5GWZA 3OAAD 1BMFD 2A5AA 3T62A 3TJVA 1MD7A 1E38B 3SYJA 4JZIA 1EAXA 4XBCA 4Y8XA 1LO6A 3UNSA 3RXLA 3M7UA 3MFJA 2FPZA 1ANBA 1T8MA 1PJPA 4KGAA 3QDZB 3U8TH 1GCTC 1Z6EA 2A7CA 4JZFH 3OY6U 5FX5A 1XVOA 4AYYB 2H9TH 3NRLA 1K1LA 1H9HE 4H6SB 4MVNA 1SOZA 2BXUH 3PLKA 2QN5T 1YPJH 1UVOA 2VIPA 1SHHB 1C5PA 1EPTA 1W0KD 1HGTH 3I78A 4I32A 3RXTA 3ZVAA 3UR6A 2UUYA 1TBZH 2F9VA 2EY4C 4O9VA 4ASHA 2YMSC 1Z8IB 1TPPA 5G4BA 1YPMH 1HJAB 1A0JA 1S85A 5E0GA 5EOKA 4NFEA 4WJG2 3VB4A 2C8ZB 3SJ9A 2ZU5A 2UUKB 2P94A 3A7YA 3A8AA 4TYDA 3VG8A 3UOUA 2ZGHA 1NY22 3LGIA 1NO9H 4IC5A 3T29A 4JK6A 1A7SA 5EJLA 4XDEA 2OC1A 1ZYOA 2LELA 2TGTA 3SU1A 1KXBA 1O2MA 2VB0A 2JH0D 1TX8A 3FKSD 5CDFE 3E6PH 3F9FA 4INHA 2ZDMA 4NIYA 5HIYA 1H9IE 1XUGA 1BZXE 3TK9A 5BRRE 1CE5A 1E36B 3ZZ4A 1C2MA 1HCGA 1O5AB 3GYLB 1FONA 1F0SA 3VB3A 1HV7A 1GBFA 1BTZA 1COWD 4WY3A 1THRH 3ZYDA 2AERH 3TLOA 3SHAH 3LGVA 2P16A 3WWFA 4DT4A 2NU0E 2EQNA 2L74A 1D4PB 5GCHG 1NC6A 2CN0H 2R3UA 3MTYA 1W0YH 3URCA 5I46H 5HXFA 4P00A 1QRZA 4X6NA 1DLKB 2XOKD 2BVXH 2ZEBA 1MU6B 5AVDA 2PKSB 3PMHB 2GX4A 5IK2D 2GCTC 1SHYA 2RCEA 1VJ9U 3BG4C 1NZQH 1SOTA 4CRDA 1GBLA 1ETSH 1V2LT 5A0CA 2A4OA 1ZRKA 3ELAH 4UFEH 1V2VT 2CHAB 2ZU2A 3GY7A 1IQKA 1EP6A 3S9AA 1XKBC 1AE5A 3DA9B 2JKHA 3DSGA 2FOAA 4Y10E 5K0HA 2XCFA 5EODA 2BB4A 1OP8A 4TWYA 2QXGA 2RA3A 3MNBA 4ZHLU 1WQSA 1RGQA 3AAVA 2VWNA 3QX5H 3M5LA 3MU5A 4DJZB 2BZAA 1P2NA 4U30A 4O97A 4E05H 1LTOA 4MDSA 1LHFH 2R9PA 1IHTH 1XX9A 4AZ2B 3RXQA 5EPNA 2SGFE 2ZP0H 2AGEX 1JRSA 5DP9A 5FPYA 3TK5A 1P11E 1UCYE 1MZAA 3EAJA 3RLWH 2A2QH 1AN1E 1D3TB 4FU7A 3CNRA 2CGAA 1HAXB 1SGNE 3SUDA 2GP9B 3MH6A 2WYJA 1Y3UA 3PM3A 3P8GA 1BHXF 1NU7B 1SC8U 1TAWA 4JCNA 3GCHC 4WMDA 2BD7A 1C4Y2 1A0HB 1O37A 2HLDD 1UJ1A 1TB6H 1FNIA 1SQRA 2XBXA 3KCGH 4X8VH 2ZTZA 2VIWA 1G2LA 1ZMNA 2TGDA 3GYMA 4BXWA 1GBEA 2VU8E 4H4FA 5E0JA 7GCHF 2YOLA 1DITH 1TA2A 3A87A 2AMDA 2ODQA 4MNYA 3SGAE 2ASUB 1HJ8A 4BAHB 2A7JA 2WPMS 4D7GA 2BZ6H 2HALA 1C1VH 3SUGA 4TY6A 2BDBA 2KZ4A 1C5LH 1P8VC 1ID5H 1YYY1 2ZQ2A 1S6HA 3Q00A 5J4SA 5F8XA 1C5QA 2GCHF 2JDID 1CSOE 1Z71A 1V2KT 1MTUA 1XKAC 2VBCA 4WH6A 4M9FA 3ZV9A 5JBBS 4ZKNU 4TSFD 1C1TA 1GHWH 1EZSC 2LP6A 1O3OA 3NXPA 1T4UH 3D62A 2FEQH 5K7RA 1HXFH 1UTKA 1GJ5H 1SGEE 1CU1A 4YO9A 1GMCF 4ABIA 3P8NA 5DN6D 3VPKA 4X6OA 1EOJA 4ZKOU 3TH2H 5CHAC 4GLYA 4B76A 3WW7A 2KX4A 1O2VA 2GD4B 3O8RA 3RUOA 3SW2B 1AE8H 1UVSH 1BTWA 4ZHMU 3UPEA 4UD9H 1AFQC 2SFAA 1DVAH 1HAHH 1HIAA 1LQEA 2UWPA 3MNSA 2XCNA 2QAAA 3K2UA 1EUFA 4IN1A 2ZGXH 3SQEE 4CH2B 1UTNA 5FPSA 2Z7FE 5GNDA 1GJ7B 1PPZA 3LGUA 4IMQA 1MKXK 5A09A 1NTPA 1HXEH 4F49A 3UUZA 5JB8S 4GVUA 5A8ZA 2PKAA 2GT8A 4AFSA 1ZJKA 2G8TA 3LU9B 3SJ8A 1GHVH 1CQQA 1GJCB 2ZPRA 3F0OA 2F9NA 4Q63A 3LGTA 1NBME 2OP9A 1IQJA 1WUNH 3PB1E 3SORA 5AHGH 3TGKE 1BBRH 2BM2A 1ZPBA 3ZZ3A 3GISB 3BTWE 3A86A 2HWLB 5IDKA 3MI4A 2KR7A 1A2CH 2QC2A 2J4IA 1Q3XA 1EASA 1DSUA 5E8EH 1V2ST 1O2KA 2J97A 1N8OC 1FJSA 3S9CA 3KF2A 4CRAA 2EI6A 5C1XA 1GJ6A 2WV5A 1F5KU 1FV9A 1K21H 3E16B 1GI3A 3RXRA 3N99A 4UFGH 2Y7XA 2ZFTA 2H1UA 5I25A 3A83A 2PR3A 1GPZA 4GAWA 4WWYA 1K1MA 1GJBB 2ZG0H 1TLDA 2WZQA 3SNEA 2ULLA 2FLBH 5JB9S 5HGGA 1DXWA 4NZLA 4KKDA 3FZDA 4FUGA 1IQFA 4BAQB 1B0EA 4O3UA 4TY7A 5CE1A 3SGBE 1ZTJA 2G5NA 1QIXB 1ANDA 1IAUA 2KM0A 1BT7A 1OWKA 4FUFA 1BB0B 4OS2A 3BTKE 2BLVA 2C4FH 3N7DA 3O8DA 2VH0A
chains in the Genus database with same CATH topology
2GGVB 5LGOA 1S0QA 3ODDA 5IYTA 1EAUA 1A1RA 2XC0A 4I31A 2Y82A 4FUIA 1B0FA 4FUDA 8LPRA 5E0HA 2F83A 1P2IA 3VGCB 1ZOMA 1TBQH 1GGDB 1GVZA 2I6SA 5LPRA 3EGKH 4Y7AA 3SJKA 1VJAU 2VNTA 4JYUH 3FFGA 2ZPSA 1W12U 2R3YA 3GCOA 4RKOB 5EG4A 1LHDH 4E06H 1EATA 4OS4A 1Y3YA 4Y71A 3MH5A 4WXVA 4NWLA 2CV3A 1NRPH 1FLEE 1B7XB 1O5CB 4CREA 1ZSJA 1K1PA 1AZZA 3KGPA 3EA7A 1PFXC 4ISLA 4Y8YA 3EDXB 1SGIB 1AI8H 1YLCA 1LVYA 1DWEH 4ISHH 5TJXA 5F8TA 3UREA 2R2MB 1HAZB 4H42U 1GCDA 2PV9B 2V3HH 2C93B 1V6DA 3I29A 1Z8JB 2STBE 1WOFA 5HMAA 1EJMA 3ATIA 5DP6A 1GVKB 3ZVBA 1FIWA 1P04A 3SNDA 1W7GH 3SN8A 3H7OA 2WPHS 1K1JA 2PUQH 4MPUA 1HAGE 1TX6A 1GMDG 5DP3A 4FVDA 3UWJH 3ZV8A 5GCHF 1ANCA 1GBBA 1WYKA 1D3QB 2XW9A 1GWAA 5T6FA 1TOCB 3T26A 8ESTE 1C5UA 1LVMA 3QGJA 1BA8B 3H5CB 3T2NA 1S0RA 2VH6A 1O3GA 2O8TA 7ESTE 1BIOA 1BJVA 2VWLA 1T31A 1TRMA 2SGPE 1T32A 3RU4D 1MBMA 1TMTH 4CR9A 4BAMB 1ZPZA 1CBWB 2F9OA 3ZZ9A 2AS9A 2J2UA 2Z3CA 3H7TA 1H4WA 1CO7E 2GT7A 1WAYB 4MNVA 3K6ZA 4J1YA 2Q6GA 4Q80A 4X1RU 2H2ZA 3BIVH 1F0TA 4LK4A 4VGCC 3VEQB 1T8OA 4ABJA 2ZCKP 3LOXA 1PYTC 1MTNB 4XE4A 3I77A 4BAKB 2BY6X 2Z9LA 4Y0ZE 3GOVB 3M5OA 3KQDA 1NRNH 1UHBB 5A8XA 1IQGA 1XXFA 4WH8A 3BTEE 1BQYA 3V0XA 2Z3EA 1S84A 1PPCE 1C1SA 2BD5A 3MU8A 2TRMA 3RMOH 2WPIS 3SV2H 1AB9B 1QTFA 1UHBA 4JYVH 4NZQA 5GJ4B 3RC6A 4JZDH 1HNEE 1E34B 2HVXA 1QL8A 2FYQA 4A5TS 1CA0B 1EQ9A 1O5GH 2FYRA 2TBSA 1C1QA 1OWHA 1UTOA 1O35A 4NA9H 5CMXH 3K65B 8GCHG 3P92A 4D9QA 1ELCA 2A4QA 4MPVA 3A7WA 3QZRA 5EQQA 1PPEE 4NWKA 5FXLA 3EE0B 3BEUA 1P01A 2AGIX 5FBIA 2O8LA 2C3SA 1SGYE 3EYDA 1FUJA 3MO9A 1SLUB 1GL0E 4NFFA 1S6FA 3DFLA 2GV6A 1AKSB 1O2HA 2ZA5A 3O8BA 1QA7A 3G01A 1SLVB 4AN7A 9LPRA 1GI7B 2G55A 1LQDB 1KXEA 4GHQA 1C2EA 3U98H 1Z6JH 2ZGJA 3SV7A 1AKSA 2OINA 2PW8H 3RU4T 4CHAC 3HGPA 2PHBA 1O2IA 1LVBA 1NFWA 3EQ0H 4DURA 2EEKA 2WUCA 2RG3A 5JDUB 4DCDA 2BY8X 3GCTF 2G4UA 1QA0A 1GBMA 2EI8A 2AIPA 3QN7A 3AAUA 1GL1A 1TABE 3RXDA 2Y5HA 3DFJA 4AFZA 1W11U 2BQWB 4UONA 3RXHA 2W7SA 4IGDA 2AIQA 3RMLH 1EZQA 1J16A 1C5VA 1N6XA 2VIOA 2FOGA 3ATLA 9ESTA 4WMFA 2W3IA 4X1PU 3SHCH 1PPBH 3A85A 2VVUA 1O3NA 1TRYA 1WCZA 3GDVA 1BITA 2WUBA 2FZZA 4R0IA 3M35A 3UFAA 1ESTA 1RIWC 3A82A 1O3PB 2XBWA 4X8TH 3SV6A 1WQVH 1UK2A 3AVZA 1OS8A 1OP0A 1SFIA 1YC0A 5A2MH 2ZI2H 1LKAA 1V2NT 5DP5A 1C5MD 4CRFA 4XBBA 4X8SH 7LPRA 2OQ5A 1PQ7A 4CR5A 2ANWA 1ZHRA 5C1YA 1TPSA 2R0LA 5EU8A 6LPRA 3HKIB 5DP8A 2XXLA 5DK1A 2BDYA 1TONA 2ODYB 3M5MA 3TH4H 4DVAU 4BNRA 4ZROA 3F9GA 1BTUA 4BANB 3LDXH 3S7KB 4B2AA 3NKKA 1ZMLA 1V2MT 1N1LA 3MU4A 1C2LA 5E2OA 5ETXA 1AUJA 2V35A 2ZWLH 1EAIA 1C5OH 1DT2A 4PROA 2TIOA 2I6QA 2THFB 1BBRK 4YOGA 5C5NA 1O2XA 4UDWH 1Q2WA 4CRGA 3URDA 2BY9X 3F9HA 4MG3A 1C1UH 1O32A 2QXIA 3LJJA 3SNCA 4Q2KA 3RXJA 1JWTA 4IN2A 1MUEB 4K2YA 3RMMH 3STJA 1O2ZA 3ATMA 2SGEE 1IQMA 5C5OA 3BG4B 1GHBG 3RXOA 1ELBA 4FXGH 4I7YH 3HK6B 1BTHH 3ZZBA 1T8NA 2AMQA 4CBOA 1EPTC 1TBRH 2XC4A 3RXCA 3MNXA 3ZZ6A 1F5LA 2W26A 4ABEA 4O03A 5JPMH 3M37A 2ZDKA 3A84A 5A0AE 1P10A 2HRVA 2ANKH 3TJOA 3FP6E 1H9LB 1HJAC 3ZVCA 1MZDA 2BX3A 5F6MA 5LPFA 3OY5U 1SB1H 3ESTA 1YPGH 4AOQA 1DWCH 3CP7A 4B75A 2ZDAH 1AO5A 1PQAA 1K1IA 2OTVA 5C20A 2PSXA 3NUMA 2H5DA 1O36A 3UWIA 2CMYA 4NA7A 6CHAC 1WSSH 3DD2H 4IW4E 1BHXB 2C90B 2GDEH 2PFEA 2HPPH 1J9CH 1ELDE 1EZUC 1O38A 3KIDU 1L1GA 1HFDA 1QY6A 1CGHA 1FPCH 1YCPM 1BMNH 2A4RA 2ZFPH 3A89A 2HNTF 1GG6B 1BUIA 3MH7A 1SQAA 3Q3XA 2HNTC 2PGQB 4NIVA 2CF8H 1NESE 5ESBA 5T6DA 2J38A 1S81A 5FHTA 1NU9A 1GI4A 2OC8A 2PGBB 4Z6AH 1TNGA 3RU4E 4OGYA 1QB9A 2ZNKH 1GMDF 4K8BA 2LPRA 3B23B 1KDQB 3RXUA 1LCYA 2P8OC 4NG9H 1TALA 3BSQA 1XMNB 2P3FH 1DWDH 2XBVA 2OQUA 1KXDA 1E37B 1ESBA 4LXBH 4ABAA 2ZHDA 2PKSC 1F92A 1KY9A 1D6RA 1NM6A 4K5ZA 2VJ1A 1G3EA 5DGJA 3VXFH 1KDQA 2SGAA 1C5YB 1ABJH 1ELFA 4OS7A 1BJUA 2FI3E 1BMMH 2CHAC 1Z8GA 2OUAA 5JBCS 1HJ9A 3NWUA 3HPTB 4K8YA 1HRTH 1HYLA 1SR5C 2JH5D 4A1TA 1C9PA 1Y3VA 1ZJDA 4OGXA 2FTMA 5E2PA 3V13A 3BIUH 2Z6BD 3KNXA 1UCYH 3GY4A 4BXSA 5GPIB 2FS9A 1FZZA 5CHAB 1P06A 2BYAX 5EXMA 1ZHPA 2QIQA 1D6WA 4ABDA 2KAIB 2O8MA 1MAYA 2ZCHP 1ARBA 1E35B 3M5NA 1O3IA 3T25A 1AFQB 1ZSLA 1G3BA 1KLTA 3W94A 3B8JA 1MTWA 3U8RH 2W5EA 1KTSB 4SGBE 1O2JA 2GKVE 1TQ7B 2KAIA 1P3CA 1SMFE 1XUIA 5A8YA 4ISNA 2GTBA 2BVSH 1YPKH 1K9OE 3QGNB 5JBAS 3BF6H 2W3KA 2QV1A 2BLWA 1DX5M 3QLPH 1C9TA 1HLTH 2OD3B 1SLWB 1RRKA 1C1WH 4F4OC 1UVUH 8GCHF 4UFDH 4A6LA 1W10U 1L2EA 4O3TA 2F91A 1ZPCA 1PPHE 4WXIA 2TPIZ 3GY3A 3LJOA 4ABBA 1GI0A 4AFUA 2BVRH 1SGTA 2YNAA 2QF0A 2HLCA 2FXRA 2YNBA 1TGCA 2P93A 3DT0H 1UVPA 1ZHMA 4Y0YE 1VCQA 3TJUA 2QF3A 4X2VA 3RC5A 2WPLS 5F8ZA 1BRAA 3SI3H 2VVCA 1D9IA 4NGAH 1FY3A 2Z9GA 1NN6A 5LPEA 4ZKRU 2Y5FA 1ZTKA 3QTVH 3MU0A 2ZGCA 1VCPA 1CVWH 3PMAB 4WF8A 2PLXA 1UMAH 3L6PA 1DXPA 1C5ZB 2ZPQA 1MKWH 3NCLA 3ZYEA 3Q76A 3Q77A 4YESB 1CA8B 1FI8A 2BTCE 2PSYA 5AFYH 3P17H 2J92A 4TPIZ 4ZHAA 1YCPH 1UVTH 2GZ7A 2H6MA 5L2YH 4BTTB 3M3TA 4R8TB 2A5KA 3U1JB 1AQ7A 2BXTH 4I8LA 2FX4A 1RD3B 1EB2A 4ZXXH 2TGPZ 4K69A 4E7NA 3SU4A 1NPMA 1THPB 2V0BA 4DT7B 3KN2A 2F9PA 2ZECA 1IQEA 3KEEA 1GDQA 3TU7H 4RKJB 3PROA 2OLGA 1TQ0B 4INKA 1IQIA 1TMUH 1W13U 1QBVH 3SQHE 1NRQH 1T7CA 4XOJA 1TGTA 4D9RA 1U6QA 2A7HA 4IS5A 2C8WB 3QTOH 1J14A 1QJ7B 1G9IE 1BTXA 1NRRH 4Q7XA 1OWEA 1DDJA 4NIXA 3RXGA 3BG8A 1W0ZU 5FCKA 1TFXA 1QFKH 1DSTA 2SNWA 2XWBI 3AW0A 5GDSH 3S0NA 2G5VA 5L30H 1O33A 2BLQA 2Z3DA 3SU0A 3S69A 1O5BB 1QL9A 2CXVA 1P2KA 1W8BH 3UQOA 3RM2H 1CHOG 1QB6A 1TX7A 4BTUB 3Q3KA 3ZZ5A 1E0FD 1FQ3A 2Q6FA 2V3OH 5TCAA 4E7RG 1WBGB 4A1XA 4B73A 2BD2A 3LGWA 1O2SA 2BOHB 5EXLA 1HAOH 4XSKU 4NSYA 2PUXB 1A5IA 1HAYB 3ZZ8A 5HM2A 1O2TA 1C4V2 2PWXA 1GHBF 3LIWA 1P02A 1G30B 3MU1A 5C2ZA 1A0LA 1TWXB 2GMTB 2VGCC 3CS7A 4I8GA 1P03A 2FDAA 2XRCA 5EXNA 1SG8B 2Y80A 1O3FA 2FESH 3MNCA 1BRBE 5DP4A 1G3DA 3M7TA 3CENA 3OU0A 3K6YA 4B1TA 1YF4A 2J95A 4YZUA 1AMHA 2UWLA 1O3DA 3MO3A 2SGDE 2BD3A 1C5NH 4I8KA 3VGCC 1FN6A 5EW2H 3ZZDA 1GGDC 1O3KA 1PPFE 1TOMH 3MO6A 4X6PA 2ZZUH 1SQOA 2B0FA 3E8LA 3PLBA 2D2DA 2EC9H 2ZTXA 2G4TA 1EJNA 1C1RA 4X1SU 3RM0H 3SBKA 1O2UA 2ZHWH 2ZQ1A 2ZDNA 1NRSH 3F9EA 1P9UA 3LPRA 1DFPA 1P0SH 2G52A 4B2BA 1ZTLA 1KXAA 2HGTH 3LH3A 4A92A 3PO1C 5EPYA 1O2QA 3BEFB 1DANH 1C5TA 1BCUH 1F7ZA 1HBTH 1LHGH 1S83A 1NFXA 3ATWA 4SGAE 6GCHG 1HAPH 1P2OA 2FX6A 2OCVB 1SGQE 1GDUA 1ESAA 4X0WU 1K22H 1W3CA 5AFZH 1QQ4A 1DY9A 4ISOA 3GICB 3VB5A 4AFQA 4NA8A 1LVOA 2FS8A 3DHKH 2RDLA 1ELEE 5AF9H 1SBWA 2G81E 3HK3B 4X1NU 3A7ZA 4LZ1H 1N6YA 2ZFQH 3PLPA 1TNKA 1VGCB 1V2JT 5BPEA 3VXEH 1O5DH 3A7TA 2QXJA 5DP7A 3SU3A 2BOKA 4I8HA 1SGRE 1P2JA 4ZH8A 1UK4A 2QCYA 4GCHG 1O2OA 3EA9A 3LC5A 3PMBB 3A80A 4CHAB 1C5WB 3SU2A 1O3MA 4IBLH 3TITA 1CBWC 2A32A 4BTIB 4ABHA 3FP7E 3BTHE 2BY7X 1DE7H 6ESTA 2WYGA 3N7OA 2EI7A 1AU8A 4ZAEA 2R2WU 1WV7H 3ZVFA 2QGRA 3GY5A 4FUEA 2VINA 2AYWA 1C5SA 1GHZA 1MTNC 2ANYA 2HOBA 1CT2E 3T5FH 5ABWA 2A4GA 5C1UA 1KYNA 4A1VA 2JETB 4Z0KA 2VIDA 1SL3A 1GBKA 1JOUB 3RXBA 1TRNA 3JZ2B 5DG6A 1A46H 1QR3E 1SGFA 1QBOA 1ZGVA 3O8CA 5FCRA 2F9BH 1UCYK 2FI4E 3UNQA 1AB9C 1O3LA 3P6ZB 4D76A 1ZRBA 3TNTA 1V2PT 1G37A 2GZ8A 3A7VA 4JK5A 3RXSA 1HUTH 1MQ5A 4MLFB 1GCTB 1DICA 4Q7ZA 1LPGB 3K9XB 3KQCA 3SV8A 1O5EH 1ELGA 2R0KA 1UTLM 3TH3H 2DUCA 3TVJB 1IQHA 2A45B 3SNAA 1JXPA 1AHTH 2BD9A 4OS5A 1Z7KA 1LHEH 1FPHH 1S5SA 3RXKA 1EJAA 3BV9B 4KTSA 2FOEA 1GDNA 1K2I1 3M7QA 4I8JA 1FMGA 3RXEA 1C2HA 1MTVA 3ATKA 2BQ6B 1Y3WA 1MCVA 4X2YA 3T28A 2J9NA 3GY6A 1O3JA 4RN6A 2IOTA 1RTFB 4U32A 3SU5A 2OXSA 1O3EA 4WVPE 3FAOA 1GBAA 4DW2U 3M3VA 1L4ZA 1EOLA 3IG6B 1W14U 2DE9A 2Q6DA 2HNTE 4ZMAH 3BEIB 3OTJE 4X2WA 1QJ1B 1YPHC 1EPTB 1UTQA 1TGNA 4K1EA 4LZ4B 1PQ5A 4K60A 5L6NH 1GJAB 2NU3E 5HM9A 1UK3A 1PYTD 4AORA 1M9UA 1P2QA 2OBOA 1MQ6A 1THSH 2V6NA 1TNLA 3RXPA 3TPIZ 1GHYH 4Q7YA 4YOJA 2WPJS 2QA9E 5TCCA 3MYWA 4YTAA 3BTFE 1VITG 1GJ9B 2NU2E 3V7TA 2XYAA 2ZO3H 1V2UT 4K3JA 3LH1A 5DPAA 3WY8A 1DPOA 2PTNA 1Y8TA 4I33A 1MKWK 3QK1A 1H8DH 1GVLA 5HYOA 3IITA 3ENSB 4HZHA 1Q31A 2GCTB 2ZF0H 1EXFA 2XNIA 3TJNA 1QQUA 1NFUA 1G32B 2WINI 4FVBA 1GI1A 1SQTA 1YCPK 3E0NB 5FPTA 1BTPA 1O3AA 1RJXB 2VWMA 4AYVB 1ETTH 4QT8C 3ZZAA 3PWCA 2FP7B 2J94A