1QY6A

Structue of v8 protease from staphylococcus aureus
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
216
structure length
216
Chain Sequence
VILPNNDRHQITDTTNGHYAPVTYIQVEAPTGTFIASGVVVGKDTLLTNKHVVDATHGDPHALKAFPSAINQDNYPNGGFTAEQITKYSGEGDLAIVKFSPNEQNKHIGEVVKPATMSNNAETQTNQNITVTGYPGDKPVATMWESKGKITYLKGEAMQYDLSTTGGNSGSPVFNEKNEVIGIHWGGVPNEFNGAVFINENVRNFLKQNIEDINFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords serine protease
publication title The structure of a universally employed enzyme: V8 protease from Staphylococcus aureus.
pubmed doi rcsb
molecule tags Protease
total genus 53
structure length 216
sequence length 216
ec nomenclature ec 3.4.21.19: Glutamyl endopeptidase.
pdb deposition date 2003-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qy6A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qy6A02
4NZQA 1O37A 3HATH 2AMPA 4GVUA 5HXFA 2V3HH 3U8RH 1OYQA 1CHOG 2BQ7B 3MO3A 4NCYA 5LGOA 1AFQC 4QT8C 1ZPCA 4R8TB 2Y5HA 1IOEA 1NU9A 1O0DH 1Y5UT 4JYVH 4BANB 4XBBA 5CMXH 3SW2B 2WPJS 1L1NA 1Y3UA 1F0TA 1UVTH 1GJ8B 3MU4A 1K2I1 5A8ZA 5FBEA 4YOIA 1Q3XA 3ODDA 2PWXA 2ZWLH 4ISNA 3JZ2B 2VIDA 2I6SA 3TJUA 1BMAA 2Z94A 2O9QA 2Z9IA 2WUCA 4ISHH 1ANBA 2WPMS 1YCPM 3L6PA 4Y0ZE 1O3EA 2BD7A 3BG4C 4AGKA 4A92A 3UNQA 1XXFA 3QTVH 9LPRA 1DOJA 1CBWB 3ZZDA 1GI6A 1FY3A 3LH3A 1QQ4A 1KY9A 1AKSB 1P57B 1LQDB 3RM2H 1YP9A 2WYJA 4ZMAH 1XUJA 3SBKA 2G52A 4IMQA 2OQUA 5DPAA 4B2BA 1G2MA 1WTGH 2BVXH 4AG2A 1LHGH 1J15A 2OC8A 3AASA 5FCRA 1RGQA 1FV9A 1N1LA 3GY8A 2HRVA 4YO9A 1LO6A 1UTLM 2ZIQH 1C1WH 1ZHPA 1AWHB 4ZUHA 5T3HA 3ZVBA 1HXEH 3MTYA 3A83A 2CJIA 2H5DA 5EQQA 5DP4A 1A5HA 4MQAA 4X1QU 4K2YA 2UWLA 3QTOH 5DK1A 4U32A 4HGCA 3M5MA 4Y0YE 3BEUA 1P9SA 2WINI 3V7TA 3EA8A 2GMTC 3SI3H 4MPWA 1IQGA 3A89A 3DT0H 3F1SB 1GJ9B 1MKXK 1XUFA 5PTPA 1GBJA 5E0HA 1BTHH 2QYIA 1FIZA 3VPKA 1GHZA 3UR6A 1TGNA 1SC8U 1ZSLA 2CF9H 2QC2A 1OX1A 2PV9B 5EPNA 1RJXB 2GT8A 3FP8E 4X6NA 3UR9A 2B5TB 4FUJA 4X1PU 5C1UA 4ZXXH 2RG3A 2FS8A 4AZ2B 3RXOA 3CP7A 1CHGA 1LCYA 3DFJA 4NGAH 2Z9JA 2VVCA 5EU8A 2R0LA 4X2VA 2RA3A 3BTTE 3SOSA 3URDA 1AQ7A 3L3TA 1IHSH 4OGYA 2G4UA 4CHAC 1MTNC 2AERH 1S6FA 3M3VA 4WXIA 1T32A 1Z1JA 1GBLA 3UIRA 1O2RA 1L4ZA 4FVDA 3ATLA 2HPQH 3K9XB 3RXFA 2GZ7A 2SGQE 1RRKA 1W2KH 1ZOMA 1XUKA 1MU6B 2UUFB 3MO9A 1GI9B 1HDTH 1TNIA 2ZCLP 4OS6A 5DP8A 2FP7B 1G3CA 1FPCH 2FI5E 2XW9A 1NY22 1EPTC 1V2JT 2OXSA 3LC5A 3L33A 3RXCA 1VR1H 1WQVH 1FY5A 2YNBA 1KIGH 2XWAA 3P70B 1O35A 1C1SA 3KQDA 2H9HA 4J2YB 4FUCA 3GCTF 3RC5A 2AMQA 1N8OC 2VIOA 4JYTA 1AI8H 1RTKA 4FU9A 4ABIA 3BTME 5EXNA 4ABBA 1A0LA 4K1EA 1YPEH 2ZZUH 3VGCB 1ARCA 1QQUA 1ZTKA 1DSTA 1X7AC 2J34A 4OGXA 4LOYH 1O2SA 2XXLA 1MQ5A 5GPIB 4H6SB 4CRGA 2P59A 4KP0A 3EE0B 1VJ9U 1BMLA 1D3PB 1HB0B 2BY5X 3LGYA 1O33A 4MTBA 2VGCB 1S5SA 2G55A 2QY0B 4CRCA 1F5RA 1V2WT 3BTDE 2BLWA 1DWCH 3M7QA 1L1JA 2XWBI 1KLJH 3ATKA 5FPYA 1SGIB 2GV6A 3VB5A 4B1TA 4RKOB 3D23A 3RMOH 3LGIA 2ODQA 1OP2A 3LU9B 2C8XB 4DG4A 3RC4A 1OYTH 3ENSB 2GKVE 4TYDA 1TX8A 4MLFB 4Y7BA 1IHTH 4X6PA 1Z6EA 4INHA 2ZPQA 2ANMH 4FUFA 4B76A 1P06A 1XUIA 4YESB 3B23B 4UFFH 1KLTA 1O5GH 2VVUA 2NU4E 2XBWA 1MAYA 2NU1E 3MI4A 3ZZBA 1MTSA 3NCLA 1MKWK 1NROH 3RLWH 1G9IE 1S83A 1FY8E 3E0NB 1C1UH 3EA9A 1YPHE 1GBEA 3SUFA 1EJNA 3RXMA 2BY6X 2O8MA 2QF3A 3STIA 3VB7A 1GHVH 1ZTJA 2BY9X 2QXJA 1EAIA 1GJ4H 1THPB 1GWAA 4K1SA 2AGGX 4U2WA 2ZDKA 4LZ4B 3RXTA 2ZGXH 3ZYDA 2UWOA 1ZZZA 1GMHF 5FHTA 2OP9A 1TGSZ 1A0HB 2GCHF 3P8GA 1Y59T 1PQAA 3SNEA 2BD3A 2FXRA 1CSOE 4NA8A 3SJKA 3MO6A 1GCTB 2Z6BD 3W94A 1O2MA 2FEQH 1PFXC 4YM9A 1BA8B 4A1TA 1GBTA 1VITF 2BY7X 4BAOB 2GV7A 2ODYB 3SUGA 2FLRH 1XUGA 3QGJA 1W12U 4CREA 5K7RA 3Q77A 1YPKH 4B73A 3SI4H 1BRCE 3F6UH 3RXLA 4ISOA 1YM0A 1C5LH 1SLXB 2BDHA 1BRAA 3T5FH 2O8WA 3RXKA 1AB9C 3S7HB 2HALA 1GMDF 1KXCA 1XUHA 3K2UA 2BLOA 1C5ZB 1O2NA 1QJ6B 1DT2A 1YLCA 3V0XA 1A46H 4DVAU 1GJ7B 1ZGIA 1FNIA 3TGKE 2ZDAH 6GCHG 2SGEE 2D26C 2ANKH 5EOKA 3RXIA 4Z6AH 1HAZB 7GCHF 3U98H 1PPGE 3TH4H 3NKKA 3BTHE 1BIOA 1EZXC 1SLVB 4R0IA 4YLUA 1Z8RA 3A85A 5C2ZA 3UOUA 1VZQH 2V6NA 2B9LA 1EJAA 3DHKH 2ZGJA 4BTTB 2OQ5A 1HLTH 1DUAA 1O3OA 2D2DA 2A5AA 1H4WA 1TNKA 5L30H 4WMFA 2ZF0H 2FYQA 2VH6A 1GCDA 1JMOH 1N6YA 2BDAA 1GPZA 1PPBH 5BPEA 1TPPA 3KL6A 1KXBA 2HPPH 3TITA 3TJOA 2WPLS 2OC1A 1O34A 1ZPZA 4XDEA 3GCHB 1P09A 5FX6A 4WY3A 1MTUA 1V2TT 3SV2H 3PO1C 1GJ5H 4KTSA 1CHOF 1BTWA 3GY2A 1LMWB 3RXPA 3I29A 2AS9A 2IN2A 1TPSA 2PLXA 3GDSA 1C5YB 4IN1A 1AZ8A 3DFLA 5TCAA 3V13A 1IQIA 4DOQA 1OP8A 4GHTA 4ABFA 2AGEX 2Q6GA 3NUMA 3QGNB 4WH6A 4CR5A 4E7NA 8KME2 2O8TA 3PMBB 4ISIH 4A6LA 1CA0C 2BLQA 1GJ6A 5A8YA 1OP0A 1LHDH 4O9VA 5HM9A 3I77A 1S0RA 3ZZAA 3TNTA 2WUBA 2ZC9H 1C5NH 2A4RA 1EP5A 2J9NA 3RU4D 1FDPA 1C2MA 4CRFA 1RIWB 4DW2U 3LDXH 2F9PA 2C90B 2BVSH 4CBNA 2Z9LA 1YPGH 1BMMH 1FY4A 5C67A 1B0EA 1AIXH 1TMTH 1AMHA 3D49H 2A32A 5IDKA 4MVNA 1QURH 1HIAB 1RFNA 1O5FH 1O5CB 4Q7YA 1P2NA 2PFEA 2OUAA 2RDLA 4H6TA 1O3KA 5C3NA 3T27A 3M35A 1S0QA 1PYTC 2FX4A 4WXVA 3BTEE 5FAHA 3A84A 3ZVGA 4I7YH 1P03A 2P3FH 4Z0KA 2FOGA 1Z8JB 1ZMLA 1DXWA 1OOKB 1EP6A 2ULLA 2Y7ZA 3V3MA 1TRMA 2HNTC 1QY6A 3PWCA 3E0PB 2BOHB 4JK6A 3IITA 1GHAG 4A1XA 5HYOA 3PV4A 4O97A 1QRZA 2P8OC 1HRTH 1NS3A 2PUXB 3ZVAA 2EEKA 1TRYA 2FOMB 2BVRH 2QN5T 1TMUH 1SGCA 2R2WU 4X8UH 1AN1E 1PQ5A 1K21H 5ESBA 7ESTE 3A81A 2BZ6H 1UTOA 3KHVA 2ZDMA 1CT2E 3U8TH 1MAXA 2EI8A 3SU5A 3TLOA 1D6RA 2STAE 5A0AE 3VFEA 3Q3XA 5F8TA 1C1PA 3ZVCA 3U69H 1A3BH 1QBNA 1AVXA 1CGHA 2GCTC 4CRBA 4CRDA 2FMJA 3SGQE 4AYVB 2RCEA 2PSYA 1C5RA 3LGVA 5AF9H 1C5PA 1QL9A 1ANEA 3E8LA 2XTTB 3P8OA 1UHBA 1LVYA 4ABGA 1GJCB 3E3TA 4AB9A 1V2ST 1KSNA 1YPJH 2ZTYA 1ZPBA 3UQVA 4IC6A 4A7IB 5AHGH 1GG6C 2QV1A 5HGGA 1WSSH 1C5UA 1GBAA 1C1RA 2JETB 4D7GA 2G8TA 1TWXB 3UQOA 2FS9A 4I32A 1NO9H 2JH5D 1C5MD 1ZSKA 2Z3CA 4BAHB 5A2MH 1V2RT 4YT7H 2ZHFH 3TK9A 2TRMA 3SO3A 1JWTA 2PGQB 1O2ZA 2M5TA 3E6PH 1O31A 1N6XA 3UOPA 1T8OA 9ESTA 1A1RA 2FIRH 4NIWA 3EA7A 1BZXE 4CR9A 1ZSJA 4IS5A 4ZHMU 1K1MA 1TNJA 2NWNA 1V2PT 1AHTH 3BSQA 1G36A 1BB0B 1GL0E 1TNGA 2B7DH 1EB2A 1QB6A 2GDEH 4VGCC 8LPRA 1E0FD 1QCPA 3TH2H 3U8OH 1FY1A 1TOMH 4Q80A 1O5EH 5F8XA 1LTOA 1DUEA 1QRWA 1GHYH 2Y80A 2BMGB 1RXPA 3JZ1B 5J4QA 1LKAA 3QUMP 1JOUB 4IC5A 4D8NA 1J9CH 1MKXH 3MU0A 1K1OA 5BRRE 2BDYA 5AVDA 5E0JA 3ZZ8A 1BBRK 3H7TA 3RXAA 3ZV9A 1RD3B 4DY7B 2QIQA 3RC6A 3RM0H 3URCA 3U1IB 1NTPA 3DUXH 4I8KA 4U30A 2IPHA 1UJ1A 3DA9B 1TRNA 4ZKSU 1JIMA 4WVPE 1ANCA 1EB1H 1V6DA 1C2JA 2VIWA 3S69A 4ZKRU 1DPOA 1O3PB 2ZU5A 1GJAB 3GICB 2W26A 3FZDA 1C2IA 1C5XB 1VITH 3LJOA 3VB4A 1QB9A 1LHCH 2SNVA 2A4GA 5B6OA 4YZUA 4E05H 6CHAB 1FN8A 4Y11E 2ZPSA 2V35A 1ZJDA 2ZCKP 3RXBA 4JZ1A 1O2JA 2ZQ1A 1TNLA 4AX9H 5EXMA 2VVVA 2Y7XA 3ZZ9A 2A2XH 1EAXA 2A31A 4E7RG 1K22H 2XCFA 2SNWA 3UUZA 2DUCA 3A8BA 1A3EH 2HNTF 5F03A 3KF2A 2BDBA 1H9IE 3UNRA 1SLUB 5ESTE 5C5OA 3P92A 5FPTA 1C5VA 1T4VH 1WQSA 1P10A 1TBQH 3SU2A 1CBWC 1O2VA 5A0CA 1NC6A 3ITIA 4IGDA 1QGFA 1GBDA 1V2NT 2BHGA 5GIBA 2O8UA 3RMLH 2Y5FA 1L2EA 2GMTB 3GOVB 3M5OA 1ETTH 5JBBS 1HAPH 3A7TA 1ABIH 4M7GA 4TY6A 2A7JA 1OKXA 1QTFA 1ZRBA 2NU2E 4Y10E 4AFZA 5EG4A 1Z6JH 1HYLA 1BOQA 2PKSB 4TWWA 3M36A 3SGAE 6GCHF 1NU7B 3ZZ6A 1BRUP 4AYYB 2HGTH 3O8DA 2W5EA 2C8YB 1LPKB 2WV4A 3KN2A 1BDAA 1ELAA 4CHAB 1GJDB 1MTNB 2CHAB 1EATA 1TE0A 4UONA 4DIIH 1QL7A 1QNJA 4Y8ZA 3SU4A 1D4PB 4JZDH 1T31A 2GT7A 1O2PA 4NZLA 3LONA 1DLEA 1G3EA 4B75A 5SGAE 2J94A 1GHBG 3OTJE 2Q6FA 2ZFTA 2SGDE 1MKWH 1P3CA 4KELA 3SU1A 2BD5A 1OWJA 3ZZ7A 1T8LA 2VWMA 2BY8X 3LPRA 3SJIA 2GD4B 3TK6A 1GI7B 3Q3KA 1OS8A 1AY6H 3H7OA 1ESTA 4CBOA 1AO5A 3LJJA 1D3QB 1W0YH 1ACBE 1MCVA 1TBZH 4KGAA 4NIYA 5DKMA 1MCTA 2F3CE 1MTWA 1TALA 1W10U 1KYNA 1ETSH 1SOZA 3SV8A 3ZVDA 4JZIA 1Y3VA 4IW4E 1GHXH 7LPRA 1W8BH 2GP9B 1HAIH 1F7ZA 1SGEE 1VGCB 3K6ZA 2B0FA 3GY4A 1DANH 5EW2H 1ZR0A 4DCDA 1BTUA 1O2TA 3RP2A 2Y82A 2IJOB 1O2YA 4KTCA 2VNTA 1EUFA 1YPMH 3H5CB 1Y5BT 1O2OA 3MU1A 3QN7A 5TJXA 4RKJB 4IBLH 1W13U 3UREA 1SHYA 2ZU3A 4MPUA 1MUEB 1P04A 2ZHWH 1K1JA 1DLKB 1MD8A 2GZ9A 2YOLA 3MYWA 3SJ9A 1DY9A 4UE7H 4BTUB 4X2XA 1PYTD 4BAKB 1HXFH 3A8CA 2G4TA 3HGPA 3WY8A 1Z8IB 1HAXB 3VGCC 4X1RU 1NRSH 1AUTC 2ALPA 1EPTA 3A8AA 4FU7A 1D6WA 1MBMA 1HAYB 4Q7ZA 1TBRH 4I8JA 3HK3B 1P2KA 2VGCC 2K1QA 3ZZCA 1GHAF 2BD4A 2D8WA 3LH1A 1QHRB 2Y6TA 5C1YA 3ELAH 2LPRA 5JYIA 2ZDLA 1BTZA 5T6GA 4WJG2 3S0NA 5DP9A 5DG6A 1UCYK 2VJ1A 3P6ZB 3SUDA 3ZZ3A 5L6NH 2HOBA 5I25A 3TGJE 3LOXA 1QR3E 1YF4A 2FODA 4XBDA 3O8CA 1C2FA 2H9TH 3F9GA 2OTVA 1U6QA 1VJAU 1KLIH 1AVGH 2BOKA 3GY7A 4O3UA 1TAWA 1C5SA 4FXGH 1C1MA 1SLWB 1K1NA 1SB1H 2PKAA 4JZFH 1PPZA 3MH4A 1DXPA 2ZFPH 1QFKH 4IMZA 3UY9A 2WPKS 3F9HA 1IAUA 1CA8B 2FTMA 4ABHA 1O3BA 2G51A 2XNIA 4ZXYH 1KDQB 3TH3H 1VCWA 1ELFA 1XX9A 3HKJB 4B74A 1CU1A 3PYHA 5DJ7A 1ID5H 5T6DA 2TGPZ 1AFEH 1HJAC 3Q3YA 2BD8A 2ZECA 2P95A 1RTLA 3O8RA 1Z8GA 2ZU1A 3RU4E 3OSYA 1CGIE 1TA6A 4GPGA 4XFQA 1GCTC 1GHWH 3UWJH 1O3FA 1OWIA 1SFIA 2FOBA 3RUOA 1V2OT 1UK3A 3SV9A 3GCOA 3F9EA 5DP5A 4XOJA 1BT7A 2EI6A 5JDUB 1M9UA 4HFPB 1O2XA 1KXEA 2CMYA 4O3TA 2ZTXA 1AVWA 4B2CA 1D3TB 1ZYOA 3HPTB 3BTFE 1O2UA 3M61U 4CH2B 4Q2KA 4OS7A 4XBCA 3BTKE 1S85A 3BN9A 1CO7E 4NWKA 3SU6A 1UTMA 4FUDA 1IQLA 2FI4E 1MU8B 4X6MA 2QCYA 2STBE 2XBXA 3ODFA 5E8EH 2PW8H 1KDQA 1WUNH 4X2WA 3UPEA 4E06H 4Y8YA 1GVZA 3FFGA 1AZZA 3F68H 1A2CH 1DWEH 2GZ8A 1T8NA 1XM1A 3LT3A 2LNCA 1SFQB 1THSH 1TGCA 3ATWA 3O8BA 1SGFG 5FXLA 1MMJN 3GYLB 1G3DA 1C5OH 3RXQA 2I6QA 1MBQA 2H6MA 4JK5A 1LHEH 1TABE 2AMDA 2V0BA 2Q6DA 1CVWH 4OS1A 1Z1IA 1OPHB 2GX4A 5L2YH 2Z9GA 1FN6A 1BQYA 1C2DA 1G32B 1YCPK 1UK4A 2AIPA 2ZG0H 5JBCS 1UMAH 1XKBC 1L0ZA 1ELBA 1NFYA 1ELTA 1ARBA 1SGPE 3GCHC 1FONA 1GGDB 3TVJB 1P11E 2ZCHP 3FANA 1F2SE 3MH6A 1ANDA 1KXAA 4XSKU 3EDXB 4WF8A 5JB8S 1TMBH 2ZHQH 3BTWE 1H8IH 2WV5A 5LPRA 1S6HA 3T2NA 1A4WH 4YLQH 3W95A 1ELDE 4WH8A 1P2IA 2FOFA 2SGAA 3KIDU 3MMGA 4D9RA 5C5NA 1C4V2 2XC0A 4NFEA 3BIUH 1IQMA 5EQSA 1KTTB 1O38A 1WOFA 4Y76A 4BTIB 3NPSA 1C5TA 3RU4T 2PGBB 2VH0A 3DD2H 1UO6A 5JB9S 2TGAA 2AIQA 4Y7AA 1LVBA 3TJNA 5CHAB 1DS2E 4AFQA 2J38A 3SJ8A 4UFEH 1UHBB 1RIWC 1GI5A 4BXWA 4NWLA 3SNAA 4ZKNU 1ESBA 4AFUA 3B8JA 1NRQH 2GDDA 2ZI2H 2H2ZA 2R9PA 3M7UA 2PHBA 2F9UA 5DO4H 4FUEA 1SQAA 2QAAA 4X1SU 2ALVA 2H9EH 1O3IA 1FZZA 1ESAA 2SGPE 4K60A 5I46H 2ZFRH 1B0FA 1GI8B 1PPCE 1SGYE 2VWOA 1TFXA 1O3LA 2ZU2A 2BX3A 2CV3A 4DURA 3PMAB 3A82A 3BEIB 1ZJKA 3TK5A 1JIRA 1EAWA 4JYUH 2UWPA 3NZIA 1HAVA 2BQWB 1BBRH 1O2KA 6ESTA 1FXYA 3LKWA 1SR5C 5AFYH 1O2HA 3SV7A 4BAMB 1FI8A 3TU7H 1TPAE 3UFAA 4SGAE 3ATIA 4B71A 1NESE 1O2LA 4K69A 1GHBF 4K3JA 3OU0A 2JH0D 2P3UB 3MWIU 4H4FA 3RLYH 1ORFA 1GG6B 1PJPA 3QDZB 2P93A 4TPYA 1K9OE 1D3DB 1YYY1 1WYKA 3KQEA 1TQ0B 1A5GH 1MH0A 1IQNA 5EQRA 5K0HA 2FOCA 2EC9H 1DICA 1OXGA 1TX6A 2D1JA 1E37B 2VB0A 1SQTA 2ODPA 1JXPA 5F6MA 1OWHA 3HK6B 2VIVA 3SORA 2Z7FE 4AOQA 4YOJA 4TPIZ 4GAWA 3T26A 2BLVA 4AN7A 4O03A 1HUTH 1BJVA 1MTVA 2ZDNA 4BNRA 1GDNA 5GDSH 8ESTE 3P17H 1GMCG 2SFAA 3N7OA 1JRTA 2JETC 1CQQA 4CH8B 1P2OA 2BQ6B 3AW1A 2A1DB 1V2KT 1SGNE 2ZQ2A 3FP7E 3SN8A 2VIQA 3TGIE 1P12E 2ZU4A 2J2UA 2ZHEH 1AE8H 1GI3A 2OC7A 1BITA 1HAHH 3K65B 4RSPA 4X1NU 1RS0A 2OLGA 5A8XA 1FIWA 1DDJA 3OY5U 5JBTA 4SGBE 3T25A 3RXUA 1O39A 2XBYA 2Z3EA 1DE7H 2QXHA 2F83A 2ZHDA 1XMNB 1PPFE 1C4Y2 2C4FH 1QIXB 1Q2WA 1E36B 1TOCB 1AFQB 1F5KU 1TGTA 2QA9E 1BJUA 4ZHLU 1FUJA 1SQOA 1YC0A 1GI0A 2ZGBH 3BEFB 3A80A 4MG3A 4D7FA 4A5TS 1CE5A 3A7XA 2TIOA 1WAYB 1Z7KA 3LGWA 3S9CA 1TGBA 2FX6A 1TQ7B 2KAIB 2PUQH 1T4UH 1TONA 1O2GH 5GWZA 1YPHC 5CE1A 3QWCH 3U9AH 3MH7A 1P02A 3SHCH 1Y3WA 3RXHA 4GCHG 4GSOA 1BTPA 3RXDA 4ABDA 2OD3B 2QXGA 3EGKH 1SSXA 4UD9H 2BTCE 4Y6DA 1AWFH 2FESH 1AD8H 3MNBA 4DIHH 1WTHD 2Q1JA 2XRCA 5GCHG 1HGTH 2R3YA 5LH8A 5EPYA 3BG4B 1EOLA 3RXGA 1C5WB 1J14A 1MZAA 1YKTA 4Y71A 2BXUH 3ZVFA 3SV6A 5A0BA 5HM2A 1PPHE 4FUIA 2R0KA 2GTBA 3PLBA 3E1XB 3Q76A 1GBKA 4OS5A 1EZQA 1DWDH 1B5GH 1SGRE 2IOTA 2Z9KA 3FZZA 2W3KA 2YNAA 1XVMA 2XCNA 1V3XA 1GDQA 2QGRA 4JMYA 3CENA 3TPIZ 2RA0A 1HAOH 3M7TA 1G2LA 1W11U 1DSUA 2A0QB 4TY7A 4X0WU 1BRBE 1O3CA 6CHAC 3LC3A 3BF6H 1QJ1B 3A7WA 2KAIA 3KGPA 4INKA 3TJVA 4ZHAA 2UUJB 4D9QA 4K1TA 1SPJA 2WPIS 4I8HA 4I33A 3FP6E 4ZKOU 3PMHB 1HCGA 1A61H 3M3TA 1HV7A 3KCGH 4ABJA 4Y79A 2BDIA 4ZAEA 3RXEA 1QA0A 1CGJE 1SVPA 5EXLA 5FX5A 5A09A 3PLKA 3VXFH 4K8BA 1S81A 3SHAH 1O5BB 2TGTA 3A88A 1C2KA 1UVUH 3STJA 4INLA 1NFWA 3SGBE 2P16A 4KTUA 1O3JA 3GISB 2NU0E 3KQCA 2OC0A 3AW0A 1ZLRA 2ZFSA 3RXRA 3RXVA 5JPMH 2HNTE 1G30B 3ZZ4A 2B8OH 3RMNH 1V2VT 3OX7U 1EQ9A 2PR3A 3PWBA 2ZFFH 1UTQA 4AORA 2BB4A 3AAUA 2PKSC 1UTKA 2P3TB 4WMDA 1AKSA 5DP7A 5TCCA 3VB3A 4NIXA 2GGVB 2CN0H 2HWLB 1NFXA 2ZNKH 4FUGA 3HGNA 1H9HE 6LPRA 1TX7A 2FI3E 5L2ZH 2FWWA 1INCA 2C8ZB 1ZGVA 1O3GA 1UK2A 3R0FA 3P8NA 1V2QT 2VINA 3BIVH 4X6OA 1UCYH 1QL8A 2BDGA 5GXPA 2FM2A 5C1XA 1F0UA 1WCZA 1YPLH 4NG9H 2CHAC 2CGAA 5F8ZA 1EPTB 2J4IA 3BTGE 1EASA 2G5VA 3AAVA 2FTLE 1IQEA 1SL3A 1W3CA 1O3AA 5E0GA 4HZHA 5DGJA 4MNXA 1RTFB 3ZZ5A 1JBUH 2C3SA 2AGIX 1HFDA 2A4OA 2OCVB 4K5ZA 4NSYA 5C20A 1SHHB 1O2IA 1HAGE 3SUEA 3F9FA 1N8OB 2A2QH 1G3BA 3S9AA 2ZTZA 1MZDA 3CS7A 1XVOA 3E16B 1K1PA 4JZEH 1C1TA 1S84A 1SGTA 1L1GA 4ISLA 4OS4A 5LPEA 1DX5M 2A4QA 1PQ8A 3KEEA 1ELCA 1GI1A 2H1UA 1HJ8A 2XBVA 2ESTE 1BHXF 1K1LA 4MDSA 1UVSH 4BOHA 4K8YA 4GUXA 2C93B 2GVFA 3LGTA 1P8VC 1WBGB 1F5LA 4JCNA 2QXIA 1FMGA 1Y3YA 4GLYA 1C9PA 1VGCC 1C1VH 3LGUA 2PKAB 4LK4A 3GDVA 1NFUA 5T6FA 1TNHA 3GDUA 1S82A 2WPHS 2BD2A 1UTNA 2F91A 1NPMA 2OBQA 2ZA5A 1BBRE 3PTBA 2FPZA 3IWMA 4J1YA 8GCHG 3MU5A 2THFB 1VCQA 2R2MB 3ZV8A 2AFQB 3A7VA 2W7SA 4B2AA 1EX3A 4FUHA 5DP6A 7KMEH 5DP3A 3S9BA 4X8TH 2ZFQH 1O3MA 3SZNA 3NWUA 4ZROA 2UUKB 2WYGA 1H8DH 1GJBB 1IQFA 4DGJA 1FQ3A 1DVAH 1TPOA 5LPFA 1GI4A 2TPIZ 1SGQE 1L4DA 5E2PA 1BTYA 2SGFE 3BG8A 3GY6A 1DM4B 2FO9A 1SMFE 3G01A 2V3OH 3PROA 2FZZA 3KQBA 4AFSA 2DE8A 1EAUA 3SQEE 3M37A 1EZSC 3V12A 1O3HA 3PM3A 1WV7H 5FCKA 3A7ZA 3OY6U 3Q00A 4AB8A 4BAQB 1ZHMA 2C8WB 1Y3XA 1BCUH 2G5NA 1PPEE 5ETXA 1DY8A 1AGJA 4YOGA 4NSVA 1GBCA 1YCPH 4RN6A 5JBAS 1FLEE 2FOHA 1C1NA 1NN6A 1NRNH 1FAKH 4UFDH 3SU3A 4Q7XA 5IYTA 1H9LB 3GY5A 1HJAB 1NRRH 3MFJA 2BYAX 1AE5A 5EODA 1VCPA 3T29A 1W14U 1DFPA 2A7HA 1SOTA 3S7KB 3QLPH 1AB9B 3EAJA 1OWKA 1C1OA 2EA3A 4MNWA 2ZEBA 1UTJA 2UUYA 2TGDA 1OSSA 1GBBA 3C1KA 1CT4E 3MU8A 3UWIA 1P0SH 1UTPA 3MOCA 3PMJA 1Q31A 2PTNA 2A5KA 1QBOA 1D9IA 1GMCF 4FU8A 1BUIA 3MNSA 4FVBA 1GBFA 2A7CA 2PSXA 2ZP0H 2F9BH 1O5AB 1TB6H 4OS2A 3MNCA 1G37A 1QRXA 2HLCA 4KKDA 1GBIA 2Z3DA 4NIVA 2H5CA 4MPVA 1ETRH 2FLBH 3EQ0H 1GL1A 1W7GH 2HVXA 3EYDA 2EI7A 5FPSA 1QA7A 3SNBA 3IG6B 3PLPA 3MHWU 2AEIH 4CRAA 2VWLA 4UFGH 1E38B 1V2LT 3PO1B 1YGCH 1LVMA 5EW1H 1BTXA 4U01A 1DITH 3M5LA 1EZUC 1EOJA 2JKHA 4BXSA 2QF0A 5H4IB 4I8LA 1EJMA 2BXTH 1ELEE 3I78A 4AG1A 1C2GA 1ABJH 3MNXA 5G4BA 1C2HA 1F0RA 1TYNA 1CA0B 4GCHF 1ELVA 2ZGHA 2AYWA 1NM6A 1CT0E 3P8FA 3SNDA 1ZTLA 3LIWA 4ABEA 2F9NA 2A45B 3M5NA 1HJ9A 5GCHF 3E91A 1O30A 2VWNA 1ZMNA 2AH4X 3B9FH 1GI2A 1QJ7B 1ZHRA 3BTQE 1GBMA 3PTNA 2Y5GA 1HBTH 1FPHH 3RXSA 2CXVA 2ASUB 4HTCH 1TIOA 3OYPA 3GCTG 1OWEA 1B7XB 1GGDC 1LQEA 2BX4A 3A87A 1K28D 1O3DA 4MPXA 1IQJA 1THRH 1H1BA 1O2QA 1HAVB 3VEQB 1FAXA 1LVOA 1W0ZU 3QO6A 1QB1A 1J16A 3SU0A 1AUJA 2TBSA 2J92A 1TLDA 4LXBH 2BDCA 3ZVEA 1SGDE 2BD9A 4X2YA 1E34B 1C4U2 3GYMA 3SNCA 4THNH 1P2QA 1LPGB 1E35B 2NU3E 3UTUH 3E90B 1Z71A 4GHQA 2OINA 1P2JA 5FBIA 1T7CA 1P3EA 3A86A 1UVPA 2P8OB 1V2MT 1NZQH 5ABWA 4HI3A 5CHAC 3QK1A 5EGMA 3P95A 2XC5A 5J4SA 3T62A 1IQKA 3MH5A 4I31A 1UVOA 1UCYE 1ELGA 1WU1A 1EKBB 4WWYA 5GJ4B 2F9VA 4WMEA 2OBOA 1P9UA 4A1VA 1O2WA 4NFFA 3VXEH 3TIUA 1GVKB 1SI5H 1C2LA 3AVZA 3ATMA 1GDUA 1Y5AT 4F49A 2GCTB 2ZGCA 1QBVH 3U1JB 2CF8H 1NT1A 3A8DA 1P01A 1SG8B 4NA9H 1C9TA 4ESTE 3GY3A 1KXDA 1YBWA 3KNXA 4LZ1H 1IQHA 4YTAA 1XXDA 1JRSA 1XKAC 1A7SA 1C1QA 1J17T 1GBHA 3R3GB 1C2EA 2VIPA 3D65E 3SQHE 3GCNA 2ILNA 4MNYA 1GMHG 1HIAA 1O36A 1K1IA 2GCHG 4ZH8A 4Y8XA 3ESTA 1AU8A 1J8AA 2F9OA 1SBWA 1O32A 2ANWA 1ZRKA 2P94A 2XC4A 4NA7A 4H42U 4ABAA 1P05A 3RMMH 3RDZA 2XYAA 2ZKSA 3SJOA 3K6YA 1VITG 1KXFA 2FOAA 3NK8A 3T28A 1LKBA 2FYRA 3BV9B 4D76A 2O8LA 4IN2A 1F92A 4X8VH 1EXFA 5AFZH 3M3SA 4MNVA 4UEHH 2FOEA 1GVLA 2G81E 2BM2A 3D62A 3PB1E 4UDWH 3VB6A 1P2MA 1KTSB 1O5DH 1PQ7A 2Y81A 3RXJA 2W7UA 1O3NA 3UNSA 1GMDG 4X8SH 2ZDVH 3QZRA 2ANYA 1W7XH 2VU8E 2W3IA 1HNEE 3A7YA 1OWDA 4ASHA 3HKIB 5E2OA 4VGCB 7GCHG 1LPZB 1Y8TA 1ZMJA 2J95A 1LDTT 4AGJA 4I8GA 2BZAA 4XE4A 4YT6H 3QX5H 1DWBH 3CS0A 1FJSA 4PROA 2DE9A 4FUBA 4F4OC 1BHXB 1YLDA 2ZPRA 2A5IA 4TWYA 3NXPA 1F0SA 3ZYEA 2FDAA 1NRPH 2ZO3H 2G00A 1V2UT 2JH6D 1C5QA 3TNSA 1A0JA 2PTCE 3FAOA 1BMNH 1MD7A 2R3UA 4DT7B 8GCHF 1SGFA 1HPGA 3C27B 1MQ6A 1T8MA 3QZQA 5HMAA 1LHFH 1A5IA 1TA2A 4DJZB 3FVFB
chains in the Genus database with same CATH superfamily
4NZQA 1O37A 3HATH 2AMPA 4GVUA 5HXFA 2V3HH 3U8RH 1OYQA 1CHOG 2BQ7B 3MO3A 4NCYA 3KQ5A 5LGOA 1AFQC 2K8IA 4QT8C 1ZPCA 4R8TB 2Y5HA 1IOEA 1NU9A 1O0DH 1Y5UT 4JYVH 4BANB 4XBBA 5CMXH 3SW2B 2WPJS 1L1NA 1Y3UA 1F0TA 1UVTH 1GJ8B 3MU4A 1K2I1 5A8ZA 5C17A 5FBEA 4YOIA 1Q3XA 3ODDA 2PWXA 2ZWLH 4ISNA 3JZ2B 2VIDA 2I6SA 3TJUA 1BMAA 2Z94A 2O9QA 2WV9A 2WUCA 2Z9IA 4ISHH 1ANBA 2WPMS 1YCPM 3L6PA 4Y0ZE 1O3EA 2BD7A 3BG4C 4AGKA 4A92A 3UNQA 1XXFA 3QTVH 9LPRA 1DOJA 4XRNA 1CBWB 3ZZDA 1GI6A 1FY3A 3LH3A 1QQ4A 1KY9A 1AKSB 1P57B 1LQDB 3RM2H 1YP9A 2WYJA 4ZMAH 1XUJA 3SBKA 2G52A 4IMQA 2OQUA 5DPAA 4B2BA 1G2MA 1WTGH 2BVXH 4AG2A 1LHGH 1J15A 2OC8A 3AASA 5FCRA 1RGQA 1FV9A 1N1LA 3GY8A 2HRVA 4YO9A 1LO6A 1UTLM 2ZIQH 1C1WH 3OE7D 1ZHPA 1AWHB 4ZUHA 5T3HA 3ZVBA 1HXEH 3MTYA 3A83A 2CJIA 2H5DA 5EQQA 5DP4A 1A5HA 4MQAA 4X1QU 4K2YA 2UWLA 3QTOH 5DK1A 4U32A 4HGCA 3M5MA 4Y0YE 1E1QD 3BEUA 1P9SA 3EE7A 2WINI 3V7TA 2KR7A 2V3MA 3EA8A 2GMTC 3SI3H 4MPWA 1IQGA 3A89A 3DT0H 3F1SB 1GJ9B 1MKXK 1XUFA 5PTPA 1GBJA 5E0HA 1BTHH 2QYIA 1FIZA 3VPKA 1GHZA 3UR6A 1TGNA 1SC8U 1ZSLA 2CF9H 2QC2A 1OX1A 2PV9B 1NBME 5EPNA 1RJXB 2GT8A 2J5UA 3FP8E 4X6NA 3UR9A 2B5TB 4FUJA 4X1PU 5C1UA 4ZXXH 2RG3A 2FS8A 4AZ2B 3RXOA 3CP7A 1CHGA 1LCYA 3DFJA 4NGAH 2YMSB 2Z9JA 2VVCA 5EU8A 2R0LA 4X2VA 2RA3A 3BTTE 3SOSA 3URDA 4FOUC 1AQ7A 3L3TA 4B6EA 1IHSH 4OGYA 2G4UA 4CHAC 4Q63A 1MTNC 2AERH 1S6FA 3KYGA 2XOKD 3M3VA 1K0HA 4WXIA 1T32A 1Z1JA 1GBLA 3UIRA 1O2RA 1L4ZA 4FVDA 3ATLA 2HPQH 3K9XB 3RXFA 2GZ7A 2SGQE 1RRKA 1W2KH 1ZOMA 3DSGA 3CNRA 1XUKA 1MU6B 2UUFB 3MO9A 3PRBA 1GI9B 1HDTH 1TNIA 2ZCLP 4OS6A 5DP8A 2FP7B 1G3CA 1FPCH 2FI5E 2XW9A 1NY22 1EPTC 1V2JT 2OXSA 3LC5A 3L33A 1SQRA 3RXCA 1VR1H 1WQVH 1FY5A 2YNBA 1KIGH 2XWAA 3P70B 2OK5A 1O35A 1C1SA 3KQDA 2H9HA 4J2YB 4FUCA 3GCTF 3RC5A 2AMQA 1N8OC 2VIOA 4JYTA 1AI8H 1RTKA 4FU9A 4ABIA 3BTME 5EXNA 4ABBA 1A0LA 4K1EA 1YPEH 2ZZUH 3VGCB 1ARCA 1QQUA 1ZTKA 1DSTA 1X7AC 2J34A 4OGXA 4LOYH 1O2SA 2AHME 1MQ5A 2XXLA 5GPIB 4ACBA 4H6SB 4CRGA 2P59A 4KP0A 3EE0B 3WW7A 1VJ9U 1BMLA 1D3PB 1HB0B 2BY5X 3LGYA 1O33A 4MTBA 2VGCB 1S5SA 2G55A 2QY0B 4CRCA 1F5RA 1V2WT 3BTDE 2BLWA 1DWCH 3M7QA 1MABB 1L1JA 1NBMD 2XWBI 1KLJH 3ATKA 5FPYA 1SGIB 2GV6A 3VB5A 4B1TA 4RKOB 3D23A 3RMOH 3LGIA 2ODQA 1OP2A 3LU9B 2C8XB 4DG4A 3RC4A 1OYTH 3ENSB 2GKVE 4TYDA 1TX8A 4MLFB 4Y7BA 1IHTH 4X6PA 1Z6EA 4INHA 4I86A 2ZPQA 2ANMH 4FUFA 4B76A 1P06A 1XUIA 4YESB 3B23B 4UFFH 1KLTA 1O5GH 2VVUA 2NU4E 2XBWA 1MAYA 2NU1E 3MI4A 3ZZBA 1MTSA 3NCLA 1MKWK 1NROH 3RLWH 1G9IE 1S83A 1FY8E 3E0NB 1C1UH 3EA9A 1YPHE 1GBEA 3SUFA 1EJNA 3RXMA 2BY6X 2O8MA 2QF3A 3STIA 3VB7A 1GHVH 1ZTJA 2BY9X 4ZCNA 2QXJA 4DT4A 1EAIA 1GJ4H 1THPB 2L6OA 2GJGA 1GWAA 4F55A 4K1SA 5B6LA 2AGGX 4U2WA 2ZDKA 4LZ4B 3VG8A 3RXTA 2ZGXH 3ZYDA 2UWOA 1ZZZA 1GMHF 5FHTA 2OP9A 1TGSZ 1A0HB 2GCHF 3P8GA 1Y59T 1PQAA 4RT0A 3SNEA 2BD3A 4RI0A 2FXRA 1CSOE 4NA8A 3SJKA 3MO6A 1GCTB 2Z6BD 3W94A 1O2MA 2FEQH 1PFXC 4YM9A 1BA8B 4A1TA 1GBTA 1VITF 2BY7X 4BAOB 2GV7A 2ODYB 3SUGA 2FLRH 1XUGA 3QGJA 1W12U 4CREA 2EQNA 3Q77A 5K7RA 1YPKH 4B73A 3SI4H 1BRCE 3F6UH 3RXLA 4ISOA 1YM0A 1C5LH 1SLXB 2BDHA 1BRAA 3T5FH 2O8WA 3RXKA 1AB9C 3S7HB 2HALA 1GMDF 1KXCA 1XUHA 3K2UA 2BLOA 1C5ZB 1O2NA 1QJ6B 1DT2A 1YLCA 3V0XA 1A46H 4DVAU 1GJ7B 1ZGIA 1FNIA 3TGKE 2ZDAH 6GCHG 2SGEE 2D26C 2ANKH 5EOKA 3RXIA 4Z6AH 1HAZB 7GCHF 2HVYB 3U98H 1PPGE 3TH4H 3NKKA 3BTHE 1BIOA 1EZXC 1SLVB 4R0IA 4YLUA 3MQKC 1Z8RA 3A85A 5C2ZA 3UOUA 1VZQH 2V6NA 2B9LA 3SZEA 1EJAA 3DHKH 2ZGJA 4BTTB 2OQ5A 1HLTH 1DUAA 1O3OA 2D2DA 4Z1MD 2A5AA 1H4WA 3PV2A 1TNKA 5L30H 4WMFA 2ZF0H 2FYQA 2VH6A 1GCDA 1JMOH 1N6YA 2BDAA 5C94A 1GPZA 1PPBH 5BPEA 1TPPA 3KL6A 1KXBA 2HPPH 3TITA 3TJOA 2WPLS 2OC1A 1O34A 1ZPZA 4XDEA 3GCHB 1P09A 5FX6A 4WY3A 1MTUA 1V2TT 4OM9A 3SV2H 3PO1C 1GJ5H 4KTSA 1CHOF 1BTWA 3GY2A 1LMWB 3RXPA 3I29A 2AS9A 2IN2A 1TPSA 2PLXA 3GDSA 1C5YB 4IN1A 1AZ8A 3DFLA 5TCAA 3V13A 4RT1A 1IQIA 4DOQA 1OP8A 4GHTA 4ABFA 2AGEX 2Q6GA 3NUMA 3QGNB 4WH6A 4CR5A 4E7NA 8KME2 2O8TA 3PMBB 4ISIH 4A6LA 1CA0C 2BLQA 1GJ6A 5A8YA 1OP0A 1LHDH 4O9VA 5HM9A 3I77A 1S0RA 3ZZAA 3TNTA 2WUBA 2ZC9H 1C5NH 1UW7A 2A4RA 1EP5A 2J9NA 3RU4D 1FDPA 3UAIC 5GNDA 1C2MA 4CRFA 1RIWB 4DW2U 3LDXH 2F9PA 2C90B 2BVSH 4CBNA 2Z9LA 1YPGH 1BMMH 1FY4A 5C67A 1B0EA 1AIXH 1TMTH 1AMHA 3D49H 2A32A 5IDKA 4MVNA 1QURH 1HIAB 1RFNA 1O5FH 5CHBA 1O5CB 4Q7YA 1P2NA 2PFEA 2OUAA 2RDLA 4H6TA 1O3KA 5C3NA 3T27A 3M35A 1S0QA 1PYTC 2FX4A 5EIYA 4WXVA 3BTEE 5FAHA 3A84A 3ZVGA 4I7YH 1P03A 2P3FH 4Z0KA 2FOGA 1Z8JB 1ZMLA 1DXWA 1OOKB 1EP6A 2ULLA 2Y7ZA 3V3MA 1TRMA 2HNTC 1QY6A 3PWCA 3E0PB 2BOHB 4JK6A 3IITA 1GHAG 4A1XA 5HYOA 3PV4A 4O97A 1QRZA 3NRLA 2P8OC 1HRTH 1NS3A 2PUXB 3ZVAA 2EEKA 1TRYA 2FOMB 2BVRH 2QN5T 1TMUH 1SGCA 2R2WU 4X8UH 1AN1E 1PQ5A 1K21H 5ESBA 7ESTE 3A81A 2BZ6H 1UTOA 3KHVA 2ZDMA 1CT2E 3U8TH 1MAXA 2EI8A 3SU5A 3TLOA 1D6RA 2STAE 5A0AE 3VFEA 3Q3XA 5F8TA 1C1PA 3ZVCA 3U69H 1A3BH 1QBNA 2EY4C 1AVXA 1CGHA 2GCTC 4CRBA 4CRDA 2FMJA 3SGQE 4AYVB 2RCEA 2PSYA 1C5RA 3LGVA 5AF9H 1C5PA 1QL9A 1ANEA 3E8LA 2XTTB 3P8OA 1UHBA 1LVYA 3OEHD 4ABGA 1GJCB 3E3TA 4AB9A 1V2ST 1KSNA 1YPJH 2ZTYA 1ZPBA 3UQVA 4IC6A 4A7IB 5AHGH 1GG6C 2QV1A 5HGGA 1WSSH 2L74A 1C5UA 1GBAA 1C1RA 2JETB 4D7GA 2G8TA 1TWXB 3UQOA 2FS9A 4I32A 3AK5A 1NO9H 2JH5D 5EJ1A 1C5MD 1ZSKA 2Z3CA 4BAHB 5A2MH 1V2RT 4YT7H 2ZHFH 3TK9A 2TRMA 3SO3A 1JWTA 2PGQB 1O2ZA 2M5TA 3E6PH 1O31A 1N6XA 3UOPA 1T8OA 9ESTA 1A1RA 2FIRH 4NIWA 3EA7A 1BZXE 2K0QA 1ZSJA 4IS5A 4CR9A 4ZHMU 1K1MA 1TNJA 2NWNA 1V2PT 1AHTH 3BSQA 1G36A 2WPDD 5DSFA 1BB0B 1GL0E 1TNGA 2B7DH 1EB2A 1QB6A 2GDEH 4VGCC 8LPRA 1E0FD 1QCPA 3TH2H 3U8OH 1FY1A 1TOMH 4Q80A 1O5EH 5F8XA 1LTOA 1DUEA 1QRWA 1GHYH 2Y80A 2BMGB 1RXPA 3JZ1B 5J4QA 1LKAA 3QUMP 1JOUB 4IC5A 4D8NA 1J9CH 1MKXH 3MU0A 1K1OA 5BRRE 2BDYA 5AVDA 5E0JA 3ZZ8A 1BBRK 3H7TA 3RXAA 3ZV9A 1RD3B 3F0PA 4DY7B 2QIQA 3RC6A 3RM0H 3URCA 3U1IB 1NTPA 3DUXH 4I8KA 4U30A 2IPHA 1UJ1A 3DA9B 1TRNA 4ZKSU 1JIMA 4WVPE 1ANCA 1EB1H 1V6DA 1C2JA 2VIWA 3S69A 4ZKRU 1DPOA 1O3PB 2ZU5A 1GJAB 1KMHB 3GICB 2W26A 3FZDA 1C2IA 1C5XB 1VITH 3LJOA 1WDIA 2W6JD 1QB9A 1LHCH 2SNVA 3VB4A 2A4GA 5B6OA 4YZUA 4E05H 6CHAB 1FN8A 4Y11E 2ZPSA 2V35A 1ZJDA 2ZCKP 3RXBA 4JZ1A 1E1RD 1O2JA 2ZQ1A 1TNLA 4AX9H 5EXMA 2VVVA 2Y7XA 3ZZ9A 4ACAA 2A2XH 1EAXA 2A31A 4E7RG 1K22H 2XCFA 2SNWA 3UUZA 2DUCA 3A8BA 1A3EH 2HNTF 5F03A 3KF2A 2BDBA 1H9IE 3UNRA 1SLUB 5ESTE 5C5OA 3P92A 5FPTA 1C5VA 1T4VH 5KECA 1WQSA 1P10A 1TBQH 3SU2A 1CBWC 1O2VA 5A0CA 1NC6A 3ITIA 4IGDA 1QGFA 1GBDA 2WHXA 1V2NT 2BHGA 5GIBA 2O8UA 3RMLH 2Y5FA 1L2EA 2GMTB 3GOVB 3WWBA 3M5OA 1ETTH 5JBBS 1HAPH 3A7TA 1ABIH 4M7GA 4TY6A 2A7JA 1OKXA 1QTFA 1ZRBA 2NU2E 4Y10E 3F0OA 4AFZA 5EG4A 1Z6JH 1HYLA 1BOQA 2PKSB 4TWWA 3M36A 3SGAE 6GCHF 1NU7B 3ZZ6A 1BRUP 4AYYB 2HGTH 3O8DA 2W5EA 2C8YB 1LPKB 2WV4A 3KN2A 1BDAA 1ELAA 4CHAB 1GJDB 1MTNB 2CHAB 1EATA 1TE0A 4UONA 4DIIH 1QL7A 1QNJA 4Y8ZA 3SU4A 1D4PB 4JZDH 1T31A 2GT7A 1O2PA 4NZLA 3LONA 1DLEA 1G3EA 4B75A 5SGAE 2J94A 1GHBG 3OTJE 2Q6FA 2ZFTA 2SGDE 1MKWH 1P3CA 4KELA 3SU1A 2BD5A 1OWJA 3ZZ7A 1T8LA 2VWMA 4P02A 2BY8X 3LPRA 3SJIA 2YMSC 2GD4B 3TK6A 1GI7B 3Q3KA 1OS8A 1AY6H 3H7OA 1ESTA 4CBOA 1AO5A 3LJJA 1D3QB 1W0YH 1ACBE 1MCVA 1TBZH 4KGAA 4NIYA 5DKMA 3N7EA 1MCTA 2F3CE 1MTWA 3F2GA 1TALA 1W10U 1KYNA 1ETSH 1SOZA 3SV8A 3ZVDA 4JZIA 1Y3VA 4IW4E 1GHXH 7LPRA 1W8BH 2GP9B 1HAIH 1F7ZA 1SGEE 1VGCB 3K6ZA 2B0FA 3GY4A 1DANH 5EW2H 1ZR0A 4DCDA 5EJZA 1BTUA 1O2TA 3RP2A 1YY3A 2Y82A 2IJOB 1O2YA 4KTCA 2VNTA 1EUFA 1YPMH 3H5CB 1Y5BT 1O2OA 3MU1A 3QN7A 5TJXA 3SYJA 4RKJB 4IBLH 1W13U 2W6ID 3UREA 1SHYA 2ZU3A 4MPUA 1MUEB 1P04A 2ZHWH 1K1JA 1DLKB 1MD8A 2GZ9A 2YOLA 3MYWA 3SJ9A 1DY9A 4UE7H 4BTUB 4X2XA 2F43B 1PYTD 4BAKB 1HXFH 3A8CA 2G4TA 3HGPA 1EFRD 3WY8A 1Z8IB 1HAXB 3VGCC 4X1RU 1NRSH 3GS9A 1AUTC 2ALPA 1EPTA 3A8AA 4FU7A 1D6WA 1MBMA 1HAYB 4Q7ZA 1TBRH 4I8JA 3HK3B 1P2KA 2VGCC 2K1QA 3ZZCA 1GHAF 2BD4A 2D8WA 3LH1A 1QHRB 2Y6TA 5C1YA 3ELAH 5DN6D 2LPRA 5JYIA 2ZDLA 1BTZA 5T6GA 4WJG2 3S0NA 5DP9A 5DG6A 1UCYK 2VJ1A 3P6ZB 3SUDA 3ZZ3A 5L6NH 2HOBA 5I25A 3TGJE 3LOXA 1QR3E 1YF4A 2FODA 4XBDA 3O8CA 1C2FA 2H9TH 3F9GA 2OTVA 1U6QA 1VJAU 1KLIH 1AVGH 2BOKA 5CDFE 3GY7A 1SKYE 4O3UA 1TAWA 5KEDA 1C5SA 4FXGH 1C1MA 1SLWB 5KGOA 1K1NA 1SB1H 2PKAA 4JZFH 1PPZA 3MH4A 1DXPA 3N7DA 2ZFPH 1QFKH 4IMZA 3UY9A 2WPKS 3F9HA 1IAUA 1CA8B 2FTMA 4ABHA 1O3BA 2G51A 2XNIA 4ZXYH 3DSPA 1W0JD 1KDQB 3TH3H 1VCWA 1ELFA 1XX9A 3HKJB 4B74A 1CU1A 3PYHA 5DJ7A 1ID5H 5T6DA 2TGPZ 1AFEH 2JJ2D 1HJAC 3Q3YA 2BD8A 2ZECA 2P95A 1RTLA 3O8RA 1Z8GA 2ZU1A 3RU4E 3OSYA 1CGIE 1TA6A 4GPGA 4XFQA 1GCTC 1GHWH 3UWJH 1O3FA 1OWIA 1SFIA 2FOBA 1E79D 3RUOA 1V2OT 1UK3A 3SV9A 3GCOA 2KCAA 3F9EA 5DP5A 4XOJA 1BT7A 2EI6A 5JDUB 1M9UA 4HFPB 2J97A 1O2XA 1KXEA 2CMYA 4O3TA 2ZTXA 1AVWA 4B2CA 1D3TB 1ZYOA 3HPTB 2WZQA 3BTFE 1O2UA 3M61U 4CH2B 4Q2KA 4OS7A 4XBCA 3BTKE 1S85A 3BN9A 1CO7E 4NWKA 3SU6A 1UTMA 4FUDA 1IQLA 2FI4E 1MU8B 4X6MA 3FN8A 2QCYA 2STBE 2XBXA 3ODFA 5E8EH 2PW8H 1KDQA 1WUNH 4X2WA 3UPEA 4E06H 4Y8YA 1GVZA 3FFGA 1AZZA 3F68H 1A2CH 1DWEH 2GZ8A 1T8NA 1XM1A 3LT3A 2LNCA 1SFQB 1THSH 1TGCA 3ATWA 3O8BA 1SGFG 5FXLA 1MMJN 3GYLB 1G3DA 1C5OH 3RXQA 2I6QA 1MBQA 2H6MA 4JK5A 1LHEH 1TABE 2AMDA 2V0BA 4FETA 2Q6DA 1CVWH 4OS1A 1Z1IA 1OPHB 2GX4A 5L2YH 2Z9GA 1FN6A 1BQYA 1C2DA 1G32B 1YCPK 1UK4A 2AIPA 2ZG0H 5JBCS 1UMAH 1XKBC 1L0ZA 4TSFD 1ELBA 1NFYA 1ELTA 1ARBA 1SGPE 3FKSD 3GCHC 1FONA 1GGDB 3TVJB 1P11E 1WXRA 2ZCHP 3FANA 1F2SE 3MH6A 4F48B 1ANDA 1KXAA 4XSKU 3EDXB 4WF8A 5JB8S 1TMBH 2ZHQH 3F2HA 3BTWE 1H8IH 2WV5A 5LPRA 1S6HA 5EJLA 3T2NA 1A4WH 4YLQH 3W95A 1ELDE 4WH8A 1P2IA 2FOFA 2SGAA 3KIDU 3MMGA 4D9RA 5C5NA 1C4V2 2XC0A 4NFEA 3BIUH 1IQMA 5EQSA 1KTTB 1O38A 1WOFA 4Y76A 4BTIB 3NPSA 1C5TA 3RU4T 2PGBB 2VH0A 3DD2H 1H8HD 1UO6A 5JB9S 2TGAA 2AIQA 4B6FA 4Y7AA 1LVBA 3TJNA 5CHAB 1DS2E 4AFQA 2J38A 3SJ8A 4UFEH 1UHBB 1RIWC 1GI5A 4BXWA 2J98A 4NWLA 3SNAA 4ZKNU 1ESBA 4AFUA 3B8JA 1NRQH 2GDDA 2ZI2H 2H2ZA 2R9PA 3M7UA 2PHBA 2F9UA 5DO4H 4FUEA 3KYFA 1SQAA 2QAAA 4X1SU 5FL7D 2ALVA 2H9EH 1O3IA 1FZZA 1ESAA 2SGPE 4K60A 5I46H 3DCLA 2ZFRH 1B0FA 1GI8B 1PPCE 1SGYE 2VWOA 1TFXA 1O3LA 2ZU2A 2BX3A 2CV3A 4DURA 3PMAB 3A82A 3BEIB 1ZJKA 3TK5A 1JIRA 1EAWA 4JYUH 5HKKD 2UWPA 3NZIA 1HAVA 3F2FA 2BQWB 1BBRH 1O2KA 6ESTA 1FXYA 3LKWA 1SR5C 5AFYH 1O2HA 3SV7A 4BAMB 1FI8A 3TU7H 1TPAE 3UFAA 4SGAE 3ATIA 4B71A 1NESE 1O2LA 4K69A 3PRDA 1GHBF 4K3JA 3OU0A 2JH0D 2P3UB 3MWIU 4H4FA 3RLYH 1ORFA 1GG6B 1PJPA 3QDZB 2P93A 4TPYA 1K9OE 1D3DB 1YYY1 1WYKA 3KQEA 1TQ0B 1A5GH 3OTPA 1MH0A 1IQNA 5EQRA 5K0HA 2FOCA 2EC9H 1DICA 1OXGA 1TX6A 2D1JA 1E37B 2VB0A 1SQTA 2ODPA 1JXPA 5F6MA 1OWHA 3HK6B 2VIVA 3SORA 2Z7FE 4AOQA 4YOJA 4TPIZ 4GAWA 3T26A 2BLVA 4AN7A 4O03A 1HUTH 1BJVA 1MTVA 2ZDNA 4BNRA 1GDNA 5GDSH 1VKYA 8ESTE 3P17H 1GMCG 2SFAA 3N7OA 1JRTA 2JETC 1CQQA 4CH8B 1P2OA 2BQ6B 3AW1A 2A1DB 1V2KT 1SGNE 2ZQ2A 3FP7E 3SN8A 2VIQA 3TGIE 1P12E 2ZU4A 2J2UA 2ZHEH 1AE8H 1GI3A 2VBCA 2OC7A 1BITA 1HAHH 3K65B 4RSPA 4X1NU 1RS0A 2OLGA 5A8XA 1FIWA 1DDJA 3OY5U 5JBTA 2LP6A 4SGBE 3T25A 3RXUA 1O39A 2XBYA 2Z3EA 1DE7H 2QXHA 2F83A 2ZHDA 1XMNB 1PPFE 1C4Y2 2C4FH 1QIXB 1Q2WA 1E36B 1TOCB 1AFQB 1F5KU 1TGTA 2QA9E 1BJUA 4ZHLU 1FUJA 1SQOA 1YC0A 1GI0A 2ZGBH 3BEFB 2RFKC 4HG6A 3A80A 4MG3A 4D7FA 4A5TS 1CE5A 3A7XA 2TIOA 1WAYB 1Z7KA 3LGWA 3S9CA 1TGBA 2FX6A 1TQ7B 2KAIB 2PUQH 1T4UH 1TONA 1O2GH 5GWZA 1YPHC 5CE1A 3QWCH 3U9AH 3MH7A 1P02A 3SHCH 1Y3WA 3RXHA 4GCHG 4GSOA 1BTPA 3FOAA 3RXDA 2OD3B 2QXGA 3EGKH 4ABDA 1SSXA 4UD9H 2BTCE 4Y6DA 1AWFH 2FESH 1AD8H 3MNBA 4DIHH 1WTHD 2Q1JA 2XRCA 5GCHG 1HGTH 2R3YA 5LH8A 5EPYA 3BG4B 3OFND 1EOLA 3RXGA 1C5WB 1J14A 1MZAA 1YKTA 4Y71A 2BXUH 3ZVFA 3SV6A 5A0BA 5HM2A 1PPHE 4FUIA 2R0KA 2GTBA 3PLBA 3E1XB 3Q76A 1GBKA 4OS5A 1EZQA 1DWDH 1B5GH 1SGRE 2IOTA 2Z9KA 3FZZA 2W3KA 2YNAA 1XVMA 2XCNA 1V3XA 1GDQA 2QGRA 4JMYA 3CENA 3TPIZ 2RA0A 1HAOH 3M7TA 1G2LA 1W11U 1DSUA 2A0QB 4TY7A 4X0WU 1BRBE 1O3CA 6CHAC 3LC3A 3BF6H 1QJ1B 5C0UA 3A7WA 2KAIA 3KGPA 4INKA 3TJVA 4ZHAA 2UUJB 4D9QA 2M2AA 4K1TA 2XNDD 1SPJA 3H09A 2WPIS 4I8HA 4AC9A 4I33A 3FP6E 4ZKOU 2JIZD 3PMHB 1HCGA 1A61H 2CK3D 3M3TA 1HV7A 3KCGH 4ABJA 4Y79A 2BDIA 4ZAEA 3RXEA 1QA0A 1CGJE 1SVPA 5EXLA 5FX5A 5A09A 3PLKA 3VXFH 3OEED 4K8BA 1S81A 3SHAH 1O5BB 2TGTA 3A88A 2KCOA 1C2KA 1UVUH 1YWUA 3STJA 2KCPA 4INLA 1NFWA 3SGBE 2P16A 4KTUA 1O3JA 3GISB 2NU0E 3KQCA 2WSSD 2OC0A 3AW0A 1ZLRA 2ZFSA 3RXRA 3RXVA 5JPMH 2HNTE 1G30B 3ZZ4A 2B8OH 3RMNH 1V2VT 3OX7U 1EQ9A 2PR3A 3PWBA 2ZFFH 1UTQA 4AORA 2BB4A 3AAUA 2PKSC 1UTKA 2P3TB 4WMDA 1AKSA 5DP7A 5TCCA 3VB3A 2PP6A 4NIXA 2GGVB 2CN0H 2HWLB 1NFXA 2ZNKH 4FUGA 3HGNA 1H9HE 6LPRA 1TX7A 2FI3E 5L2ZH 2FWWA 1INCA 2C8ZB 1ZGVA 1O3GA 1UK2A 3R0FA 3P8NA 1V2QT 2VINA 3BIVH 4X6OA 2KCYA 1UCYH 1QL8A 2BDGA 5GXPA 2FM2A 5C1XA 1F0UA 1WCZA 1YPLH 4NG9H 2CHAC 2CGAA 5F8ZA 1EPTB 2J4IA 3BTGE 1EASA 2G5VA 3AAVA 2FTLE 1IQEA 1SL3A 1W3CA 1O3AA 2RDEA 5E0GA 4HZHA 5DGJA 4MNXA 1RTFB 3ZZ5A 1JBUH 2C3SA 2AGIX 1HFDA 2A4OA 2OCVB 4K5ZA 4NSYA 5C20A 1SHHB 1O2IA 1HAGE 3SUEA 3F9FA 3ZIAD 1N8OB 2A2QH 1G3BA 3S9AA 2ZTZA 1MZDA 3CS7A 1FX0B 1XVOA 3E16B 1K1PA 4JZEH 1C1TA 1S84A 1SGTA 1L1GA 4ISLA 4OS4A 5LPEA 1DX5M 2A4QA 1PQ8A 3KEEA 1ELCA 4YXWD 1GI1A 2H1UA 1HJ8A 2XBVA 2ESTE 1BHXF 1K1LA 4MDSA 2IJD1 1UVSH 2JDID 4BOHA 4K8YA 4GUXA 2C93B 2GVFA 3LGTA 1P8VC 1WBGB 1F5LA 4JCNA 2QXIA 1FMGA 1Y3YA 4GLYA 1C9PA 1VGCC 1C1VH 3LGUA 2PKAB 4LK4A 3GDVA 1NFUA 5T6FA 1TNHA 3GDUA 1S82A 2WPHS 2BD2A 3W1EA 1UTNA 2F91A 1NPMA 2OBQA 2ZA5A 1BBRE 3PTBA 2FPZA 3IWMA 4J1YA 8GCHG 3MU5A 5HIZA 2THFB 1VCQA 2R2MB 3ZV8A 2AFQB 3A7VA 2W7SA 2F4LA 4B2AA 1W0KD 1EX3A 4FUHA 5DP6A 7KMEH 1H8ED 5DP3A 3S9BA 4X8TH 2ZFQH 1O3MA 3SZNA 3NWUA 4ZROA 2UUKB 2WYGA 1H8DH 1GJBB 1IQFA 4DGJA 1FQ3A 1DVAH 1TPOA 5LPFA 1GI4A 2TPIZ 1SGQE 1L4DA 5E2PA 1BTYA 2SGFE 3BG8A 3GY6A 5C0TA 1DM4B 3F3BA 2FO9A 1SMFE 3G01A 2V3OH 3PROA 2FZZA 3KQBA 4AFSA 2DE8A 1EAUA 3SQEE 3M37A 1EZSC 1S6LA 3V12A 1O3HA 3PM3A 1WV7H 5FCKA 3A7ZA 3OY6U 3Q00A 4AB8A 4BAQB 1ZHMA 2C8WB 1Y3XA 1BCUH 2G5NA 1PPEE 5ETXA 1DY8A 1AGJA 3DSOA 4YOGA 4NSVA 1GBCA 1YCPH 4RN6A 5JBAS 1FLEE 2FOHA 1C1NA 1NN6A 1NRNH 1FAKH 4UFDH 3SU3A 4Q7XA 4TT3D 5IYTA 1H9LB 3GY5A 1HJAB 1NRRH 3MFJA 2BYAX 1AE5A 5EODA 2QF4A 1VCPA 3T29A 1W14U 1DFPA 2A7HA 1SOTA 3S7KB 3QLPH 1AB9B 3EAJA 1OWKA 1C1OA 2EA3A 4MNWA 2ZEBA 1UTJA 2UUYA 2TGDA 1OSSA 1GBBA 3C1KA 1CT4E 3MU8A 3UWIA 1P0SH 1UTPA 3MOCA 3PMJA 1BMFD 1Q31A 2PTNA 2A5KA 1QBOA 1D9IA 1GMCF 4FU8A 1BUIA 2LELA 3MNSA 4FVBA 1GBFA 1QZ8A 2A7CA 2PSXA 2ZP0H 2F9BH 1O5AB 1TB6H 4OS2A 3MNCA 1G37A 1QRXA 2HLCA 4KKDA 1GBIA 2Z3DA 4NIVA 2H5CA 4MPVA 1ETRH 2FLBH 3EQ0H 1GL1A 1W7GH 2HVXA 3EYDA 2EI7A 5FPSA 1QA7A 3SNBA 3IG6B 3PLPA 3MHWU 3PV5A 2AEIH 4CRAA 3U28C 2VWLA 4UFGH 1E38B 1V2LT 3PO1B 1YGCH 1LVMA 5EW1H 1BTXA 4U01A 1DITH 3FO8D 3M5LA 1EZUC 1EOJA 2JKHA 2V7QD 4BXSA 2QF0A 5H4IB 4I8LA 1EJMA 2BXTH 1ELEE 3I78A 4AG1A 1C2GA 1ABJH 3MNXA 5G4BA 2J98B 1C2HA 1F0RA 1TYNA 1CA0B 4GCHF 1ELVA 2ZGHA 2AYWA 1NM6A 1CT0E 3P8FA 3SNDA 1COWD 1ZTLA 3LIWA 4ABEA 2F9NA 2A45B 3M5NA 1HJ9A 3OAAD 5GCHF 3E91A 1O30A 2VWNA 1ZMNA 2AH4X 3B9FH 1GI2A 1QJ7B 1ZHRA 3BTQE 1GBMA 4XD7D 3PTNA 2KM0A 2Y5GA 1HBTH 1FPHH 5T1VA 3RXSA 2CXVA 2ASUB 4HTCH 1TIOA 3OYPA 3GCTG 1OWEA 1B7XB 1GGDC 1LQEA 2BX4A 3A87A 1K28D 1O3DA 4MPXA 1IQJA 1THRH 1H1BA 1O2QA 1HAVB 3VEQB 1FAXA 5F53A 4M9FA 1LVOA 1W0ZU 3QO6A 1QB1A 1J16A 3SU0A 1AUJA 2TBSA 2J92A 1TLDA 1YLNA 4LXBH 2BDCA 3ZVEA 1SGDE 2BD9A 4X2YA 1E34B 1C4U2 3GYMA 3SNCA 4THNH 1P2QA 1LPGB 1E35B 2NU3E 3UTUH 3E90B 1Z71A 4GHQA 2OINA 1P2JA 5FBIA 1T7CA 1P3EA 3A86A 1UVPA 2P8OB 1V2MT 2JJ1D 1NZQH 5HIYA 5ABWA 2IPQX 4HI3A 5CHAC 3QK1A 4P00A 3P95A 2XC5A 5EGMA 5J4SA 3T62A 1IQKA 3MH5A 4I31A 1UVOA 1UCYE 1ELGA 1WU1A 1EKBB 4WWYA 5GJ4B 2F9VA 4WMEA 2OBOA 1P9UA 4A1VA 1O2WA 4NFFA 3VXEH 3TIUA 1GVKB 1SI5H 1C2LA 3AVZA 3ATMA 1GDUA 1Y5AT 4F49A 2GCTB 2ZGCA 1QBVH 3U1JB 2CF8H 1NT1A 3A8DA 1P01A 1SG8B 4NA9H 1C9TA 4ESTE 3GY3A 1KXDA 1YBWA 3KNXA 4LZ1H 1IQHA 4YTAA 1XXDA 1JRSA 1XKAC 1A7SA 1C1QA 1J17T 1GBHA 3R3GB 1C2EA 2VIPA 2YMSD 2KZ4A 3D65E 3GCNA 3SQHE 2ILNA 4MNYA 1GMHG 5IK2D 1HIAA 1O36A 1K1IA 2GCHG 3UB0A 4ZH8A 4Y8XA 3ESTA 1AU8A 1J8AA 2F9OA 1SBWA 1O32A 2ANWA 1ZRKA 2P94A 3WWFA 2XC4A 4NA7A 4H42U 4ASUD 4ABAA 1P05A 3RMMH 3RDZA 2XYAA 2ZKSA 3SJOA 3K6YA 1VITG 2HLDD 1KXFA 2FOAA 3NK8A 3T28A 1LKBA 2FYRA 3BV9B 4D76A 2O8LA 4IN2A 2KFWA 1F92A 4X8VH 1EXFA 5AFZH 3M3SA 4MNVA 4UEHH 2FOEA 1GVLA 2G81E 2BM2A 3D62A 3PB1E 4UDWH 3VB6A 1P2MA 4Q4LA 1KTSB 1O5DH 1PQ7A 2Y81A 3RXJA 2W7UA 1O3NA 3UNSA 1GMDG 4X8SH 2ZDVH 3QZRA 2ANYA 1W7XH 2VU8E 1OHHD 2W3IA 1HNEE 3A7YA 1OWDA 2QF5A 4ASHA 3HKIB 3N99A 5E2OA 4VGCB 7GCHG 1LPZB 1Y8TA 1ZMJA 2J95A 1LDTT 4AGJA 4I8GA 2QE7D 2BZAA 4XE4A 4YT6H 3QX5H 1DWBH 3CS0A 1FJSA 4PROA 2DE9A 4FUBA 4F4OC 1BHXB 1YLDA 2ZPRA 2A5IA 4TWYA 3NXPA 1F0SA 3ZYEA 2FDAA 1NRPH 2ZO3H 2G00A 1V2UT 2JH6D 1C5QA 3TNSA 1A0JA 2PTCE 3FAOA 1BMNH 1MD7A 2R3UA 4DT7B 8GCHF 1SGFA 1HPGA 3C27B 1MQ6A 1T8MA 3QZQA 5HMAA 1LHFH 2KX4A 1A5IA 1TA2A 4DJZB 3FVFB
chains in the Genus database with same CATH topology
4NZQA 1O37A 3HATH 2AMPA 4GVUA 5HXFA 2V3HH 3U8RH 1OYQA 1CHOG 2BQ7B 3MO3A 4NCYA 5LGOA 1AFQC 4QT8C 1ZPCA 4R8TB 2Y5HA 1IOEA 1NU9A 1O0DH 1Y5UT 4JYVH 4BANB 4XBBA 5CMXH 3SW2B 2WPJS 1L1NA 1Y3UA 1F0TA 1UVTH 1GJ8B 3MU4A 1K2I1 5A8ZA 5FBEA 4YOIA 1Q3XA 3ODDA 2PWXA 2ZWLH 4ISNA 3JZ2B 2VIDA 2I6SA 3TJUA 1BMAA 2Z94A 2O9QA 2Z9IA 2WUCA 4ISHH 1ANBA 2WPMS 1YCPM 3L6PA 4Y0ZE 1O3EA 2BD7A 3BG4C 4AGKA 4A92A 3UNQA 1XXFA 3QTVH 9LPRA 1DOJA 1CBWB 3ZZDA 1GI6A 1FY3A 3LH3A 1QQ4A 1KY9A 1AKSB 1P57B 1LQDB 3RM2H 1YP9A 2WYJA 4ZMAH 1XUJA 3SBKA 2G52A 4IMQA 2OQUA 5DPAA 4B2BA 1G2MA 1WTGH 2BVXH 4AG2A 1LHGH 1J15A 2OC8A 3AASA 5FCRA 1RGQA 1FV9A 1N1LA 3GY8A 2HRVA 4YO9A 1LO6A 1UTLM 2ZIQH 1C1WH 1ZHPA 1AWHB 4ZUHA 5T3HA 3ZVBA 1HXEH 3MTYA 3A83A 2CJIA 2H5DA 5EQQA 5DP4A 1A5HA 4MQAA 4X1QU 4K2YA 2UWLA 3QTOH 5DK1A 4U32A 4HGCA 3M5MA 4Y0YE 3BEUA 1P9SA 2WINI 3V7TA 3EA8A 2GMTC 3SI3H 4MPWA 1IQGA 3A89A 3DT0H 3F1SB 1GJ9B 1MKXK 1XUFA 5PTPA 1GBJA 5E0HA 1BTHH 2QYIA 1FIZA 3VPKA 1GHZA 3UR6A 1TGNA 1SC8U 1ZSLA 2CF9H 2QC2A 1OX1A 2PV9B 5EPNA 1RJXB 2GT8A 3FP8E 4X6NA 3UR9A 2B5TB 4FUJA 4X1PU 5C1UA 4ZXXH 2RG3A 2FS8A 4AZ2B 3RXOA 3CP7A 1CHGA 1LCYA 3DFJA 4NGAH 2Z9JA 2VVCA 5EU8A 2R0LA 4X2VA 2RA3A 3BTTE 3SOSA 3URDA 1AQ7A 3L3TA 1IHSH 4OGYA 2G4UA 4CHAC 1MTNC 2AERH 1S6FA 3M3VA 4WXIA 1T32A 1Z1JA 1GBLA 3UIRA 1O2RA 1L4ZA 4FVDA 3ATLA 2HPQH 3K9XB 3RXFA 2GZ7A 2SGQE 1RRKA 1W2KH 1ZOMA 1XUKA 1MU6B 2UUFB 3MO9A 1GI9B 1HDTH 1TNIA 2ZCLP 4OS6A 5DP8A 2FP7B 1G3CA 1FPCH 2FI5E 2XW9A 1NY22 1EPTC 1V2JT 2OXSA 3LC5A 3L33A 3RXCA 1VR1H 1WQVH 1FY5A 2YNBA 1KIGH 2XWAA 3P70B 1O35A 1C1SA 3KQDA 2H9HA 4J2YB 4FUCA 3GCTF 3RC5A 2AMQA 1N8OC 2VIOA 4JYTA 1AI8H 1RTKA 4FU9A 4ABIA 3BTME 5EXNA 4ABBA 1A0LA 4K1EA 1YPEH 2ZZUH 3VGCB 1ARCA 1QQUA 1ZTKA 1DSTA 1X7AC 2J34A 4OGXA 4LOYH 1O2SA 2XXLA 1MQ5A 5GPIB 4H6SB 4CRGA 2P59A 4KP0A 3EE0B 1VJ9U 1BMLA 1D3PB 1HB0B 2BY5X 3LGYA 1O33A 4MTBA 2VGCB 1S5SA 2G55A 2QY0B 4CRCA 1F5RA 1V2WT 3BTDE 2BLWA 1DWCH 3M7QA 1L1JA 2XWBI 1KLJH 3ATKA 5FPYA 1SGIB 2GV6A 3VB5A 4B1TA 4RKOB 3D23A 3RMOH 3LGIA 2ODQA 1OP2A 3LU9B 2C8XB 4DG4A 3RC4A 1OYTH 3ENSB 2GKVE 4TYDA 1TX8A 4MLFB 4Y7BA 1IHTH 4X6PA 1Z6EA 4INHA 2ZPQA 2ANMH 4FUFA 4B76A 1P06A 1XUIA 4YESB 3B23B 4UFFH 1KLTA 1O5GH 2VVUA 2NU4E 2XBWA 1MAYA 2NU1E 3MI4A 3ZZBA 1MTSA 3NCLA 1MKWK 1NROH 3RLWH 1G9IE 1S83A 1FY8E 3E0NB 1C1UH 3EA9A 1YPHE 1GBEA 3SUFA 1EJNA 3RXMA 2BY6X 2O8MA 2QF3A 3STIA 3VB7A 1GHVH 1ZTJA 2BY9X 2QXJA 1EAIA 1GJ4H 1THPB 1GWAA 4K1SA 2AGGX 4U2WA 2ZDKA 4LZ4B 3RXTA 2ZGXH 3ZYDA 2UWOA 1ZZZA 1GMHF 5FHTA 2OP9A 1TGSZ 1A0HB 2GCHF 3P8GA 1Y59T 1PQAA 3SNEA 2BD3A 2FXRA 1CSOE 4NA8A 3SJKA 3MO6A 1GCTB 2Z6BD 3W94A 1O2MA 2FEQH 1PFXC 4YM9A 1BA8B 4A1TA 1GBTA 1VITF 2BY7X 4BAOB 2GV7A 2ODYB 3SUGA 2FLRH 1XUGA 3QGJA 1W12U 4CREA 5K7RA 3Q77A 1YPKH 4B73A 3SI4H 1BRCE 3F6UH 3RXLA 4ISOA 1YM0A 1C5LH 1SLXB 2BDHA 1BRAA 3T5FH 2O8WA 3RXKA 1AB9C 3S7HB 2HALA 1GMDF 1KXCA 1XUHA 3K2UA 2BLOA 1C5ZB 1O2NA 1QJ6B 1DT2A 1YLCA 3V0XA 1A46H 4DVAU 1GJ7B 1ZGIA 1FNIA 3TGKE 2ZDAH 6GCHG 2SGEE 2D26C 2ANKH 5EOKA 3RXIA 4Z6AH 1HAZB 7GCHF 3U98H 1PPGE 3TH4H 3NKKA 3BTHE 1BIOA 1EZXC 1SLVB 4R0IA 4YLUA 1Z8RA 3A85A 5C2ZA 3UOUA 1VZQH 2V6NA 2B9LA 1EJAA 3DHKH 2ZGJA 4BTTB 2OQ5A 1HLTH 1DUAA 1O3OA 2D2DA 2A5AA 1H4WA 1TNKA 5L30H 4WMFA 2ZF0H 2FYQA 2VH6A 1GCDA 1JMOH 1N6YA 2BDAA 1GPZA 1PPBH 5BPEA 1TPPA 3KL6A 1KXBA 2HPPH 3TITA 3TJOA 2WPLS 2OC1A 1O34A 1ZPZA 4XDEA 3GCHB 1P09A 5FX6A 4WY3A 1MTUA 1V2TT 3SV2H 3PO1C 1GJ5H 4KTSA 1CHOF 1BTWA 3GY2A 1LMWB 3RXPA 3I29A 2AS9A 2IN2A 1TPSA 2PLXA 3GDSA 1C5YB 4IN1A 1AZ8A 3DFLA 5TCAA 3V13A 1IQIA 4DOQA 1OP8A 4GHTA 4ABFA 2AGEX 2Q6GA 3NUMA 3QGNB 4WH6A 4CR5A 4E7NA 8KME2 2O8TA 3PMBB 4ISIH 4A6LA 1CA0C 2BLQA 1GJ6A 5A8YA 1OP0A 1LHDH 4O9VA 5HM9A 3I77A 1S0RA 3ZZAA 3TNTA 2WUBA 2ZC9H 1C5NH 2A4RA 1EP5A 2J9NA 3RU4D 1FDPA 1C2MA 4CRFA 1RIWB 4DW2U 3LDXH 2F9PA 2C90B 2BVSH 4CBNA 2Z9LA 1YPGH 1BMMH 1FY4A 5C67A 1B0EA 1AIXH 1TMTH 1AMHA 3D49H 2A32A 5IDKA 4MVNA 1QURH 1HIAB 1RFNA 1O5FH 1O5CB 4Q7YA 1P2NA 2PFEA 2OUAA 2RDLA 4H6TA 1O3KA 5C3NA 3T27A 3M35A 1S0QA 1PYTC 2FX4A 4WXVA 3BTEE 5FAHA 3A84A 3ZVGA 4I7YH 1P03A 2P3FH 4Z0KA 2FOGA 1Z8JB 1ZMLA 1DXWA 1OOKB 1EP6A 2ULLA 2Y7ZA 3V3MA 1TRMA 2HNTC 1QY6A 3PWCA 3E0PB 2BOHB 4JK6A 3IITA 1GHAG 4A1XA 5HYOA 3PV4A 4O97A 1QRZA 2P8OC 1HRTH 1NS3A 2PUXB 3ZVAA 2EEKA 1TRYA 2FOMB 2BVRH 2QN5T 1TMUH 1SGCA 2R2WU 4X8UH 1AN1E 1PQ5A 1K21H 5ESBA 7ESTE 3A81A 2BZ6H 1UTOA 3KHVA 2ZDMA 1CT2E 3U8TH 1MAXA 2EI8A 3SU5A 3TLOA 1D6RA 2STAE 5A0AE 3VFEA 3Q3XA 5F8TA 1C1PA 3ZVCA 3U69H 1A3BH 1QBNA 1AVXA 1CGHA 2GCTC 4CRBA 4CRDA 2FMJA 3SGQE 4AYVB 2RCEA 2PSYA 1C5RA 3LGVA 5AF9H 1C5PA 1QL9A 1ANEA 3E8LA 2XTTB 3P8OA 1UHBA 1LVYA 4ABGA 1GJCB 3E3TA 4AB9A 1V2ST 1KSNA 1YPJH 2ZTYA 1ZPBA 3UQVA 4IC6A 4A7IB 5AHGH 1GG6C 2QV1A 5HGGA 1WSSH 1C5UA 1GBAA 1C1RA 2JETB 4D7GA 2G8TA 1TWXB 3UQOA 2FS9A 4I32A 1NO9H 2JH5D 1C5MD 1ZSKA 2Z3CA 4BAHB 5A2MH 1V2RT 4YT7H 2ZHFH 3TK9A 2TRMA 3SO3A 1JWTA 2PGQB 1O2ZA 2M5TA 3E6PH 1O31A 1N6XA 3UOPA 1T8OA 9ESTA 1A1RA 2FIRH 4NIWA 3EA7A 1BZXE 4CR9A 1ZSJA 4IS5A 4ZHMU 1K1MA 1TNJA 2NWNA 1V2PT 1AHTH 3BSQA 1G36A 1BB0B 1GL0E 1TNGA 2B7DH 1EB2A 1QB6A 2GDEH 4VGCC 8LPRA 1E0FD 1QCPA 3TH2H 3U8OH 1FY1A 1TOMH 4Q80A 1O5EH 5F8XA 1LTOA 1DUEA 1QRWA 1GHYH 2Y80A 2BMGB 1RXPA 3JZ1B 5J4QA 1LKAA 3QUMP 1JOUB 4IC5A 4D8NA 1J9CH 1MKXH 3MU0A 1K1OA 5BRRE 2BDYA 5AVDA 5E0JA 3ZZ8A 1BBRK 3H7TA 3RXAA 3ZV9A 1RD3B 4DY7B 2QIQA 3RC6A 3RM0H 3URCA 3U1IB 1NTPA 3DUXH 4I8KA 4U30A 2IPHA 1UJ1A 3DA9B 1TRNA 4ZKSU 1JIMA 4WVPE 1ANCA 1EB1H 1V6DA 1C2JA 2VIWA 3S69A 4ZKRU 1DPOA 1O3PB 2ZU5A 1GJAB 3GICB 2W26A 3FZDA 1C2IA 1C5XB 1VITH 3LJOA 3VB4A 1QB9A 1LHCH 2SNVA 2A4GA 5B6OA 4YZUA 4E05H 6CHAB 1FN8A 4Y11E 2ZPSA 2V35A 1ZJDA 2ZCKP 3RXBA 4JZ1A 1O2JA 2ZQ1A 1TNLA 4AX9H 5EXMA 2VVVA 2Y7XA 3ZZ9A 2A2XH 1EAXA 2A31A 4E7RG 1K22H 2XCFA 2SNWA 3UUZA 2DUCA 3A8BA 1A3EH 2HNTF 5F03A 3KF2A 2BDBA 1H9IE 3UNRA 1SLUB 5ESTE 5C5OA 3P92A 5FPTA 1C5VA 1T4VH 1WQSA 1P10A 1TBQH 3SU2A 1CBWC 1O2VA 5A0CA 1NC6A 3ITIA 4IGDA 1QGFA 1GBDA 1V2NT 2BHGA 5GIBA 2O8UA 3RMLH 2Y5FA 1L2EA 2GMTB 3GOVB 3M5OA 1ETTH 5JBBS 1HAPH 3A7TA 1ABIH 4M7GA 4TY6A 2A7JA 1OKXA 1QTFA 1ZRBA 2NU2E 4Y10E 4AFZA 5EG4A 1Z6JH 1HYLA 1BOQA 2PKSB 4TWWA 3M36A 3SGAE 6GCHF 1NU7B 3ZZ6A 1BRUP 4AYYB 2HGTH 3O8DA 2W5EA 2C8YB 1LPKB 2WV4A 3KN2A 1BDAA 1ELAA 4CHAB 1GJDB 1MTNB 2CHAB 1EATA 1TE0A 4UONA 4DIIH 1QL7A 1QNJA 4Y8ZA 3SU4A 1D4PB 4JZDH 1T31A 2GT7A 1O2PA 4NZLA 3LONA 1DLEA 1G3EA 4B75A 5SGAE 2J94A 1GHBG 3OTJE 2Q6FA 2ZFTA 2SGDE 1MKWH 1P3CA 4KELA 3SU1A 2BD5A 1OWJA 3ZZ7A 1T8LA 2VWMA 2BY8X 3LPRA 3SJIA 2GD4B 3TK6A 1GI7B 3Q3KA 1OS8A 1AY6H 3H7OA 1ESTA 4CBOA 1AO5A 3LJJA 1D3QB 1W0YH 1ACBE 1MCVA 1TBZH 4KGAA 4NIYA 5DKMA 1MCTA 2F3CE 1MTWA 1TALA 1W10U 1KYNA 1ETSH 1SOZA 3SV8A 3ZVDA 4JZIA 1Y3VA 4IW4E 1GHXH 7LPRA 1W8BH 2GP9B 1HAIH 1F7ZA 1SGEE 1VGCB 3K6ZA 2B0FA 3GY4A 1DANH 5EW2H 1ZR0A 4DCDA 1BTUA 1O2TA 3RP2A 2Y82A 2IJOB 1O2YA 4KTCA 2VNTA 1EUFA 1YPMH 3H5CB 1Y5BT 1O2OA 3MU1A 3QN7A 5TJXA 4RKJB 4IBLH 1W13U 3UREA 1SHYA 2ZU3A 4MPUA 1MUEB 1P04A 2ZHWH 1K1JA 1DLKB 1MD8A 2GZ9A 2YOLA 3MYWA 3SJ9A 1DY9A 4UE7H 4BTUB 4X2XA 1PYTD 4BAKB 1HXFH 3A8CA 2G4TA 3HGPA 3WY8A 1Z8IB 1HAXB 3VGCC 4X1RU 1NRSH 1AUTC 2ALPA 1EPTA 3A8AA 4FU7A 1D6WA 1MBMA 1HAYB 4Q7ZA 1TBRH 4I8JA 3HK3B 1P2KA 2VGCC 2K1QA 3ZZCA 1GHAF 2BD4A 2D8WA 3LH1A 1QHRB 2Y6TA 5C1YA 3ELAH 2LPRA 5JYIA 2ZDLA 1BTZA 5T6GA 4WJG2 3S0NA 5DP9A 5DG6A 1UCYK 2VJ1A 3P6ZB 3SUDA 3ZZ3A 5L6NH 2HOBA 5I25A 3TGJE 3LOXA 1QR3E 1YF4A 2FODA 4XBDA 3O8CA 1C2FA 2H9TH 3F9GA 2OTVA 1U6QA 1VJAU 1KLIH 1AVGH 2BOKA 3GY7A 4O3UA 1TAWA 1C5SA 4FXGH 1C1MA 1SLWB 1K1NA 1SB1H 2PKAA 4JZFH 1PPZA 3MH4A 1DXPA 2ZFPH 1QFKH 4IMZA 3UY9A 2WPKS 3F9HA 1IAUA 1CA8B 2FTMA 4ABHA 1O3BA 2G51A 2XNIA 4ZXYH 1KDQB 3TH3H 1VCWA 1ELFA 1XX9A 3HKJB 4B74A 1CU1A 3PYHA 5DJ7A 1ID5H 5T6DA 2TGPZ 1AFEH 1HJAC 3Q3YA 2BD8A 2ZECA 2P95A 1RTLA 3O8RA 1Z8GA 2ZU1A 3RU4E 3OSYA 1CGIE 1TA6A 4GPGA 4XFQA 1GCTC 1GHWH 3UWJH 1O3FA 1OWIA 1SFIA 2FOBA 3RUOA 1V2OT 1UK3A 3SV9A 3GCOA 3F9EA 5DP5A 4XOJA 1BT7A 2EI6A