1QY6A

Structue of v8 protease from staphylococcus aureus
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
216
structure length
216
Chain Sequence
VILPNNDRHQITDTTNGHYAPVTYIQVEAPTGTFIASGVVVGKDTLLTNKHVVDATHGDPHALKAFPSAINQDNYPNGGFTAEQITKYSGEGDLAIVKFSPNEQNKHIGEVVKPATMSNNAETQTNQNITVTGYPGDKPVATMWESKGKITYLKGEAMQYDLSTTGGNSGSPVFNEKNEVIGIHWGGVPNEFNGAVFINENVRNFLKQNIEDINFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a universally employed enzyme: V8 protease from Staphylococcus aureus.
pubmed doi rcsb
molecule tags Protease
molecule keywords serine protease
total genus 53
structure length 216
sequence length 216
ec nomenclature ec 3.4.21.19: Glutamyl endopeptidase.
pdb deposition date 2003-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qy6A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qy6A02
3MU4A 1BBRK 4BANB 3LGWA 3RXPA 2BVSH 5T6FA 3TIUA 1ZR0A 2AMDA 1BBRE 4BNRA 3GY4A 2QIQA 3M3SA 1GI8B 3BIUH 4ISHH 3QZQA 2O8UA 4O3TA 4IS5A 1GCTB 1SB1H 1C5QA 2BD3A 2ZF0H 3MH5A 4YT6H 5DO4H 3D62A 1Y3YA 1LPZB 1SOZA 1C1TA 1UK3A 3MU5A 3QN7A 1IAUA 1IQEA 3E91A 4X1NU 3ZVGA 3ZYEA 4E06H 3T26A 1TONA 3KGPA 4HZHA 1H8IH 1ETSH 5ETXA 1C5MD 1JWTA 1GJBB 2CF9H 3M5OA 2SFAA 1TX7A 2P95A 1SMFE 3T2NA 1Z8RA 1O3DA 2AFQB 3BTGE 3BEIB 1AZZA 3T5FH 3CS7A 1IQLA 1ANCA 3H7OA 5A0CA 4ABAA 3FP8E 1HAYB 4WH6A 3VXFH 2ZIQH 5GXPA 3MNSA 1SGFG 2R0LA 2ZPSA 3HATH 4NWKA 1GBBA 4O3UA 3SI3H 1OOKB 1SL3A 1Y3XA 4YO9A 2ZKSA 1VCWA 5FX5A 3UTUH 2ASUB 4AOQA 4YLQH 3UWJH 2A1DB 2JETB 4GPGA 3PWCA 3SU0A 2CMYA 5FPTA 2JH6D 4A1TA 1N6XA 1A1RA 1OSSA 1O31A 3U1JB 1PPBH 3H7TA 3GCTF 3RXHA 2D1JA 4WMFA 4B71A 3UNRA 2VH6A 2G81E 5H4IB 1SFIA 5C1XA 1O3IA 4INHA 5J4QA 4YT7H 4UONA 3UNSA 1GHZA 3O8BA 4MPVA 4DOQA 1O2QA 2FLBH 1KTSB 1ZJKA 1FDPA 5CMXH 5GDSH 1XMNB 4X2YA 4TY7A 3LH3A 1DY9A 3ATMA 3ITIA 1A0HB 1TIOA 3ZZBA 1IOEA 4JZ1A 2P94A 4CRDA 1SLXB 1DOJA 1IQKA 4I8LA 2ALVA 2C8YB 3LGYA 4KTCA 2QGRA 4MDSA 4D9RA 3E0PB 2PR3A 1O39A 3SOSA 5A0AE 1SGEE 5FHTA 1GBLA 1W8BH 3JZ2B 3NK8A 2BY9X 3LGTA 1PPCE 5EGMA 1WU1A 4MVNA 4TPYA 3L3TA 2OCVB 1IHSH 3E90B 1UCYH 4AYVB 2ANMH 2FPZA 2W3IA 1NRQH 4MNXA 1NS3A 3TPIZ 2XC0A 3VGCB 1GHAG 1E37B 2IN2A 1FXYA 4BXWA 1CBWB 3UQVA 1C1OA 1S84A 5A8ZA 3L33A 1SGDE 2BD9A 4IGDA 1AKSB 2GT8A 3Q00A 3SORA 1PQAA 3D49H 2FDAA 7KMEH 2BLOA 1TRYA 4TWWA 1DWEH 2ZA5A 4I32A 4FUEA 3A7XA 1S0RA 1UTOA 4O03A 1A3EH 3Q3KA 1YGCH 2ZHWH 1K28D 1SGIB 2VGCC 4B1TA 1C2GA 5EU8A 1A7SA 1P2JA 2FIRH 4A5TS 2HNTF 1Z8IB 1M9UA 3U1IB 1O5DH 1HV7A 1TE0A 4IC6A 5TCCA 5A0BA 2ANYA 2OQUA 3VEQB 2BZAA 5L30H 1D3TB 4X1SU 2UWLA 3QZRA 2F9NA 1ANBA 2UUFB 1BHXB 5E0GA 3SV6A 1VGCB 3A7WA 2BVRH 3RU4E 5K0HA 1V2OT 1YPLH 1OWJA 3LDXH 1DM4B 1EB2A 2C8ZB 1UCYE 3BF6H 1CHOF 1HJAB 2Y5HA 1BTZA 1DT2A 3I29A 3V12A 2H9HA 1NRNH 1GJ6A 2P59A 4B75A 4YOIA 2A4RA 2ZTYA 2BDYA 4GHQA 3AW0A 3S9BA 1C1PA 1GBCA 5EXMA 2QXGA 2AS9A 3K6ZA 3M5LA 4JK5A 1BT7A 4OS2A 3BTKE 2BVXH 8KME2 2G00A 3SJKA 8GCHG 4A1VA 2TGTA 1IQGA 3MO9A 1HAIH 1LKBA 3RXFA 4AG1A 1CA0B 2VIWA 1ELFA 3LKWA 3A84A 5EQRA 1HGTH 1ZLRA 3A83A 1UVOA 2P3FH 3K2UA 4UDWH 2LNCA 3P95A 4BAOB 4BAQB 1YPHC 1G32B 3MTYA 1QBNA 4IN1A 4WH8A 4FUFA 4B76A 2FI4E 3SV7A 2SGEE 2FX4A 1QBVH 1TBZH 1K1MA 7GCHG 4TY6A 4ZKNU 1BTUA 1BZXE 1SGRE 2W3KA 3NPSA 3BEUA 1CU1A 2PKSC 1O32A 3OY5U 1EPTB 6GCHG 2FX6A 4Q7YA 1C1WH 5A8XA 2G4TA 1O3BA 2ANWA 1MTVA 4DGJA 1U6QA 1Y3WA 2B0FA 5BRRE 2NU4E 3CENA 1BMMH 2STAE 3P92A 4F49A 2TIOA 2ZU4A 1TAWA 4DT7B 5LGOA 1JXPA 5PTPA 2Z94A 4X8SH 1YPKH 2R0KA 1L1GA 1D3DB 4WMDA 1TGBA 1G9IE 1PPHE 5HXFA 4K5ZA 1G3DA 5DJ7A 3UREA 1KXCA 1XKAC 1WSSH 3B8JA 2FOAA 2BXTH 4D9QA 4CR9A 2KAIB 1C2FA 3KEEA 3SQHE 3BTFE 4DIIH 3ODDA 1UHBA 4D7FA 1FNIA 1IQNA 1L0ZA 1P9UA 1BBRH 3A8DA 1Q31A 3PTBA 4IN2A 3ZZ4A 1JRSA 4KTUA 1O2KA 1EAWA 2AGGX 4DVAU 3LGUA 1F0UA 3SI4H 1XUGA 1C1RA 5T6GA 3MH6A 1RFNA 2XBVA 4GCHG 1ORFA 2GD4B 4THNH 1AU8A 4FUIA 1G2LA 3A7TA 2P93A 4ISNA 1QRWA 1A5IA 2XNIA 1C2JA 3LGVA 1BUIA 3ZYDA 1GJ5H 5EQQA 1HAZB 4D8NA 3MH7A 1DWDH 4TPIZ 1FAKH 2BDHA 5DP7A 4BAHB 1HJ9A 4XBDA 2RG3A 3A8BA 3CP7A 1BITA 4FU9A 1NY22 3FP7E 1TPAE 1INCA 3PYHA 4B74A 1GG6C 4Y11E 4FUJA 1O3NA 1J17T 5F03A 1A46H 1W7GH 1S82A 1QFKH 1ANEA 4R0IA 3T25A 1EJAA 1SBWA 3ZVCA 4Y0YE 3K6YA 4OS1A 1G2MA 3LH1A 1O2RA 1ZPBA 1TYNA 1GBTA 1AD8H 3RXVA 4AZ2B 1K22H 1K1IA 3FAOA 1CBWC 1QQ4A 2ZDKA 3DHKH 3U98H 2H9EH 5CE1A 5CHAB 1EZSC 1WV7H 1QA7A 4I7YH 1XUHA 1QJ6B 4UE7H 4B2BA 2ZCKP 3E1XB 1AVGH 1TOMH 4E05H 2A32A 4CBNA 2EI6A 5FCKA 1CHOG 1T32A 3GCOA 2GGVB 1NM6A 1PQ8A 2STBE 3EDXB 1FY8E 3O8RA 2RA0A 4AB9A 1WUNH 1HAHH 3V3MA 1LCYA 1UK2A 5TJXA 3M7TA 1TPOA 2H9TH 7GCHF 1GHBF 2J2UA 1AFEH 1AY6H 1NESE 2PWXA 3D23A 1DS2E 2G52A 3N7OA 4X8TH 3OX7U 5A09A 1NFUA 4MQAA 2A31A 3M3VA 3RU4T 1FY3A 1ELVA 1T8NA 4X6MA 1YF4A 1KYNA 5L2YH 1THSH 1PYTC 2PLXA 1JRTA 4Y6DA 4CRCA 4IMZA 1V2QT 4I8JA 2FOHA 5DP8A 2ZDNA 3M5NA 2QN5T 3NXPA 1NROH 1DUEA 1TB6H 2BQ6B 3TJOA 2I6QA 1A61H 3QUMP 3SQEE 3PLKA 1EPTA 5T3HA 3ZZDA 1O2VA 1AGJA 1LO6A 1IHTH 2VWLA 3GY2A 4UEHH 2WYJA 5E0HA 3V7TA 1SC8U 1KLIH 4ISIH 1ZPZA 5JB8S 4UFGH 1GMDF 1DICA 2V0BA 2W7SA 2O8WA 1C2MA 1ZGIA 1EZXC 1P11E 1YLDA 3MU0A 1GHXH 2A4GA 4CHAB 1VJAU 3AAUA 1ZJDA 3FANA 4I8KA 1DY8A 3URDA 3RXJA 1UO6A 1MKWK 2BM2A 2BQ7B 4DG4A 4ZMAH 3GYMA 4NA7A 1SPJA 1QY6A 3NKKA 1V2MT 4JZFH 1VCQA 4NZLA 1GGDC 1AE5A 3K65B 1O2MA 1GDQA 3MYWA 1NZQH 3HPTB 3ZVAA 1O5BB 1P0SH 1YPGH 1ZOMA 3MO3A 2V3OH 3R3GB 1EOJA 3TGIE 3RDZA 2A5IA 1C2IA 1HAXB 2OBQA 2ZDVH 3DA9B 3SU2A 1ZTKA 2BDCA 3KCGH 1S83A 1SG8B 3TH3H 2FMJA 1FQ3A 1F5KU 2ZP0H 2AEIH 4IBLH 4WF8A 1AVXA 1WCZA 1GBDA 1C4U2 3NWUA 4IMQA 1O3AA 1T31A 1P2MA 1C4V2 3O8DA 4SGBE 1GI0A 2TGPZ 1C5ZB 4FU8A 1ESAA 3RXAA 1MAXA 1ZMNA 2PW8H 3OY6U 1HJ8A 3ZZ6A 4AFSA 2P3UB 3BG4C 1TFXA 1MBQA 1BTYA 2FOMB 1LPGB 1O3LA 3RXTA 2UUJB 1H9HE 2VGCB 3FZZA 1TGSZ 1Z7KA 2H6MA 1C5YB 1FAXA 1TA2A 3C27B 1TX6A 1V2LT 2C4FH 4WY3A 4AX9H 3KQBA 4RKOB 1MD7A 1MU6B 5ESTE 3ZVBA 3PMBB 3E16B 2XBYA 3TK5A 2FTLE 4E7NA 1OYTH 2VWNA 2VIDA 3PLPA 1PYTD 5FXLA 1ZMLA 3RXQA 1SQOA 1RGQA 5C67A 2Z6BD 3GY3A 2BDIA 2BY5X 2W7UA 1MUEB 2ZU1A 2ZTXA 5HGGA 1DX5M 1C5OH 2PSXA 2VINA 1C5LH 1GI1A 4R8TB 1LKAA 1NFYA 3BTWE 1TNLA 4X6NA 5JBTA 3DT0H 3SN8A 3SV8A 5K7RA 4JMYA 2JH5D 4Q2KA 5JBBS 3EQ0H 1B0FA 3UNQA 1QB6A 4KP0A 1N6YA 2CN0H 1HXFH 1ELBA 1UMAH 3HGNA 1GI9B 1FN8A 2O8LA 3RLWH 1GBAA 1UTMA 2YOLA 2FOGA 4CREA 1MH0A 1SSXA 2FLRH 1HAOH 4AN7A 2G51A 3QGJA 3RXDA 2BMGB 1P04A 2G55A 2ZHQH 3HGPA 2P8OB 1BTHH 4VGCB 1NU7B 3EA9A 4GSOA 4MPXA 3UWIA 3BSQA 3BTDE 1S6FA 2ZCLP 2BHGA 3TVJB 1ZSLA 1TNJA 5C1UA 3TNTA 3ZZ8A 1UTNA 4AGJA 3HKIB 2RDLA 3BTHE 1HUTH 1BIOA 2ZFPH 1HAVB 2A0QB 1ELTA 2QXJA 3KQEA 1XUKA 2XWBI 3MO6A 2A7CA 3KL6A 2ZGJA 3ESTA 3ATLA 1KY9A 2UWOA 3LJOA 1A3BH 1TWXB 4KTSA 5EPNA 1E0FD 3SHCH 1LPKB 1W0YH 4Y8YA 1L4ZA 2BY8X 3M3TA 4AORA 1RTLA 1Q2WA 1Y3UA 3SJ9A 3UOPA 2I6SA 3SZNA 1E38B 1C5VA 2FOEA 1K1LA 1KXFA 1QL9A 3ATIA 1QGFA 2ZZUH 3F9HA 1B5GH 3QTOH 1C9TA 1JMOH 2QY0B 4JYVH 3A7VA 1QNJA 1ELCA 1DDJA 1Q3XA 2Y5FA 4E7RG 5JBAS 1FJSA 1EZUC 1LHCH 2GTBA 1P12E 3WY8A 4WVPE 1C1MA 4FUCA 2PGBB 1P57B 1O3FA 1O5EH 1FY5A 2JKHA 5DKMA 4YM9A 1EP5A 3SUFA 1HRTH 2VVVA 4GUXA 2J92A 3A86A 3SBKA 3AASA 5AVDA 5GWZA 1IQJA 1DWCH 1MKWH 3EGKH 1TGCA 3L6PA 2VIQA 4FU7A 1MBMA 3RXSA 1GJ4H 4JK6A 3VGCC 1TBRH 2G4UA 1UVTH 2V6NA 3NCLA 3OYPA 2Z3CA 1WAYB 8LPRA 2ZTZA 4NFFA 4Y7AA 3HKJB 5EODA 1TMBH 1O2TA 5C5NA 4ZKSU 2EEKA 3M7QA 2HNTE 2M5TA 3GY8A 1K1NA 3DFJA 2A5KA 1S5SA 3D65E 3VFEA 1GHYH 2UUKB 4OS7A 4UFEH 2Z9LA 2J38A 1XKBC 4OGYA 1HFDA 2KAIA 5G4BA 2FOFA 4ZXXH 1T7CA 4HTCH 1TA6A 2BDAA 2NWNA 4YZUA 1LVOA 2A4OA 3PO1C 3VB6A 1T8OA 5E2OA 4RKJB 4NG9H 4ABHA 2W5EA 1N1LA 1UVSH 1LMWB 1THRH 2SGAA 4WXIA 1AFQB 3SU1A 1IQMA 4JZEH 1CGJE 1MU8B 1DVAH 2PKAA 1YP9A 1JOUB 5FCRA 1NFXA 1GI7B 1PPEE 1GBHA 1HDTH 1VZQH 2H2ZA 3SNEA 5FAHA 3F9GA 3LU9B 1TGNA 1GJ9B 1MKXH 2ZECA 3RXIA 1P2NA 2CHAC 2XW9A 4I33A 1GJ8B 1HJAC 3VB5A 1WTHD 3TJUA 3PO1B 5J4SA 1N8OC 2ULLA 2ZU2A 4ZHAA 5EXLA 3SW2B 5E0JA 1ARCA 2ODYB 2J4IA 2OLGA 2B9LA 4K1EA 2ZDAH 4X2XA 1GGDB 3IG6B 2FEQH 3RLYH 1PQ7A 3R0FA 3QLPH 3A80A 1Y8TA 3BTME 3Q3XA 4I31A 4AFUA 3RP2A 1V2WT 1GI2A 1V2NT 2GCHG 2BZ6H 3ZZ5A 3SGAE 1GCDA 2Q6DA 5C3NA 1LQDB 2FP7B 5C20A 1O5FH 1DXPA 1SLWB 1TNKA 1ELGA 3SNBA 1G36A 4KGAA 3SJOA 2QXHA 4X0WU 4BTUB 1DLKB 1NT1A 3GY6A 2PGQB 4NSYA 2BLQA 4U32A 1Z8JB 1XVMA 1PPFE 2VIOA 4X1PU 3SGBE 1VITF 3M36A 3M7UA 1KXEA 2F9BH 1IQIA 3PV4A 1ACBE 1O2XA 2ZWLH 1L4DA 3BG4B 4A92A 4XOJA 2B7DH 1XX9A 2R3UA 5GIBA 2BQWB 2OBOA 1GCTC 1A4WH 4DIHH 2XBWA 3S9CA 1LVYA 3A7YA 1D3PB 3MFJA 4RN6A 1LTOA 2F9UA 1FZZA 1OP8A 1GI3A 5C1YA 3A81A 3SV2H 3TH4H 3VPKA 3F6UH 1EXFA 3LGIA 4F4OC 2WUBA 1T4VH 3SUDA 1GVZA 1SGNE 4BXSA 2ZQ2A 1GJAB 1ID5H 1L2EA 4LXBH 5HM2A 3P8NA 1YCPM 4IC5A 2ZNKH 1J14A 4ZKRU 1V6DA 1E36B 3MNBA 3UIRA 1C1VH 2BDGA 4CH8B 3SGQE 1W2KH 1CT2E 4NIYA 4HI3A 4WMEA 1JIRA 2WPJS 1ZMJA 3K9XB 4DY7B 3URCA 1S0QA 1FV9A 1C1UH 3F9FA 4U01A 5EQSA 3S0NA 1RXPA 1QB9A 1AI8H 1TRNA 3RC5A 2XC4A 3GCTG 5DP5A 2W26A 2A45B 1UTJA 2BX3A 1A2CH 1FY4A 1P05A 1BCUH 2AMPA 2ZC9H 1C4Y2 1O3PB 3PROA 4MPWA 3TJVA 4DJZB 2TRMA 1GDNA 3A87A 1IQFA 4Q7ZA 4Y8XA 3KQCA 2QYIA 2FOBA 1MAYA 1RRKA 5DP6A 4ZKOU 1C5UA 1J8AA 1GVKB 2BY6X 3A89A 2GVFA 2K1QA 3MI4A 5AHGH 3U8TH 1EZQA 3P70B 4B73A 3DFLA 4CBOA 1TQ7B 2BDBA 3SUEA 2HNTC 1HAGE 2HALA 1EX3A 2XC5A 4Q7XA 2HWLB 1O2UA 1O5AB 5EPYA 2V3HH 5JDUB 2FZZA 2XRCA 1ABJH 4NSVA 4X6OA 1ARBA 2FYRA 6CHAC 1ESBA 8ESTE 4LZ1H 1AB9B 1O2OA 1YPHE 1GMCF 3EE0B 1Z1IA 3OU0A 5I46H 2VU8E 1HAVA 1SGQE 2PV9B 1O2ZA 1KXAA 1GBMA 1AQ7A 2OP9A 3UQOA 1JBUH 2ODPA 2SNWA 4RSPA 2JETC 3Q3YA 5FBEA 2Y82A 5B6OA 1K21H 4LZ4B 1GI6A 4ZUHA 1F0SA 1GMCG 1GJ7B 1T8MA 1K9OE 5ESBA 3A85A 4O9VA 1Z6JH 4ZH8A 3LT3A 2AGEX 1NU9A 2GCTB 4AFQA 2P3TB 1F92A 3SU6A 5JPMH 2UWPA 1EOLA 3S69A 1BQYA 2WPIS 5ABWA 3RXRA 1T8LA 1GDUA 4ISOA 1WBGB 1Z8GA 1ZRKA 2Y5GA 4AYYB 2EI7A 1SGTA 1TALA 1EASA 1BJVA 1QCPA 1PJPA 3RXUA 3RC4A 1V3XA 4XE4A 2R9PA 2GV6A 2DE9A 3F1SB 4KELA 1J15A 1JIMA 1FY1A 3SU5A 3GCHC 3SJ8A 4FUBA 2HOBA 2QA9E 1G3CA 3SJIA 3T27A 1OPHB 4FXGH 2Y81A 1RJXB 2GX4A 2FODA 1F5LA 3NZIA 1BHXF 4A6LA 1UTLM 3MU8A 3RC6A 1KDQA 3E3TA 1O3CA 2B5TB 2OTVA 5DG6A 1AMHA 2XXLA 1YLCA 9ESTA 4GAWA 1VITG 4WWYA 5L2ZH 1ZTLA 4INLA 3RXBA 3ZZ7A 2IJOB 1MTNC 2IPHA 1ANDA 3BTQE 4NCYA 3B9FH 2EI8A 3RM0H 3RMMH 4MPUA 4OS4A 1EAIA 3KNXA 1YKTA 1SR5C 3FVFB 4UFFH 4ISLA 1LHEH 1UTPA 3TK6A 4AFZA 2CJIA 4TWYA 1O3MA 3HK6B 2ZGHA 4MTBA 1ELAA 2C3SA 2WINI 1EP6A 1B0EA 1THPB 4K1TA 1F7ZA 1QRXA 1MD8A 4OS5A 3ENSB 2XWAA 5DK1A 2F9OA 3MH4A 1XXDA 2Y6TA 5EOKA 1OP0A 4M7GA 5LPEA 4NA8A 3KQDA 2XYAA 1O2IA 5AF9H 1SFQB 1QA0A 2WPLS 1DFPA 1TLDA 1O2GH 1LDTT 3MMGA 1HNEE 5JB9S 1LHDH 2GDDA 3ATWA 4YLUA 5DGJA 3U9AH 2H5DA 2TBSA 2ODQA 4MLFB 3SNDA 1BMLA 2ZFRH 2GKVE 2BLWA 2GZ7A 1AIXH 2C8XB 2CV3A 2F83A 4D76A 3W94A 2J95A 4ASHA 4ABFA 1ELEE 3KHVA 2FOCA 2FS9A 2SGQE 1KDQB 2ZCHP 4U2WA 5IYTA 2BX4A 2TGDA 1MQ5A 2A2QH 5T6DA 3A7ZA 9LPRA 1H1BA 1K2I1 1SLUB 1EATA 3KIDU 4JYTA 4K3JA 1KIGH 1HB0B 2D2DA 2ZPQA 2Q1JA 2ZO3H 4ZHMU 4NIXA 2BY7X 1ZHRA 1TNGA 2VH0A 1AZ8A 1ZSKA 1NRPH 1W14U 2V35A 2VIPA 3PWBA 3PLBA 1C5TA 1DANH 3GDUA 4XFQA 6LPRA 4K1SA 1BRCE 1FUJA 2J34A 2Z9GA 1L1NA 1Y59T 1CO7E 2QV1A 2EC9H 1OWHA 4ABDA 1J9CH 4B2CA 1OWIA 1O2PA 1TMUH 3P8OA 3JZ1B 2HLCA 5IDKA 1Y5BT 2YNBA 3BTEE 4MG3A 3QO6A 4Y76A 4NIVA 2OC0A 1SGPE 3LOXA 2ANKH 5SGAE 2BXUH 1ZPCA 4MNYA 4D7GA 2CGAA 1TPSA 1BRAA 1QRZA 1KTTB 1C2DA 1A0LA 1LHFH 1MCTA 1K1OA 2XTTB 3KN2A 1BMAA 1MTUA 1PPZA 1C2LA 4X2WA 1NN6A 1FN6A 3UUZA 1A5HA 3MHWU 5GCHF 4B2AA 4X1QU 1WYKA 3MU1A 3TH2H 4MNWA 1C9PA 2ZU5A 3P8FA 3BN9A 3GDSA 2D26C 1OWKA 3UPEA 3STJA 1AWHB 3QX5H 1SHYA 4INKA 2GZ8A 6ESTA 1C2HA 5EW1H 1ETRH 2Z7FE 3UY9A 3QTVH 2OC7A 4UFDH 2PUXB 2WPMS 1GBEA 1XUJA 1P02A 2VIVA 4OS6A 4JCNA 1S85A 1GBJA 3ZZAA 1BDAA 2Z9JA 3GOVB 1J16A 1EJNA 5F8TA 2OXSA 1O3JA 4ABJA 1D3QB 2IOTA 1GBKA 3A8CA 1W11U 4KKDA 1UTKA 1P9SA 1QHRB 3QGNB 3RUOA 5F6MA 1TMTH 1H8DH 1MQ6A 1TNHA 3S7HB 1TX8A 3RM2H 3PMHB 1GJCB 1K1PA 4ZXYH 3RXMA 5JBCS 4ZAEA 2VVUA 4BAKB 4H4FA 1BB0B 1UK4A 4NWLA 2PKAB 1AWFH 1BA8B 4XSKU 3KF2A 1CGIE 4CRFA 1QQUA 4JZIA 1C5WB 5BPEA 4X2VA 1K1JA 1BMNH 2NU2E 1BTXA 1C1SA 1RIWC 2HPPH 1Y3VA 4ABIA 1TOCB 4FUDA 3DD2H 4J2YB 4DW2U 1O38A 1G37A 3ATKA 1DE7H 1O3GA 1O5GH 2JH0D 4Z6AH 1O33A 3QDZB 1TNIA 3QK1A 3S9AA 1V2KT 2HGTH 1DITH 1MTNB 1QJ1B 7ESTE 1NRRH 1HLTH 1NFWA 1PQ5A 2J9NA 1QJ7B 1MTSA 3RMOH 3SO3A 2BTCE 2Q6FA 1CT0E 3C1KA 3F68H 1YYY1 4JYUH 3LC5A 2FESH 4ABBA 2AH4X 2PSYA 2FI3E 1YPEH 3F9EA 1O37A 3V0XA 1GHBG 1ZTJA 1VCPA 4I8GA 2HPQH 3TGKE 1F2SE 1LVMA 2FYQA 2ZU3A 1BTWA 1GL1A 1RS0A 1WQVH 5DPAA 1ESTA 5GPIB 1LQEA 4LK4A 1QBOA 3VXEH 4IW4E 3TITA 2ALPA 2Z3DA 1Y5UT 2A2XH 3Q77A 1D6RA 5F8ZA 1TBQH 4GHTA 1Z71A 5FBIA 1V2UT 2NU3E 1DUAA 4CRAA 1IQHA 6CHAB 2A7JA 1KSNA 1P10A 3M61U 1ZHMA 1O36A 1OP2A 5L6NH 1QR3E 3PB1E 1OXGA 1QL7A 2ESTE 4ABEA 3ODFA 2F9VA 2VWMA 1EUFA 1OWDA 2ZEBA 2ZQ1A 1FPCH 4J1YA 2ZFTA 3T28A 3I77A 1C2KA 3LPRA 1S6HA 3IITA 2GT7A 2GZ9A 4NA9H 2G5NA 3OSYA 2TPIZ 2ZDLA 1O35A 1AVWA 2ZG0H 3EA7A 4CH2B 3GY5A 1YBWA 1GHVH 2GCTC 1TQ0B 1SGFA 1YCPK 1WTGH 1MTWA 3ZZ3A 3I78A 2XBXA 1DWBH 3TU7H 1D4PB 1VJ9U 1P01A 5LH8A 2BOHB 1KXDA 2BD7A 4GVUA 3EYDA 2WYGA 1GPZA 5F8XA 2OQ5A 2BD5A 1DSTA 1OYQA 1A5GH 2ZGCA 2QF3A 2G8TA 2PTNA 6GCHF 3RXEA 1AHTH 4A7IB 2LPRA 4GLYA 3ZZ9A 1HCGA 1YC0A 1LVBA 2SGFE 3GYLB 2OUAA 2FS8A 3U8OH 5GJ4B 4X8UH 2PFEA 4XDEA 4H42U 3TJNA 2OD3B 4ESTE 1C5RA 2CXVA 1TRMA 1V2VT 1ZRBA 1BRUP 3FZDA 1Y5AT 3RXKA 3SV9A 1GJDB 1P06A 3GICB 1G3EA 2RCEA 1UHBB 4Y0ZE 1FIZA 2O8TA 2Y7XA 2NU1E 2VB0A 4UD9H 3RXCA 1S81A 1TPPA 1HAPH 2RA3A 3QWCH 2BD4A 1OX1A 1BRBE 2THFB 3UFAA 1QURH 2O9QA 2GV7A 1EJMA 3RXGA 2Y7ZA 1PPGE 1ZZZA 3AVZA 1P3EA 1SQAA 1SOTA 1AN1E 3T62A 1YCPH 2FWWA 2DE8A 2QF0A 1DPOA 1CT4E 1V2RT 5C5OA 1B7XB 3FFGA 4AGKA 1QL8A 1C1NA 3MOCA 1CE5A 1ZSJA 2D8WA 2OC8A 2BD8A 2BOKA 2VJ1A 4ZHLU 4BAMB 5EW2H 1SLVB 1CA8B 3PMAB 5AFZH 4AG2A 3RXLA 1GBFA 2PTCE 3SU3A 3MWIU 2P8OC 4VGCC 2SNVA 1DSUA 1GMHF 1UTQA 4LOYH 2GP9B 1UVPA 3M35A 3G01A 1O2SA 3GISB 1EB1H 2GCHF 1CHGA 3T29A 2OC1A 1BTPA 2QCYA 2WV5A 1VITH 2C90B 4MNVA 1MCVA 2R2MB 2GDEH 5E8EH 1CSOE 1ETTH 1O2WA 5I25A 1UVUH 1V2JT 5FPSA 4CRGA 1FONA 1XUIA 1XVOA 1XXFA 1D9IA 1HPGA 3EA8A 5DP3A 3SU4A 1MMJN 3UR6A 2EA3A 1HYLA 2FXRA 4DCDA 1SHHB 3OTJE 4SGAE 1W10U 5FPYA 2FO9A 1P03A 5EXNA 1SGYE 4OGXA 1FLEE 3M5MA 1O5CB 4BTIB 3P6ZB 3TNSA 2PUQH 1DXWA 1H9LB 1YPMH 1W3CA 1GVLA 4HGCA 2H1UA 3DUXH 4JZDH 1MZAA 1RD3B 4NZQA 1OS8A 4CRBA 1RTKA 3NUMA 1A0JA 1YM0A 3TK9A 2AERH 2AGIX 2BLVA 3P17H 2F91A 1XM1A 3LC3A 1GBIA 3GCNA 2ZGBH 2WPHS 5TCAA 2Q6GA 3ZVDA 5FX6A 3A8AA 2WV4A 4FUHA 1W13U 1P2OA 4H6TA 2C8WB 4K69A 3STIA 3TLOA 1O2LA 2ZHDA 2Z3EA 2UUYA 2VNTA 2ILNA 3PM3A 3BTTE 4Y7BA 2GMTC 1O3EA 1GMHG 1E34B 5DP9A 1HBTH 3BEFB 1C5SA 4FVBA 3P8GA 3RMLH 5GCHG 1O34A 2ZGXH 1F5RA 3ZV9A 3U8RH 2A5AA 1OKXA 3SHAH 1Z1JA 4ZROA 3GY7A 3IWMA 1O30A 1SGCA 4X8VH 5CHAC 3W95A 2F3CE 2Z9IA 1VR1H 1W12U 2R2WU 1FPHH 4QT8C 1LHGH 4ABGA 1AKSA 1L1JA 3ELAH 1OWEA 1AE8H 1P09A 2GMTB 1V2TT 3SUGA 1XUFA 1RIWB 1O3HA 1WOFA 4CHAC 5LPFA 2AIPA 3MNXA 1W0ZU 4U30A 1C5NH 2F9PA 1TGTA 3AAVA 1GI5A 2A7HA 4YOGA 1SVPA 2Z9KA 1AFQC 4YTAA 5A2MH 2AIQA 3B23B 2H5CA 2OINA 1H9IE 2ZHEH 1O2HA 4FVDA 4TYDA 3PMJA 1C5XB 1MZDA 1EAXA 2FI5E 1AB9C 2DUCA 4Y79A 1C1QA 3E8LA 2NU0E 1KLTA 1YPJH 2ZI2H 1UCYK 1AO5A 2CHAB 2SGDE 3BG8A 1C5PA 1TABE 2P16A 1CA0C 1ZYOA 2Y80A 2TGAA 4Y8ZA 5EG4A 4AB8A 1N8OB 2ZHFH 3TGJE 5LPRA 3RMNH 8GCHF 3MNCA 3S7KB 2SGPE 1GI4A 1GL0E 2HRVA 1KXBA 4X6PA 3E0NB 2O8MA 1HIAB 1EKBB 1MKXK 4FUGA 2PKSB 5DP4A 1EPTC 1P2KA 3ZV8A 2XCNA 3GDVA 4H6SB 5E2PA 3CS0A 4CR5A 1HXEH 1VGCC 7LPRA 1C2EA 2VVCA 1CVWH 2J94A 1UJ1A 1E35B 1O2NA 1AUJA 1O2YA 2BD2A 4GCHF 4NGAH 1G30B 1P2QA 4DURA 2WPKS 5AFYH 4BOHA 4K60A 1GWAA 1O2JA 3EAJA 4NIWA 3LONA 1V2PT 3BV9B 1EQ9A 2BB4A 1BJUA 1D6WA 3GCHB 1PFXC 1ZGVA 3SNCA 1T4UH 2AYWA 1QTFA 1X7AC 3Q76A 2ZFSA 2XCFA 2ZPRA 4X1RU 2A4QA 2HVXA 1CQQA 2R3YA 3M37A 3RU4D 1W7XH 3A88A 1QB1A 2B8OH 1FMGA 1H4WA 3UR9A 3LIWA 3LJJA 3A82A 3H5CB 4YESB 4Q80A 1O3OA 3ZVFA 1NRSH 3RXOA 5C2ZA 4Y71A 1FIWA 3PTNA 1F0RA 2QXIA 2FTMA 1NO9H 2C93B 1SQTA 3SNAA 5HM9A 1NTPA 1O3KA 1BOQA 1O0DH 1V2ST 4BTTB 4WJG2 2ZDMA 2ZFQH 1GHWH 2QC2A 3VB3A 1HIAA 1P2IA 2YNAA 4WXVA 3UOUA 4XBCA 4Z0KA 2FM2A 3AW1A 1ELDE 1F0TA 4K2YA 4XBBA 3VB7A 3O8CA 4K8BA 1G3BA 2CF8H 5HMAA 1WQSA 1NPMA 5A8YA 4YOJA 3BIVH 1KLJH 1AUTC 2G5VA 3ZVEA 1ABIH 1CGHA 1GMDG 1NC6A 4I8HA 2BYAX 5JYIA 1RTFB 1DLEA 3E6PH 1ZHPA 4O97A 3HK3B 2VWOA 1P3CA 1P8VC 1GG6B 4Y10E 1Z6EA 4PROA 3U69H 4HFPB 3V13A 4A1XA 2ZFFH 1FI8A 2QAAA 2AMQA 2PHBA 1EAUA 3VB4A 5HYOA 3ZZCA 1GHAF 4NFEA 4K8YA 1QIXB 3FP6E 2WUCA 1SI5H
chains in the Genus database with same CATH superfamily
3MU4A 1BBRK 4BANB 3LGWA 3RXPA 5KEDA 2BVSH 5T6FA 3TIUA 1ZR0A 2AMDA 1BBRE 4BNRA 3GY4A 2QIQA 3M3SA 1GI8B 3BIUH 4ISHH 3QZQA 2O8UA 4O3TA 4IS5A 1GCTB 1SB1H 1C5QA 2BD3A 2ZF0H 3MH5A 1SKYE 4YT6H 5DO4H 1BMFD 3D62A 1Y3YA 1LPZB 1SOZA 1C1TA 1UK3A 2AHME 3MU5A 3QN7A 1IAUA 1IQEA 3E91A 4X1NU 3ZVGA 3ZYEA 4E06H 3T26A 1TONA 3KGPA 3DSGA 1E1RD 4HZHA 1H8IH 1ETSH 5ETXA 1C5MD 1JWTA 1GJBB 2QF4A 2CF9H 3M5OA 2SFAA 1TX7A 5HKKD 2P95A 1SMFE 3T2NA 1Z8RA 1O3DA 2AFQB 3BTGE 1NBMD 1AZZA 3BEIB 3CS7A 1IQLA 1ANCA 3H7OA 1H8HD 3T5FH 5A0CA 4ABAA 3FP8E 1HAYB 4WH6A 3VXFH 2ZIQH 5GXPA 3MNSA 1SGFG 2R0LA 2ZPSA 3HATH 4NWKA 1GBBA 4O3UA 3SI3H 1OOKB 1SL3A 1Y3XA 4YO9A 2ZKSA 1VCWA 5FX5A 3UTUH 2ASUB 4AOQA 4YLQH 3UWJH 2A1DB 2JETB 4GPGA 3PWCA 3SU0A 2CMYA 5FPTA 2JH6D 4A1TA 1N6XA 1A1RA 1OSSA 1O31A 3U1JB 1PPBH 3H7TA 3GCTF 3RXHA 2D1JA 4WMFA 4B71A 3UNRA 2VH6A 2G81E 5H4IB 1SFIA 5C1XA 4ZCNA 1O3IA 4INHA 5J4QA 4YT7H 4UONA 3UNSA 1GHZA 3O8BA 2JIZD 4MPVA 4DOQA 1O2QA 3OEHD 2FLBH 1KTSB 1ZJKA 1FDPA 5CMXH 5GDSH 1XMNB 4X2YA 4TY7A 3LH3A 1DY9A 3ATMA 3ITIA 1A0HB 1TIOA 3ZZBA 1IOEA 4JZ1A 2P94A 4CRDA 1SLXB 1DOJA 1IQKA 4I8LA 2ALVA 2C8YB 3LGYA 4KTCA 2QGRA 4MDSA 4D9RA 2WSSD 3E0PB 2PR3A 1O39A 3SOSA 5A0AE 1SGEE 5FHTA 1GBLA 3CNRA 1W8BH 3JZ2B 3NK8A 2BY9X 3LGTA 1PPCE 5EGMA 1WU1A 4MVNA 4TPYA 3L3TA 2OCVB 1IHSH 3E90B 1UCYH 4AYVB 2ANMH 2FPZA 2W3IA 1NRQH 4MNXA 1NS3A 4P00A 2XC0A 3TPIZ 5HIZA 3VGCB 1GHAG 1E37B 2IN2A 1FXYA 4BXWA 1CBWB 3UQVA 1C1OA 1S84A 5A8ZA 3L33A 1SGDE 2BD9A 4IGDA 1AKSB 2GT8A 3Q00A 3SORA 1PQAA 3D49H 2FDAA 7KMEH 2BLOA 1TRYA 4TWWA 1DWEH 2ZA5A 4I32A 4FUEA 3A7XA 1S0RA 1UTOA 1COWD 4O03A 1A3EH 3Q3KA 1YGCH 2ZHWH 1K28D 1SGIB 2VGCC 4B1TA 1C2GA 5EU8A 1A7SA 1P2JA 2FIRH 4A5TS 2HNTF 1Z8IB 1M9UA 3U1IB 1O5DH 1HV7A 1TE0A 4IC6A 5TCCA 5A0BA 2ANYA 2OQUA 3VEQB 2BZAA 5L30H 1D3TB 4X1SU 2UWLA 3QZRA 2F9NA 1ANBA 3EE7A 1W0JD 2UUFB 1BHXB 5E0GA 3SV6A 1VGCB 2J5UA 2BVRH 3A7WA 3RU4E 5K0HA 1V2OT 1YPLH 1OWJA 3LDXH 1DM4B 1EB2A 2C8ZB 1UCYE 3BF6H 1CHOF 1HJAB 2Y5HA 4P02A 1BTZA 1DT2A 3I29A 4Q4LA 3V12A 2H9HA 1NRNH 1GJ6A 2P59A 4B75A 4YOIA 2A4RA 2ZTYA 2BDYA 4GHQA 3AW0A 3S9BA 1C1PA 1GBCA 5EXMA 2QXGA 2AS9A 2PP6A 3K6ZA 3M5LA 4JK5A 1BT7A 4OS2A 3BTKE 2BVXH 8KME2 2G00A 3SJKA 8GCHG 4A1VA 2TGTA 1IQGA 3MO9A 1HAIH 1LKBA 3RXFA 4AG1A 1CA0B 2VIWA 1ELFA 5EIYA 3LKWA 3A84A 5EQRA 1HGTH 1ZLRA 3A83A 1UVOA 2P3FH 3K2UA 4UDWH 2LNCA 3P95A 4BAOB 4BAQB 1YPHC 1G32B 3MTYA 1QBNA 4IN1A 4WH8A 4FUFA 4B76A 2FI4E 3SV7A 2SGEE 2FX4A 1QBVH 1TBZH 1K1MA 7GCHG 4TY6A 4ZKNU 1BTUA 1BZXE 1SGRE 1OHHD 2J97A 2W3KA 3BEUA 3NPSA 1CU1A 2PKSC 1O32A 3OY5U 1EPTB 6GCHG 2FX6A 4Q7YA 1C1WH 5A8XA 2G4TA 1O3BA 2OK5A 2ANWA 1MTVA 3OTPA 4DGJA 1U6QA 1Y3WA 2B0FA 5BRRE 2NU4E 3CENA 1BMMH 2STAE 3P92A 4F49A 2TIOA 2ZU4A 1TAWA 4DT7B 5LGOA 1JXPA 5PTPA 2Z94A 4X8SH 1YPKH 2R0KA 1L1GA 1D3DB 4WMDA 2K8IA 1TGBA 3F0OA 1G9IE 1PPHE 5HXFA 4K5ZA 1G3DA 5DJ7A 3UREA 1KXCA 1XKAC 1WSSH 3B8JA 2FOAA 2BXTH 4D9QA 4CR9A 2KAIB 2XOKD 1C2FA 3KEEA 3SQHE 3BTFE 4DIIH 3ODDA 1UHBA 4D7FA 1FNIA 1IQNA 1L0ZA 1P9UA 1BBRH 3A8DA 1Q31A 3PTBA 4IN2A 3ZZ4A 1JRSA 4KTUA 1O2KA 1EAWA 2AGGX 4DVAU 3LGUA 1F0UA 3SI4H 1XUGA 1C1RA 5T6GA 3MH6A 1RFNA 2XBVA 4GCHG 1ORFA 2GD4B 4THNH 1AU8A 4FUIA 1G2LA 3A7TA 2P93A 5HIYA 4ISNA 1QRWA 1A5IA 2XNIA 1C2JA 3LGVA 1BUIA 3ZYDA 1GJ5H 5EQQA 1HAZB 4D8NA 3MH7A 1DWDH 4TPIZ 1FAKH 2BDHA 5DP7A 4BAHB 1HJ9A 4XBDA 2RG3A 3KQ5A 3A8BA 3CP7A 4FETA 1BITA 4FU9A 1NY22 3FP7E 1TPAE 5CDFE 1INCA 3PYHA 4B74A 1GG6C 4Y11E 4FUJA 1O3NA 1J17T 5F03A 5B6LA 1A46H 1W7GH 1S82A 1QFKH 1ANEA 4R0IA 3T25A 3KYGA 1EJAA 1SBWA 3FO8D 3ZVCA 4Y0YE 3K6YA 4OS1A 1G2MA 3LH1A 1O2RA 1ZPBA 1TYNA 1GBTA 1AD8H 3RXVA 4AZ2B 1K22H 1K1IA 3FAOA 1CBWC 1QQ4A 2ZDKA 3DHKH 3U98H 2H9EH 3N7EA 5CE1A 5CHAB 1EZSC 1WV7H 1QA7A 4I7YH 1XUHA 1QJ6B 4UE7H 4B2BA 2ZCKP 3E1XB 1AVGH 1TOMH 4E05H 2A32A 4CBNA 2EI6A 5FCKA 1CHOG 1T32A 2WHXA 3GCOA 2GGVB 1NM6A 1PQ8A 2STBE 3EDXB 4F48B 1FY8E 3O8RA 2RA0A 4AB9A 1WUNH 1HAHH 3V3MA 1LCYA 1UK2A 5TJXA 3M7TA 1TPOA 2H9TH 7GCHF 1GHBF 2J2UA 1AFEH 1AY6H 1NESE 2PWXA 3D23A 1DS2E 2G52A 3N7OA 4X8TH 3OX7U 5A09A 1NFUA 4MQAA 2A31A 3M3VA 3RU4T 1FY3A 1ELVA 1T8NA 4X6MA 1YF4A 1S6LA 1KYNA 2W6ID 5C0TA 5L2YH 1THSH 1PYTC 2PLXA 5DN6D 1JRTA 4Y6DA 4CRCA 4IMZA 1V2QT 4I8JA 2FOHA 5DP8A 2ZDNA 3M5NA 2QN5T 3NXPA 1NROH 1DUEA 1TB6H 2BQ6B 3TJOA 2I6QA 2YMSD 1A61H 3QUMP 3SQEE 3PLKA 1EPTA 5T3HA 3ZZDA 1O2VA 1AGJA 1K0HA 1LO6A 1IHTH 2VWLA 3GY2A 4UEHH 2WYJA 5E0HA 3V7TA 1SC8U 1KLIH 4ISIH 1ZPZA 5JB8S 4UFGH 1GMDF 1DICA 2V0BA 2W7SA 2O8WA 3F0PA 3DCLA 1C2MA 1ZGIA 1EZXC 1P11E 1YLDA 3MU0A 1GHXH 1W0KD 2A4GA 4CHAB 1VJAU 3AAUA 1ZJDA 4ASUD 3FANA 4I8KA 1DY8A 3URDA 3RXJA 1UO6A 1MKWK 2BM2A 2BQ7B 4DG4A 4ZMAH 3GYMA 4NA7A 1SPJA 3OFND 1QY6A 3NKKA 1V2MT 3W1EA 4JZFH 1VCQA 4NZLA 1GGDC 1AE5A 3K65B 1O2MA 1GDQA 3MYWA 1NZQH 3HPTB 3ZVAA 1O5BB 1P0SH 1YPGH 1ZOMA 3MO3A 2V3OH 3R3GB 3DSOA 1EOJA 5T1VA 3TGIE 3RDZA 2A5IA 1C2IA 1HAXB 2OBQA 2ZDVH 3DA9B 3SU2A 1ZTKA 2BDCA 3KCGH 3UAIC 1S83A 1SG8B 3TH3H 2FMJA 1FQ3A 1F5KU 2ZP0H 2YMSB 2AEIH 4IBLH 4WF8A 1AVXA 1WCZA 1GBDA 1C4U2 3NWUA 4IMQA 1O3AA 1T31A 1P2MA 1C4V2 3O8DA 4SGBE 1GI0A 2TGPZ 1C5ZB 4FU8A 1ESAA 3RXAA 1MAXA 1YLNA 1ZMNA 2PW8H 3OY6U 1HJ8A 3ZZ6A 4AFSA 2P3UB 3BG4C 1TFXA 1MBQA 1BTYA 2FOMB 1LPGB 1O3LA 3RXTA 2UUJB 1H9HE 2VGCB 3FZZA 1TGSZ 1Z7KA 2H6MA 1H8ED 1C5YB 1FAXA 1TA2A 3C27B 1TX6A 1V2LT 2C4FH 4WY3A 4AX9H 3KQBA 4RKOB 1MD7A 1MU6B 5ESTE 3ZVBA 3PMBB 3E16B 4Q63A 5EJLA 2XBYA 3TK5A 2FTLE 4E7NA 1OYTH 2VWNA 2VIDA 3PLPA 1PYTD 5FXLA 1ZMLA 3WWBA 3RXQA 1SQOA 1RGQA 5C67A 2Z6BD 3GY3A 2BDIA 2BY5X 2W7UA 1MUEB 2ZU1A 2ZTXA 5HGGA 1DX5M 1C5OH 2PSXA 2VINA 1C5LH 1GI1A 4R8TB 1LKAA 1NFYA 3BTWE 1TNLA 4X6NA 5JBTA 3DT0H 3SN8A 3SV8A 5K7RA 4JMYA 2JH5D 4Q2KA 5JBBS 3EQ0H 1B0FA 3UNQA 1QB6A 4KP0A 1N6YA 2CN0H 1HXFH 3ZIAD 1ELBA 1UMAH 3HGNA 1GI9B 1FN8A 2O8LA 3RLWH 1GBAA 1UTMA 2YOLA 2FOGA 4CREA 1MH0A 1SSXA 2FLRH 1HAOH 3SYJA 4AN7A 2G51A 3QGJA 3RXDA 2BMGB 1P04A 2G55A 2XNDD 2ZHQH 3HGPA 2P8OB 1BTHH 4VGCB 1NU7B 3EA9A 4GSOA 4MPXA 3UWIA 3BSQA 3BTDE 1S6FA 2ZCLP 2BHGA 3TVJB 3FOAA 1ZSLA 1TNJA 5C1UA 3AK5A 3TNTA 3ZZ8A 1UTNA 4AGJA 3HKIB 2RDLA 3BTHE 1HUTH 1BIOA 2HVYB 4I86A 2ZFPH 1HAVB 5GNDA 2A0QB 1ELTA 2QXJA 3KQEA 1XUKA 2XWBI 3MO6A 2A7CA 3KL6A 2ZGJA 3ESTA 3ATLA 1KY9A 2UWOA 3LJOA 2IJD1 1A3BH 1TWXB 4KTSA 5EPNA 1E0FD 3SHCH 1LPKB 1W0YH 4Y8YA 1L4ZA 2BY8X 3M3TA 4AORA 1RTLA 1Q2WA 1Y3UA 3SJ9A 3UOPA 2I6SA 3SZNA 1E38B 1C5VA 2FOEA 1K1LA 1KXFA 1QL9A 3ATIA 5DSFA 1QGFA 2ZZUH 3F9HA 1B5GH 3QTOH 1C9TA 1JMOH 2QY0B 4JYVH 3A7VA 1QNJA 1ELCA 3SZEA 1DDJA 1Q3XA 2Y5FA 4E7RG 5JBAS 1FJSA 1EZUC 1LHCH 2GTBA 1P12E 3WY8A 4WVPE 1C1MA 4FUCA 2PGBB 1P57B 1O3FA 1O5EH 1FY5A 2JKHA 5DKMA 4YM9A 1EP5A 5EJ1A 3SUFA 1HRTH 2VVVA 4GUXA 2J92A 3A86A 3SBKA 3AASA 5AVDA 5GWZA 1IQJA 1DWCH 1MKWH 3EGKH 1TGCA 3L6PA 2VIQA 1WDIA 4FU7A 1MBMA 3RXSA 1GJ4H 4JK6A 3VGCC 1TBRH 2G4UA 3PV5A 1UVTH 2V6NA 3NCLA 3OYPA 2Z3CA 1WAYB 8LPRA 2ZTZA 4NFFA 4Y7AA 3HKJB 5EODA 1TMBH 1O2TA 5C5NA 4ZKSU 2EEKA 3M7QA 2HNTE 2M5TA 3GY8A 1K1NA 3DFJA 2A5KA 1S5SA 3D65E 3VFEA 1GHYH 2UUKB 4OS7A 4UFEH 1WXRA 2Z9LA 2J38A 1XKBC 4OGYA 1HFDA 2KAIA 5G4BA 2FOFA 4ZXXH 1T7CA 4HTCH 1TA6A 2BDAA 2NWNA 4YZUA 1LVOA 2A4OA 3PO1C 3VB6A 1T8OA 5E2OA 2KR7A 4NG9H 4RKJB 2W5EA 4ABHA 1N1LA 1UVSH 1LMWB 1THRH 3PRBA 2WZQA 2SGAA 4WXIA 1AFQB 3SU1A 1IQMA 4JZEH 1CGJE 1MU8B 1DVAH 2PKAA 1YP9A 1JOUB 5FCRA 1NFXA 1GI7B 1PPEE 1GBHA 1HDTH 1VZQH 2H2ZA 5FL7D 3SNEA 5FAHA 1VKYA 3F9GA 3LU9B 2VBCA 1TGNA 1GJ9B 1MKXH 2ZECA 3RXIA 1P2NA 2CHAC 2XW9A 4I33A 1GJ8B 1HJAC 3VB5A 1WTHD 3TJUA 3PO1B 5J4SA 1N8OC 2ULLA 2ZU2A 4ZHAA 5EXLA 4B6EA 3SW2B 5E0JA 1ARCA 2ODYB 2J4IA 2OLGA 2B9LA 4K1EA 2ZDAH 4X2XA 1GGDB 3IG6B 2FEQH 3RLYH 1KMHB 1PQ7A 3R0FA 3QLPH 3A80A 1Y8TA 2W6JD 3BTME 3Q3XA 4I31A 4AFUA 3RP2A 1V2WT 1E79D 1GI2A 1V2NT 2GCHG 2BZ6H 3ZZ5A 3SGAE 1GCDA 2Q6DA 5C3NA 1LQDB 2FP7B 5C20A 1O5FH 1DXPA 1SLWB 1TNKA 1ELGA 3SNBA 1G36A 4KGAA 3SJOA 2QXHA 4X0WU 4BTUB 1DLKB 1NT1A 2RDEA 3GY6A 2PGQB 4NSYA 2BLQA 4U32A 1Z8JB 1XVMA 1PPFE 2VIOA 4X1PU 4DT4A 3SGBE 1VITF 3M36A 3M7UA 1KXEA 2F9BH 1IQIA 3PV4A 1ACBE 1O2XA 2JJ1D 2ZWLH 1L4DA 3BG4B 4A92A 4XOJA 4ACAA 2B7DH 1XX9A 2R3UA 5GIBA 2BQWB 2OBOA 4TSFD 1GCTC 1A4WH 4DIHH 2XBWA 3S9CA 1LVYA 3A7YA 1D3PB 3MFJA 3PV2A 4RN6A 1LTOA 2F9UA 1FZZA 1OP8A 1GI3A 5C1YA 3A81A 3SV2H 3TH4H 3VPKA 3F6UH 2EQNA 1EXFA 3LGIA 4XD7D 4F4OC 2WUBA 1T4VH 3SUDA 1GVZA 1SGNE 4BXSA 2ZQ2A 1GJAB 1ID5H 1L2EA 4LXBH 5HM2A 3F2HA 3P8NA 1YCPM 4IC5A 2ZNKH 1J14A 4ZKRU 1V6DA 4YXWD 1E36B 3MNBA 3UIRA 1C1VH 2BDGA 4CH8B 3SGQE 1W2KH 1CT2E 4NIYA 4HI3A 4WMEA 1JIRA 2WPJS 1ZMJA 3K9XB 4DY7B 3URCA 1S0QA 1FV9A 1C1UH 3DSPA 3F9FA 4U01A 5EQSA 3S0NA 1RXPA 1QB9A 1AI8H 1TRNA 3RC5A 2XC4A 3GCTG 5DP5A 2W26A 2A45B 1UTJA 2BX3A 3GS9A 1A2CH 1FY4A 1P05A 1BCUH 2AMPA 2ZC9H 1C4Y2 1O3PB 3PROA 4MPWA 3TJVA 4DJZB 2TRMA 1GDNA 3A87A 1IQFA 4Q7ZA 4Y8XA 2KZ4A 3KQCA 2QYIA 2FOBA 1MAYA 3N7DA 1RRKA 5DP6A 2KX4A 1C5UA 4ZKOU 1J8AA 1GVKB 2BY6X 3A89A 2GVFA 2K1QA 3MI4A 5AHGH 4F55A 5C94A 3U8TH 1EZQA 3P70B 5F53A 4B73A 3DFLA 4CBOA 1TQ7B 2BDBA 3SUEA 2HNTC 1HAGE 2HALA 1EX3A 2XC5A 4Q7XA 2HWLB 1O2UA 1O5AB 5EPYA 2V3HH 5JDUB 2FZZA 2XRCA 1ABJH 4NSVA 4X6OA 1ARBA 2FYRA 6CHAC 1ESBA 8ESTE 4LZ1H 1AB9B 1O2OA 1YPHE 1GMCF 5KGOA 3EE0B 1Z1IA 3OU0A 5I46H 2VU8E 1HAVA 1SGQE 2PV9B 1O2ZA 1KXAA 1GBMA 1AQ7A 2OP9A 3UQOA 1JBUH 2ODPA 2SNWA 4RSPA 2JETC 3Q3YA 5FBEA 3F3BA 2Y82A 5B6OA 1K21H 3OAAD 1GI6A 4ZUHA 4LZ4B 1F0SA 1GMCG 2J98B 1GJ7B 1T8MA 1K9OE 5ESBA 3A85A 4O9VA 1Z6JH 4ZH8A 3LT3A 2AGEX 1NU9A 2GCTB 4AFQA 2P3TB 1F92A 3SU6A 5JPMH 2UWPA 4Z1MD 1EOLA 3S69A 1BQYA 2EY4C 2WPIS 5ABWA 3F2FA 3RXRA 1T8LA 1GDUA 4ISOA 2F43B 1WBGB 1Z8GA 1ZRKA 2Y5GA 4AYYB 2EI7A 1SGTA 1TALA 1EASA 1BJVA 1QCPA 1PJPA 3RXUA 3RC4A 1V3XA 4XE4A 2R9PA 2KCOA 2K0QA 2GV6A 2DE9A 3F1SB 2IPQX 4KELA 1J15A 1JIMA 1FY1A 3SU5A 3GCHC 3SJ8A 4FUBA 2HOBA 2QA9E 1G3CA 3SJIA 3T27A 1OPHB 4FXGH 2Y81A 1RJXB 2GX4A 2FODA 1F5LA 3NZIA 1BHXF 4A6LA 1UTLM 3MU8A 3RC6A 1KDQA 3E3TA 1O3CA 2B5TB 2OTVA 5DG6A 1AMHA 2XXLA 1YLCA 9ESTA 4GAWA 1VITG 4WWYA 5L2ZH 1ZTLA 4INLA 3RXBA 3ZZ7A 2IJOB 1MTNC 2IPHA 1ANDA 3BTQE 4NCYA 3WWFA 3B9FH 2EI8A 3RM0H 3RMMH 4MPUA 4OS4A 1EAIA 3KNXA 1YKTA 1SR5C 3FVFB 4UFFH 4ISLA 1LHEH 1UTPA 3TK6A 4AFZA 2CJIA 4TWYA 1O3MA 3WW7A 3HK6B 2ZGHA 4MTBA 1ELAA 2C3SA 2WINI 1EP6A 1B0EA 1THPB 4K1TA 1F7ZA 1QRXA 1MD8A 4OS5A 3ENSB 2XWAA 2V3MA 5DK1A 2F9OA 3MH4A 1XXDA 2Y6TA 5EOKA 1OP0A 4M7GA 5LPEA 2V7QD 4NA8A 3KQDA 2XYAA 1O2IA 5AF9H 1SFQB 1QA0A 2WPLS 1DFPA 1TLDA 1O2GH 1LDTT 3MMGA 1HNEE 5JB9S 1LHDH 2GDDA 3ATWA 4YLUA 5DGJA 3U9AH 1SQRA 2H5DA 2TBSA 2ODQA 4MLFB 3SNDA 1BMLA 2ZFRH 2GKVE 2BLWA 2GZ7A 1AIXH 2C8XB 2CV3A 2F83A 4D76A 3W94A 2J95A 4ASHA 4ABFA 1ELEE 3KHVA 2FOCA 2FS9A 2SGQE 1KDQB 2ZCHP 4U2WA 5IYTA 2BX4A 4ACBA 2TGDA 1MQ5A 2A2QH 5T6DA 3A7ZA 9LPRA 1H1BA 1K2I1 1SLUB 1EATA 3KIDU 4FOUC 4JYTA 4K3JA 1KIGH 1HB0B 2D2DA 2ZPQA 5IK2D 2Q1JA 2ZO3H 4ZHMU 4NIXA 2BY7X 1ZHRA 1TNGA 2VH0A 1AZ8A 1ZSKA 1NRPH 1W14U 2V35A 2VIPA 3PWBA 3PLBA 2L6OA 1C5TA 1DANH 3GDUA 4XFQA 6LPRA 4K1SA 1BRCE 1FUJA 2J34A 3OE7D 2Z9GA 1L1NA 1Y59T 1CO7E 2QV1A 2EC9H 1OWHA 4ABDA 1J9CH 4B2CA 1OWIA 1O2PA 1TMUH 3P8OA 3JZ1B 2HLCA 5IDKA 1Y5BT 2YNBA 3BTEE 4MG3A 3QO6A 4Y76A 4NIVA 2OC0A 1SGPE 3LOXA 2ANKH 5SGAE 2BXUH 1ZPCA 4MNYA 4D7GA 2CGAA 1TPSA 1BRAA 1QRZA 1YY3A 1KTTB 1C2DA 1A0LA 4OM9A 1LHFH 1MCTA 1K1OA 2XTTB 3KN2A 1BMAA 1MTUA 1PPZA 1C2LA 4X2WA 5EJZA 1NN6A 1FN6A 3UUZA 1A5HA 3MHWU 5GCHF 4B2AA 4X1QU 1WYKA 2JJ2D 3MU1A 3TH2H 4MNWA 1C9PA 2ZU5A 3P8FA 3BN9A 3GDSA 2D26C 1OWKA 3UPEA 3STJA 1AWHB 3QX5H 4M9FA 1EFRD 1SHYA 4INKA 2GZ8A 2KCAA 1C2HA 6ESTA 5EW1H 1ETRH 2Z7FE 3H09A 3UY9A 3QTVH 1UW7A 2OC7A 4UFDH 2PUXB 2WPMS 1FX0B 1GBEA 1XUJA 1P02A 2VIVA 4OS6A 4JCNA 1S85A 1GBJA 3ZZAA 1BDAA 2Z9JA 3GOVB 1J16A 1EJNA 5F8TA 2OXSA 1O3JA 4ABJA 1D3QB 2IOTA 1GBKA 3A8CA 1W11U 4KKDA 1UTKA 1P9SA 1QHRB 3QGNB 3RUOA 5F6MA 1TMTH 1H8DH 1MQ6A 1TNHA 3S7HB 1TX8A 3RM2H 3PMHB 1GJCB 1K1PA 4ZXYH 3RXMA 5JBCS 4ZAEA 2VVUA 3UB0A 4BAKB 4H4FA 1BB0B 1UK4A 4NWLA 2PKAB 1AWFH 1BA8B 4XSKU 3KF2A 1CGIE 4CRFA 1QQUA 4JZIA 1C5WB 5BPEA 4X2VA 1K1JA 1BMNH 2NU2E 1BTXA 1C1SA 1RIWC 2HPPH 1Y3VA 4ABIA 4RT0A 1TOCB 4FUDA 3DD2H 4J2YB 4DW2U 1O38A 1G37A 3ATKA 1DE7H 1O3GA 1O5GH 2JH0D 4Z6AH 1O33A 3QDZB 1TNIA 3QK1A 3S9AA 1V2KT 2HGTH 1DITH 1MTNB 1QJ1B 7ESTE 1NRRH 1HLTH 1NFWA 1PQ5A 2J9NA 1QJ7B 1MTSA 3RMOH 3SO3A 2BTCE 2Q6FA 1CT0E 3C1KA 3F68H 1YYY1 4JYUH 3LC5A 2FESH 4ABBA 2AH4X 2PSYA 2FI3E 1YPEH 3F9EA 1O37A 3V0XA 1GHBG 1ZTJA 2WV9A 1VCPA 4I8GA 2HPQH 3TGKE 1F2SE 1LVMA 4RT1A 2FYQA 2ZU3A 1BTWA 1GL1A 1RS0A 1WQVH 5DPAA 1ESTA 5GPIB 1LQEA 4LK4A 1QBOA 3VXEH 4IW4E 3TITA 2ALPA 2Z3DA 1Y5UT 2A2XH 3Q77A 1D6RA 5F8ZA 1TBQH 4GHTA 1Z71A 2LELA 5FBIA 1V2UT 2NU3E 1DUAA 4CRAA 1IQHA 6CHAB 2A7JA 1KSNA 1P10A 3M61U 1ZHMA 1O36A 1OP2A 5L6NH 1QR3E 3PB1E 1OXGA 3PRDA 1QL7A 2ESTE 2L74A 4ABEA 3ODFA 2F9VA 1MABB 2VWMA 1EUFA 1OWDA 2ZEBA 2ZQ1A 1FPCH 4J1YA 2ZFTA 3T28A 3I77A 1C2KA 3LPRA 1S6HA 3IITA 2GT7A 2YMSC 2GZ9A 4NA9H 2G5NA 3OSYA 2TPIZ 2ZDLA 1O35A 1AVWA 2ZG0H 3EA7A 4XRNA 4CH2B 3GY5A 1YBWA 1GHVH 2GCTC 3NRLA 1TQ0B 1SGFA 1YCPK 1WTGH 1MTWA 3ZZ3A 3I78A 2KM0A 2XBXA 1DWBH 4TT3D 3TU7H 1D4PB 1VJ9U 1P01A 5LH8A 2BOHB 1KXDA 2BD7A 4GVUA 3EYDA 2WYGA 1GPZA 5F8XA 2OQ5A 2BD5A 2HLDD 1DSTA 1OYQA 1A5GH 2ZGCA 2QF3A 2G8TA 2PTNA 6GCHF 4AC9A 3RXEA 1AHTH 4A7IB 2LPRA 4GLYA 3ZZ9A 1HCGA 1YC0A 1LVBA 2SGFE 3GYLB 2OUAA 2FS8A 3U8OH 5GJ4B 4X8UH 2PFEA 4XDEA 4H42U 3TJNA 2OD3B 4ESTE 3OEED 1C5RA 2CXVA 1TRMA 1V2VT 1ZRBA 1BRUP 3FZDA 1Y5AT 3RXKA 3SV9A 1GJDB 1P06A 3GICB 1G3EA 1NBME 1UHBB 2RCEA 4Y0ZE 1FIZA 2O8TA 2Y7XA 2NU1E 2VB0A 4UD9H 2KCPA 3RXCA 1S81A 1TPPA 5C0UA 1HAPH 2RA3A 3QWCH 2BD4A 1OX1A 1BRBE 2THFB 3UFAA 4B6FA 1QURH 2O9QA 2GV7A 1E1QD 1EJMA 2LP6A 2Y7ZA 3RXGA 1PPGE 1ZZZA 3AVZA 1P3EA 1SQAA 1SOTA 1AN1E 3T62A 1YCPH 2FWWA 2DE8A 2QF0A 1DPOA 1CT4E 1V2RT 5C5OA 1B7XB 3FFGA 3FN8A 3FKSD 4AGKA 1QL8A 1C1NA 3MOCA 1CE5A 1ZSJA 2D8WA 2OC8A 2BD8A 2BOKA 2VJ1A 4ZHLU 4BAMB 5EW2H 1SLVB 1CA8B 3PMAB 5AFZH 4AG2A 3RXLA 1GBFA 2PTCE 3SU3A 3MWIU 2P8OC 4VGCC 2SNVA 2QF5A 1DSUA 1GMHF 1UTQA 4LOYH 2GP9B 1UVPA 3M35A 3G01A 1O2SA 3GISB 1EB1H 2GCHF 1CHGA 3T29A 2OC1A 1BTPA 2QCYA 2WV5A 1VITH 2C90B 4MNVA 1MCVA 2R2MB 2GDEH 2J98A 5E8EH 1CSOE 1ETTH 1O2WA 5I25A 1UVUH 1V2JT 5FPSA 4CRGA 1FONA 1XUIA 1XVOA 1XXFA 1D9IA 1HPGA 3EA8A 5DP3A 3SU4A 1MMJN 3UR6A 2EA3A 1HYLA 2FXRA 4DCDA 1SHHB 3OTJE 4SGAE 1W10U 5FPYA 3KYFA 2FO9A 1P03A 5EXNA 1SGYE 4OGXA 1FLEE 3M5MA 1O5CB 4BTIB 3P6ZB 3TNSA 2PUQH 1DXWA 1H9LB 1YPMH 1W3CA 1GVLA 4HGCA 2H1UA 3DUXH 4JZDH 1MZAA 1RD3B 4NZQA 1OS8A 4CRBA 1RTKA 3NUMA 2RFKC 1A0JA 1YM0A 3TK9A 2AERH 2AGIX 2BLVA 2GJGA 3P17H 2F91A 1XM1A 3LC3A 1GBIA 3GCNA 2ZGBH 2WPHS 5TCAA 2Q6GA 3ZVDA 5FX6A 3A8AA 4RI0A 2WV4A 4FUHA 1W13U 1P2OA 4H6TA 2C8WB 2F4LA 4K69A 3STIA 3TLOA 1O2LA 2ZHDA 2Z3EA 2UUYA 2VNTA 2ILNA 3PM3A 3BTTE 4Y7BA 2GMTC 1O3EA 1GMHG 1E34B 5DP9A 1HBTH 3BEFB 1C5SA 3N99A 4FVBA 3P8GA 3RMLH 5GCHG 1O34A 2ZGXH 1F5RA 3ZV9A 3U8RH 2A5AA 1OKXA 3SHAH 1Z1JA 4ZROA 3GY7A 3IWMA 1O30A 1SGCA 4X8VH 5CHAC 3W95A 2F3CE 2Z9IA 1VR1H 1W12U 2R2WU 1FPHH 4QT8C 1LHGH 4ABGA 1AKSA 1L1JA 3ELAH 1OWEA 1AE8H 1P09A 2GMTB 5CHBA 1V2TT 3U28C 3SUGA 1XUFA 1RIWB 1O3HA 1WOFA 4CHAC 5LPFA 2AIPA 3MNXA 1W0ZU 4U30A 1C5NH 3VG8A 2F9PA 1TGTA 3AAVA 1GI5A 2A7HA 4YOGA 1SVPA 2Z9KA 1AFQC 4YTAA 5A2MH 2AIQA 3B23B 2H5CA 2OINA 1H9IE 2ZHEH 1O2HA 4FVDA 4TYDA 3PMJA 1C5XB 1MZDA 3F2GA 1EAXA 2FI5E 1AB9C 2DUCA 4Y79A 1C1QA 3E8LA 2NU0E 1KLTA 1YPJH 2ZI2H 1UCYK 1AO5A 2CHAB 2SGDE 3BG8A 2P16A 1C5PA 1QZ8A 1TABE 1CA0C 1ZYOA 2KCYA 2Y80A 2TGAA 4Y8ZA 5EG4A 4AB8A 2WPDD 1N8OB 2ZHFH 3TGJE 5LPRA 3RMNH 8GCHF 3MNCA 3S7KB 2SGPE 1GI4A 1GL0E 2HRVA 1KXBA 4X6PA 3E0NB 2O8MA 1HIAB 1EKBB 4HG6A 1MKXK 5KECA 4FUGA 2PKSB 5DP4A 1EPTC 1P2KA 3ZV8A 2XCNA 3GDVA 4H6SB 5E2PA 3CS0A 4CR5A 1YWUA 1HXEH 1VGCC 7LPRA 1C2EA 2VVCA 1CVWH 2J94A 1UJ1A 2JDID 1E35B 1O2NA 1AUJA 1O2YA 2BD2A 4GCHF 4NGAH 1G30B 1P2QA 4DURA 2WPKS 5AFYH 5C17A 4BOHA 4K60A 1GWAA 1O2JA 3EAJA 4NIWA 3LONA 1V2PT 3BV9B 1EQ9A 2BB4A 1BJUA 1D6WA 3GCHB 1PFXC 1ZGVA 3SNCA 1T4UH 2AYWA 1QTFA 1X7AC 3Q76A 2ZFSA 2XCFA 2ZPRA 4X1RU 2A4QA 2HVXA 1CQQA 2R3YA 3M37A 3RU4D 1W7XH 3A88A 1QB1A 2B8OH 1FMGA 1H4WA 3UR9A 3LIWA 3LJJA 3A82A 3H5CB 4YESB 4Q80A 1O3OA 3ZVFA 1NRSH 3RXOA 5C2ZA 3MQKC 4Y71A 1FIWA 3PTNA 1F0RA 2QXIA 2FTMA 1NO9H 2C93B 1SQTA 3SNAA 5HM9A 1NTPA 1O3KA 1BOQA 1O0DH 1V2ST 2M2AA 4BTTB 4WJG2 2ZDMA 2ZFQH 1GHWH 2QC2A 3VB3A 1HIAA 1P2IA 2YNAA 4WXVA 3UOUA 4XBCA 4Z0KA 2FM2A 3AW1A 1ELDE 1F0TA 4K2YA 4XBBA 3VB7A 3O8CA 4K8BA 1G3BA 2CF8H 5HMAA 1WQSA 1NPMA 5A8YA 4YOJA 3BIVH 1KLJH 1AUTC 2G5VA 3ZVEA 1ABIH 1CGHA 1GMDG 1NC6A 4I8HA 2BYAX 5JYIA 1RTFB 1DLEA 3E6PH 1ZHPA 4O97A 2QE7D 3HK3B 2VWOA 1P3CA 1P8VC 1GG6B 4Y10E 2CK3D 1Z6EA 4PROA 3U69H 4HFPB 3V13A 4A1XA 2ZFFH 1FI8A 2QAAA 2AMQA 2KFWA 1EAUA 2PHBA 3VB4A 5HYOA 3ZZCA 1GHAF 4NFEA 4K8YA 1QIXB 3FP6E 2WUCA 1SI5H
chains in the Genus database with same CATH topology
3MU4A 1BBRK 4BANB 3LGWA 3RXPA 2BVSH 5T6FA 3TIUA 1ZR0A 2AMDA 1BBRE 4BNRA 3GY4A 2QIQA 3M3SA 1GI8B 3BIUH 4ISHH 3QZQA 2O8UA 4O3TA 4IS5A 1GCTB 1SB1H 1C5QA 2BD3A 2ZF0H 3MH5A 4YT6H 5DO4H 3D62A 1Y3YA 1LPZB 1SOZA 1C1TA 1UK3A 3MU5A 3QN7A 1IAUA 1IQEA 3E91A 4X1NU 3ZVGA 3ZYEA 4E06H 3T26A 1TONA 3KGPA 4HZHA 1H8IH 1ETSH 5ETXA 1C5MD 1JWTA 1GJBB 2CF9H 3M5OA 2SFAA 1TX7A 2P95A 1SMFE 3T2NA 1Z8RA 1O3DA 2AFQB 3BTGE 3BEIB 1AZZA 3T5FH 3CS7A 1IQLA 1ANCA 3H7OA 5A0CA 4ABAA 3FP8E 1HAYB 4WH6A 3VXFH 2ZIQH 5GXPA 3MNSA 1SGFG 2R0LA 2ZPSA 3HATH 4NWKA 1GBBA 4O3UA 3SI3H 1OOKB 1SL3A 1Y3XA 4YO9A 2ZKSA 1VCWA 5FX5A 3UTUH 2ASUB 4AOQA 4YLQH 3UWJH 2A1DB 2JETB 4GPGA 3PWCA 3SU0A 2CMYA 5FPTA 2JH6D 4A1TA 1N6XA 1A1RA 1OSSA 1O31A 3U1JB 1PPBH 3H7TA 3GCTF 3RXHA 2D1JA 4WMFA 4B71A 3UNRA 2VH6A 2G81E 5H4IB 1SFIA 5C1XA 1O3IA 4INHA 5J4QA 4YT7H 4UONA 3UNSA 1GHZA 3O8BA 4MPVA 4DOQA 1O2QA 2FLBH 1KTSB 1ZJKA 1FDPA 5CMXH 5GDSH 1XMNB 4X2YA 4TY7A 3LH3A 1DY9A 3ATMA 3ITIA 1A0HB 1TIOA 3ZZBA 1IOEA 4JZ1A 2P94A 4CRDA 1SLXB 1DOJA 1IQKA 4I8LA 2ALVA 2C8YB 3LGYA 4KTCA 2QGRA 4MDSA 4D9RA 3E0PB 2PR3A 1O39A 3SOSA 5A0AE 1SGEE 5FHTA 1GBLA 1W8BH 3JZ2B 3NK8A 2BY9X 3LGTA 1PPCE 5EGMA 1WU1A 4MVNA 4TPYA 3L3TA 2OCVB 1IHSH 3E90B 1UCYH 4AYVB 2ANMH 2FPZA 2W3IA 1NRQH 4MNXA 1NS3A 3TPIZ 2XC0A 3VGCB 1GHAG 1E37B 2IN2A 1FXYA 4BXWA 1CBWB 3UQVA 1C1OA 1S84A 5A8ZA 3L33A 1SGDE 2BD9A 4IGDA 1AKSB 2GT8A 3Q00A 3SORA 1PQAA 3D49H 2FDAA 7KMEH 2BLOA 1TRYA 4TWWA 1DWEH 2ZA5A 4I32A 4FUEA 3A7XA 1S0RA 1UTOA 4O03A 1A3EH 3Q3KA 1YGCH 2ZHWH 1K28D 1SGIB 2VGCC 4B1TA 1C2GA 5EU8A 1A7SA 1P2JA 2FIRH 4A5TS 2HNTF 1Z8IB 1M9UA 3U1IB 1O5DH 1HV7A 1TE0A 4IC6A 5TCCA 5A0BA 2ANYA 2OQUA 3VEQB 2BZAA 5L30H 1D3TB 4X1SU 2UWLA 3QZRA 2F9NA 1ANBA 2UUFB 1BHXB 5E0GA 3SV6A 1VGCB 3A7WA 2BVRH 3RU4E 5K0HA 1V2OT 1YPLH 1OWJA 3LDXH 1DM4B 1EB2A 2C8ZB 1UCYE 3BF6H 1CHOF 1HJAB 2Y5HA 1BTZA 1DT2A 3I29A 3V12A 2H9HA 1NRNH 1GJ6A 2P59A 4B75A 4YOIA 2A4RA 2ZTYA 2BDYA 4GHQA 3AW0A 3S9BA 1C1PA 1GBCA 5EXMA 2QXGA 2AS9A 3K6ZA 3M5LA 4JK5A 1BT7A 4OS2A 3BTKE 2BVXH 8KME2 2G00A 3SJKA 8GCHG 4A1VA 2TGTA 1IQGA 3MO9A 1HAIH 1LKBA 3RXFA 4AG1A 1CA0B 2VIWA 1ELFA 3LKWA 3A84A 5EQRA 1HGTH 1ZLRA 3A83A 1UVOA 2P3FH 3K2UA 4UDWH 2LNCA 3P95A 4BAOB 4BAQB 1YPHC 1G32B 3MTYA 1QBNA 4IN1A 4WH8A 4FUFA 4B76A 2FI4E 3SV7A 2SGEE 2FX4A 1QBVH 1TBZH 1K1MA 7GCHG 4TY6A 4ZKNU 1BTUA 1BZXE 1SGRE 2W3KA 3NPSA 3BEUA 1CU1A 2PKSC 1O32A 3OY5U 1EPTB 6GCHG 2FX6A 4Q7YA 1C1WH 5A8XA 2G4TA 1O3BA 2ANWA 1MTVA 4DGJA 1U6QA 1Y3WA 2B0FA 5BRRE 2NU4E 3CENA 1BMMH 2STAE 3P92A 4F49A 2TIOA 2ZU4A 1TAWA 4DT7B 5LGOA 1JXPA 5PTPA 2Z94A 4X8SH 1YPKH 2R0KA 1L1GA 1D3DB 4WMDA 1TGBA 1G9IE 1PPHE 5HXFA 4K5ZA 1G3DA 5DJ7A 3UREA 1KXCA 1XKAC 1WSSH 3B8JA 2FOAA 2BXTH 4D9QA 4CR9A 2KAIB 1C2FA 3KEEA 3SQHE 3BTFE 4DIIH 3ODDA 1UHBA 4D7FA 1FNIA 1IQNA 1L0ZA 1P9UA 1BBRH 3A8DA 1Q31A 3PTBA 4IN2A 3ZZ4A 1JRSA 4KTUA 1O2KA 1EAWA 2AGGX 4DVAU 3LGUA 1F0UA 3SI4H 1XUGA 1C1RA 5T6GA 3MH6A 1RFNA 2XBVA 4GCHG 1ORFA 2GD4B 4THNH 1AU8A 4FUIA 1G2LA 3A7TA 2P93A 4ISNA 1QRWA 1A5IA 2XNIA 1C2JA 3LGVA 1BUIA 3ZYDA 1GJ5H 5EQQA 1HAZB 4D8NA 3MH7A 1DWDH 4TPIZ 1FAKH 2BDHA 5DP7A 4BAHB 1HJ9A 4XBDA 2RG3A 3A8BA 3CP7A 1BITA 4FU9A 1NY22 3FP7E 1TPAE 1INCA 3PYHA 4B74A 1GG6C 4Y11E 4FUJA 1O3NA 1J17T 5F03A 1A46H 1W7GH 1S82A 1QFKH 1ANEA 4R0IA 3T25A 1EJAA 1SBWA 3ZVCA 4Y0YE 3K6YA 4OS1A 1G2MA 3LH1A 1O2RA 1ZPBA 1TYNA 1GBTA 1AD8H 3RXVA 4AZ2B 1K22H 1K1IA 3FAOA 1CBWC 1QQ4A 2ZDKA 3DHKH 3U98H 2H9EH 5CE1A 5CHAB 1EZSC 1WV7H 1QA7A 4I7YH 1XUHA 1QJ6B 4UE7H 4B2BA 2ZCKP 3E1XB 1AVGH 1TOMH 4E05H 2A32A 4CBNA 2EI6A 5FCKA 1CHOG 1T32A 3GCOA 2GGVB 1NM6A 1PQ8A 2STBE 3EDXB 1FY8E 3O8RA 2RA0A 4AB9A 1WUNH 1HAHH 3V3MA 1LCYA 1UK2A 5TJXA 3M7TA 1TPOA 2H9TH 7GCHF 1GHBF 2J2UA 1AFEH 1AY6H 1NESE 2PWXA 3D23A 1DS2E 2G52A 3N7OA 4X8TH 3OX7U 5A09A 1NFUA 4MQAA 2A31A 3M3VA 3RU4T 1FY3A 1ELVA 1T8NA 4X6MA 1YF4A 1KYNA 5L2YH 1THSH 1PYTC 2PLXA 1JRTA 4Y6DA 4CRCA 4IMZA 1V2QT 4I8JA 2FOHA 5DP8A 2ZDNA 3M5NA 2QN5T 3NXPA 1NROH 1DUEA 1TB6H 2BQ6B 3TJOA 2I6QA 1A61H 3QUMP 3SQEE 3PLKA 1EPTA 5T3HA 3ZZDA 1O2VA 1AGJA 1LO6A 1IHTH 2VWLA 3GY2A 4UEHH 2WYJA 5E0HA 3V7TA 1SC8U 1KLIH 4ISIH 1ZPZA 5JB8S 4UFGH 1GMDF 1DICA 2V0BA 2W7SA 2O8WA 1C2MA 1ZGIA 1EZXC 1P11E 1YLDA 3MU0A 1GHXH 2A4GA 4CHAB 1VJAU 3AAUA 1ZJDA 3FANA 4I8KA 1DY8A 3URDA 3RXJA 1UO6A 1MKWK 2BM2A 2BQ7B 4DG4A 4ZMAH 3GYMA 4NA7A 1SPJA 1QY6A 3NKKA 1V2MT 4JZFH 1VCQA 4NZLA 1GGDC 1AE5A 3K65B 1O2MA 1GDQA 3MYWA 1NZQH 3HPTB 3ZVAA 1O5BB 1P0SH 1YPGH 1ZOMA 3MO3A 2V3OH 3R3GB 1EOJA 3TGIE 3RDZA 2A5IA 1C2IA 1HAXB 2OBQA 2ZDVH 3DA9B 3SU2A 1ZTKA 2BDCA 3KCGH 1S83A 1SG8B 3TH3H 2FMJA 1FQ3A 1F5KU 2ZP0H 2AEIH 4IBLH 4WF8A 1AVXA 1WCZA 1GBDA 1C4U2 3NWUA 4IMQA 1O3AA 1T31A 1P2MA 1C4V2 3O8DA 4SGBE 1GI0A 2TGPZ 1C5ZB 4FU8A 1ESAA 3RXAA 1MAXA 1ZMNA 2PW8H 3OY6U 1HJ8A 3ZZ6A 4AFSA 2P3UB 3BG4C 1TFXA 1MBQA 1BTYA 2FOMB 1LPGB 1O3LA 3RXTA 2UUJB 1H9HE 2VGCB 3FZZA 1TGSZ 1Z7KA 2H6MA 1C5YB 1FAXA 1TA2A 3C27B 1TX6A 1V2LT 2C4FH 4WY3A 4AX9H 3KQBA 4RKOB 1MD7A 1MU6B 5ESTE 3ZVBA 3PMBB 3E16B 2XBYA 3TK5A 2FTLE 4E7NA 1OYTH 2VWNA 2VIDA 3PLPA 1PYTD 5FXLA 1ZMLA 3RXQA 1SQOA 1RGQA 5C67A 2Z6BD 3GY3A 2BDIA 2BY5X 2W7UA 1MUEB 2ZU1A 2ZTXA 5HGGA 1DX5M 1C5OH 2PSXA 2VINA 1C5LH 1GI1A 4R8TB 1LKAA 1NFYA 3BTWE 1TNLA 4X6NA 5JBTA 3DT0H 3SN8A 3SV8A 5K7RA 4JMYA 2JH5D 4Q2KA 5JBBS 3EQ0H 1B0FA 3UNQA 1QB6A 4KP0A 1N6YA 2CN0H 1HXFH 1ELBA 1UMAH 3HGNA 1GI9B 1FN8A 2O8LA 3RLWH 1GBAA 1UTMA 2YOLA 2FOGA 4CREA 1MH0A 1SSXA 2FLRH 1HAOH 4AN7A 2G51A 3QGJA 3RXDA 2BMGB 1P04A 2G55A 2ZHQH 3HGPA 2P8OB 1BTHH 4VGCB 1NU7B 3EA9A 4GSOA 4MPXA 3UWIA 3BSQA 3BTDE 1S6FA 2ZCLP 2BHGA 3TVJB 1ZSLA 1TNJA 5C1UA 3TNTA 3ZZ8A 1UTNA 4AGJA 3HKIB 2RDLA 3BTHE 1HUTH 1BIOA 2ZFPH 1HAVB 2A0QB 1ELTA 2QXJA 3KQEA 1XUKA 2XWBI 3MO6A 2A7CA 3KL6A 2ZGJA 3ESTA 3ATLA 1KY9A 2UWOA 3LJOA 1A3BH 1TWXB 4KTSA 5EPNA 1E0FD 3SHCH 1LPKB 1W0YH 4Y8YA 1L4ZA 2BY8X 3M3TA 4AORA 1RTLA 1Q2WA 1Y3UA 3SJ9A 3UOPA 2I6SA 3SZNA 1E38B 1C5VA 2FOEA 1K1LA 1KXFA 1QL9A 3ATIA 1QGFA 2ZZUH 3F9HA 1B5GH 3QTOH 1C9TA 1JMOH 2QY0B 4JYVH 3A7VA 1QNJA 1ELCA 1DDJA 1Q3XA 2Y5FA 4E7RG 5JBAS 1FJSA 1EZUC 1LHCH 2GTBA 1P12E 3WY8A 4WVPE 1C1MA 4FUCA 2PGBB 1P57B 1O3FA 1O5EH 1FY5A 2JKHA 5DKMA 4YM9A 1EP5A 3SUFA 1HRTH 2VVVA 4GUXA 2J92A 3A86A 3SBKA 3AASA 5AVDA 5GWZA 1IQJA 1DWCH 1MKWH 3EGKH 1TGCA 3L6PA 2VIQA 4FU7A 1MBMA 3RXSA 1GJ4H 4JK6A 3VGCC 1TBRH 2G4UA 1UVTH 2V6NA 3NCLA 3OYPA 2Z3CA 1WAYB 8LPRA 2ZTZA 4NFFA 4Y7AA 3HKJB 5EODA 1TMBH 1O2TA 5C5NA 4ZKSU 2EEKA 3M7QA 2HNTE 2M5TA 3GY8A 1K1NA 3DFJA 2A5KA 1S5SA 3D65E 3VFEA 1GHYH 2UUKB 4OS7A 4UFEH 2Z9LA 2J38A 1XKBC 4OGYA 1HFDA 2KAIA 5G4BA 2FOFA 4ZXXH 1T7CA 4HTCH 1TA6A 2BDAA 2NWNA 4YZUA 1LVOA 2A4OA 3PO1C 3VB6A 1T8OA 5E2OA 4RKJB 4NG9H 4ABHA 2W5EA 1N1LA 1UVSH 1LMWB 1THRH 2SGAA 4WXIA 1AFQB 3SU1A 1IQMA 4JZEH 1CGJE 1MU8B 1DVAH 2PKAA 1YP9A 1JOUB 5FCRA 1NFXA 1GI7B 1PPEE 1GBHA 1HDTH 1VZQH 2H2ZA 3SNEA 5FAHA 3F9GA 3LU9B 1TGNA 1GJ9B 1MKXH 2ZECA 3RXIA 1P2NA 2CHAC 2XW9A 4I33A 1GJ8B 1HJAC 3VB5A 1WTHD 3TJUA 3PO1B 5J4SA 1N8OC 2ULLA 2ZU2A 4ZHAA 5EXLA 3SW2B 5E0JA 1ARCA 2ODYB 2J4IA 2OLGA 2B9LA 4K1EA 2ZDAH 4X2XA 1GGDB 3IG6B 2FEQH 3RLYH 1PQ7A 3R0FA 3QLPH 3A80A 1Y8TA 3BTME 3Q3XA 4I31A 4AFUA 3RP2A 1V2WT 1GI2A 1V2NT 2GCHG 2BZ6H 3ZZ5A 3SGAE 1GCDA 2Q6DA 5C3NA 1LQDB 2FP7B 5C20A 1O5FH 1DXPA 1SLWB 1TNKA 1ELGA 3SNBA 1G36A 4KGAA 3SJOA 2QXHA 4X0WU 4BTUB 1DLKB 1NT1A 3GY6A 2PGQB 4NSYA 2BLQA 4U32A 1Z8JB 1XVMA 1PPFE 2VIOA 4X1PU 3SGBE 1VITF 3M36A 3M7UA 1KXEA 2F9BH 1IQIA 3PV4A 1ACBE 1O2XA 2ZWLH 1L4DA 3BG4B 4A92A 4XOJA 2B7DH 1XX9A 2R3UA 5GIBA 2BQWB 2OBOA 1GCTC 1A4WH 4DIHH 2XBWA 3S9CA 1LVYA 3A7YA 1D3PB 3MFJA 4RN6A 1LTOA 2F9UA 1FZZA 1OP8A 1GI3A 5C1YA 3A81A 3SV2H 3TH4H 3VPKA 3F6UH 1EXFA 3LGIA 4F4OC 2WUBA 1T4VH 3SUDA 1GVZA 1SGNE 4BXSA 2ZQ2A 1GJAB 1ID5H 1L2EA 4LXBH 5HM2A 3P8NA 1YCPM 4IC5A 2ZNKH 1J14A 4ZKRU 1V6DA 1E36B 3MNBA 3UIRA 1C1VH 2BDGA 4CH8B 3SGQE 1W2KH 1CT2E 4NIYA 4HI3A 4WMEA 1JIRA 2WPJS 1ZMJA 3K9XB 4DY7B 3URCA 1S0QA 1FV9A 1C1UH 3F9FA 4U01A 5EQSA 3S0NA 1RXPA 1QB9A 1AI8H