1QY6A

Structue of v8 protease from staphylococcus aureus
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
216
structure length
216
Chain Sequence
VILPNNDRHQITDTTNGHYAPVTYIQVEAPTGTFIASGVVVGKDTLLTNKHVVDATHGDPHALKAFPSAINQDNYPNGGFTAEQITKYSGEGDLAIVKFSPNEQNKHIGEVVKPATMSNNAETQTNQNITVTGYPGDKPVATMWESKGKITYLKGEAMQYDLSTTGGNSGSPVFNEKNEVIGIHWGGVPNEFNGAVFINENVRNFLKQNIEDINFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protease
molecule keywords serine protease
publication title The structure of a universally employed enzyme: V8 protease from Staphylococcus aureus.
pubmed doi rcsb
total genus 53
structure length 216
sequence length 216
ec nomenclature ec 3.4.21.19: Glutamyl endopeptidase.
pdb deposition date 2003-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qy6A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qy6A02
1HAHH 1HJAB 1HJ9A 1AWHB 3MO9A 3OTJE 1SLXB 3B8JA 1PYTD 4MQAA 1D3QB 2VIDA 4TPYA 2UWPA 3GY3A 2XWBI 2PGQB 3LC5A 1PQ7A 2ZU4A 4X0WU 4AGJA 4ISIH 3BEIB 3P8FA 1GHYH 5LPEA 1G30B 2WPKS 2BD3A 4DIIH 3ATLA 1V2LT 4ESTE 2WUCA 5K0HA 1E35B 1HFDA 3UPEA 1ETRH 3KQBA 1PPBH 1EB2A 3M61U 1UVOA 1AB9C 2PV9B 3A7XA 1CO7E 4U2WA 4OS1A 2A4OA 2FOGA 1TNIA 5CHAC 1MCVA 1CE5A 2BDAA 1C9TA 4UD9H 2BY9X 3FP7E 2Y80A 2ZQ1A 1TGNA 1AN1E 1GBIA 5JYIA 1HJ8A 1O3DA 3FZDA 1P02A 2FOFA 4ZXXH 3LKWA 1K1OA 1C5SA 1AVGH 6CHAB 1EASA 1XXDA 4TY6A 4BAOB 4WVPE 3MH6A 2R2WU 1HPGA 4BNRA 2VIOA 2FOAA 2XRCA 1EAXA 1C2FA 1VJAU 1W0YH 1SHYA 3P8GA 3ZV9A 3RC4A 1PPCE 3UNRA 4X6NA 3F9GA 4UFEH 1GJ8B 2EC9H 3ATWA 2UWOA 4E05H 1ELVA 1C5WB 1K1LA 2A31A 2A4RA 1GJ6A 4CRBA 2BD2A 3P70B 1ZLRA 2Z3CA 1FQ3A 1ZHPA 2O8TA 4Q7XA 4O97A 3SGQE 1HUTH 1GMCF 2GGVB 4FUJA 1ABIH 4XSKU 4CRGA 4I8LA 4ISNA 2A0QB 1SOZA 3STJA 5SGAE 2NU4E 3MMGA 2ZHEH 1ARCA 2B0FA 1H9HE 3NUMA 3RMOH 1SFQB 4U01A 5FHTA 4NIXA 4ZHMU 4OS5A 2RCEA 3P17H 4JK6A 2ZP0H 2FI4E 1W8BH 5EW1H 3SV9A 2BQ7B 3RXHA 3LPRA 2A7HA 3SU6A 2VH0A 1P9SA 3EA9A 2W7SA 3GY6A 1C2GA 3P8NA 1TPPA 3GY5A 1GJ4H 4INLA 1SVPA 1GBLA 1GJDB 1N8OB 2ZO3H 6GCHG 1HIAA 3BTDE 2TGTA 1THPB 1YP9A 1EKBB 1O2JA 1H4WA 1SB1H 3SJOA 3TH2H 2FM2A 4KP0A 1GMHF 1L0ZA 1TX7A 2EA3A 1DY9A 2QIQA 4OS2A 4KTUA 2R0LA 4UE7H 2VVCA 1ZHRA 1W0ZU 4ZHAA 3QDZB 3RM0H 2H6MA 4CREA 2R0KA 2ZFTA 2SGEE 3ZZ8A 1ZR0A 3FZZA 1JXPA 3ESTA 4Y71A 1AE5A 4IW4E 1TPOA 3ZZBA 4MVNA 1L4ZA 1V3XA 5IYTA 4A7IB 4ABJA 1QRWA 5JBCS 2K1QA 2ZKSA 5DPAA 3E90B 3E6PH 1ZZZA 1O2VA 1OX1A 1HYLA 5DP3A 1AWFH 1K22H 1O2KA 2THFB 2GT8A 1Y5BT 2I6QA 2O9QA 2ALPA 3STIA 3UNQA 1GMHG 3LH3A 3MWIU 3RXQA 2A45B 4KTSA 3IITA 2OCVB 1IHTH 1BCUH 1WQSA 4GAWA 1O2UA 2RDLA 7ESTE 3BN9A 4MNWA 1ZPBA 2O8MA 1WYKA 3UR9A 3LGWA 2ZDMA 3QGNB 1QB6A 1BTUA 4ISHH 1ZTLA 1C1WH 3O8RA 1QHRB 2ZI2H 4Y8ZA 4MTBA 4ZHLU 2ZTXA 5EW2H 1CT2E 5FXLA 1YLDA 3ZZ6A 5A0AE 2BY7X 1C4V2 2CF9H 2Z94A 3W95A 4IN1A 3L6PA 1O3JA 3LGVA 4KTCA 4WH8A 1HBTH 2HALA 2IOTA 1NN6A 2W26A 4WY3A 1F0TA 1KXDA 4ABHA 5DJ7A 4I32A 4OS7A 1UTJA 1JWTA 3FVFB 3GY2A 1JRTA 1OPHB 1SI5H 1LVBA 4LK4A 2OTVA 1O3MA 2ANYA 4K3JA 1EP6A 2ZGHA 3RMMH 4RKJB 3RXIA 4D7GA 4Y0YE 2BD4A 1BTWA 3U1IB 3URDA 2DE8A 2KAIA 1FNIA 3MYWA 3TGJE 4IMQA 2XTTB 3KGPA 2FOHA 1O2RA 1C2DA 1ANDA 2BLOA 1AQ7A 2P93A 1G36A 1GJCB 1SR5C 3E1XB 4CRFA 1NTPA 2BDIA 3A88A 1V2ST 4UFGH 3SNEA 3T5FH 1GVLA 1O3GA 1SGPE 4CHAC 4IGDA 4FUBA 2Z9JA 2Q6GA 3A8BA 2XCFA 5LH8A 1SFIA 2FX4A 1WU1A 1OWDA 3VB3A 1YCPK 3F68H 1GBKA 1P11E 2ANKH 1J17T 1SLVB 3TU7H 1C4U2 2BDGA 4ABGA 1BMLA 1ELAA 1H9IE 1C5XB 1TGBA 2BM2A 4ZKSU 1P09A 2FWWA 1W7XH 3M5MA 4I8HA 2AGEX 3NPSA 4IC6A 1WOFA 1ACBE 2H2ZA 3ELAH 3ZZ3A 1A0JA 3ODFA 4JYVH 4JZEH 3RXOA 1P2NA 3RXSA 4DCDA 1BTHH 1YM0A 1O5DH 2ZZUH 1KLJH 1QJ6B 1PFXC 1D9IA 2ANWA 1CT0E 1T8MA 1P01A 2BOKA 4OS6A 3SI3H 1TMBH 1GJ9B 2BXTH 1IOEA 3RP2A 1MKWH 2AERH 5C1UA 4YESB 1HAPH 2XBWA 1OP0A 1C5NH 1Y8TA 1Y5AT 1TWXB 2ZDKA 4AYVB 3Q3XA 2FLBH 1IHSH 2TPIZ 5FCKA 3Q77A 3HK6B 3ATKA 4IBLH 2GZ8A 3S9AA 1DVAH 4NWKA 1WTGH 3PB1E 1YPKH 4MPUA 4Z0KA 1KDQB 4Z6AH 3MU8A 1C2HA 1TNHA 2BLQA 1C1RA 2SGFE 2OC8A 2VIQA 1LHGH 1T4VH 1V2QT 1ZTKA 3LIWA 4JMYA 4WWYA 1RFNA 2JETB 2VGCB 3SQEE 3TJOA 2PSYA 4JZ1A 1O3HA 1CHGA 2QF0A 3SI4H 1GHBF 1DWCH 4THNH 2H9TH 2GP9B 5JDUB 1QRZA 4MNVA 1QA7A 3UWJH 1V2UT 3SNAA 4FUHA 1TPSA 2V6NA 5CE1A 1TOCB 2D26C 4CRDA 1EUFA 2V0BA 4BANB 1QFKH 1BMAA 2A4GA 1OWJA 4INHA 3ODDA 1TB6H 4D9RA 1O34A 1A61H 4IMZA 2P95A 1VITH 1FMGA 4FVBA 5B6OA 1LHFH 4I8JA 2VB0A 1TA2A 1W7GH 1WTHD 1Y3YA 1XXFA 1UVSH 5AFYH 4YTAA 4NIYA 3A87A 2VIVA 1HAVB 1Y3XA 2JH6D 5F8TA 4MNXA 3KQCA 2VVVA 2R9PA 3RXTA 1FY4A 4AGKA 1C2IA 1YCPM 2UUYA 2XBXA 1O2QA 3O8BA 1O2NA 1C5VA 1GHBG 1VGCB 2F91A 4TPIZ 2HNTE 2GDDA 1LTOA 2UWLA 5GPIB 5F6MA 4X6OA 3MU5A 1UCYK 1GL0E 4U32A 1EPTB 3F9HA 1TRNA 3DT0H 3GISB 3BG4B 3V0XA 3ZYEA 3PROA 1G3EA 5G4BA 1G3CA 1WAYB 5E2OA 4UFDH 1P12E 2VWOA 5DGJA 1EB1H 1AFEH 3QWCH 1N6YA 1SGFA 1YPHE 1C1TA 2BDBA 5FBIA 1GGDB 2ZDVH 4X2YA 1Y59T 1ZMLA 1P8VC 1O36A 2BMGB 2PKSB 4NA9H 3OYPA 2DE9A 3NKKA 2ZF0H 1TBZH 1C1QA 2ZNKH 1W11U 5C1YA 4IN2A 2W3KA 1Q3XA 3WY8A 2ZQ2A 1C2EA 1C5OH 1JMOH 3VXEH 4K1EA 3BIVH 1V2NT 2G4UA 1K1NA 1CA0C 4X8TH 1CVWH 2F9UA 2FS9A 2ZG0H 3Q00A 2AH4X 3UWIA 4HGCA 1MKXK 5J4SA 1GCTB 1Q31A 5F8ZA 2ZGJA 1O2HA 3U8TH 2HNTF 1DUAA 5C2ZA 2ALVA 2FS8A 3RXUA 5TJXA 5HYOA 2FP7B 1NY22 4WMFA 1O2WA 4FUCA 1EZUC 5L30H 3LU9B 3GCHC 1GI4A 4AZ2B 4FUGA 2P8OB 4X1PU 1E34B 4HZHA 2Q6DA 3TPIZ 1C1OA 4BAMB 4WXIA 4NWLA 2Y5GA 4ZKNU 2STAE 1E38B 1B7XB 8LPRA 1FJSA 3A80A 3RXKA 1MD8A 2ZFPH 1NROH 4Y7AA 1A2CH 1D6WA 2CN0H 1L1JA 4X6MA 1XUIA 3GCOA 1EXFA 3A7YA 1Z7KA 1W10U 1BTPA 1QJ1B 2ZWLH 1O2LA 2BZ6H 1G32B 4MPXA 1SMFE 3TLOA 1P3CA 3RXCA 1P9UA 1OXGA 4ABDA 3B9FH 3Q3YA 3VPKA 4A1VA 1FLEE 1BUIA 3SZNA 4O3TA 4INKA 5ABWA 3VB5A 3EQ0H 1TNKA 2XXLA 1WV7H 1O30A 2HGTH 2Z3DA 2Y5HA 2ZGCA 4D76A 1ANBA 1FY8E 3TITA 5EPYA 1U6QA 4LOYH 1QBOA 3IWMA 1BIOA 1SG8B 3SJKA 4J1YA 1TMUH 3EYDA 1BHXF 5L6NH 2WINI 1HCGA 4A1XA 2A32A 4XFQA 2ODPA 3GYMA 8GCHF 4NZQA 3MNCA 3MFJA 1DANH 1QQ4A 3T29A 2FMJA 1V2RT 1ID5H 4KKDA 4MLFB 2J34A 4M7GA 3ZVGA 2GDEH 1GVZA 3GDVA 1PPGE 1LKBA 1PYTC 5E8EH 1RJXB 4DURA 1CA8B 2GMTB 2ZPRA 3TGIE 1G2LA 5HM2A 1TA6A 3PYHA 2BVSH 4WMDA 1XKAC 1PQ8A 4GVUA 4GLYA 4X1RU 1J8AA 5JBTA 1G9IE 3KL6A 3EA8A 3LC3A 3MHWU 1OYQA 3RXEA 1FONA 1O3PB 1P2IA 1S83A 4DY7B 1NT1A 4BTUB 4YZUA 4YM9A 5I25A 3ATIA 3FFGA 5T6GA 1YBWA 3F1SB 2R3YA 5A8YA 8GCHG 1VJ9U 2VNTA 1PPHE 3LONA 1HAGE 1Y3WA 1H8DH 3V13A 3ZZ9A 1K2I1 1UK4A 4Y11E 3L33A 3SUFA 1SGIB 5T6DA 1BTZA 4ABIA 3EA7A 1MAYA 3SNBA 1ELBA 5JBBS 4CBOA 5DP6A 2QN5T 3NZIA 1TQ0B 5A0CA 1LO6A 4K8BA 1DS2E 3F9EA 3S9CA 5A09A 1FDPA 2FO9A 2PUXB 1BJVA 2V3HH 5K7RA 1DSTA 1O3BA 1GHZA 2WPMS 1GWAA 4WF8A 5EQRA 2XBVA 5TCCA 2GT7A 3PV4A 2OQUA 1BOQA 6GCHF 1G37A 2LPRA 1XUJA 2BD9A 1C5RA 1XX9A 1SL3A 1JRSA 1TNLA 1Z71A 2LNCA 3T2NA 4GHTA 1ANCA 1C4Y2 4B71A 1G3BA 2CGAA 2PFEA 3QX5H 1GBBA 1TBQH 3F9FA 3R0FA 1ELEE 3UQOA 3K65B 4CBNA 1GI0A 1SPJA 1LVMA 1DUEA 1O3CA 3KNXA 4ZROA 1ESTA 3GY7A 1C5PA 4RN6A 4VGCC 4AYYB 5FAHA 4BTIB 1BDAA 3A8AA 3BEUA 1F2SE 4AFSA 1IQIA 1SC8U 2TRMA 4DOQA 6ESTA 2SFAA 1HJAC 1JIRA 2OLGA 4UFFH 3D23A 4TWYA 1IQEA 4FUIA 2ZCLP 3RXRA 1KXBA 3VB4A 1FIZA 3BTKE 1O3NA 2BD5A 1ZSKA 1FY3A 5A8XA 2A7CA 1A5GH 1TFXA 5E0GA 1Y3VA 1YLCA 1DX5M 3PMBB 1YPMH 1C1VH 3RLYH 1GBTA 3UOPA 1L1NA 3PLKA 2D1JA 1FPHH 3M3TA 1TRMA 1AU8A 2Z7FE 2ZFSA 3DFLA 3TNSA 5HXFA 3UY9A 3LT3A 1MTVA 3Q76A 8KME2 3PM3A 1AY6H 2ZHQH 2FDAA 2A5KA 3U69H 1ELGA 1MU8B 3OY5U 2OBQA 4CHAB 1AI8H 1GJAB 4X2VA 1K1PA 1GI9B 1O39A 2Z9KA 2XBYA 1CHOF 3RU4E 1KIGH 1MU6B 3OSYA 4YOJA 3ZV8A 3H5CB 1IQHA 1EAUA 1UJ1A 3SU5A 4FVDA 3UOUA 2WV4A 3VEQB 1YPLH 1G2MA 1XMNB 6CHAC 1QR3E 2NU3E 1GVKB 1HIAB 1EOJA 2QA9E 4ZH8A 2WPLS 1HNEE 2BD7A 1O3KA 2G55A 2J95A 1AVXA 4I8KA 2GCTB 1EAWA 4Q80A 1IQKA 1NFYA 1DLKB 2CV3A 2EI6A 1FAKH 1OWHA 1Z6EA 3S0NA 1LPZB 2H9HA 2PKAA 5ETXA 1CGIE 1O5GH 1TLDA 1SLUB 2Z9LA 5JB9S 4WXVA 1CHOG 2HLCA 1PPEE 4K5ZA 1TE0A 1GMDG 1A7SA 1SSXA 2B7DH 1RTKA 1ZJDA 1ZRKA 3EE0B 1AKSA 3NWUA 1MMJN 1GG6C 7GCHG 2R3UA 3S7KB 4X2WA 2WPJS 4BAHB 2BYAX 3BTQE 1GBCA 1J16A 2B9LA 5EPNA 1D4PB 1NS3A 2GCHF 1B0EA 1UTLM 4ABBA 2VJ1A 2Z9GA 4AFQA 2PSXA 3D65E 1MTNB 3L3TA 3U8RH 3ENSB 3S9BA 3P92A 1GBJA 1OS8A 4TWWA 3SHAH 1TPAE 1GDNA 2JH5D 4HTCH 1KLTA 4F49A 3RDZA 2XC0A 2CF8H 2ZCKP 7KMEH 5LPFA 5FBEA 2F9PA 1OOKB 1FIWA 3HPTB 1ELCA 1ZTJA 1V6DA 3A8DA 2IPHA 3SU2A 1UK2A 2ZHDA 1Z8IB 3MH7A 1QA0A 2QCYA 1ZMNA 5GDSH 4J2YB 2ZFQH 3QTVH 4CH8B 5EXMA 2BX4A 2HVXA 1QL8A 3M35A 1NC6A 2AS9A 1IQFA 3GY8A 2UUKB 1SGQE 2PWXA 3RXJA 1P03A 2GCHG 1GJ7B 3RXFA 4FUFA 4AB8A 5HMAA 1YPJH 1K1MA 2FLRH 4X1QU 3D62A 1LVYA 3A8CA 3ZZ7A 3KQDA 3A85A 5DP9A 3ZVBA 5FPTA 4BAQB 1NFXA 2D2DA 2FOCA 1DXWA 1VZQH 1X7AC 1P2KA 1LVOA 2VU8E 1A1RA 1GCDA 4MPWA 3URCA 1LMWB 1YCPH 4D7FA 3A7VA 1RTLA 3SV7A 8ESTE 5AFZH 2PTCE 3PMAB 4AFUA 2QC2A 2ZPSA 3T26A 1EJAA 2KAIB 1KDQA 1MUEB 3I77A 3GYLB 1GBEA 1O5AB 3TJVA 1HGTH 3QO6A 2A7JA 3TVJB 2FIRH 4O9VA 2OBOA 3HKIB 1NU9A 2QAAA 3SUEA 1O2IA 5FPSA 1OYTH 3BTWE 2FYQA 5GIBA 5DKMA 3A82A 1Z1IA 3ZVEA 2Y82A 3KEEA 4JYTA 1V2MT 3G01A 2SNVA 5FX6A 4SGAE 1MQ6A 1UCYE 1KXFA 4Y76A 4NSYA 2ODYB 1C5ZB 1RD3B 3ATMA 4Q7ZA 1MBMA 1GI3A 2O8UA 1SGEE 1P05A 3ZYDA 2QYIA 3MTYA 3LH1A 4R0IA 1FAXA 5EQSA 3S7HB 1SGFG 1KXAA 1BTXA 3TK6A 2ZU3A 2Q6FA 1F5KU 2BY5X 5A2MH 1AFQC 2RG3A 1OP2A 1HAVA 1OWKA 4I7YH 1H9LB 1TNGA 2WPHS 3RMLH 4GHQA 3JZ1B 1C1MA 4LXBH 5L2YH 1Z8JB 1GI8B 1RTFB 2BB4A 1O2SA 2HWLB 4X8UH 4BTTB 3BEFB 4XE4A 2ZU1A 1BB0B 2AMPA 1GI1A 2AIPA 1C2KA 1S84A 1ZRBA 1SLWB 1W12U 3PO1B 1BBRK 2F83A 3LJOA 1IQLA 1KTTB 4JK5A 5T6FA 1QBVH 4AOQA 1K21H 5DO4H 2CHAC 2RA0A 5DP7A 1O38A 3FP8E 4I31A 4FU7A 1O3OA 1BZXE 2ZC9H 4BOHA 4NCYA 5J4QA 2EI7A 2GKVE 2QXHA 2Y6TA 4MDSA 1AUTC 2TGDA 3TH4H 5EU8A 4D8NA 1KXEA 4KELA 1GI7B 1AMHA 2FODA 2J4IA 4UEHH 3RC6A 1W14U 1THRH 1QBNA 5HGGA 2OC1A 1VCPA 1GPZA 2G5NA 1NU7B 3AAVA 1UTQA 1BJUA 2PTNA 1ZHMA 3QTOH 4H6TA 4MG3A 4AN7A 2ZIQH 3O8CA 1UTNA 1A3BH 1UCYH 1HDTH 4NG9H 3E0PB 1ELFA 1Q2WA 5AHGH 3PTNA 4YOIA 2J9NA 4ZAEA 1C1UH 3P8OA 5DK1A 1DDJA 2H5CA 4FUDA 3SUDA 1OSSA 4GPGA 4YLUA 1J14A 1A5IA 1S6HA 2XWAA 2OINA 2Y7ZA 2UUJB 4H42U 3SOSA 4Y6DA 5AF9H 2BLWA 1V2VT 2TGAA 3MO3A 1NRRH 2F9BH 2VWLA 3A7WA 1O2XA 3BG8A 2FYRA 4E06H 2ASUB 1ESAA 2ILNA 1V2JT 1DE7H 1HXEH 1AZ8A 1E37B 2D8WA 1HAIH 3KIDU 1ELDE 1LHCH 1MKXH 1D3TB 1PPZA 5FCRA 4ZMAH 1UVUH 4RKOB 2ZEBA 2J94A 2PLXA 4CR5A 1P06A 1O2ZA 2ZHFH 1HV7A 1TALA 2A1DB 3BTTE 1AB9B 2SGQE 3RUOA 2FX6A 1F0SA 5CHAB 2ZHWH 1EOLA 1CSOE 1MCTA 1GHVH 3VGCC 2G00A 4ISOA 3BTME 4K1SA 5EQQA 1BRCE 3RXVA 5JBAS 1SGTA 2NU0E 4Y79A 1P10A 1F0UA 5BPEA 5ESTE 1VR1H 2P3TB 1UHBB 1K9OE 3AW0A 3FANA 3FAOA 1XM1A 3P95A 4MPVA 4NZLA 1IQNA 1JBUH 1TYNA 3RXGA 4YO9A 2BXUH 3E8LA 3ZVAA 3K9XB 4HI3A 1QTFA 1EJMA 1SQOA 1ZPZA 2QXGA 4YT7H 4PROA 1XVOA 3FP6E 1AIXH 2ZPQA 1ZJKA 1GJ5H 4NFFA 1A46H 1C5MD 3BG4C 5E0HA 4LZ4B 2ZTYA 1ORFA 3MU4A 1LQEA 1ARBA 5JB8S 1T7CA 5C20A 4RSPA 1QQUA 1KXCA 3RU4D 4K8YA 1O3EA 1SGRE 1GHWH 1UVPA 4B2AA 1TGSZ 2ESTE 1BQYA 1GGDC 3C1KA 2GVFA 1Z1JA 4ISLA 3U98H 1UO6A 2XC4A 1O2GH 1O2TA 4X1SU 3SV2H 3CS0A 1TONA 2Z3EA 1RIWC 1O2YA 1WCZA 2OC7A 2XYAA 5C67A 1O2MA 2OD3B 2VINA 3VFEA 4H4FA 4VGCB 4GCHG 2FPZA 1AD8H 3LGUA 1CGHA 1UK3A 2F9OA 3KQEA 3TK9A 1QJ7B 2BTCE 2CJIA 1SHHB 2GV6A 1TX8A 4X1NU 1DICA 1F5RA 1GBHA 2RA3A 1BMMH 2F9VA 2FZZA 2FTLE 3M5NA 3SN8A 5JPMH 4B1TA 1Y3UA 2YOLA 3BF6H 3LDXH 3EAJA 1GCTC 3M7UA 2WYJA 2NWNA 1A0LA 2OC0A 3M5OA 5IDKA 3RC5A 1S0QA 1S85A 2FOEA 3PWCA 1QB1A 1F92A 2A2XH 5PTPA 1S82A 4Y0ZE 2F3CE 1AVWA 3DHKH 5H4IB 2P8OC 5E0JA 3AAUA 2AMDA 1O3IA 1T8NA 1S81A 4BAKB 1GBMA 1SOTA 1AO5A 5EGMA 1A4WH 4TY7A 2AGIX 4GSOA 3MNBA 1INCA 1YF4A 3UQVA 4Y7BA 2A5IA 3RLWH 1DPOA 3PMHB 1TGTA 5I46H 1VCQA 2GX4A 1GI5A 1EZSC 3PTBA 4ZXYH 1FZZA 1O5EH 2WUBA 3E0NB 1EX3A 1MD7A 3ZZDA 1YKTA 1LCYA 1V2KT 1GBDA 3SU3A 2BX3A 3NCLA 3S69A 3HKJB 4X8VH 1CBWC 1O0DH 1NFWA 1TGCA 2CXVA 2SGPE 3QUMP 2G51A 3KN2A 1P3EA 3T62A 3SJ9A 2HOBA 2JH0D 4NIVA 1Y5UT 1N1LA 2YNAA 2A2QH 4B2CA 4U30A 1LPKB 2XC5A 2NU2E 3E16B 5DP4A 2C8XB 2Z9IA 4DG4A 2ZFFH 4DW2U 1C2LA 1LPGB 1PPFE 3BIUH 2GD4B 4FU8A 2FI5E 1L4DA 2FOMB 1C5LH 2FXRA 3HGPA 3M37A 1L2EA 1L1GA 4D9QA 2VWMA 4B76A 2SGDE 3SU4A 4X6PA 1MZAA 3LGTA 1ZSJA 1P2JA 2Y7XA 1EZQA 1YPEH 1GG6B 3BTFE 3RXLA 1LHDH 1XUKA 3M7TA 1QL7A 2ULLA 2G8TA 4CR9A 2ZGXH 3Q3KA 2C93B 1D3DB 1P0SH 5DG6A 3R3GB 2GMTC 4F4OC 5C3NA 3HATH 3SGBE 5GWZA 3ZZAA 1NRQH 5EG4A 2F9NA 2G52A 2P59A 1C1SA 4IC5A 5BRRE 1QIXB 1AE8H 1GMCG 3W94A 1SGCA 1FPCH 4MNYA 5CMXH 4CH2B 7LPRA 1C1PA 2G4TA 1DLEA 3SV8A 3HGNA 1EAIA 1J9CH 5GXPA 1C2MA 1YPGH 1O5CB 2C3SA 1NPMA 3M3SA 2HPQH 3SORA 1UTMA 4ZUHA 3SNCA 2J2UA 3RXDA 5AVDA 3JZ2B 3A83A 1BHXB 1OWIA 3KCGH 5A8ZA 3TGKE 4K60A 4XDEA 1ABJH 4Y8YA 3UIRA 1RRKA 1W3CA 2J92A 2A5AA 2EI8A 3KF2A 1ZGIA 1GMDF 1C5YB 5LPRA 3A86A 3RXPA 1F0RA 1UTOA 7GCHF 2Y5FA 2ZTZA 2BY6X 3MNSA 1JOUB 3SQHE 2BOHB 2W5EA 3UR6A 1H1BA 1LDTT 1AUJA 1QGFA 1O37A 2FESH 1G3DA 1GHXH 1FN6A 4UONA 2B8OH 2AMQA 3AASA 1DFPA 1XVMA 1EQ9A 1WSSH 3EGKH 3GY4A 4TYDA 4X2XA 5DP8A 5DP5A 1MTWA 2OXSA 2ZU5A 3EDXB 1CQQA 2BQWB 4DVAU 1KSNA 1T32A 5EOKA 4OGYA 3TK5A 4NA7A 2HNTC 5TCAA 1SQTA 4WMEA 1EZXC 1XKBC 4ZKRU 1UVTH 1ETTH 2V35A 2JKHA 2ZA5A 3DFJA 3A84A 4ABAA 1WQVH 3M7QA 3UNSA 5L2ZH 3V7TA 3LGYA 5C1XA 2A4QA 3VB7A 2ZU2A 3ZVFA 3M36A 4OGXA 4JYUH 1UTPA 1YPHC 3K6YA 1MH0A 3DA9B 1H8IH 5C5NA 1LQDB 1MBQA 3DUXH 1XUHA 3K6ZA 2C8YB 1AFQB 4QT8C 1TMTH 2BDHA 1J15A 4WH6A 2XNIA 2W7UA 4B75A 4X8SH 1GL1A 5F8XA 1N8OC 1SGNE 1Z8GA 2O8WA 1FN8A 4WJG2 1W2KH 1TIOA 1SGDE 1BITA 1CGJE 2TIOA 2Z6BD 1F5LA 2J38A 2VIWA 3SHCH 5FX5A 1PQAA 2PKAB 1DM4B 4A6LA 1QCPA 1GDUA 1S0RA 3SU0A 1GI6A 2G5VA 1FY5A 3RU4T 1V2WT 2AEIH 2C90B 1KLIH 1SBWA 3AW1A 1O5FH 2ANMH 3MNXA 4I33A 1AHTH 3PWBA 3MOCA 1A0HB 1MTSA 1AKSB 1HAYB 2TGPZ 3O8DA 4R8TB 4K1TA 3NK8A 2CHAB 2R2MB 3I78A 4UDWH 3VB6A 4YLQH 2C8WB 3SO3A 1QNJA 3QGJA 3LGIA 6LPRA 1AZZA 3ITIA 5E2PA 4BXSA 2TBSA 4NA8A 4JZDH 1ZSLA 1A5HA 1OKXA 1BBRE 2ZGBH 3T25A 1DWBH 2P3UB 1B0FA 3ZZCA 3GCTF 2OP9A 4FU9A 3D49H 1HB0B 4LZ1H 1GBFA 1MKWK 1TRYA 1NRSH 3I29A 1EP5A 2B5TB 2DUCA 1MTUA 2QY0B 1LHEH 3A89A 2BDCA 1FV9A 4DIHH 1O5BB 3M3VA 1P2OA 3CP7A 1IAUA 1C9PA 1QY6A 1T8OA 1BMNH 2GCTC 1BRBE 2QF3A 1P04A 3RMNH 1GI2A 3UTUH 3NXPA 3RXMA 4ABFA 1HLTH 2BLVA 1TOMH 1P2QA 3AVZA 1O2OA 1UTKA 3A7ZA 1QL9A 1RGQA 1YC0A 3N7OA 3TIUA 1W13U 4JZFH 1CA0B 2VWNA 1DWEH 3GCTG 4XBDA 3E91A 3MH4A 3T27A 3SU1A 2C4FH 1NO9H 2GZ9A 3OX7U 1KYNA 2H9EH 4DJZB 4HFPB 3MU1A 1TX6A 3ZVDA 5EXNA 4B2BA 3QK1A 3QZRA 3V3MA 1BA8B 1RXPA 1O2PA 4AG1A 1TBRH 2AYWA 2SGAA 1T4UH 1IQJA 1D3PB 1MTNC 2FOBA 5C5OA 1VITF 3GDSA 1SGYE 4BXWA 3DD2H 3GCHB 2Q1JA 1ELTA 1EPTA 1T31A 1FXYA 2BDYA 2FI3E 2WPIS 3A81A 1DITH 5EXLA 4IS5A 1NRPH 1ZYOA 2GV7A 1O33A 3QN7A 2AGGX 1C5QA 2H5DA 2IJOB 3SNDA 1TNJA 1YGCH 3TJNA 2P16A 4H6SB 3UREA 1BRUP 1ETSH 3VGCB 1CT4E 2IN2A 3ZVCA 2GZ7A 1THSH 1QURH 1V2PT 3SBKA 1BBRH 2WV5A 3MI4A 1V2OT 1Z6JH 3HK3B 1EJNA 2PR3A 2VVUA 4AORA 2Y81A 3PMJA 1VITG 2OUAA 4NGAH 3UUZA 1E0FD 2PHBA 1PJPA 1T8LA 2UUFB 1HAXB 2PW8H 1GHAF 1TAWA 2WYGA 3BSQA 4NFEA 4DT7B 2STBE 4Y10E 1QB9A 1YYY1 2BQ6B 1HRTH 2BZAA 2FEQH 3BV9B 4XBBA 1BRAA 1V2TT 4Y8XA 4B74A 3VXFH 1NM6A 4XBCA 1ZMJA 2O8LA 2ZCHP 1ESBA 1DT2A 1UMAH 3H7TA 2I6SA 1WBGB 3BTGE 1S5SA 3GDUA 3MH5A 4GUXA 4AG2A 4O3UA 1JIMA 1DY8A 1GJBB 3U8OH 2ZECA 3CENA 5LGOA 2OQ5A 5GCHF 2BVXH 2QXIA 1NRNH 4K2YA 4FXGH 4K69A 3RM2H 2QGRA 3QLPH 3M5LA 3C27B 1IQGA 3KHVA 3GICB 4A5TS 3CS7A 2FTMA 2C8ZB 1GHAG 1KY9A 2G81E 5EODA 4AX9H 1RIWB 1F7ZA 2ZDNA 2VIPA 1D6RA 4CRCA 1XUGA 1HAOH 1GBAA 3U9AH 1Z8RA 1DWDH 4A1TA 5F03A 2ZFRH 4YT6H 1HXFH 4DGJA 3SV6A 2PGBB 1WUNH 3SJIA 4NIWA 1UHBA 2VGCC 1C5TA 1K1JA 2AIQA 2JETC 3QZQA 1FUJA 3SUGA 3SGAE 1EATA 3TJUA 3TNTA 1TQ7B 1M9UA 1NESE 4B73A 4KGAA 3T28A 1O3LA 1BT7A 1FY1A 1PQ5A 2ZDAH 2CMYA 5GCHG 3BTHE 1BTYA 1OWEA 3PLPA 3GOVB 1DSUA 3BTEE 4OS4A 1S6FA 1C2JA 3UFAA 2QXJA 3E3TA 1AGJA 4I8GA 3PLBA 4O03A 1K1IA 3PO1C 4CRAA 1O31A 2P3FH 3F6UH 4ABEA 1VCWA 1HAZB 1IQMA 4XOJA 3ZZ4A 1K28D 1B5GH 1SQAA 3IG6B 4E7RG 3TH3H 2NU1E 9ESTA 4NSVA 1MZDA 1ZPCA 3U1JB 4YOGA 1O3AA 1KTSB 2ODQA 2HRVA 1DOJA 4A92A 2BD8A 1O32A 1VGCC 2H1UA 2EEKA 1ZOMA 1LKAA 2PUQH 2P94A 3OY6U 1XUFA 3B23B 1MQ5A 3LOXA 3SW2B 4GCHF 3RXBA 1P2MA 2HPPH 3MU0A 1A3EH 1CBWB 1GDQA 5GJ4B 3ZZ5A 2SNWA 4JZIA 3LJJA 4JCNA 3GCNA 1EPTC 1TABE 2BHGA 5FPYA 1O35A 2BVRH 1E36B 2XCNA 1C1NA 4ASHA 3OU0A 1QRXA 2XW9A 1O3FA 9LPRA 2VH6A 1NZQH 1FI8A 1ANEA 1C5UA 3K2UA 1RS0A 5A0BA 4Q2KA 3P6ZB 3V12A 2YNBA 5T3HA 1OP8A 3H7OA 5ESBA 4ZKOU 2PKSC 2V3OH 4E7NA 3MO6A 1CU1A 3A7TA 2W3IA 1ZGVA 4Q7YA 4AB9A 1P57B 3RXAA 5HM9A 1N6XA 3SJ8A 1DXPA 1NFUA 2ZDLA 4SGBE 2QV1A 4AFZA 2BY8X 2GTBA 4FUEA 2M5TA 1MAXA 2AFQB
chains in the Genus database with same CATH superfamily
1HAHH 1HJAB 1HJ9A 1AWHB 3MO9A 3OTJE 1SLXB 3B8JA 1PYTD 4MQAA 1D3QB 2VIDA 4TPYA 2UWPA 3GY3A 5HKKD 2XWBI 2PGQB 3LC5A 1PQ7A 2ZU4A 4X0WU 4AGJA 4ISIH 4AC9A 3BEIB 3P8FA 1GHYH 5LPEA 1G30B 2WPKS 2BD3A 4DIIH 3ATLA 1V2LT 4ESTE 2WUCA 5K0HA 1E35B 1HFDA 3UPEA 1ETRH 3KQBA 1PPBH 1EB2A 3M61U 1UVOA 1AB9C 2PV9B 3A7XA 1CO7E 4U2WA 4OS1A 2A4OA 2FOGA 1TNIA 5CHAC 1MCVA 1CE5A 2BDAA 1C9TA 4UD9H 2BY9X 3FP7E 2Y80A 1YY3A 2ZQ1A 1TGNA 1AN1E 1GBIA 5JYIA 1HJ8A 1O3DA 3FZDA 1P02A 2FOFA 4ZXXH 3LKWA 1OHHD 1K1OA 1C5SA 1AVGH 6CHAB 1EASA 1XXDA 4TY6A 4BAOB 4WVPE 3MH6A 2R2WU 1HPGA 4BNRA 2VIOA 2FOAA 2XRCA 1EAXA 1C2FA 1VJAU 1W0YH 1SHYA 3P8GA 3ZV9A 3RC4A 3U28C 1PPCE 3UNRA 2VBCA 4X6NA 3F9GA 4UFEH 1GJ8B 2EC9H 3ATWA 2UWOA 4E05H 1ELVA 1C5WB 1K1LA 2A31A 2A4RA 1GJ6A 4CRBA 2BD2A 3P70B 1ZLRA 2Z3CA 1FQ3A 1ZHPA 2O8TA 1E1QD 4Q7XA 4O97A 3SGQE 1HUTH 1GMCF 2GGVB 4FUJA 1ABIH 4XSKU 4CRGA 4I8LA 4ISNA 2A0QB 1SOZA 3STJA 5SGAE 2NU4E 3MMGA 2ZHEH 1ARCA 2B0FA 1H9HE 3NUMA 3RMOH 1SFQB 4U01A 5FHTA 4NIXA 4ZHMU 5EJZA 4OS5A 2RCEA 3P17H 4JK6A 2ZP0H 2FI4E 1W8BH 5HIYA 5EW1H 2KCYA 3SV9A 2BQ7B 3RXHA 3LPRA 2A7HA 3SU6A 2VH0A 1P9SA 3EA9A 2W7SA 3GY6A 1C2GA 2L74A 3P8NA 1TPPA 3GY5A 1GJ4H 4INLA 1SVPA 1GBLA 1GJDB 1N8OB 2ZO3H 6GCHG 1HIAA 3BTDE 3F2GA 2TGTA 1THPB 1YP9A 1EKBB 1O2JA 1H4WA 1SB1H 3WWBA 3SJOA 3TH2H 2FM2A 3KYGA 1GMHF 4KP0A 1L0ZA 1TX7A 2EA3A 1DY9A 2QIQA 4OS2A 4KTUA 2R0LA 4UE7H 2VVCA 3W1EA 1ZHRA 1W0ZU 4ZHAA 3QDZB 3RM0H 2H6MA 4CREA 2R0KA 2ZFTA 2SGEE 3ZZ8A 1ZR0A 5KECA 3FZZA 1JXPA 3ESTA 4Y71A 1AE5A 4IW4E 1TPOA 3ZZBA 4TT3D 3GS9A 4MVNA 1L4ZA 1V3XA 5IYTA 4A7IB 4ABJA 1QRWA 5JBCS 2K1QA 2ZKSA 5DPAA 3E90B 3E6PH 1ZZZA 1EFRD 1O2VA 1OX1A 1HYLA 5DP3A 1AWFH 5C94A 1K22H 1O2KA 2THFB 2GT8A 1Y5BT 2I6QA 2O9QA 2YMSB 2ALPA 3STIA 3UNQA 3SZEA 1GMHG 3LH3A 3EE7A 3MWIU 3RXQA 2A45B 4KTSA 3IITA 2OCVB 1IHTH 1BCUH 1WQSA 4GAWA 1O2UA 3F3BA 2RDLA 7ESTE 3BN9A 4MNWA 1ZPBA 2O8MA 1WYKA 3UR9A 3LGWA 2ZDMA 3QGNB 4YXWD 1QB6A 1BTUA 4ISHH 1ZTLA 1C1WH 2AHME 3O8RA 1QHRB 2ZI2H 4Y8ZA 4MTBA 4ZHLU 2J98B 4RI0A 2ZTXA 5EW2H 1CT2E 5FXLA 1YLDA 3ZZ6A 5A0AE 2BY7X 1C4V2 2CF9H 2Z94A 3W95A 3MQKC 4IN1A 2GJGA 1O3JA 3L6PA 3LGVA 4KTCA 4WH8A 1HBTH 2HALA 2IOTA 1NN6A 2W26A 4HG6A 4WY3A 1F0TA 1KXDA 4ABHA 5DJ7A 4I32A 4OS7A 1WXRA 1UTJA 1JWTA 3FVFB 3GY2A 1JRTA 1OPHB 1SI5H 1LVBA 4LK4A 2OTVA 1O3MA 2ANYA 4K3JA 1EP6A 2ZGHA 3RMMH 4RKJB 3RXIA 4D7GA 4Y0YE 2BD4A 1BTWA 3U1IB 3URDA 2DE8A 2KAIA 1FNIA 3MYWA 3TGJE 4IMQA 2XTTB 3KGPA 2FOHA 1O2RA 1C2DA 1ANDA 2BLOA 1AQ7A 2F43B 1G36A 1GJCB 1SR5C 2P93A 3E1XB 4CRFA 1NTPA 2BDIA 3A88A 4TSFD 1V2ST 4UFGH 3SNEA 3T5FH 1GVLA 1O3GA 1SGPE 4CHAC 4IGDA 2KFWA 4FUBA 3UAIC 2Z9JA 2Q6GA 3A8BA 2XCFA 5LH8A 1SFIA 2FX4A 1WU1A 1OWDA 3VB3A 1YCPK 3F68H 1GBKA 1P11E 2ANKH 1J17T 1SLVB 3TU7H 1C4U2 2BDGA 4ABGA 1BMLA 1ELAA 1H9IE 1C5XB 1TGBA 2BM2A 4ZKSU 1P09A 2FWWA 1W7XH 3M5MA 4I8HA 2AGEX 3NPSA 4IC6A 1WOFA 1ACBE 2H2ZA 3ELAH 3ZZ3A 1A0JA 3ODFA 2WSSD 4JYVH 4JZEH 3RXOA 1E1RD 1YLNA 1P2NA 3RXSA 4DCDA 1BTHH 1YM0A 1O5DH 2ZZUH 1KLJH 1QJ6B 1PFXC 1D9IA 2ANWA 1CT0E 1T8MA 1P01A 2BOKA 4OS6A 3SI3H 1TMBH 1GJ9B 2BXTH 1IOEA 3RP2A 2QE7D 1MKWH 2AERH 5C1UA 4YESB 1HAPH 2XBWA 1OP0A 1C5NH 1Y8TA 1Y5AT 1TWXB 2CK3D 2ZDKA 4AYVB 3Q3XA 2FLBH 1IHSH 2TPIZ 5FCKA 3Q77A 5KGOA 3HK6B 3ATKA 4IBLH 2GZ8A 3S9AA 1DVAH 4NWKA 1WTGH 3PB1E 1YPKH 4MPUA 4Z0KA 1KDQB 4Z6AH 3MU8A 1C2HA 1TNHA 2BLQA 1C1RA 2SGFE 2OC8A 2VIQA 1LHGH 1T4VH 1V2QT 1ZTKA 3LIWA 4JMYA 4WWYA 1RFNA 2JETB 2VGCB 3SQEE 3TJOA 2PSYA 4JZ1A 1O3HA 1CHGA 2QF0A 3SI4H 1GHBF 1DWCH 4THNH 2H9TH 2GP9B 5JDUB 1QRZA 4MNVA 1QA7A 3UWJH 1V2UT 3SNAA 4FUHA 1TPSA 2V6NA 5CE1A 1TOCB 2D26C 4CRDA 1EUFA 2V0BA 4BANB 1QFKH 1BMAA 2A4GA 1OWJA 4INHA 3ODDA 1TB6H 4D9RA 1O34A 1A61H 4IMZA 2P95A 1VITH 1FMGA 4FVBA 5B6OA 1LHFH 4I8JA 2KX4A 2VB0A 3FN8A 1TA2A 1W7GH 1WTHD 1Y3YA 3ZIAD 1XXFA 1UVSH 5AFYH 4YTAA 2KM0A 4NIYA 3A87A 4F55A 2VIVA 1HAVB 1Y3XA 2JH6D 5F8TA 4MNXA 3KQCA 2VVVA 2R9PA 3RXTA 1FY4A 4AGKA 1C2IA 1YCPM 2UUYA 2XBXA 1O2QA 3O8BA 1O2NA 1C5VA 1GHBG 1VGCB 2F91A 2JJ1D 4TPIZ 2HNTE 2GDDA 1LTOA 2UWLA 5GPIB 5F6MA 4X6OA 3MU5A 1UCYK 1GL0E 4U32A 1EPTB 3F9HA 1TRNA 3DT0H 3GISB 3BG4B 3V0XA 3ZYEA 3PROA 1G3EA 5G4BA 1G3CA 1WAYB 5E2OA 5KEDA 4UFDH 4RT0A 1P12E 2VWOA 2QF5A 5DGJA 1EB1H 1AFEH 3QWCH 1N6YA 1SGFA 2IJD1 1YPHE 4I86A 1C1TA 2BDBA 5FBIA 1GGDB 4ACAA 2ZDVH 4X2YA 1Y59T 1ZMLA 1P8VC 1O36A 2BMGB 2PKSB 4NA9H 3OYPA 2DE9A 3NKKA 2ZF0H 1TBZH 1C1QA 1UW7A 2ZNKH 1W11U 5C1YA 4IN2A 2W3KA 1Q3XA 3WY8A 2ZQ2A 1C2EA 1C5OH 1JMOH 3VXEH 4K1EA 5C17A 3BIVH 1V2NT 2G4UA 1K1NA 1CA0C 4X8TH 1H8ED 1CVWH 5GNDA 2F9UA 2FS9A 2ZG0H 3Q00A 2AH4X 3UWIA 4HGCA 1MKXK 5J4SA 1GCTB 1Q31A 5F8ZA 4FOUC 2ZGJA 1O2HA 3U8TH 2HNTF 1DUAA 5C2ZA 2ALVA 2FS8A 3RXUA 5TJXA 5HYOA 2FP7B 1NY22 4WMFA 1O2WA 4FUCA 1EZUC 5L30H 3LU9B 3GCHC 1GI4A 4AZ2B 4FUGA 2P8OB 4X1PU 1E34B 4HZHA 2Q6DA 3TPIZ 1C1OA 4BAMB 4WXIA 4NWLA 2Y5GA 4ZKNU 2STAE 1E38B 1B7XB 8LPRA 1FJSA 3A80A 3RXKA 1MD8A 2ZFPH 1NROH 4Y7AA 1A2CH 1D6WA 2CN0H 1L1JA 4X6MA 1XUIA 3GCOA 1EXFA 3A7YA 1Z7KA 1W10U 1BTPA 1QJ1B 2ZWLH 1O2LA 2BZ6H 1G32B 4MPXA 1SMFE 3TLOA 1P3CA 3RXCA 1P9UA 1OXGA 4ABDA 3B9FH 3Q3YA 3VPKA 4A1VA 1FLEE 1BUIA 3SZNA 1S6LA 4O3TA 4INKA 5ABWA 3VB5A 3EQ0H 1TNKA 2XXLA 1WV7H 1O30A 2HGTH 2Z3DA 2Y5HA 3OTPA 2ZGCA 4D76A 1ANBA 1FY8E 3TITA 5EPYA 1U6QA 4LOYH 1QBOA 3IWMA 1BIOA 1SG8B 3SJKA 4J1YA 1TMUH 3EYDA 1BHXF 5L6NH 2WINI 1HCGA 4A1XA 2A32A 4XFQA 4XD7D 2ODPA 3GYMA 8GCHF 4NZQA 3MNCA 3MFJA 1DANH 1QQ4A 3T29A 2FMJA 1V2RT 1ID5H 4KKDA 4MLFB 2J34A 4M7GA 3ZVGA 2GDEH 1GVZA 3GDVA 1PPGE 1LKBA 1PYTC 5E8EH 1RJXB 4DURA 1CA8B 2GMTB 2ZPRA 3TGIE 1G2LA 5HM2A 2WZQA 1TA6A 3PYHA 2BVSH 4WMDA 5DN6D 1XKAC 1PQ8A 4GVUA 4GLYA 4X1RU 1J8AA 5JBTA 1G9IE 3KL6A 3EA8A 3LC3A 3MHWU 1OYQA 3RXEA 1FONA 1O3PB 1P2IA 1S83A 4DY7B 1NT1A 4BTUB 4YZUA 4YM9A 5I25A 3ATIA 3FFGA 5T6GA 1YBWA 3F1SB 2R3YA 5A8YA 8GCHG 1VJ9U 2VNTA 1PPHE 3LONA 1HAGE 1Y3WA 1H8DH 3V13A 3ZZ9A 1K2I1 1UK4A 4Y11E 3L33A 3SUFA 1SGIB 5T6DA 1BTZA 4ABIA 3EA7A 1MAYA 3SNBA 1ELBA 5JBBS 4CBOA 5DP6A 2QN5T 3NZIA 1TQ0B 5A0CA 1LO6A 4K8BA 1DS2E 3F9EA 3PV5A 3S9CA 5A09A 1FDPA 2FO9A 2PUXB 1BJVA 2V3HH 5K7RA 1DSTA 1O3BA 3OE7D 3OAAD 1GHZA 2WPMS 1GWAA 4WF8A 5EQRA 2XBVA 5TCCA 2GT7A 3PV4A 2OQUA 1BOQA 6GCHF 1G37A 2LPRA 1XUJA 2BD9A 5FL7D 1C5RA 1XX9A 1SL3A 1JRSA 1TNLA 2KCOA 1Z71A 2LNCA 3T2NA 4GHTA 1ANCA 1C4Y2 4B71A 1G3BA 2PP6A 2CGAA 2PFEA 3QX5H 1GBBA 2HLDD 1TBQH 4P00A 3F9FA 2M2AA 3R0FA 1ELEE 3UQOA 3K65B 3UB0A 4CBNA 1GI0A 1YWUA 1SPJA 1LVMA 1DUEA 1O3CA 3KNXA 4ZROA 1ESTA 3GY7A 1C5PA 4RN6A 4VGCC 4AYYB 5FAHA 4BTIB 1BDAA 3A8AA 3BEUA 1F2SE 4AFSA 2V3MA 1IQIA 1SC8U 3N99A 2TRMA 4DOQA 6ESTA 2SFAA 1HJAC 1JIRA 2OLGA 4UFFH 3D23A 4TWYA 1IQEA 4FUIA 2ZCLP 3RXRA 1KXBA 3VB4A 1FIZA 1W0JD 3BTKE 1O3NA 2BD5A 2W6JD 1ZSKA 1FY3A 5A8XA 2A7CA 1A5GH 1TFXA 5E0GA 1Y3VA 1YLCA 1DX5M 3PMBB 1YPMH 1C1VH 3RLYH 1GBTA 3UOPA 1L1NA 3PLKA 2D1JA 1FPHH 3M3TA 1TRMA 1AU8A 2Z7FE 2ZFSA 3DFLA 3TNSA 5HXFA 2RFKC 2KZ4A 3UY9A 3LT3A 1MTVA 3Q76A 8KME2 3PM3A 1AY6H 2L6OA 3DCLA 2ZHQH 2FDAA 2A5KA 3U69H 1ELGA 1MU8B 3OY5U 2OBQA 4CHAB 1AI8H 1GJAB 4X2VA 1K1PA 1GI9B 1O39A 2Z9KA 2XBYA 1CHOF 3RU4E 2J98A 1KIGH 1MU6B 3OSYA 4YOJA 3DSGA 3ZV8A 3H5CB 1IQHA 1EAUA 1UJ1A 3SU5A 4FVDA 3UOUA 2WV4A 3VEQB 1YPLH 1G2MA 1XMNB 3VG8A 6CHAC 2JDID 1QR3E 2NU3E 1GVKB 1HIAB 1EOJA 2QA9E 4ZH8A 2WPLS 1HNEE 2BD7A 1O3KA 2G55A 2J95A 1AVXA 4I8KA 2GCTB 1EAWA 4Q80A 1IQKA 1MABB 1NFYA 1DLKB 2CV3A 2EI6A 1FAKH 1OWHA 1Z6EA 3S0NA 1LPZB 4B6EA 2H9HA 2PKAA 5ETXA 1CGIE 1O5GH 3FOAA 1TLDA 1SLUB 2Z9LA 5JB9S 2W6ID 4WXVA 1CHOG 2HLCA 1PPEE 4K5ZA 1TE0A 1GMDG 1A7SA 1SSXA 2B7DH 1RTKA 1ZJDA 1ZRKA 3EE0B 1AKSA 3NWUA 1MMJN 1GG6C 7GCHG 2R3UA 2K0QA 3S7KB 4X2WA 2WPJS 4BAHB 2BYAX 3BTQE 1GBCA 1J16A 2B9LA 5EPNA 1D4PB 1NS3A 2GCHF 1B0EA 1UTLM 4ABBA 2VJ1A 2Z9GA 5T1VA 4AFQA 3KYFA 2PSXA 3D65E 1MTNB 3L3TA 3U8RH 3ENSB 3S9BA 3DSPA 3P92A 5EJLA 1GBJA 1OS8A 4TWWA 3SHAH 1TPAE 1GDNA 2JH5D 4HTCH 1KLTA 4F49A 3RDZA 2XC0A 2CF8H 2ZCKP 7KMEH 5LPFA 5FBEA 2F9PA 1OOKB 1FIWA 3HPTB 1ELCA 1ZTJA 1V6DA 3A8DA 2IPHA 3SU2A 1UK2A 2ZHDA 1Z8IB 2OK5A 3MH7A 1QA0A 2QCYA 1ZMNA 5GDSH 4J2YB 2ZFQH 3QTVH 4CH8B 5EXMA 2BX4A 2HVXA 1QL8A 3M35A 1NC6A 2AS9A 1IQFA 3GY8A 2UUKB 1SGQE 2PWXA 3RXJA 1P03A 2GCHG 1GJ7B 3RXFA 1BMFD 4FUFA 4AB8A 5HMAA 1YPJH 1K1MA 2FLRH 4X1QU 1KMHB 3D62A 1LVYA 3A8CA 3ZZ7A 3KQDA 3A85A 5DP9A 3ZVBA 5FPTA 4BAQB 1NFXA 2D2DA 2FOCA 1DXWA 1VZQH 1X7AC 1P2KA 3CNRA 1LVOA 2VU8E 1A1RA 3OEED 1GCDA 4MPWA 3URCA 1LMWB 1YCPH 4D7FA 2YMSD 3A7VA 1RTLA 3SV7A 8ESTE 2YMSC 5AFZH 2PTCE 3PMAB 4AFUA 2QC2A 2ZPSA 3T26A 1EJAA 2KAIB 1KDQA 1MUEB 3I77A 3GYLB 1GBEA 1O5AB 3TJVA 1HGTH 3QO6A 5CDFE 3FO8D 2A7JA 3TVJB 2FIRH 4O9VA 2OBOA 3HKIB 1NU9A 2QAAA 3AK5A 3SUEA 1O2IA 5FPSA 1OYTH 3BTWE 2FYQA 5GIBA 5DKMA 3A82A 1Z1IA 3ZVEA 2Y82A 3KEEA 4JYTA 1V2MT 3G01A 2SNVA 5FX6A 4SGAE 1MQ6A 1UCYE 1KXFA 4Y76A 4NSYA 2ODYB 1C5ZB 1RD3B 3ATMA 4Q7ZA 1MBMA 1GI3A 2O8UA 1SGEE 1P05A 3ZYDA 2QYIA 3MTYA 3LH1A 4R0IA 1FAXA 5EQSA 3S7HB 1SGFG 1KXAA 1BTXA 3TK6A 2ZU3A 2Q6FA 1F5KU 2BY5X 5A2MH 1AFQC 2RG3A 1OP2A 1HAVA 1OWKA 4I7YH 1H9LB 1TNGA 2WPHS 3RMLH 4GHQA 3JZ1B 1C1MA 3KQ5A 4LXBH 4M9FA 5L2YH 1Z8JB 1GI8B 1RTFB 3H09A 2BB4A 1O2SA 2HWLB 4X8UH 4BTTB 3BEFB 4XE4A 2ZU1A 1BB0B 2AMPA 5C0TA 1GI1A 2AIPA 1C2KA 1S84A 1ZRBA 1SLWB 1W12U 3PO1B 1BBRK 2F83A 3LJOA 1IQLA 1KTTB 4JK5A 5T6FA 1QBVH 4AOQA 1K21H 5DO4H 2CHAC 2RA0A 4OM9A 5DP7A 1O38A 3FP8E 4I31A 4FU7A 1O3OA 1BZXE 2J5UA 2ZC9H 4BOHA 4NCYA 5J4QA 2EI7A 2GKVE 2QXHA 2Y6TA 4MDSA 1AUTC 2TGDA 3TH4H 5EU8A 5DSFA 4D8NA 1KXEA 4KELA 1GI7B 1AMHA 2FODA 2J4IA 4UEHH 3RC6A 1W14U 1THRH 1QBNA 5HGGA 2OC1A 1VCPA 1GPZA 2G5NA 1NU7B 3AAVA 1UTQA 1BJUA 2PTNA 1ZHMA 3QTOH 4H6TA 1H8HD 4MG3A 1NBME 5CHBA 4ACBA 4AN7A 2ZIQH 3O8CA 1UTNA 1A3BH 1UCYH 1HDTH 4NG9H 3OFND 3E0PB 1ELFA 1Q2WA 5AHGH 3PTNA 3F0PA 4YOIA 2J9NA 4XRNA 4ZAEA 1C1UH 3P8OA 5DK1A 1DDJA 2H5CA 4FUDA 3SUDA 1OSSA 4GPGA 4YLUA 1J14A 1A5IA 1S6HA 2XWAA 2OINA 2Y7ZA 2UUJB 4H42U 3SOSA 4Y6DA 5AF9H 2BLWA 1V2VT 2TGAA 3MO3A 1NRRH 2F9BH 2VWLA 3A7WA 1O2XA 3BG8A 2FYRA 4E06H 2ASUB 1ESAA 2ILNA 1V2JT 1DE7H 1HXEH 1AZ8A 1E37B 2D8WA 1HAIH 3KIDU 1ELDE 1LHCH 1MKXH 1D3TB 1PPZA 5FCRA 4ZMAH 1UVUH 4RKOB 2ZEBA 2J94A 2PLXA 4CR5A 1P06A 1O2ZA 2ZHFH 1HV7A 1TALA 2A1DB 3BTTE 1AB9B 2SGQE 3RUOA 2FX6A 1F0SA 5CHAB 2ZHWH 1EOLA 1CSOE 1MCTA 1GHVH 3VGCC 2G00A 4ISOA 3BTME 4K1SA 5EQQA 1BRCE 3RXVA 5JBAS 1SGTA 2NU0E 4Y79A 1P10A 1F0UA 5BPEA 5ESTE 1VR1H 2EQNA 2P3TB 1UHBB 1K9OE 3AW0A 3FANA 3FAOA 1XM1A 3P95A 4MPVA 4NZLA 1IQNA 1JBUH 1TYNA 3RXGA 4YO9A 2BXUH 3E8LA 3ZVAA 3K9XB 4HI3A 1QTFA 1EJMA 1SQOA 1ZPZA 2QXGA 5HIZA 4PROA 4YT7H 2KCAA 1XVOA 3FP6E 1AIXH 2ZPQA 1ZJKA 1GJ5H 4NFFA 1A46H 1C5MD 3BG4C 5E0HA 4LZ4B 2ZTYA 1ORFA 3MU4A 1LQEA 1ARBA 5JB8S 1T7CA 2KR7A 4RSPA 1QQUA 5C20A 1KXCA 3RU4D 4K8YA 1O3EA 1SGRE 1GHWH 1UVPA 4B2AA 1TGSZ 2ESTE 1BQYA 1GGDC 3C1KA 2GVFA 1Z1JA 4ISLA 3U98H 1UO6A 2XC4A 1O2GH 1O2TA 4X1SU 3SV2H 3CS0A 1TONA 2Z3EA 1RIWC 1O2YA 1WCZA 2OC7A 2XYAA 5C67A 1O2MA 2OD3B 2VINA 3VFEA 4H4FA 4VGCB 4GCHG 2FPZA 1AD8H 3LGUA 1CGHA 4Q63A 1UK3A 2F9OA 3KQEA 3TK9A 1QJ7B 2BTCE 2CJIA 1SHHB 2GV6A 1TX8A 4X1NU 1DICA 1F5RA 1GBHA 2RA3A 1BMMH 2F9VA 2FZZA 2FTLE 3M5NA 3SN8A 5JPMH 4B1TA 1Y3UA 2YOLA 3BF6H 3LDXH 3EAJA 1GCTC 3M7UA 2WYJA 2NWNA 1A0LA 2OC0A 3M5OA 3F2HA 5IDKA 3RC5A 1S0QA 1S85A 2FOEA 3PWCA 1QB1A 1F92A 2A2XH 5PTPA 1S82A 4Y0ZE 3OEHD 2F3CE 1AVWA 3DHKH 5H4IB 2P8OC 5E0JA 3AAUA 2AMDA 1O3IA 1T8NA 1S81A 4BAKB 1GBMA 1SOTA 1AO5A 5EGMA 1A4WH 4TY7A 2AGIX 1COWD 4GSOA 3MNBA 2XOKD 1INCA 1YF4A 3UQVA 4Y7BA 2A5IA 3RLWH 1DPOA 3PMHB 1TGTA 5I46H 1VCQA 4B6FA 2GX4A 1GI5A 1EZSC 3PTBA 4ZXYH 1FZZA 1O5EH 2WUBA 3E0NB 1EX3A 1MD7A 2K8IA 3ZZDA 1YKTA 1LCYA 1V2KT 1GBDA 3SU3A 2BX3A 3NCLA 3S69A 3HKJB 4FETA 4X8VH 1CBWC 1O0DH 1NFWA 1K0HA 1TGCA 4F48B 2CXVA 4Z1MD 2SGPE 3QUMP 2G51A 3KN2A 1P3EA 3T62A 3SJ9A 2HOBA 2JH0D 4NIVA 1Y5UT 1N1LA 2YNAA 2A2QH 4B2CA 4U30A 1LPKB 2XC5A 2NU2E 3E16B 5DP4A 2C8XB 2Z9IA 4DG4A 2ZFFH 4DW2U 2EY4C 1C2LA 1LPGB 1PPFE 3BIUH 2GD4B 4FU8A 2FI5E 1L4DA 2FOMB 1C5LH 2FXRA 2JIZD 3HGPA 3M37A 1L2EA 1L1GA 4D9QA 2VWMA 4B76A 2SGDE 4ASUD 2JJ2D 3SU4A 4X6PA 1MZAA 3LGTA 1ZSJA 1P2JA 3WW7A 2Y7XA 1EZQA 1YPEH 1GG6B 3BTFE 3RXLA 1LHDH 1XUKA 3M7TA 2V7QD 1QL7A 2ULLA 2G8TA 4CR9A 2ZGXH 3Q3KA 2C93B 1D3DB 1P0SH 5DG6A 3R3GB 2GMTC 4F4OC 5C3NA 3HATH 3SGBE 5GWZA 3ZZAA 1NRQH 5EG4A 2F9NA 2G52A 2P59A 1C1SA 4IC5A 5BRRE 1QIXB 1AE8H 1GMCG 3W94A 5C0UA 1SGCA 1FPCH 4MNYA 5CMXH 4CH2B 7LPRA 1C1PA 2G4TA 1DLEA 3SV8A 3HGNA 1EAIA 1J9CH 5GXPA 1C2MA 3N7DA 1YPGH 1O5CB 2C3SA 1NPMA 3M3SA 2HPQH 3SORA 1UTMA 4ZUHA 3PV2A 3SNCA 2J2UA 3RXDA 5AVDA 1W0KD 3JZ2B 3A83A 1BHXB 1OWIA 3KCGH 5A8ZA 3TGKE 4K60A 4XDEA 1ABJH 2QF4A 4Y8YA 1RRKA 1W3CA 3UIRA 2J92A 2A5AA 2EI8A 3KF2A 1ZGIA 1GMDF 1C5YB 2J97A 5LPRA 3A86A 3RXPA 1F0RA 1UTOA 7GCHF 2Y5FA 2ZTZA 2BY6X 3MNSA 1JOUB 3SQHE 2BOHB 2W5EA 3UR6A 1H1BA 1LDTT 1AUJA 1QGFA 1O37A 2FESH 1G3DA 1GHXH 1FN6A 4UONA 2B8OH 2AMQA 3AASA 1DFPA 1XVMA 1EQ9A 1WSSH 3EGKH 3GY4A 4TYDA 4X2XA 5DP8A 5DP5A 1MTWA 2OXSA 2ZU5A 5F53A 3EDXB 1VKYA 1CQQA 2BQWB 4DVAU 1KSNA 1T32A 5EOKA 4OGYA 3TK5A 4NA7A 2HNTC 5TCAA 1SQTA 2WHXA 4WMEA 1EZXC 1XKBC 4ZKRU 1SQRA 1UVTH 1ETTH 2V35A 2JKHA 2ZA5A 3DFJA 3A84A 4ABAA 5IK2D 1WQVH 3M7QA 3UNSA 5L2ZH 3V7TA 3LGYA 1NBMD 5C1XA 2A4QA 3VB7A 2ZU2A 3ZVFA 3M36A 4OGXA 4JYUH 1UTPA 1YPHC 3K6YA 1MH0A 3DA9B 1H8IH 5C5NA 1LQDB 1MBQA 3DUXH 1XUHA 3K6ZA 2C8YB 1AFQB 4QT8C 1TMTH 2BDHA 1J15A 4WH6A 2XNIA 2W7UA 4B75A 4X8SH 1GL1A 5B6LA 5F8XA 1N8OC 1SGNE 2XNDD 1Z8GA 2O8WA 1FN8A 4WJG2 1W2KH 1TIOA 1SGDE 1BITA 1CGJE 2TIOA 2Z6BD 1F5LA 2J38A 2VIWA 3SHCH 5FX5A 1PQAA 2PKAB 1DM4B 4A6LA 1QCPA 1GDUA 1S0RA 1SKYE 3SU0A 1GI6A 2G5VA 1FY5A 3RU4T 1V2WT 2AEIH 2C90B 1KLIH 1SBWA 3AW1A 1O5FH 2ANMH 3MNXA 4I33A 1AHTH 3PWBA 3MOCA 1A0HB 1MTSA 1AKSB 1HAYB 2TGPZ 3O8DA 4R8TB 4K1TA 3NK8A 2CHAB 2R2MB 3I78A 4UDWH 3VB6A 4YLQH 2C8WB 3SO3A 1QNJA 3QGJA 3LGIA 6LPRA 1AZZA 3ITIA 3PRBA 5E2PA 4BXSA 2TBSA 4NA8A 4JZDH 1ZSLA 1A5HA 1OKXA 1BBRE 2ZGBH 3T25A 1DWBH 2P3UB 1B0FA 3ZZCA 3GCTF 2OP9A 4FU9A 3D49H 1HB0B 4LZ1H 1GBFA 1MKWK 1TRYA 1NRSH 3I29A 1EP5A 2B5TB 2DUCA 1MTUA 2QY0B 1LHEH 3A89A 2BDCA 1FV9A 4DIHH 1O5BB 3M3VA 1P2OA 3CP7A 1IAUA 1C9PA 1QY6A 1T8OA 1BMNH 2GCTC 1BRBE 2QF3A 4ZCNA 1P04A 3RMNH 2LELA 1GI2A 3UTUH 3NXPA 3RXMA 4ABFA 1HLTH 2BLVA 1TOMH 1P2QA 3AVZA 1O2OA 1UTKA 3A7ZA 1QL9A 1RGQA 1YC0A 3N7OA 3TIUA 1W13U 4JZFH 1CA0B 2VWNA 1FX0B 1DWEH 3GCTG 4XBDA 3E91A 3MH4A 3T27A 3SU1A 2C4FH 1NO9H 2HVYB 2GZ9A 3OX7U 1KYNA 2H9EH 4DJZB 4HFPB 3MU1A 1TX6A 3ZVDA 5EXNA 4B2BA 3QK1A 3QZRA 3V3MA 1BA8B 1RXPA 1O2PA 4AG1A 1TBRH 2AYWA 2SGAA 1T4UH 1IQJA 1D3PB 1MTNC 2FOBA 5C5OA 1VITF 3GDSA 1SGYE 4BXWA 3DD2H 3GCHB 2KCPA 2Q1JA 1ELTA 3F0OA 1EPTA 1T31A 3N7EA 3DSOA 1FXYA 2BDYA 2FI3E 2WPIS 3A81A 1DITH 5EXLA 3SYJA 4IS5A 1NRPH 1ZYOA 2GV7A 1O33A 3QN7A 2AGGX 5EJ1A 1C5QA 2H5DA 2IJOB 3SNDA 5EIYA 1TNJA 3FKSD 1YGCH 3TJNA 2P16A 4H6SB 3UREA 1BRUP 1ETSH 3VGCB 1CT4E 2IN2A 3ZVCA 2GZ7A 1THSH 1QURH 1V2PT 3SBKA 1BBRH 2WV5A 3MI4A 1V2OT 1Z6JH 3NRLA 3HK3B 2WPDD 1EJNA 2PR3A 2VVUA 4AORA 2Y81A 3PMJA 1VITG 2OUAA 4NGAH 3UUZA 1E0FD 2PHBA 1PJPA 1T8LA 2UUFB 1HAXB 2PW8H 1GHAF 1TAWA 2WYGA 3BSQA 4NFEA 4DT4A 4DT7B 2STBE 4Y10E 2IPQX 1QB9A 1YYY1 2BQ6B 1HRTH 1E79D 2BZAA 2FEQH 3BV9B 1BRAA 1V2TT 4XBBA 4Y8XA 4B74A 3VXFH 1NM6A 4XBCA 1ZMJA 2O8LA 2ZCHP 1ESBA 1DT2A 1UMAH 3H7TA 2I6SA 1WBGB 3BTGE 1S5SA 3GDUA 3MH5A 4GUXA 4AG2A 4O3UA 1JIMA 1DY8A 1GJBB 3U8OH 2ZECA 3CENA 5LGOA 2OQ5A 5GCHF 2BVXH 2QXIA 1NRNH 4K2YA 4FXGH 4K69A 3RM2H 2QGRA 2RDEA 3QLPH 3M5LA 3C27B 1IQGA 3KHVA 3GICB 4A5TS 3CS7A 2FTMA 2C8ZB 1GHAG 1KY9A 2G81E 5EODA 4AX9H 1RIWB 1F7ZA 2ZDNA 2WV9A 2VIPA 1D6RA 4CRCA 1XUGA 1HAOH 1GBAA 3U9AH 1Z8RA 1DWDH 4A1TA 5F03A 2ZFRH 4YT6H 1HXFH 4DGJA 3SV6A 2PGBB 1WUNH 3SJIA 4NIWA 1UHBA 2VGCC 1C5TA 1K1JA 2AIQA 2JETC 3QZQA 1FUJA 3SUGA 3SGAE 1EATA 3TJUA 3TNTA 1TQ7B 1M9UA 1NESE 4B73A 4KGAA 3T28A 1O3LA 1BT7A 1FY1A 1PQ5A 2ZDAH 2CMYA 5GCHG 3BTHE 1BTYA 1OWEA 3PLPA 3GOVB 1DSUA 3BTEE 4OS4A 1S6FA 1C2JA 3UFAA 2QXJA 3E3TA 1AGJA 4I8GA 3PLBA 4O03A 1K1IA 3PO1C 4CRAA 1O31A 2P3FH 3F6UH 4ABEA 1VCWA 1HAZB 1IQMA 4XOJA 3ZZ4A 1K28D 1B5GH 1SQAA 3IG6B 4E7RG 3TH3H 2NU1E 3F2FA 4NSVA 9ESTA 1QZ8A 1MZDA 1ZPCA 3U1JB 4YOGA 4P02A 1O3AA 1KTSB 2ODQA 2HRVA 1DOJA 4A92A 2BD8A 1O32A 1VGCC 2H1UA 1WDIA 2EEKA 1ZOMA 3PRDA 1LKAA 2PUQH 2P94A 3OY6U 1XUFA 3B23B 1MQ5A 3LOXA 3SW2B 4GCHF 3RXBA 1P2MA 2HPPH 3MU0A 1A3EH 1CBWB 1GDQA 5GJ4B 3ZZ5A 2SNWA 4JZIA 3LJJA 4JCNA 3GCNA 1EPTC 1TABE 2BHGA 5FPYA 1O35A 2BVRH 1E36B 2XCNA 1C1NA 4ASHA 2F4LA 3OU0A 1QRXA 2XW9A 1O3FA 9LPRA 2VH6A 1NZQH 1FI8A 1ANEA 1C5UA 3K2UA 1RS0A 5A0BA 4Q2KA 3P6ZB 4RT1A 3V12A 2YNBA 5T3HA 1OP8A 3H7OA 5ESBA 3WWFA 4ZKOU 2PKSC 2V3OH 4E7NA 2LP6A 3MO6A 1CU1A 3A7TA 2W3IA 1ZGVA 4Q7YA 4AB9A 1P57B 4Q4LA 3RXAA 5HM9A 1N6XA 3SJ8A 1DXPA 1NFUA 2ZDLA 4SGBE 2QV1A 4AFZA 2BY8X 2GTBA 4FUEA 2M5TA 1MAXA 2AFQB
chains in the Genus database with same CATH topology
1HAHH 1HJAB 1HJ9A 1AWHB 3MO9A 3OTJE 1SLXB 3B8JA 1PYTD 4MQAA 1D3QB 2VIDA 4TPYA 2UWPA 3GY3A 2XWBI 2PGQB 3LC5A 1PQ7A 2ZU4A 4X0WU 4AGJA 4ISIH 3BEIB 3P8FA 1GHYH 5LPEA 1G30B 2WPKS 2BD3A 4DIIH 3ATLA 1V2LT 4ESTE 2WUCA 5K0HA 1E35B 1HFDA 3UPEA 1ETRH 3KQBA 1PPBH 1EB2A 3M61U 1UVOA 1AB9C 2PV9B 3A7XA 1CO7E 4U2WA 4OS1A 2A4OA 2FOGA 1TNIA 5CHAC 1MCVA 1CE5A 2BDAA 1C9TA 4UD9H 2BY9X 3FP7E 2Y80A 2ZQ1A 1TGNA 1AN1E 1GBIA 5JYIA 1HJ8A 1O3DA 3FZDA 1P02A 2FOFA 4ZXXH 3LKWA 1K1OA 1C5SA 1AVGH 6CHAB 1EASA 1XXDA 4TY6A 4BAOB 4WVPE 3MH6A 2R2WU 1HPGA 4BNRA 2VIOA 2FOAA 2XRCA 1EAXA 1C2FA 1VJAU 1W0YH 1SHYA 3P8GA 3ZV9A 3RC4A 1PPCE 3UNRA 4X6NA 3F9GA 4UFEH 1GJ8B 2EC9H 3ATWA 2UWOA 4E05H 1ELVA 1C5WB 1K1LA 2A31A 2A4RA 1GJ6A 4CRBA 2BD2A 3P70B 1ZLRA 2Z3CA 1FQ3A 1ZHPA 2O8TA 4Q7XA 4O97A 3SGQE 1HUTH 1GMCF 2GGVB 4FUJA 1ABIH 4XSKU 4CRGA 4I8LA 4ISNA 2A0QB 1SOZA 3STJA 5SGAE 2NU4E 3MMGA 2ZHEH 1ARCA 2B0FA 1H9HE 3NUMA 3RMOH 1SFQB 4U01A 5FHTA 4NIXA 4ZHMU 4OS5A 2RCEA 3P17H 4JK6A 2ZP0H 2FI4E 1W8BH 5EW1H 3SV9A 2BQ7B 3RXHA 3LPRA 2A7HA 3SU6A 2VH0A 1P9SA 3EA9A 2W7SA 3GY6A 1C2GA 3P8NA 1TPPA 3GY5A 1GJ4H 4INLA 1SVPA 1GBLA 1GJDB 1N8OB 2ZO3H 6GCHG 1HIAA 3BTDE 2TGTA 1THPB 1YP9A 1EKBB 1O2JA 1H4WA 1SB1H 3SJOA 3TH2H 2FM2A 4KP0A 1GMHF 1L0ZA 1TX7A 2EA3A 1DY9A 2QIQA 4OS2A 4KTUA 2R0LA 4UE7H 2VVCA 1ZHRA 1W0ZU 4ZHAA 3QDZB 3RM0H 2H6MA 4CREA 2R0KA 2ZFTA 2SGEE 3ZZ8A 1ZR0A 3FZZA 1JXPA 3ESTA 4Y71A 1AE5A 4IW4E 1TPOA 3ZZBA 4MVNA 1L4ZA 1V3XA 5IYTA 4A7IB 4ABJA 1QRWA 5JBCS 2K1QA 2ZKSA 5DPAA 3E90B 3E6PH 1ZZZA 1O2VA 1OX1A 1HYLA 5DP3A 1AWFH 1K22H 1O2KA 2THFB 2GT8A 1Y5BT 2I6QA 2O9QA 2ALPA 3STIA 3UNQA 1GMHG 3LH3A 3MWIU 3RXQA 2A45B 4KTSA 3IITA 2OCVB 1IHTH 1BCUH 1WQSA 4GAWA 1O2UA 2RDLA 7ESTE 3BN9A 4MNWA 1ZPBA 2O8MA 1WYKA 3UR9A 3LGWA 2ZDMA 3QGNB 1QB6A 1BTUA 4ISHH 1ZTLA 1C1WH 3O8RA 1QHRB 2ZI2H 4Y8ZA 4MTBA 4ZHLU 2ZTXA 5EW2H 1CT2E 5FXLA 1YLDA 3ZZ6A 5A0AE 2BY7X 1C4V2 2CF9H 2Z94A 3W95A 4IN1A 3L6PA 1O3JA 3LGVA 4KTCA 4WH8A 1HBTH 2HALA 2IOTA 1NN6A 2W26A 4WY3A 1F0TA 1KXDA 4ABHA 5DJ7A 4I32A 4OS7A 1UTJA 1JWTA 3FVFB 3GY2A 1JRTA 1OPHB 1SI5H 1LVBA 4LK4A 2OTVA 1O3MA 2ANYA 4K3JA 1EP6A 2ZGHA 3RMMH 4RKJB 3RXIA 4D7GA 4Y0YE 2BD4A 1BTWA 3U1IB 3URDA 2DE8A 2KAIA 1FNIA 3MYWA 3TGJE 4IMQA 2XTTB 3KGPA 2FOHA 1O2RA 1C2DA 1ANDA 2BLOA 1AQ7A 2P93A 1G36A 1GJCB 1SR5C 3E1XB 4CRFA 1NTPA 2BDIA 3A88A 1V2ST 4UFGH 3SNEA 3T5FH 1GVLA 1O3GA 1SGPE 4CHAC 4IGDA 4FUBA 2Z9JA 2Q6GA 3A8BA 2XCFA 5LH8A 1SFIA 2FX4A 1WU1A 1OWDA 3VB3A 1YCPK 3F68H 1GBKA 1P11E 2ANKH 1J17T 1SLVB 3TU7H 1C4U2 2BDGA 4ABGA 1BMLA 1ELAA 1H9IE 1C5XB 1TGBA 2BM2A 4ZKSU 1P09A 2FWWA 1W7XH 3M5MA 4I8HA 2AGEX 3NPSA 4IC6A 1WOFA 1ACBE 2H2ZA 3ELAH 3ZZ3A 1A0JA 3ODFA 4JYVH 4JZEH 3RXOA 1P2NA 3RXSA 4DCDA 1BTHH 1YM0A 1O5DH 2ZZUH 1KLJH 1QJ6B 1PFXC 1D9IA 2ANWA 1CT0E 1T8MA 1P01A 2BOKA 4OS6A 3SI3H 1TMBH 1GJ9B 2BXTH 1IOEA 3RP2A 1MKWH 2AERH 5C1UA 4YESB 1HAPH 2XBWA 1OP0A 1C5NH 1Y8TA 1Y5AT 1TWXB 2ZDKA 4AYVB 3Q3XA 2FLBH 1IHSH 2TPIZ 5FCKA 3Q77A 3HK6B 3ATKA 4IBLH 2GZ8A 3S9AA 1DVAH 4NWKA 1WTGH 3PB1E 1YPKH 4MPUA 4Z0KA 1KDQB 4Z6AH 3MU8A 1C2HA 1TNHA 2BLQA 1C1RA 2SGFE 2OC8A 2VIQA 1LHGH 1T4VH 1V2QT 1ZTKA 3LIWA 4JMYA 4WWYA 1RFNA 2JETB 2VGCB 3SQEE 3TJOA 2PSYA 4JZ1A 1O3HA 1CHGA 2QF0A 3SI4H 1GHBF 1DWCH 4THNH 2H9TH 2GP9B 5JDUB 1QRZA 4MNVA 1QA7A 3UWJH 1V2UT 3SNAA 4FUHA 1TPSA 2V6NA 5CE1A 1TOCB 2D26C 4CRDA 1EUFA 2V0BA 4BANB 1QFKH 1BMAA 2A4GA 1OWJA 4INHA 3ODDA 1TB6H 4D9RA 1O34A 1A61H 4IMZA 2P95A 1VITH 1FMGA 4FVBA 5B6OA 1LHFH 4I8JA 2VB0A 1TA2A 1W7GH 1WTHD 1Y3YA 1XXFA 1UVSH 5AFYH 4YTAA 4NIYA 3A87A 2VIVA 1HAVB 1Y3XA 2JH6D 5F8TA 4MNXA 3KQCA 2VVVA 2R9PA 3RXTA 1FY4A 4AGKA 1C2IA 1YCPM 2UUYA 2XBXA 1O2QA 3O8BA 1O2NA 1C5VA 1GHBG 1VGCB 2F91A 4TPIZ 2HNTE 2GDDA 1LTOA 2UWLA 5GPIB 5F6MA 4X6OA 3MU5A 1UCYK 1GL0E 4U32A 1EPTB 3F9HA 1TRNA 3DT0H 3GISB 3BG4B 3V0XA 3ZYEA 3PROA 1G3EA 5G4BA 1G3CA 1WAYB 5E2OA 4UFDH 1P12E 2VWOA 5DGJA 1EB1H 1AFEH 3QWCH 1N6YA 1SGFA 1YPHE 1C1TA 2BDBA 5FBIA 1GGDB 2ZDVH 4X2YA 1Y59T 1ZMLA 1P8VC 1O36A 2BMGB 2PKSB 4NA9H 3OYPA 2DE9A 3NKKA 2ZF0H 1TBZH 1C1QA 2ZNKH 1W11U 5C1YA 4IN2A 2W3KA 1Q3XA 3WY8A 2ZQ2A 1C2EA 1C5OH 1JMOH 3VXEH 4K1EA 3BIVH 1V2NT 2G4UA 1K1NA 1CA0C 4X8TH 1CVWH 2F9UA 2FS9A 2ZG0H 3Q00A 2AH4X 3UWIA 4HGCA 1MKXK 5J4SA 1GCTB 1Q31A 5F8ZA 2ZGJA 1O2HA 3U8TH 2HNTF 1DUAA 5C2ZA 2ALVA 2FS8A 3RXUA 5TJXA 5HYOA 2FP7B 1NY22 4WMFA 1O2WA 4FUCA 1EZUC 5L30H 3LU9B 3GCHC 1GI4A 4AZ2B 4FUGA 2P8OB 4X1PU 1E34B 4HZHA 2Q6DA 3TPIZ 1C1OA 4BAMB 4WXIA 4NWLA 2Y5GA 4ZKNU 2STAE 1E38B 1B7XB 8LPRA 1FJSA 3A80A 3RXKA 1MD8A 2ZFPH 1NROH 4Y7AA 1A2CH 1D6WA 2CN0H 1L1JA 4X6MA 1XUIA 3GCOA 1EXFA 3A7YA 1Z7KA 1W10U 1BTPA 1QJ1B 2ZWLH 1O2LA 2BZ6H 1G32B 4MPXA 1SMFE 3TLOA 1P3CA 3RXCA 1P9UA 1OXGA 4ABDA 3B9FH 3Q3YA 3VPKA 4A1VA 1FLEE 1BUIA 3SZNA 4O3TA 4INKA 5ABWA 3VB5A 3EQ0H 1TNKA 2XXLA 1WV7H 1O30A 2HGTH 2Z3DA 2Y5HA 2ZGCA 4D76A 1ANBA 1FY8E 3TITA 5EPYA 1U6QA 4LOYH 1QBOA 3IWMA 1BIOA 1SG8B 3SJKA 4J1YA 1TMUH 3EYDA 1BHXF 5L6NH 2WINI 1HCGA 4A1XA 2A32A 4XFQA 2ODPA 3GYMA 8GCHF 4NZQA 3MNCA 3MFJA 1DANH 1QQ4A 3T29A 2FMJA 1V2RT 1ID5H 4KKDA 4MLFB 2J34A 4M7GA 3ZVGA 2GDEH 1GVZA 3GDVA 1PPGE 1LKBA 1PYTC 5E8EH 1RJXB 4DURA 1CA8B 2GMTB 2ZPRA 3TGIE 1G2LA 5HM2A 1TA6A 3PYHA 2BVSH 4WMDA 1XKAC 1PQ8A 4GVUA 4GLYA 4X1RU 1J8AA 5JBTA 1G9IE 3KL6A 3EA8A 3LC3A 3MHWU 1OYQA 3RXEA 1FONA 1O3PB 1P2IA 1S83A 4DY7B 1NT1A 4BTUB 4YZUA 4YM9A 5I25A 3ATIA 3FFGA 5T6GA 1YBWA 3F1SB 2R3YA 5A8YA 8GCHG 1VJ9U 2VNTA 1PPHE 3LONA 1HAGE 1Y3WA 1H8DH 3V13A 3ZZ9A 1K2I1 1UK4A 4Y11E 3L33A 3SUFA 1SGIB 5T6DA 1BTZA 4ABIA 3EA7A 1MAYA 3SNBA 1ELBA 5JBBS 4CBOA 5DP6A 2QN5T 3NZIA 1TQ0B 5A0CA 1LO6A 4K8BA 1DS2E 3F9EA 3S9CA 5A09A 1FDPA 2FO9A 2PUXB 1BJVA 2V3HH 5K7RA 1DSTA 1O3BA 1GHZA 2WPMS 1GWAA 4WF8A 5EQRA 2XBVA 5TCCA 2GT7A 3PV4A 2OQUA 1BOQA 6GCHF 1G37A 2LPRA 1XUJA 2BD9A 1C5RA 1XX9A 1SL3A 1JRSA 1TNLA 1Z71A 2LNCA 3T2NA 4GHTA 1ANCA 1C4Y2 4B71A 1G3BA 2CGAA 2PFEA 3QX5H 1GBBA 1TBQH 3F9FA 3R0FA 1ELEE 3UQOA 3K65B 4CBNA 1GI0A 1SPJA 1LVMA 1DUEA 1O3CA 3KNXA 4ZROA 1ESTA 3GY7A 1C5PA 4RN6A 4VGCC 4AYYB 5FAHA 4BTIB 1BDAA 3A8AA 3BEUA 1F2SE 4AFSA 1IQIA 1SC8U 2TRMA 4DOQA 6ESTA 2SFAA 1HJAC 1JIRA 2OLGA 4UFFH 3D23A 4TWYA 1IQEA 4FUIA 2ZCLP 3RXRA 1KXBA 3VB4A 1FIZA 3BTKE 1O3NA 2BD5A 1ZSKA 1FY3A 5A8XA 2A7CA 1A5GH 1TFXA 5E0GA 1Y3VA 1YLCA 1DX5M 3PMBB 1YPMH 1C1VH 3RLYH 1GBTA 3UOPA 1L1NA 3PLKA 2D1JA 1FPHH 3M3TA 1TRMA 1AU8A 2Z7FE 2ZFSA 3DFLA 3TNSA 5HXFA 3UY9A 3LT3A 1MTVA 3Q76A 8KME2 3PM3A 1AY6H 2ZHQH 2FDAA 2A5KA 3U69H 1ELGA 1MU8B 3OY5U 2OBQA 4CHAB 1AI8H 1GJAB 4X2VA 1K1PA 1GI9B 1O39A 2Z9KA 2XBYA 1CHOF 3RU4E 1KIGH 1MU6B 3OSYA 4YOJA 3ZV8A 3H5CB 1IQHA 1EAUA 1UJ1A 3SU5A 4FVDA 3UOUA 2WV4A 3VEQB 1YPLH 1G2MA 1XMNB 6CHAC 1QR3E 2NU3E 1GVKB 1HIAB 1EOJA 2QA9E 4ZH8A 2WPLS 1HNEE 2BD7A 1O3KA 2G55A 2J95A 1AVXA 4I8KA 2GCTB 1EAWA 4Q80A 1IQKA 1NFYA 1DLKB 2CV3A 2EI6A 1FAKH 1OWHA 1Z6EA 3S0NA 1LPZB 2H9HA 2PKAA 5ETXA 1CGIE 1O5GH 1TLDA 1SLUB 2Z9LA 5JB9S 4WXVA 1CHOG 2HLCA 1PPEE 4K5ZA 1TE0A 1GMDG 1A7SA 1SSXA 2B7DH 1RTKA 1ZJDA 1ZRKA 3EE0B 1AKSA 3NWUA 1MMJN 1GG6C 7GCHG 2R3UA 3S7KB 4X2WA 2WPJS 4BAHB 2BYAX 3BTQE 1GBCA 1J16A 2B9LA 5EPNA 1D4PB 1NS3A 2GCHF 1B0EA 1UTLM 4ABBA 2VJ1A 2Z9GA 4AFQA 2PSXA 3D65E 1MTNB 3L3TA 3U8RH 3ENSB 3S9BA 3P92A 1GBJA 1OS8A 4TWWA 3SHAH 1TPAE 1GDNA 2JH5D 4HTCH 1KLTA 4F49A 3RDZA 2XC0A 2CF8H 2ZCKP 7KMEH 5LPFA 5FBEA 2F9PA 1OOKB 1FIWA 3HPTB 1ELCA 1ZTJA 1V6DA 3A8DA 2IPHA 3SU2A 1UK2A 2ZHDA 1Z8IB 3MH7A 1QA0A 2QCYA 1ZMNA 5GDSH 4J2YB 2ZFQH 3QTVH 4CH8B 5EXMA 2BX4A 2HVXA 1QL8A 3M35A 1NC6A 2AS9A 1IQFA 3GY8A 2UUKB 1SGQE 2PWXA 3RXJA 1P03A 2GCHG 1GJ7B 3RXFA 4FUFA 4AB8A 5HMAA 1YPJH 1K1MA 2FLRH 4X1QU 3D62A 1LVYA 3A8CA 3ZZ7A 3KQDA 3A85A 5DP9A 3ZVBA 5FPTA 4BAQB 1NFXA 2D2DA 2FOCA 1DXWA 1VZQH 1X7AC 1P2KA 1LVOA 2VU8E 1A1RA 1GCDA 4MPWA 3URCA 1LMWB 1YCPH 4D7FA 3A7VA 1RTLA 3SV7A 8ESTE 5AFZH 2PTCE 3PMAB 4AFUA 2QC2A 2ZPSA 3T26A 1EJAA 2KAIB 1KDQA 1MUEB 3I77A 3GYLB 1GBEA 1O5AB 3TJVA 1HGTH 3QO6A 2A7JA 3TVJB 2FIRH 4O9VA 2OBOA 3HKIB 1NU9A 2QAAA 3SUEA 1O2IA 5FPSA