1G36A

Trypsin inhibitor complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for inhibition promiscuity of dual specific thrombin and factor Xa blood coagulation inhibitors.
pubmed doi rcsb
molecule keywords TRYPSINOGEN, CATIONIC
molecule tags Hydrolase
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2000-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1g36A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1g36A02
4I32A 3TK6A 1FN8A 1UTLM 5AFZH 1GJ9B 1AMHA 1GBIA 1Z6JH 4D9QA 1F92A 3P8FA 3ZVCA 3EGKH 1O2QA 1H9LB 1Z1JA 1GL1A 2FZZA 4XFQA 4D9RA 5JDUB 4FUBA 2BDGA 1CGHA 1GHWH 4AG1A 4MPUA 2J94A 5EOKA 3ZZ8A 2ZKSA 4NIWA 1ELAA 2H5DA 1TRMA 1OKXA 5FPYA 4UEHH 3SJKA 2O8MA 2ZGJA 2BM2A 2FWWA 2Y5HA 4Y0ZE 3UR6A 1TX6A 3O8BA 3SV9A 3DD2H 2I6QA 3UTUH 1Z7KA 3ZZBA 4WF8A 2XC5A 1A1RA 1WUNH 3NXPA 2ZU2A 4XSKU 4ABIA 2Z9KA 1UVSH 2CF9H 1O38A 4H42U 2ZFRH 3AVZA 3ITIA 3V12A 5JBBS 1IQFA 1PPBH 1C2LA 1TAWA 5DP8A 1KXAA 4A6LA 1JRTA 2TPIZ 3AAUA 1H9HE 1V2RT 8LPRA 4YESB 4WXVA 3MNSA 1ZJKA 2ZFFH 1UJ1A 1BTUA 2ZPRA 5HM9A 1J9CH 1XVOA 1QL8A 3LKWA 3E8LA 4IW4E 1P12E 3M61U 2PUQH 3M5NA 4FUGA 4CBNA 3GCTG 2A1DB 2BVXH 2OUAA 1P57B 1UTQA 2D1JA 1LKAA 2V6NA 3VB7A 1LVOA 3HGNA 2FMJA 1FPCH 4B75A 3GICB 1LMWB 3SQEE 1UCYK 4Y8ZA 1O3CA 3LGTA 1O3DA 3IG6B 4B2BA 1C5TA 1UHBA 1P2IA 4BAQB 1BOQA 1LHGH 4Y7BA 3P6ZB 4FXGH 1W12U 1MTSA 1IQHA 1WV7H 1P9SA 1LO6A 3A88A 1GI8B 2BDCA 5EW2H 1UTJA 3NUMA 3BV9B 1Z8RA 2ZDKA 4NCYA 1ANEA 4UFGH 1WTHD 1A7SA 3SORA 1FONA 1KXBA 3C27B 2FYQA 1GI5A 5DKMA 3HKIB 1GJCB 4KTUA 1NTPA 2VWLA 5JB8S 3LDXH 1OWKA 2H9HA 1HAVA 2QXHA 1CVWH 1GHAF 4FVBA 3V3MA 4XBDA 4NSYA 1V2NT 2ZIQH 1EAIA 4OS1A 1FDPA 4LZ1H 1GHVH 1SHYA 1AFQB 1WU1A 4OS4A 1O2ZA 3EA7A 2BY5X 2Z9LA 2Z7FE 1UTMA 1FQ3A 1BITA 1O2KA 1SGCA 1AI8H 2GCHG 2FS9A 1C1PA 1BRCE 1ANBA 1W11U 2ZI2H 2OC8A 1FUJA 2OBQA 2ZGCA 1RGQA 1LVBA 1PQ7A 2QY0B 4H6TA 4E7RG 2HVXA 3M35A 3KNXA 1PQ5A 3QDZB 1SQOA 2C8YB 2XC4A 1G37A 2Z3CA 1SL3A 2O9QA 1O36A 1C5VA 2JH0D 2XXLA 3LC5A 2BLOA 2UWPA 4FUCA 1BRUP 3ENSB 1BBRE 1MTNC 1YBWA 4GSOA 5ESTE 1GHXH 4TYDA 3UWIA 1D3DB 4NA9H 1SGFA 4A7IB 1GBAA 1TNIA 1YCPM 1NS3A 4NGAH 2ZU4A 1A3EH 2IOTA 3SW2B 4BXWA 3W95A 1TNHA 2PKSC 1ESAA 4RKOB 4ZAEA 4OS7A 4GVUA 1A0HB 2Y6TA 1N1LA 1O31A 1C1NA 4KTSA 4UDWH 1EZXC 2A7CA 1AN1E 1P2KA 1K1JA 2PGQB 1CA8B 1OWIA 1GBLA 1EASA 2O8WA 4ISOA 3LGWA 1AB9C 2ZDMA 3EE0B 2Y81A 2ZCLP 3FP7E 4UFFH 1NFUA 3URCA 1W13U 1OSSA 1C2FA 2J34A 2ODPA 3FFGA 4NZQA 1ELTA 3SV8A 3RXUA 1MKXH 2A45B 1NESE 1KY9A 1CU1A 1O3OA 1P03A 4NG9H 3HK6B 1C2MA 4UFDH 1O2VA 1YC0A 2PTCE 2D2DA 3M5MA 1YCPH 2VIOA 4WVPE 1YPHE 3O8RA 5FAHA 1C2JA 2ZGHA 2FOGA 5EG4A 4BANB 1KDQB 1OPHB 1UVPA 1E34B 2ZF0H 4MQAA 5C1YA 3RXAA 1Q2WA 1OWDA 2FOEA 2FPZA 2VNTA 4WJG2 1CHOF 1GI0A 1SLWB 2XWAA 3PO1C 3A7XA 4IN2A 2KAIB 2Y7XA 1V2OT 3SU5A 1AUTC 4BAHB 1J17T 1GJAB 1WSSH 2JH5D 1O3NA 2Y80A 4U2WA 1T8MA 1ELFA 1HBTH 2AMQA 3SNCA 2ZHQH 1VR1H 3KEEA 2F9UA 1AVXA 1Y5AT 2WPLS 1G36A 3RLYH 2NU1E 2RA0A 1AUJA 3B23B 1CGJE 3SUDA 1GHBG 3TH3H 1SGTA 3EA9A 2A7HA 1HV7A 1O3LA 1TOMH 4M7GA 2CV3A 4ABFA 3BTHE 2OD3B 1ZOMA 5DJ7A 1EAWA 3GY5A 3TK5A 4CH2B 3TJUA 3L3TA 1A5GH 2ZEBA 2P93A 3QK1A 3MMGA 2IJOB 4CR9A 2YNAA 3JZ1B 2OINA 1DT2A 1FY8E 3SJ9A 2O8UA 4D7GA 2OP9A 2G00A 2WPMS 2GCTC 3ATLA 1VCPA 4X2XA 3U1IB 5F03A 1UVOA 2FM2A 2V3HH 4KELA 4D7FA 2Q6GA 1KIGH 1NFWA 4ISIH 5LPEA 1PPFE 5GJ4B 1YPLH 3SOSA 1AY6H 2CN0H 2UWLA 2R3UA 4ZH8A 4AGKA 2JKHA 4OGXA 4DY7B 5I25A 3PMAB 1K1PA 1MCTA 1YPGH 1LKBA 4Y7AA 1KXDA 1W3CA 3A86A 4HI3A 2ANKH 5L6NH 3T26A 4IBLH 3PTBA 4ISLA 2OTVA 2FOAA 2NWNA 1UMAH 3MH4A 1T32A 3QUMP 1DS2E 3RXSA 3GY6A 1O3HA 1EOLA 3MH6A 7GCHG 1HAXB 2SFAA 3O8DA 1AVWA 1QBVH 2H9TH 4BXSA 1QBNA 5EPYA 1Z6EA 4JZDH 2ANYA 4BNRA 2BDYA 1QR3E 5JBTA 1FJSA 3MNBA 4FU8A 4TY7A 1FZZA 4KKDA 1DUAA 1XMNB 2CHAC 1TX7A 1ETRH 3SJ8A 3M37A 4XBCA 2PTNA 2IN2A 2BTCE 4WH8A 2VGCC 3FVFB 1SSXA 2WUBA 4GPGA 4O03A 3FZDA 3PYHA 2BY8X 1S0RA 2ZPSA 1IQJA 2D8WA 1D3PB 1BHXF 1QB6A 1LHCH 1VJ9U 1Y8TA 5C20A 2TGAA 3RXEA 1WBGB 2OQUA 2V0BA 4AFUA 1AKSA 1C1MA 1MUEB 2OC0A 1DLEA 4MPWA 1GI7B 2ZHDA 1SGPE 1Z1IA 5GIBA 4BAOB 2OCVB 4JYTA 1XKBC 1K21H 3MU5A 4A1VA 1G30B 5A0BA 4U01A 1LVMA 1QQ4A 3LIWA 3RMNH 3A7WA 4INHA 1EZSC 1BTXA 1VZQH 3U8TH 1MTNB 3H7TA 4ZXXH 5L2ZH 3P17H 1Q31A 4FUIA 1GG6C 1GDNA 1A61H 2WPIS 1E38B 1P06A 3KF2A 1G3CA 1HAOH 4K2YA 2GT7A 2CXVA 3SU3A 4FUJA 1SR5C 1QB9A 1ABIH 1MBMA 2BHGA 3M3TA 2PKSB 2TIOA 1DWEH 1ESBA 1FY1A 1C2DA 3F9EA 1D6RA 2BYAX 1MTWA 3A85A 2GMTB 1NU7B 4I8LA 1LTOA 1NZQH 5EGMA 1ARCA 1CHOG 4X6OA 1K1OA 1WQVH 4A5TS 3T2NA 4K8YA 2P8OC 5DP3A 1EPTC 3GCTF 4WWYA 1UK3A 3KN2A 1ELDE 5CMXH 4AYVB 3MH5A 1FV9A 1IQGA 3UY9A 2FIRH 4JZIA 1AFEH 1CHGA 1GCTC 2Z6BD 4I33A 1JRSA 1TPPA 3M36A 1OP2A 4ABAA 1GMHF 2J9NA 5AHGH 1G3DA 2ZDNA 4BTUB 1DLKB 3MNXA 1UVUH 4X8TH 1O33A 2ZTYA 4CH8B 1NY22 5A09A 1EXFA 2XCFA 1AO5A 1BJUA 3L6PA 2VWNA 4F49A 1SFIA 3TLOA 1AU8A 1AQ7A 3TK9A 1QJ7B 3TNSA 4YLUA 2DE9A 3NWUA 4O3TA 4H6SB 4LXBH 1LHDH 2I6SA 1F2SE 1T8OA 1JOUB 1HAYB 3E0PB 1SGQE 2SGAA 3PO1B 2H6MA 3UQOA 2FOFA 1NROH 4INKA 5J4QA 1TMUH 1G9IE 2HNTC 2Y5GA 1HUTH 4CREA 4BAKB 1AGJA 2OLGA 3VXFH 2FP7B 2QC2A 4UFEH 3D23A 4K60A 3TPIZ 3M3SA 3KQDA 1TMBH 1E35B 4ZKRU 4TPIZ 1DX5M 3SUFA 2GVFA 2V35A 3T5FH 4I8KA 1UO6A 1YYY1 4IN1A 1C4Y2 1P09A 2C93B 3EA8A 1AHTH 3DFLA 3A7TA 1QL9A 2BD5A 1FY5A 2GCHF 2FX4A 5I46H 3SU1A 4QT8C 1TNLA 1ZTKA 4JZEH 1AWHB 1EB1H 1SPJA 2BDBA 2UUJB 3RXQA 1GJ5H 1ELCA 4DVAU 4Y76A 4K69A 4JMYA 4TWWA 2ZTZA 1SC8U 3U8OH 1P8VC 5A2MH 1SGDE 2UUYA 2R0LA 1XUHA 1B0EA 8GCHG 1BMNH 1GBJA 5DP7A 2GCTB 4O97A 2O8LA 3ODDA 3VFEA 2AH4X 1P2NA 3SNEA 4CRAA 1QBOA 2J4IA 1TPAE 3M7UA 5BPEA 4XBBA 4D76A 1AZZA 2FO9A 5EXLA 4VGCC 1DDJA 2P59A 2M5TA 1EP5A 1MKWK 3TGJE 4J1YA 2BDAA 4Q80A 3RXGA 1HAPH 2G5NA 1XUFA 2QXIA 1LCYA 5T6DA 1DXPA 1P01A 2VB0A 3CENA 2ALPA 5E8EH 3DA9B 1HLTH 1PPHE 2HALA 4I7YH 1ZSKA 1Z8JB 1ESTA 1RIWC 3QTOH 1GHYH 5A0CA 2H2ZA 4X6PA 2ILNA 4DG4A 1AIXH 4CRCA 6ESTA 3RXDA 1AWFH 1P2OA 2CHAB 4WMFA 4X1RU 4OS6A 4ABGA 2TGDA 2JETC 3SBKA 3RDZA 3ZZ3A 1DVAH 2A31A 1XUJA 2VGCB 1ZPBA 5GPIB 3KCGH 4Z0KA 3K65B 1W8BH 1ZPZA 5ETXA 5LH8A 1C4V2 1HGTH 2Q1JA 3ATWA 1BHXB 2SNWA 1W10U 4DIIH 4CBOA 2ZTXA 3LONA 3S7HB 1VGCC 2QXJA 4PROA 5C1XA 3PWBA 1IAUA 4ABHA 2FYRA 2PUXB 3MI4A 2VH0A 3SU6A 5E2PA 4X1PU 2ZHFH 4AZ2B 1VITG 3C1KA 1S5SA 2R2MB 3GOVB 4X6NA 1OYTH 3U98H 3SZNA 4ZKSU 1TIOA 1FNIA 3GYMA 3MO3A 1V2LT 2BY9X 5E0HA 1NU9A 3AASA 3D62A 7ESTE 4MDSA 1DPOA 1GMHG 3B8JA 2QF3A 3MHWU 1S0QA 1GG6B 2QCYA 1GBMA 2FXRA 4FUFA 1TGSZ 3WY8A 1GHBF 4I31A 1CSOE 1QA7A 1C2KA 1OWEA 1YPMH 3SUEA 1FY4A 4BTTB 1SLXB 2ZNKH 4Y8YA 1HB0B 1BZXE 5HGGA 2A32A 1KLTA 2AGIX 2GDEH 3RXVA 1TQ0B 1K1MA 1XM1A 3GCHC 2K1QA 3PMBB 4Y6DA 1EAXA 4FVDA 2AIPA 2QIQA 4AFZA 1W14U 3P8GA 3DFJA 1EQ9A 1PQAA 2P8OB 1EPTB 2GZ8A 3BSQA 7KMEH 3P8OA 1KDQA 1PJPA 3EQ0H 3E0NB 1SQTA 1Y3WA 2FOCA 1GBDA 1GI6A 5K0HA 3ATMA 3TJNA 1GCTB 1J14A 2AYWA 1SGIB 2KAIA 2WV4A 2VIQA 3BTME 3PTNA 1MMJN 2ZCHP 1NRSH 1C5MD 3T28A 1TBQH 2ZFTA 1C1OA 2HWLB 1C2IA 1TGBA 1P04A 1HNEE 3U8RH 1IOEA 2ZDLA 2D26C 1ZYOA 4B73A 2DUCA 7GCHF 1TYNA 1EB2A 1ZHRA 1TGCA 3QTVH 1Y59T 1K1LA 2BLVA 1P2JA 1G2LA 1KTSB 2YNBA 5LGOA 3ZV8A 1FIZA 2ODYB 1IQMA 1O2RA 4GAWA 3P92A 3TGKE 1CBWC 1GGDC 3BEFB 3F68H 3ZYDA 2NU3E 3BTEE 4WH6A 1RFNA 1TE0A 5F8ZA 1F0SA 1OWHA 3SU4A 4R8TB 1P05A 4JCNA 1D4PB 1V2TT 1A3BH 1LPGB 1V3XA 1SGNE 4A1TA 3ZZ9A 1XUIA 2HRVA 2WPKS 1ZR0A 1O3IA 3PWCA 3NPSA 3SO3A 3GCOA 2F91A 3RM0H 1BCUH 2GT8A 2PR3A 3Q77A 1N8OC 1SI5H 1FMGA 1PYTC 4MPVA 3UWJH 2FLRH 3Q3YA 2OQ5A 4IMZA 5C5NA 2XCNA 3MTYA 4JZ1A 1GBTA 2ZPQA 3UFAA 1O2SA 3URDA 1XX9A 2OBOA 4I8JA 5EXMA 5F6MA 2Z94A 3LGVA 4GCHF 4E06H 1C1SA 4FUDA 4YM9A 1ARBA 3OTJE 3STIA 4FUHA 1TGNA 2A0QB 3SGBE 2ZWLH 1P3CA 1DSTA 1SGRE 3RXIA 1FAKH 1X7AC 1O2TA 3RXLA 1VCQA 1GVZA 4VGCB 3GDSA 4AYYB 1O2XA 1FN6A 1RTLA 2ZFSA 1MTUA 1ETTH 1Z8IB 3UNRA 2F9NA 5IYTA 2CJIA 2AMDA 3BIVH 3UNQA 2FS8A 3BTDE 1C5XB 2A2QH 2PGBB 3ZZ7A 1RS0A 1FAXA 1K1IA 1MTVA 3BTQE 2FESH 1F5RA 2FOHA 4WMDA 2NU0E 2Q6DA 3PM3A 1RIWB 2HOBA 1C5NH 4RN6A 5JPMH 1N6YA 4K5ZA 4K1EA 2BD8A 2QGRA 2NU2E 4OS5A 3BF6H 4YOIA 1KSNA 3NK8A 1C2EA 1MU8B 1T8LA 5PTPA 2HPQH 4JYVH 4AFSA 3BEIB 7LPRA 2JETB 3HGPA 5JBCS 1KXCA 4X8UH 1RTKA 2W7UA 1ACBE 2J95A 3V0XA 1LVYA 1CT0E 4NIXA 1YLDA 5EQRA 1RRKA 1SGYE 2DE8A 1C1TA 1KYNA 1O3MA 3MU0A 3OY6U 3T62A 4K8BA 3ZZ4A 1S6FA 1AE8H 5T6GA 1VGCB 3A8CA 1MZAA 2THFB 4ZHMU 1O5CB 2FLBH 2BXUH 3LGIA 1C5YB 4MNXA 3A7YA 1O5FH 1C1RA 1Z8GA 3A83A 1QRZA 1C5RA 2A5AA 4YT6H 1A0LA 1C5QA 1NFXA 1BTWA 4K1SA 2ZGBH 1XUGA 3BTWE 2P3UB 1V2UT 2G4UA 3PROA 1BMAA 2ZU5A 1LPZB 8ESTE 1NRQH 4MNWA 2F9OA 2BD2A 3A7ZA 2AS9A 1O3GA 4X2YA 1B0FA 4HGCA 1WOFA 3VB5A 1S83A 2RG3A 3BTFE 1AD8H 1TA6A 1ELEE 3MH7A 3A89A 2FOMB 4X2WA 1MKXK 3P95A 4DJZB 3I29A 1GJBB 3SV6A 1O2YA 3NZIA 4MTBA 1PPGE 1GDQA 2QA9E 3EYDA 1C5PA 1PYTD 3RC5A 1PQ8A 3GY8A 2B9LA 1K22H 2WYJA 3RXCA 1BMLA 3M3VA 1YCPK 3G01A 1NN6A 1AE5A 2VVCA 4DW2U 2LNCA 1ZTJA 2ANMH 3GCHB 3SU2A 2HPPH 2ZDVH 8GCHF 1O39A 1ZSJA 3SV7A 3VGCC 3F6UH 1FLEE 3FZZA 3ZYEA 4LOYH 1O2NA 1TB6H 1H9IE 2Y7ZA 2BOHB 2WUCA 1NFYA 3E6PH 3HKJB 1DY8A 3ELAH 1O5AB 4BAMB 1GBFA 1UCYE 4YOJA 1GI1A 2H9EH 1MZDA 3QWCH 3SUGA 1L1NA 1EX3A 1HJ8A 2Z3EA 2R3YA 3ZVBA 3UNSA 3V7TA 1OOKB 4AOQA 4X1QU 2R9PA 4I8GA 2ZGXH 3R0FA 2AEIH 3PLPA 4B74A 1O2UA 2GTBA 3GCNA 4INLA 3ZV9A 1TALA 2ZQ1A 1ELGA 1FI8A 5GCHF 1F5LA 4GCHG 2PFEA 1GI9B 4OGYA 3B9FH 3BIUH 1Q3XA 3FP6E 4K1TA 4O9VA 4YO9A 1TNKA 1CBWB 3S7KB 1GGDB 4Y0YE 2VU8E 2BB4A 1LHEH 3T29A 3ESTA 4UONA 3BG8A 1CO7E 1P2MA 4R0IA 3QZRA 2EC9H 2ZZUH 1O3JA 4MNVA 5E0GA 3NKKA 1PPZA 1N6XA 1NPMA 1VITH 3F1SB 2ULLA 4NIYA 1N8OB 2XRCA 6GCHF 2P94A 4SGAE 1W0YH 1F0TA 3E90B 1A46H 3I78A 1JIRA 1IQIA 5EU8A 3MYWA 3A82A 2WPHS 3CS0A 1ZLRA 2AGGX 1L4ZA 1VITF 3GISB 2A4QA 3QGJA 1BMMH 3GDUA 2VWOA 1V2KT 1TFXA 2ZCKP 1S85A 5J4SA 1AB9B 1TNJA 2QAAA 4DT7B 2SGDE 4TPYA 2Z9JA 2AMPA 2ZFPH 1V2JT 5TCAA 3RXPA 4TY6A 3M5OA 2BD7A 1GWAA 3A8DA 3A7VA 2F9BH 3F9GA 2A4RA 4B2AA 8KME2 2TRMA 5DP5A 1JIMA 2FOBA 2B8OH 1BBRK 1O5GH 1YPHC 2P3FH 5FBEA 4B76A 3KHVA 4Y11E 2FTLE 2Z9IA 1HXFH 1C1VH 1K9OE 1ZMLA 2QYIA 2ZHWH 3A8AA 1DSUA 3RU4T 3RP2A 1TQ7B 4KTCA 2VIWA 2VINA 2HNTF 1V6DA 4NFEA 2ODQA 1Y3UA 9ESTA 1EOJA 1QGFA 5A8XA 2WV5A 5FPTA 3I77A 3RU4D 1KLIH 4GUXA 2PKAB 2FI3E 2BZAA 3SI4H 2GV6A 1QJ1B 3K6ZA 3RC6A 1OXGA 1GVKB 1SBWA 1O2MA 9LPRA 1O2IA 3TH2H 3HK3B 5GWZA 3TNTA 1YKTA 1EP6A 2RA3A 3FANA 2ZECA 3A81A 3OX7U 2IPHA 2BLWA 3SHCH 1GPZA 1T4UH 1C1QA 4X8SH 1SLVB 2C4FH 4F4OC 1ZRBA 2OC7A 2VIPA 1QRWA 3PMJA 1NO9H 1S82A 2FTMA 1DICA 4WMEA 3VPKA 1ZZZA 2FDAA 2R0KA 4DGJA 1O2LA 2Y5FA 2EI7A 1GJ8B 1UK2A 1NRPH 4E05H 1EJNA 4Y10E 2TGPZ 2BX3A 2RCEA 2SNVA 3W94A 1V2VT 2ZDAH 1L0ZA 1GHZA 4UD9H 4X6MA 2CMYA 2CF8H 2QN5T 1Y5UT 1Y5BT 1BT7A 1EPTA 1SOTA 2TBSA 2F3CE 1DITH 1UCYH 3AW0A 1HAHH 1F5KU 1OX1A 3S69A 1GBBA 4IC6A 2EI6A 4Y79A 1CA0C 3AAVA 4MLFB 1MCVA 2BZ6H 3ZZCA 1V2QT 1U6QA 2A7JA 1O3PB 2ZHEH 1RTFB 5GCHG 1GI2A 4O3UA 1QL7A 2BDIA 2W3KA 1EKBB 1T31A 4A92A 2G51A 1J8AA 3VGCB 4YTAA 3QGNB 2H1UA 4GLYA 1GVLA 4E7NA 2VJ1A 2YOLA 3ZVFA 4HFPB 4A1XA 1A0JA 1SG8B 2C8ZB 1F7ZA 5AFYH 2UUFB 2PSXA 1NT1A 3DHKH 1P9UA 3A84A 3VXEH 1V2ST 3TVJB 1AVGH 3H5CB 1INCA 1K28D 1CT4E 1C2HA 2BLQA 3BEUA 1GI4A 2G81E 2UUKB 1TWXB 1WTGH 2B5TB 1O2OA 2BQ6B 2XWBI 3UR9A 1EUFA 4ZMAH 3Q3KA 5ABWA 1O2JA 4XE4A 6GCHG 5F8XA 3A80A 1G3EA 3LPRA 5LPFA 1XVMA 4ESTE 5FPSA 4WXIA 1BRBE 5FX6A 1JMOH 1ZMNA 3GY3A 4B1TA 2ANWA 1C5UA 3SJOA 5EXNA 3MFJA 3A87A 1DXWA 4NA7A 2XTTB 1C5OH 1HIAB 1BTYA 1BTZA 4BOHA 5DPAA 3U9AH 1IQEA 2HLCA 3DUXH 2F83A 4X8VH 1O5EH 1E0FD 1O2GH 1GJ6A 5A8ZA 3TGIE 2SGFE 3RUOA 3KL6A 3N7OA 2G4TA 1BA8B 1K1NA 1D3TB 1D3QB 3BG4C 3TJVA 1EZUC 3GY4A 3PLKA 4JZFH 3GY2A 3PLBA 1THSH 4HZHA 2G5VA 3ZVEA 1SB1H 3RC4A 1ANDA 3OYPA 5EQQA 1IQKA 1O5DH 1W0ZU 1HPGA 1HDTH 3DT0H 4MG3A 2QXGA 5TCCA 3RXBA 4Q7XA 4Q7YA 4RSPA 1B7XB 5FX5A 3M7QA 4FUEA 3RM2H 4YT7H 1YPKH 3RXTA 1UTNA 3S9BA 4NWLA 1DUEA 1PFXC 4AGJA 1THPB 1GCDA 1O3BA 5JBAS 4NA8A 2FI4E 3KQBA 2ZC9H 4ISHH 3D49H 1CGIE 2A5IA 2P16A 2VIDA 1KXFA 4YZUA 1OS8A 2XBXA 1B5GH 3M5LA 5B6OA 1SMFE 5FCKA 5E0JA 1LQDB 1TPSA 2W26A 1G2MA 2SGPE 1MD7A 3RU4E 1QURH 3SJIA 1QY6A 1EJMA 1C4U2 1WQSA 5SGAE 4AORA 1BUIA 1C5WB 2J2UA 2C90B 3E1XB 1C2GA 1K2I1 3RMMH 2ZU3A 5DGJA 4CRBA 2ZG0H 4ABJA 4K3JA 4RKJB 4MNYA 1YM0A 1TBRH 4BTIB 4KP0A 5FXLA 4ZUHA 3UOUA 5HXFA 2Z3DA 5K7RA 3MOCA 3SNDA 2ZP0H 1E37B 3ZVDA 1M9UA 4FU9A 4FU7A 5DP9A 1QA0A 2H5CA 5HYOA 2XBWA 5EPNA 2F9VA 2PSYA 2OC1A 4JK5A 3MO9A 4THNH 2VWMA 3QO6A 1VJAU 2F9PA 1UTPA 1O34A 1WYKA 3STJA 1KXEA 2ZQ2A 2VVUA 3UPEA 3BTKE 3K6YA 3UQVA 2AIQA 1YLCA 1Y3XA 3GDVA 3BTGE 3QN7A 1ELBA 1LDTT 2BQ7B 5A8YA 1OYQA 4U32A 4D8NA 1BIOA 4XOJA 1ELVA 1C9TA 1THRH 4ZHLU 3P8NA 3SN8A 4NFFA 1C1WH 2FODA 2J92A 1ABJH 2BD3A 2BMGB 4CHAC 3MNCA 3LJOA 1ZPCA 3T25A 1QTFA 1EATA 1P02A 5BRRE 2GMTC 4ZKNU 5LPRA 2NU4E 1P11E 2Z9GA 1L1JA 1A5HA 1O30A 4Q7ZA 2ZO3H 3GY7A 3CP7A 1V2WT 5F8TA 2JH6D 1HFDA 2BX4A 5A0AE 1QRXA 3SQHE 4AX9H 1O0DH 2G8TA 1NRRH 1XXDA 4JYUH 2BXTH 1GMDF 1ZMJA 2W3IA 1TMTH 1UHBB 2GP9B 3V13A 1GJDB 1DOJA 2AFQB 2XYAA 3BN9A 4MPXA 4CRFA 3LH3A 6LPRA 1F0RA 1BJVA 1JWTA 3ZVGA 1AZ8A 3QX5H 1CA0B 1GBHA 3UOPA 3M7TA 1QHRB 3K9XB 5G4BA 1D6WA 2AERH 2GGVB 1BTHH 2C3SA 3BTTE 1DANH 5HM2A 2BY6X 1Y3YA 2GV7A 4JK6A 6CHAC 1SGEE 1EAUA 1LPKB 3Q00A 1OWJA 1PPCE 1HAVB 1TLDA 3ZZDA 1GMCF 1SGFG 2R2WU 2XBVA 3E91A 1YGCH 4GHQA 1ZGIA 5GXPA 5GDSH 2SGEE 4J2YB 4X1SU 2HNTE 1A4WH 3SV2H 1HJAC 5H4IB 3RXHA 1QQUA 2G55A 4DOQA 3JZ2B 2BD9A 1FPHH 2XC0A 4YOGA 1MAYA 1SVPA 4KGAA 4H4FA 5L30H 4MVNA 2VIVA 1GBEA 4DURA 3SGQE 4IS5A 4CRDA 1TRYA 1O5BB 2W5EA 1SHHB 2XNIA 5ESBA 2TGTA 3K2UA 5CHAC 4ZKOU 1QNJA 3ZZ5A 1TONA 2C8XB 3KIDU 3MU1A 1S84A 1WCZA 5FHTA 5AF9H 3QLPH 2GX4A 1MH0A 1UVTH 5EODA 2A4GA 4DCDA 1MU6B 4ABDA 1TNGA 1UK4A 2A5KA 1TGTA 5FBIA 2ALVA 3VB6A 4LK4A 1OP0A 2P3TB 1TOCB 2RDLA 1H8IH 1MAXA 1QIXB 5FCRA 3RXOA 1BB0B 1UTKA 3BG4B 3PMHB 5TJXA 1W7XH 1G32B 3RXMA 3EAJA 4ZHAA 4AN7A 1C5ZB 1DE7H 1MBQA 4Y8XA 3SNBA 1GHAG 5CE1A 5IDKA 2WINI 3MWIU 4IMQA 5T3HA 1BDAA 3VB4A 1OP8A 3LU9B 3KQCA 1Z71A 1C5LH 2A4OA 4X0WU 4ABEA 2VH6A 1SOZA 3ODFA 1ZRKA 1RD3B 1EZQA 2BD4A 4NZLA 1S6HA 1CT2E 1Y3VA 1O2HA 2EEKA 2V3OH 2PW8H 3HATH 3EDXB 3SI3H 2BQWB 3FAOA 3U69H 4AG2A 5DG6A 5DP6A 2STBE 2VVVA 4U30A 1HJ9A 3TITA 3S0NA 2XBYA 1G3BA 5EQSA 4TWYA 3P70B 3RLWH 1YP9A 1IHSH 1TBZH 4HTCH 1HCGA 1DWBH 1O35A 2P95A 2PKAA 3MO6A 1CQQA 1GBCA 4ZXYH 1O2PA 2FEQH 3ATKA 1BBRH 1BRAA 4ZROA 1IQNA 2BVRH 3T27A 1RXPA 3IWMA 1W2KH 2PV9B 1KTTB 3CS7A 1O3AA 2BOKA 5JB9S 1V2PT 3RXFA 1W7GH 1TABE 3OSYA 1C9PA 1S81A 3MU8A 1ZHPA 3U1JB 5C1UA 1SLUB 2PWXA 2A2XH 1CE5A 2EA3A 1V2MT 2GZ7A 1QFKH 2PLXA 3S9AA 1XKAC 1H8DH 5C5OA 1ZHMA 2GDDA 1DFPA 3UUZA 3TU7H 1MQ6A 4ASHA 4ABBA 1EJAA 1HAGE 3ATIA 4ISNA 2FX6A 1TPOA 1GMDG 1IQLA 3ZVAA 2LPRA 1JBUH 2GD4B 1QCPA 3LOXA 2CGAA 1GDUA 2B0FA 4Y71A 1XUKA 3SHAH 4B2CA 1LQEA 1P10A 1SFQB 3LJJA 3E16B 3QZQA 1C5SA 2WPJS 3TIUA 1A2CH 3L33A 3PB1E 3UIRA 3E3TA 1NRNH 1SQAA 4CHAB 3KGPA 3GYLB 2FI5E 3LC3A 1ID5H 2XW9A 3F9FA 3LH1A 1KLJH 3MU4A 1P2QA 1GMCG 1WAYB 1RJXB 3D65E 1ZJDA 5EW1H 1BQYA 2WYGA 1J16A 3LGYA 5HMAA 1DWCH 5DP4A 5JYIA 2STAE 1HYLA 2UWOA 1TX8A 4I8HA 3SNAA 3ZZAA 1O2WA 5DO4H 4AFQA 2ZU1A 4IGDA 1MKWH 2ASUB 1HRTH 1DWDH 3RXKA 3FP8E 4NSVA 3UREA 2EI8A 1GI3A 1VCWA 1XXFA 1TA2A 1F0UA 3F9HA 4NWKA 4B71A 1AFQC 1O3EA 1FY3A 4CRGA 5C2ZA 2HGTH 1QB1A 1ORFA 1MQ5A 1T4VH 1MD8A 1L2EA 5C67A 1HAIH 1NM6A 3RXJA 2QV1A 2OXSA 1LHFH 4WY3A 2BDHA 4OS2A 1GJ7B 1D9IA 1ZGVA 2J38A 1O3FA 3S9CA 1ETSH 2PHBA 1O3KA 6CHAB 4CR5A 1ANCA 4IC5A 3TH4H 2BY7X 1GBKA 3H7OA 1T8NA 3R3GB 3RMOH 1HIAA 3Q76A 1H1BA 3Q3XA 4Z6AH 5E2OA 1YPEH 5AVDA 1P3EA 1HJAB 1L1GA 1TRNA 2SGQE 3A8BA 4UE7H 3NCLA 4X1NU 4DIHH 2O8TA 5DK1A 3AW1A 3RMLH 1AKSB 3SGAE 4LZ4B 3VB3A 3KQEA 1O37A 1FXYA 1L4DA 1J15A 2W7SA 3IITA 2Q6FA 2BVSH 2Y82A 4YLQH 1BTPA 1A5IA 1YPJH 1P0SH 5L2YH 4SGBE 1C1UH 3OY5U 2C8WB 1FIWA 2ZA5A 3OU0A 2B7DH 3PV4A 5CHAB 3TJOA 4AB8A 2ESTE 5C3NA 1ZSLA 4NIVA 4XDEA 1GJ4H 2GKVE 2GZ9A 1NC6A 3LGUA 3RXRA 3LT3A 1JXPA 2G52A 3HPTB 1GL0E 4GHTA 1T7CA 2QF0A 1QJ6B 1IHTH 1ZTLA 1UTOA 3ZZ6A 1HAZB 1H4WA 1O32A 3VEQB 4X2VA 4AB9A 5T6FA 1DY9A 1HXEH 3SU0A 1PPEE 4Q2KA 2AGEX 2ZFQH 1E36B 3O8CA 1YF4A 1DM4B
chains in the Genus database with same CATH superfamily
4I32A 3TK6A 1FN8A 1UTLM 5AFZH 3PV5A 1GJ9B 1AMHA 1GBIA 1Z6JH 4D9QA 1F92A 2CK3D 3P8FA 3ZVCA 3EGKH 1O2QA 1H9LB 1Z1JA 1GL1A 2FZZA 4XFQA 4D9RA 5JDUB 3F0OA 4FUBA 2BDGA 2OK5A 1CGHA 1GHWH 4AG1A 4MPUA 2J94A 5EOKA 3ZZ8A 2ZKSA 4NIWA 1ELAA 2H5DA 1TRMA 1OKXA 1YY3A 5FPYA 4UEHH 3SJKA 2O8MA 2ZGJA 2BM2A 2FWWA 2Y5HA 4Y0ZE 3UR6A 1TX6A 3O8BA 3SV9A 3DD2H 2I6QA 3UTUH 1Z7KA 3ZZBA 4WF8A 2XC5A 1A1RA 1WUNH 3NXPA 2ZU2A 4XSKU 4ABIA 2Z9KA 1S6LA 1UVSH 2CF9H 1O38A 4H42U 2ZFRH 3AVZA 3ITIA 3V12A 5JBBS 1IQFA 1PPBH 1WDIA 1C2LA 1TAWA 3OEHD 5DP8A 1KXAA 4A6LA 1JRTA 2TPIZ 3AAUA 2LELA 3FN8A 1H9HE 1V2RT 8LPRA 4YESB 4WXVA 3MNSA 1ZJKA 2ZFFH 1UJ1A 1BTUA 2ZPRA 5HM9A 1J9CH 1XVOA 1QL8A 3LKWA 3E8LA 4IW4E 5HIZA 1P12E 3M61U 2PUQH 1H8ED 3M5NA 4FUGA 4CBNA 3GCTG 2A1DB 2BVXH 2OUAA 1P57B 1UTQA 2D1JA 1LKAA 2V6NA 3VB7A 1LVOA 3HGNA 2FMJA 1FPCH 4B75A 3GICB 1LMWB 3SQEE 1UCYK 4Y8ZA 1O3CA 3LGTA 1O3DA 3IG6B 4B2BA 1C5TA 1UHBA 1P2IA 5HIYA 4BAQB 1BOQA 1LHGH 2LP6A 3P6ZB 4Y7BA 4FXGH 1W12U 1MTSA 2KCYA 1IQHA 1WV7H 1E79D 1P9SA 1LO6A 3A88A 1GI8B 2V7QD 2BDCA 5EW2H 1UTJA 3NUMA 3BV9B 1Z8RA 2ZDKA 4NCYA 1ANEA 4UFGH 1WTHD 1A7SA 3SORA 1FONA 1KXBA 3C27B 2FYQA 1GI5A 5DKMA 3HKIB 1GJCB 4KTUA 1NTPA 2VWLA 5JB8S 3LDXH 1OWKA 2H9HA 1HAVA 2QXHA 5DN6D 1CVWH 1GHAF 4FVBA 3V3MA 4XBDA 4NSYA 1V2NT 2ZIQH 1EAIA 4OS1A 1FDPA 4LZ1H 1GHVH 1SHYA 1AFQB 1WU1A 4OS4A 1O2ZA 3EA7A 2BY5X 2Z9LA 2Z7FE 2J97A 1UTMA 1FQ3A 1BITA 1O2KA 1SGCA 1AI8H 2GCHG 2FS9A 1C1PA 1QZ8A 3N7DA 3U28C 1BRCE 1ANBA 1W11U 2ZI2H 2OC8A 1FUJA 2OBQA 2ZGCA 1RGQA 1LVBA 1PQ7A 2QY0B 4H6TA 4E7RG 2HVXA 3M35A 3KNXA 1PQ5A 3QDZB 1SQOA 2C8YB 2XC4A 1G37A 2Z3CA 1MABB 1SL3A 2O9QA 1O36A 1C5VA 2JH0D 2XXLA 3LC5A 2BLOA 2UWPA 4FUCA 1BRUP 3ENSB 1BBRE 1MTNC 1YBWA 4GSOA 5ESTE 1GHXH 4TYDA 3UWIA 1D3DB 4NA9H 1SGFA 4A7IB 1GBAA 1TNIA 1YCPM 1NS3A 4NGAH 2ZU4A 1A3EH 2IOTA 3SW2B 4BXWA 3W95A 1TNHA 2PKSC 1ESAA 3GS9A 4RKOB 5DSFA 4ZAEA 4OS7A 4GVUA 1A0HB 2RFKC 1NBMD 2Y6TA 1N1LA 1O31A 1C1NA 4KTSA 4UDWH 1EZXC 2A7CA 1AN1E 1P2KA 3F2GA 1K1JA 2PGQB 1CA8B 1OWIA 1GBLA 1EASA 2O8WA 4ISOA 3LGWA 1AB9C 2ZDMA 3EE0B 2Y81A 2ZCLP 3FP7E 4UFFH 1NFUA 3URCA 1W13U 1OSSA 1C2FA 2J34A 2ODPA 3FFGA 4NZQA 1ELTA 3SV8A 3RXUA 1MKXH 2A45B 1NESE 1KY9A 1CU1A 1O3OA 1P03A 4NG9H 3HK6B 1C2MA 4UFDH 1O2VA 1YC0A 2PTCE 2D2DA 5T1VA 3M5MA 1YCPH 2VIOA 4WVPE 1YPHE 3O8RA 5FAHA 1C2JA 2ZGHA 2FOGA 2F4LA 5EG4A 4BANB 1KDQB 1OPHB 1UVPA 1E34B 2ZF0H 4MQAA 5C1YA 3RXAA 1Q2WA 1OWDA 2FOEA 2FPZA 2VNTA 4WJG2 1CHOF 1GI0A 1SLWB 2XWAA 3PO1C 3N7EA 3A7XA 4IN2A 2KAIB 2Y7XA 1V2OT 3SU5A 1AUTC 4BAHB 1J17T 1GJAB 3UB0A 1WSSH 2JH5D 1O3NA 2Y80A 4U2WA 1T8MA 1ELFA 1HBTH 2AMQA 3SNCA 2ZHQH 1VR1H 3KEEA 2F9UA 1AVXA 4OM9A 1Y5AT 2WPLS 1G36A 3RLYH 2NU1E 2RA0A 1AUJA 3B23B 1CGJE 3SUDA 1GHBG 3TH3H 1SGTA 3EA9A 2A7HA 1SKYE 2XOKD 1HV7A 1O3LA 1TOMH 4M7GA 2CV3A 4ABFA 3BTHE 2OD3B 1ZOMA 5DJ7A 1EAWA 3GY5A 3TK5A 4CH2B 3TJUA 3L3TA 1A5GH 2ZEBA 2P93A 3QK1A 3MMGA 2IJOB 4CR9A 2YNAA 3JZ1B 2OINA 1DT2A 1FY8E 3SJ9A 2O8UA 4D7GA 2OP9A 2G00A 2WPMS 2GCTC 3ATLA 1VCPA 4X2XA 3U1IB 5F03A 1UVOA 2FM2A 2V3HH 4KELA 4D7FA 2Q6GA 1KIGH 1NFWA 4P00A 4ISIH 5LPEA 1PPFE 1BMFD 5GJ4B 1YPLH 3SOSA 1AY6H 2CN0H 2UWLA 2R3UA 4ZH8A 4AGKA 4Z1MD 2JKHA 4OGXA 4DY7B 5I25A 3PMAB 1K1PA 1MCTA 1YPGH 1LKBA 4Y7AA 1KXDA 1W3CA 3A86A 4HI3A 2ANKH 5L6NH 3T26A 4IBLH 3PTBA 4ISLA 2OTVA 2FOAA 2NWNA 1UMAH 3MH4A 1T32A 3QUMP 1DS2E 3RXSA 2WZQA 3GY6A 1O3HA 1EOLA 2KCOA 3MH6A 7GCHG 1HAXB 2SFAA 3O8DA 1AVWA 1QBVH 2H9TH 4BXSA 1QBNA 5EPYA 1Z6EA 4JZDH 2ANYA 4BNRA 2BDYA 1QR3E 4XD7D 5JBTA 1FJSA 3MNBA 4AC9A 4FU8A 2QE7D 4TY7A 1FZZA 4KKDA 1DUAA 1XMNB 2CHAC 1TX7A 1ETRH 3SJ8A 3M37A 4XBCA 2PTNA 2IN2A 2BTCE 4WH8A 2WHXA 2VGCC 3FVFB 1SSXA 2WUBA 4GPGA 3NRLA 4O03A 2HVYB 3FZDA 3PYHA 2BY8X 1S0RA 2ZPSA 1IQJA 2D8WA 1D3PB 1BHXF 1QB6A 1LHCH 1VJ9U 1Y8TA 2L74A 5C20A 5C0UA 3EE7A 2TGAA 3RXEA 1WBGB 2OQUA 2V0BA 4HG6A 4AFUA 1AKSA 5CDFE 1C1MA 1MUEB 2OC0A 1DLEA 2EQNA 4MPWA 1GI7B 3OEED 2ZHDA 5FL7D 1SGPE 1Z1IA 5GIBA 4BAOB 2OCVB 4JYTA 1XKBC 1K21H 3MU5A 4A1VA 1G30B 5A0BA 4U01A 1LVMA 1QQ4A 3LIWA 3RMNH 3A7WA 4INHA 1EZSC 1BTXA 1NBME 1VZQH 2YMSC 1MTNB 2WV9A 3H7TA 3U8TH 4ZXXH 5L2ZH 3P17H 1Q31A 4FUIA 1GG6C 1GDNA 1A61H 2WPIS 1E38B 1P06A 3KF2A 1G3CA 1HAOH 4K2YA 2GT7A 2CXVA 3SU3A 4FUJA 1SR5C 1QB9A 1ABIH 1MBMA 2BHGA 3M3TA 2PKSB 2TIOA 1DWEH 1ESBA 1FY1A 1C2DA 3F9EA 1D6RA 2BYAX 1MTWA 3A85A 2GMTB 1NU7B 4I8LA 1LTOA 1NZQH 5EGMA 1ARCA 1CHOG 4X6OA 1K1OA 3DSOA 1WQVH 4F48B 4A5TS 3T2NA 4K8YA 2P8OC 5DP3A 1EPTC 3GCTF 4WWYA 1UK3A 2EY4C 3KN2A 1ELDE 5CMXH 4AYVB 3MH5A 1FV9A 1IQGA 3UY9A 2FIRH 4JZIA 1AFEH 1CHGA 1GCTC 2Z6BD 4I33A 1JRSA 1TPPA 3M36A 1OP2A 4ABAA 1GMHF 2J9NA 1YWUA 5AHGH 1G3DA 2ZDNA 4BTUB 1DLKB 4YXWD 3MNXA 1UVUH 4X8TH 1O33A 2ZTYA 4CH8B 1NY22 5A09A 1EXFA 2XCFA 1AO5A 1BJUA 3L6PA 2VWNA 4F49A 1SFIA 3TLOA 1AU8A 1AQ7A 3TK9A 1QJ7B 3TNSA 4YLUA 2DE9A 3NWUA 4O3TA 4H6SB 4LXBH 1LHDH 2I6SA 1F2SE 1T8OA 1JOUB 1HAYB 3E0PB 1SGQE 2SGAA 3PO1B 2H6MA 3UQOA 2FOFA 1NROH 4INKA 5J4QA 1TMUH 1G9IE 2HNTC 2Y5GA 1HUTH 3FKSD 4CREA 4BAKB 1AGJA 2OLGA 3VXFH 2FP7B 2QC2A 4UFEH 3D23A 4K60A 3TPIZ 3M3SA 3KQDA 1TMBH 1E35B 4ZKRU 4TPIZ 1DX5M 3SUFA 2GVFA 2V35A 3T5FH 4I8KA 1UO6A 1YYY1 4IN1A 1C4Y2 1P09A 2C93B 3EA8A 1AHTH 3DFLA 3A7TA 1QL9A 2BD5A 1FY5A 2GCHF 2FX4A 5I46H 3SU1A 4QT8C 1TNLA 1ZTKA 4JZEH 1AWHB 1EB1H 1SPJA 2BDBA 2UUJB 3RXQA 1GJ5H 1ELCA 4DVAU 4Y76A 4K69A 4JMYA 4TWWA 2ZTZA 1SC8U 3U8OH 1P8VC 5CHBA 5A2MH 3FO8D 1SGDE 2UUYA 2R0LA 1XUHA 1B0EA 8GCHG 1BMNH 1GBJA 5DP7A 2GCTB 4O97A 2O8LA 3ODDA 3VFEA 2AH4X 1P2NA 3SNEA 4CRAA 1QBOA 2J4IA 1TPAE 3M7UA 5IK2D 5BPEA 4P02A 4XBBA 4D76A 3KYFA 1AZZA 2JDID 2FO9A 5EXLA 4VGCC 1DDJA 2P59A 2M5TA 1EP5A 1MKWK 3TGJE 4J1YA 2BDAA 4Q80A 3RXGA 1HAPH 5EJ1A 2G5NA 1XUFA 2QXIA 1LCYA 5T6DA 1DXPA 1P01A 2VB0A 3CENA 2ALPA 5E8EH 3DA9B 1HLTH 1PPHE 2HALA 4I7YH 1ZSKA 1Z8JB 5KGOA 1ESTA 1RIWC 3QTOH 1GHYH 5A0CA 2H2ZA 4X6PA 3MQKC 2ILNA 4DG4A 1AIXH 4CRCA 6ESTA 3RXDA 1AWFH 1P2OA 2CHAB 4WMFA 4X1RU 4OS6A 4ABGA 2TGDA 2JETC 3SBKA 3RDZA 3ZZ3A 1DVAH 2A31A 1XUJA 2VGCB 1ZPBA 5GPIB 3KCGH 4Z0KA 3K65B 2W6JD 4RI0A 1W8BH 1ZPZA 5ETXA 5LH8A 1C4V2 1HGTH 2Q1JA 3ATWA 1BHXB 2SNWA 1W10U 4DIIH 4CBOA 2ZTXA 3LONA 3S7HB 1VGCC 2QXJA 4PROA 5C1XA 3PWBA 3F0PA 1IAUA 4ABHA 2FYRA 2PUXB 1YLNA 3MI4A 2VH0A 3SU6A 5E2PA 4X1PU 2ZHFH 4AZ2B 1VITG 3W1EA 3C1KA 1S5SA 2R2MB 3GOVB 4X6NA 1OYTH 3U98H 3SZNA 4ZKSU 1TIOA 1FNIA 3GYMA 3MO3A 1V2LT 2BY9X 5E0HA 1NU9A 2YMSB 3AASA 3D62A 7ESTE 4MDSA 1DPOA 1GMHG 3B8JA 2QF3A 3MHWU 1S0QA 1GG6B 2QCYA 1GBMA 2FXRA 4FUFA 1TGSZ 3WY8A 1GHBF 4I31A 1CSOE 1EFRD 1QA7A 1C2KA 1OWEA 1YPMH 3SUEA 1FY4A 4BTTB 1SLXB 2ZNKH 4Y8YA 1HB0B 1BZXE 5HGGA 2A32A 1KLTA 2AGIX 2GDEH 3RXVA 1TQ0B 1K1MA 1XM1A 3GCHC 2K1QA 3PMBB 4Y6DA 1EAXA 4FVDA 2AIPA 2QIQA 4AFZA 1W14U 3P8GA 3DFJA 1EQ9A 1PQAA 2P8OB 1EPTB 2GZ8A 3BSQA 3UAIC 7KMEH 3P8OA 1KDQA 1PJPA 3EQ0H 1KMHB 3E0NB 1SQTA 1Y3WA 2FOCA 1GBDA 1GI6A 5K0HA 3ATMA 3TJNA 1GCTB 1J14A 2AYWA 1SGIB 2KAIA 2WV4A 2VIQA 3BTME 3PTNA 1MMJN 2ZCHP 2JIZD 1NRSH 1C5MD 3T28A 2J5UA 1TBQH 2ZFTA 1C1OA 2HWLB 1C2IA 1TGBA 1P04A 1HNEE 3U8RH 1IOEA 2ZDLA 2D26C 1ZYOA 4B73A 2DUCA 7GCHF 1TYNA 1EB2A 1ZHRA 1TGCA 3QTVH 5GNDA 1Y59T 2KX4A 1K1LA 2BLVA 1P2JA 1G2LA 1KTSB 4Q4LA 2YNBA 2AHME 5LGOA 3ZV8A 1FIZA 2ODYB 1IQMA 4TT3D 1O2RA 4GAWA 3P92A 3TGKE 1CBWC 1GGDC 3BEFB 3F68H 3ZYDA 2NU3E 3BTEE 4WH6A 1RFNA 1TE0A 5F8ZA 2IPQX 1F0SA 1OWHA 3SU4A 4R8TB 1P05A 4JCNA 1D4PB 1V2TT 1A3BH 1LPGB 1V3XA 1SGNE 4A1TA 3ZZ9A 1XUIA 2HRVA 4TSFD 2WPKS 1ZR0A 1O3IA 3PWCA 3NPSA 3SO3A 3GCOA 2F91A 3RM0H 1BCUH 2GT8A 2PR3A 3Q77A 1N8OC 1SI5H 3WWFA 1FMGA 1PYTC 4MPVA 3UWJH 2FLRH 3Q3YA 2OQ5A 4IMZA 5C5NA 2XCNA 3MTYA 4JZ1A 1GBTA 2ZPQA 3UFAA 1O2SA 3URDA 1XX9A 2OBOA 4I8JA 5EXMA 5F6MA 2Z94A 3LGVA 4GCHF 4E06H 1C1SA 4FUDA 4YM9A 1ARBA 3OTJE 3STIA 4FUHA 3FOAA 1TGNA 2A0QB 3SGBE 2ZWLH 1P3CA 1DSTA 1SGRE 3RXIA 1FAKH 1X7AC 1FX0B 1O2TA 3RXLA 1VCQA 1GVZA 4VGCB 3GDSA 4AYYB 1O2XA 5KECA 1FN6A 1RTLA 2ZFSA 1MTUA 1ETTH 1Z8IB 3UNRA 2F9NA 5IYTA 2CJIA 2AMDA 3BIVH 3UNQA 2FS8A 3BTDE 1C5XB 4ASUD 2A2QH 2PGBB 3ZZ7A 1RS0A 1FAXA 1K1IA 1MTVA 3BTQE 2FESH 1F5RA 2FOHA 4WMDA 2NU0E 2Q6DA 3PM3A 1RIWB 2HOBA 1C5NH 4RN6A 5JPMH 1N6YA 4K5ZA 4K1EA 2BD8A 2QGRA 2NU2E 4OS5A 3BF6H 4YOIA 1KSNA 3NK8A 1C2EA 1MU8B 1SQRA 1T8LA 5PTPA 2HPQH 4JYVH 4AFSA 3BEIB 7LPRA 2JETB 3HGPA 5JBCS 1KXCA 4X8UH 1RTKA 2W7UA 1ACBE 3DSGA 2J95A 3V0XA 1VKYA 2KM0A 1LVYA 1CT0E 4NIXA 1YLDA 5EQRA 1RRKA 1SGYE 2DE8A 1C1TA 1KYNA 1O3MA 3MU0A 3OY6U 3T62A 4K8BA 3ZZ4A 1S6FA 1AE8H 5T6GA 1VGCB 3A8CA 1MZAA 2THFB 4ZHMU 1O5CB 2FLBH 2BXUH 3LGIA 1C5YB 4MNXA 3A7YA 1O5FH 1C1RA 1Z8GA 3A83A 1QRZA 1C5RA 2A5AA 4YT6H 1A0LA 1C5QA 1NFXA 1BTWA 4K1SA 2ZGBH 1XUGA 2GJGA 3BTWE 2P3UB 1V2UT 2G4UA 3PROA 1BMAA 2ZU5A 1LPZB 8ESTE 1NRQH 4MNWA 2F9OA 2BD2A 3A7ZA 2AS9A 1O3GA 4X2YA 1B0FA 4HGCA 1WOFA 3VB5A 1S83A 2RG3A 3BTFE 2VBCA 1AD8H 1TA6A 1ELEE 3MH7A 3A89A 2FOMB 4X2WA 1MKXK 3P95A 4DJZB 3I29A 1GJBB 3SV6A 1O2YA 3NZIA 4MTBA 1PPGE 1GDQA 2QA9E 3EYDA 1C5PA 1PYTD 3RC5A 1PQ8A 3GY8A 2B9LA 1K22H 2WYJA 3RXCA 1BMLA 3M3VA 1YCPK 3G01A 1NN6A 1AE5A 2VVCA 4DW2U 3PV2A 1ZTJA 2ANMH 2LNCA 3GCHB 3SU2A 2HPPH 2ZDVH 8GCHF 1O39A 1ZSJA 3SV7A 3VGCC 3F6UH 1FLEE 3FZZA 3ZYEA 4LOYH 1O2NA 1TB6H 1H9IE 2Y7ZA 2BOHB 2WUCA 1NFYA 3E6PH 3HKJB 1DY8A 3ELAH 1O5AB 4BAMB 5F53A 1GBFA 1UCYE 4YOJA 1GI1A 2H9EH 3VG8A 1MZDA 3QWCH 3SUGA 1L1NA 1EX3A 2XNDD 3WW7A 2PP6A 1HJ8A 2Z3EA 2R3YA 3ZVBA 3UNSA 3PRBA 3V7TA 1OOKB 4AOQA 4X1QU 2R9PA 4I8GA 2ZGXH 3R0FA 2AEIH 3PLPA 4B74A 1O2UA 2GTBA 3F3BA 3GCNA 4INLA 3ZV9A 1TALA 2W6ID 2ZQ1A 1ELGA 1FI8A 5GCHF 1F5LA 3KYGA 4GCHG 2PFEA 1GI9B 4FETA 4OGYA 3B9FH 3BIUH 1Q3XA 3FP6E 4K1TA 4O9VA 4YO9A 1TNKA 1CBWB 3S7KB 1GGDB 4Y0YE 2VU8E 2BB4A 1LHEH 3T29A 3ESTA 4UONA 3BG8A 1CO7E 1P2MA 4R0IA 3QZRA 2EC9H 2ZZUH 1O3JA 4MNVA 5E0GA 3NKKA 1PPZA 4ZCNA 1N6XA 1NPMA 1VITH 3F1SB 2ULLA 4NIYA 1H8HD 1N8OB 2XRCA 6GCHF 2P94A 4RT1A 4SGAE 1W0YH 1F0TA 3E90B 1A46H 3I78A 1JIRA 5KEDA 1IQIA 5EU8A 3MYWA 3PRDA 3A82A 2WPHS 3CS0A 1ZLRA 2AGGX 1L4ZA 1VITF 3GISB 2A4QA 3QGJA 1BMMH 3GDUA 2VWOA 1V2KT 1TFXA 2ZCKP 1S85A 5J4SA 1AB9B 1TNJA 2QAAA 4DT7B 2SGDE 4TPYA 2Z9JA 2AMPA 2ZFPH 1V2JT 5TCAA 3RXPA 4TY6A 3M5OA 2BD7A 3OFND 1GWAA 3A8DA 3A7VA 2F9BH 3F9GA 2A4RA 4B2AA 8KME2 2TRMA 5DP5A 1JIMA 2FOBA 2B8OH 1BBRK 1O5GH 1YPHC 2P3FH 5FBEA 4B76A 3KHVA 4Y11E 2FTLE 2Z9IA 5HKKD 1HXFH 1C1VH 1K9OE 1ZMLA 2QYIA 2ZHWH 3A8AA 1DSUA 3RU4T 1E1RD 3RP2A 1TQ7B 4KTCA 2VIWA 2VINA 4FOUC 2HNTF 1V6DA 4NFEA 2ODQA 1Y3UA 9ESTA 1EOJA 1QGFA 2KR7A 5A8XA 2WV5A 5FPTA 3I77A 3RU4D 1KLIH 4GUXA 2QF5A 2PKAB 2FI3E 2BZAA 3SI4H 3ZIAD 2GV6A 1QJ1B 3K6ZA 3RC6A 1OXGA 1GVKB 1SBWA 1O2MA 9LPRA 1O2IA 2KZ4A 3TH2H 3HK3B 5GWZA 3TNTA 1YKTA 1EP6A 2RA3A 3FANA 2ZECA 3A81A 3OX7U 2IPHA 2BLWA 4M9FA 3SHCH 1GPZA 1T4UH 1C1QA 4X8SH 5EJZA 1SLVB 2C4FH 4F4OC 1ZRBA 2OC7A 2VIPA 1QRWA 3PMJA 1NO9H 1S82A 2FTMA 1DICA 4WMEA 3VPKA 1ZZZA 2FDAA 1COWD 2R0KA 4DGJA 1O2LA 2Y5FA 2EI7A 1GJ8B 1UK2A 1NRPH 4E05H 2YMSD 1EJNA 4Y10E 2TGPZ 2BX3A 2RCEA 2SNVA 3W94A 1V2VT 2ZDAH 1L0ZA 1GHZA 4UD9H 4X6MA 2CMYA 2CF8H 2QN5T 1Y5UT 1Y5BT 1BT7A 1EPTA 1SOTA 2TBSA 2F3CE 1DITH 1UCYH 3AW0A 1HAHH 1F5KU 1OX1A 3S69A 1GBBA 4IC6A 2EI6A 4B6FA 3DSPA 4Y79A 1CA0C 3AAVA 4MLFB 1MCVA 2BZ6H 3ZZCA 1V2QT 1U6QA 2A7JA 1O3PB 2ZHEH 1RTFB 5GCHG 1GI2A 4O3UA 1QL7A 2BDIA 2W3KA 1EKBB 1T31A 4A92A 2G51A 1J8AA 3VGCB 4YTAA 3QGNB 2H1UA 4GLYA 1GVLA 4E7NA 2VJ1A 2YOLA 3ZVFA 4HFPB 4A1XA 1A0JA 1SG8B 2C8ZB 1F7ZA 5AFYH 2UUFB 2PSXA 3WWBA 1NT1A 3DHKH 1P9UA 3A84A 3VXEH 1V2ST 3TVJB 1AVGH 3H5CB 2WPDD 1INCA 1K28D 1CT4E 1C2HA 2BLQA 3BEUA 1GI4A 2G81E 2UUKB 1TWXB 1WTGH 2B5TB 1O2OA 2BQ6B 2XWBI 3UR9A 1EUFA 4ZMAH 3Q3KA 5ABWA 1O2JA 4XE4A 6GCHG 5F8XA 3A80A 1G3EA 3LPRA 5LPFA 1XVMA 4ESTE 5FPSA 4WXIA 1BRBE 5FX6A 1JMOH 1ZMNA 3GY3A 4B1TA 2ANWA 1C5UA 3SJOA 5EXNA 5C0TA 3MFJA 3A87A 1DXWA 4NA7A 2XTTB 1C5OH 1HIAB 1BTYA 1BTZA 4BOHA 3KQ5A 5DPAA 3U9AH 1IQEA 2HLCA 3DUXH 2F83A 4X8VH 1O5EH 1E0FD 1O2GH 1GJ6A 5A8ZA 3TGIE 2SGFE 3RUOA 3KL6A 4DT4A 3N7OA 5EJLA 2G4TA 2J98B 1BA8B 4ACAA 1K1NA 1D3TB 1D3QB 3BG4C 3TJVA 1EZUC 3GY4A 3PLKA 4JZFH 3GY2A 3PLBA 1THSH 4HZHA 2G5VA 3F2HA 5B6LA 3ZVEA 1SB1H 3RC4A 1ANDA 3OYPA 5EQQA 1IQKA 1O5DH 1E1QD 1W0ZU 1HPGA 1HDTH 3DT0H 4MG3A 2QXGA 5TCCA 5C94A 3RXBA 4Q7XA 4Q7YA 4RSPA 1B7XB 5FX5A 3M7QA 4FUEA 3RM2H 4YT7H 1YPKH 3RXTA 1UTNA 3S9BA 4NWLA 1DUEA 1PFXC 4AGJA 3SZEA 1THPB 1GCDA 1O3BA 5JBAS 4NA8A 2FI4E 3KQBA 2ZC9H 4ISHH 3D49H 1CGIE 2RDEA 2A5IA 4XRNA 2P16A 2VIDA 1KXFA 4YZUA 1OS8A 2XBXA 1B5GH 3M5LA 5B6OA 1SMFE 5FCKA 4ACBA 5E0JA 1LQDB 1TPSA 2W26A 1G2MA 2SGPE 1MD7A 3RU4E 3OAAD 1QURH 3SJIA 1QY6A 1EJMA 1C4U2 1WQSA 5SGAE 4AORA 5C17A 1BUIA 1C5WB 2J2UA 2C90B 3E1XB 1C2GA 1K2I1 1W0JD 3RMMH 2ZU3A 5DGJA 4CRBA 2ZG0H 4ABJA 4K3JA 4RKJB 4MNYA 2K0QA 1YM0A 1TBRH 4BTIB 4KP0A 5FXLA 4ZUHA 3UOUA 5HXFA 2Z3DA 5K7RA 3MOCA 3SNDA 2ZP0H 1E37B 3ZVDA 1M9UA 4FU9A 4FU7A 5DP9A 1QA0A 2H5CA 5HYOA 2XBWA 5EPNA 2WSSD 2F9VA 2PSYA 2OC1A 4JK5A 3MO9A 4THNH 2VWMA 3QO6A 1VJAU 2F9PA 1UTPA 1O34A 1WYKA 3STJA 1KXEA 2ZQ2A 2VVUA 3UPEA 3BTKE 3K6YA 3UQVA 2AIQA 1YLCA 1Y3XA 3GDVA 3BTGE 3QN7A 1ELBA 1LDTT 2BQ7B 5A8YA 1OYQA 4U32A 4D8NA 1BIOA 4XOJA 1ELVA 1C9TA 1THRH 4ZHLU 3P8NA 3SN8A 4NFFA 1C1WH 2FODA 2J92A 1ABJH 2BD3A 2KFWA 2BMGB 4CHAC 3MNCA 3LJOA 1ZPCA 3T25A 1QTFA 1EATA 1P02A 5BRRE 2GMTC 4ZKNU 5LPRA 2JJ1D 1P11E 2NU4E 2Z9GA 3OE7D 1L1JA 1A5HA 1O30A 4Q7ZA 2ZO3H 3GY7A 3CP7A 1V2WT 5F8TA 2JH6D 1HFDA 2F43B 2BX4A 5A0AE 1QRXA 3SQHE 4AX9H 1O0DH 2G8TA 1NRRH 1XXDA 4JYUH 2BXTH 1GMDF 1ZMJA 2W3IA 1TMTH 1UHBB 2GP9B 3V13A 1GJDB 3CNRA 1DOJA 2AFQB 2XYAA 3BN9A 4MPXA 4CRFA 3LH3A 6LPRA 1F0RA 1BJVA 1JWTA 3ZVGA 1AZ8A 3QX5H 1CA0B 1GBHA 3UOPA 3M7TA 3OTPA 1QHRB 3K9XB 5G4BA 1D6WA 2AERH 2GGVB 1BTHH 1WXRA 2C3SA 3BTTE 1DANH 5HM2A 2BY6X 1Y3YA 4F55A 2GV7A 4JK6A 6CHAC 1SGEE 1EAUA 1LPKB 3Q00A 1OWJA 1PPCE 1HAVB 1TLDA 3ZZDA 1GMCF 1SGFG 2R2WU 2XBVA 3E91A 1YGCH 4GHQA 1ZGIA 5GXPA 5GDSH 2SGEE 4J2YB 4X1SU 2HNTE 1A4WH 3SV2H 1HJAC 5H4IB 3RXHA 1QQUA 2G55A 4DOQA 3JZ2B 2BD9A 1FPHH 2XC0A 4YOGA 1MAYA 1SVPA 4KGAA 4H4FA 5L30H 4MVNA 2VIVA 1GBEA 4DURA 3SGQE 4IS5A 4CRDA 1TRYA 2HLDD 1O5BB 2W5EA 1SHHB 2XNIA 5ESBA 2TGTA 3K2UA 5CHAC 4ZKOU 1QNJA 3ZZ5A 1TONA 2C8XB 3KIDU 2JJ2D 3MU1A 4B6EA 1S84A 1WCZA 5FHTA 5AF9H 3QLPH 2GX4A 1MH0A 1UVTH 5EODA 2A4GA 4DCDA 1MU6B 4ABDA 1TNGA 1UK4A 2A5KA 1TGTA 5FBIA 2ALVA 3VB6A 4LK4A 1OP0A 2P3TB 1UW7A 1TOCB 2RDLA 1H8IH 1MAXA 1QIXB 5FCRA 3RXOA 1BB0B 1UTKA 3BG4B 3PMHB 5TJXA 1W7XH 1G32B 3RXMA 3EAJA 4ZHAA 4RT0A 4AN7A 3H09A 1C5ZB 1DE7H 1MBQA 4Y8XA 3SNBA 1GHAG 5CE1A 5IDKA 2WINI 3MWIU 4IMQA 5T3HA 1BDAA 3VB4A 1OP8A 3LU9B 3KQCA 5EIYA 1Z71A 1C5LH 2A4OA 4X0WU 4ABEA 2VH6A 1SOZA 3ODFA 1ZRKA 1RD3B 1EZQA 2BD4A 4NZLA 1S6HA 1CT2E 1Y3VA 1O2HA 2EEKA 1K0HA 2V3OH 1W0KD 2PW8H 3HATH 3EDXB 3SI3H 2BQWB 3FAOA 3U69H 4AG2A 5DG6A 5DP6A 2STBE 2VVVA 4U30A 1HJ9A 3TITA 3S0NA 2XBYA 1G3BA 5EQSA 4TWYA 3P70B 3RLWH 1YP9A 1IHSH 1TBZH 4HTCH 1HCGA 1DWBH 1O35A 2P95A 2PKAA 3MO6A 1CQQA 1GBCA 4ZXYH 1O2PA 2FEQH 3ATKA 1BBRH 1BRAA 4ZROA 1IQNA 2BVRH 3T27A 1RXPA 3IWMA 1W2KH 2PV9B 1KTTB 3CS7A 1O3AA 2BOKA 5JB9S 1V2PT 3RXFA 1W7GH 1TABE 3OSYA 1C9PA 1S81A 3MU8A 1ZHPA 3U1JB 5C1UA 1SLUB 2PWXA 2A2XH 2KCAA 1CE5A 2EA3A 1V2MT 3DCLA 2GZ7A 1QFKH 2PLXA 3S9AA 1XKAC 1H8DH 5C5OA 1ZHMA 2GDDA 1DFPA 3UUZA 3TU7H 1MQ6A 4ASHA 4ABBA 1EJAA 1HAGE 3ATIA 4ISNA 2FX6A 1TPOA 1GMDG 1IQLA 3ZVAA 2LPRA 1JBUH 2GD4B 1QCPA 3LOXA 2CGAA 1GDUA 2B0FA 4Y71A 1XUKA 3SHAH 4B2CA 1LQEA 1P10A 1SFQB 3LJJA 3E16B 3QZQA 1C5SA 2WPJS 2V3MA 3TIUA 1A2CH 3L33A 3PB1E 3UIRA 3E3TA 1NRNH 1SQAA 4CHAB 3KGPA 3GYLB 2FI5E 3LC3A 1ID5H 2XW9A 3F9FA 3LH1A 1KLJH 3MU4A 1P2QA 1GMCG 1WAYB 1RJXB 3D65E 1ZJDA 5EW1H 1BQYA 2WYGA 1J16A 3LGYA 5HMAA 1DWCH 5DP4A 5JYIA 2STAE 1HYLA 2UWOA 1TX8A 4I8HA 3SNAA 3ZZAA 1O2WA 5DO4H 4AFQA 2ZU1A 4IGDA 1MKWH 2ASUB 1HRTH 1DWDH 3RXKA 3FP8E 4NSVA 3UREA 2EI8A 1GI3A 1VCWA 1XXFA 1TA2A 1F0UA 3F9HA 4NWKA 4B71A 1AFQC 1O3EA 1FY3A 4CRGA 5C2ZA 2HGTH 1QB1A 1ORFA 1MQ5A 1T4VH 1MD8A 1L2EA 5C67A 1HAIH 1NM6A 3RXJA 2QV1A 2OXSA 1LHFH 4WY3A 2BDHA 2L6OA 1GJ7B 2K8IA 4OS2A 1D9IA 1ZGVA 2J38A 1O3FA 3S9CA 1ETSH 4I86A 2PHBA 1O3KA 3SYJA 6CHAB 4CR5A 1ANCA 4IC5A 3TH4H 2BY7X 1GBKA 3AK5A 2IJD1 3H7OA 1T8NA 3R3GB 3RMOH 2M2AA 1HIAA 3Q76A 1H1BA 3Q3XA 4Z6AH 5E2OA 1YPEH 5AVDA 1P3EA 1HJAB 1L1GA 1TRNA 2SGQE 3A8BA 4UE7H 1OHHD 3NCLA 4X1NU 4DIHH 2O8TA 2QF4A 3AW1A 5DK1A 3RMLH 1AKSB 3SGAE 2J98A 4LZ4B 3N99A 3VB3A 3KQEA 1O37A 1FXYA 1L4DA 1J15A 2W7SA 3IITA 2Q6FA 2BVSH 2Y82A 4YLQH 1BTPA 1A5IA 1YPJH 1P0SH 5L2YH 4SGBE 1C1UH 3OY5U 2C8WB 1FIWA 2ZA5A 3OU0A 2B7DH 3PV4A 5CHAB 3TJOA 4Q63A 4AB8A 2ESTE 5C3NA 1ZSLA 4NIVA 4XDEA 1GJ4H 2GKVE 2GZ9A 1NC6A 3LGUA 3F2FA 3RXRA 3LT3A 1JXPA 2G52A 3HPTB 1GL0E 4GHTA 1T7CA 2QF0A 1QJ6B 1IHTH 1ZTLA 1UTOA 3ZZ6A 1HAZB 1H4WA 1O32A 3VEQB 4X2VA 4AB9A 2KCPA 5T6FA 1DY9A 1HXEH 3SU0A 1PPEE 4Q2KA 2AGEX 2ZFQH 1E36B 3O8CA 1YF4A 1DM4B
chains in the Genus database with same CATH topology
4I32A 3TK6A 1FN8A 1UTLM 5AFZH 1GJ9B 1AMHA 1GBIA 1Z6JH 4D9QA 1F92A 3P8FA 3ZVCA 3EGKH 1O2QA 1H9LB 1Z1JA 1GL1A 2FZZA 4XFQA 4D9RA 5JDUB 4FUBA 2BDGA 1CGHA 1GHWH 4AG1A 4MPUA 2J94A 5EOKA 3ZZ8A 2ZKSA 4NIWA 1ELAA 2H5DA 1TRMA 1OKXA 5FPYA 4UEHH 3SJKA 2O8MA 2ZGJA 2BM2A 2FWWA 2Y5HA 4Y0ZE 3UR6A 1TX6A 3O8BA 3SV9A 3DD2H 2I6QA 3UTUH 1Z7KA 3ZZBA 4WF8A 2XC5A 1A1RA 1WUNH 3NXPA 2ZU2A 4XSKU 4ABIA 2Z9KA 1UVSH 2CF9H 1O38A 4H42U 2ZFRH 3AVZA 3ITIA 3V12A 5JBBS 1IQFA 1PPBH 1C2LA 1TAWA 5DP8A 1KXAA 4A6LA 1JRTA 2TPIZ 3AAUA 1H9HE 1V2RT 8LPRA 4YESB 4WXVA 3MNSA 1ZJKA 2ZFFH 1UJ1A 1BTUA 2ZPRA 5HM9A 1J9CH 1XVOA 1QL8A 3LKWA 3E8LA 4IW4E 1P12E 3M61U 2PUQH 3M5NA 4FUGA 4CBNA 3GCTG 2A1DB 2BVXH 2OUAA 1P57B 1UTQA 2D1JA 1LKAA 2V6NA 3VB7A 1LVOA 3HGNA 2FMJA 1FPCH 4B75A 3GICB 1LMWB 3SQEE 1UCYK 4Y8ZA 1O3CA 3LGTA 1O3DA 3IG6B 4B2BA 1C5TA 1UHBA 1P2IA 4BAQB 1BOQA 1LHGH 4Y7BA 3P6ZB 4FXGH 1W12U 1MTSA 1IQHA 1WV7H 1P9SA 1LO6A 3A88A 1GI8B 2BDCA 5EW2H 1UTJA 3NUMA 3BV9B 1Z8RA 2ZDKA 4NCYA 1ANEA 4UFGH 1WTHD 1A7SA 3SORA 1FONA 1KXBA 3C27B 2FYQA 1GI5A 5DKMA 3HKIB 1GJCB 4KTUA 1NTPA 2VWLA 5JB8S 3LDXH 1OWKA 2H9HA 1HAVA 2QXHA 1CVWH 1GHAF 4FVBA 3V3MA 4XBDA 4NSYA 1V2NT 2ZIQH 1EAIA 4OS1A 1FDPA 4LZ1H 1GHVH 1SHYA 1AFQB 1WU1A 4OS4A 1O2ZA 3EA7A 2BY5X 2Z9LA 2Z7FE 1UTMA 1FQ3A 1BITA 1O2KA 1SGCA 1AI8H 2GCHG 2FS9A 1C1PA 1BRCE 1ANBA 1W11U 2ZI2H 2OC8A 1FUJA 2OBQA 2ZGCA 1RGQA 1LVBA 1PQ7A 2QY0B 4H6TA 4E7RG 2HVXA 3M35A 3KNXA 1PQ5A 3QDZB 1SQOA 2C8YB 2XC4A 1G37A 2Z3CA 1SL3A 2O9QA 1O36A 1C5VA 2JH0D 2XXLA 3LC5A 2BLOA 2UWPA 4FUCA 1BRUP 3ENSB 1BBRE 1MTNC 1YBWA 4GSOA 5ESTE 1GHXH 4TYDA 3UWIA 1D3DB 4NA9H 1SGFA 4A7IB 1GBAA 1TNIA 1YCPM 1NS3A 4NGAH 2ZU4A 1A3EH 2IOTA 3SW2B 4BXWA 3W95A 1TNHA 2PKSC 1ESAA 4RKOB 4ZAEA 4OS7A 4GVUA 1A0HB 2Y6TA 1N1LA 1O31A 1C1NA 4KTSA 4UDWH 1EZXC 2A7CA 1AN1E 1P2KA 1K1JA 2PGQB 1CA8B 1OWIA 1GBLA 1EASA 2O8WA 4ISOA 3LGWA 1AB9C 2ZDMA 3EE0B 2Y81A 2ZCLP 3FP7E 4UFFH 1NFUA 3URCA 1W13U 1OSSA 1C2FA 2J34A 2ODPA 3FFGA 4NZQA 1ELTA 3SV8A 3RXUA 1MKXH 2A45B 1NESE 1KY9A 1CU1A 1O3OA 1P03A 4NG9H 3HK6B 1C2MA 4UFDH 1O2VA 1YC0A 2PTCE 2D2DA 3M5MA 1YCPH 2VIOA 4WVPE 1YPHE 3O8RA 5FAHA 1C2JA 2ZGHA 2FOGA 5EG4A 4BANB 1KDQB 1OPHB 1UVPA 1E34B 2ZF0H 4MQAA 5C1YA 3RXAA 1Q2WA 1OWDA 2FOEA 2FPZA 2VNTA 4WJG2 1CHOF 1GI0A 1SLWB 2XWAA 3PO1C 3A7XA 4IN2A 2KAIB 2Y7XA 1V2OT 3SU5A 1AUTC 4BAHB 1J17T 1GJAB 1WSSH 2JH5D 1O3NA 2Y80A 4U2WA 1T8MA 1ELFA 1HBTH 2AMQA 3SNCA 2ZHQH 1VR1H 3KEEA 2F9UA 1AVXA 1Y5AT 2WPLS 1G36A 3RLYH 2NU1E 2RA0A 1AUJA 3B23B 1CGJE 3SUDA 1GHBG 3TH3H 1SGTA 3EA9A 2A7HA 1HV7A 1O3LA 1TOMH 4M7GA 2CV3A 4ABFA 3BTHE 2OD3B 1ZOMA 5DJ7A 1EAWA 3GY5A 3TK5A 4CH2B 3TJUA 3L3TA 1A5GH 2ZEBA 2P93A 3QK1A 3MMGA 2IJOB 4CR9A 2YNAA 3JZ1B 2OINA 1DT2A 1FY8E 3SJ9A 2O8UA 4D7GA 2OP9A 2G00A 2WPMS 2GCTC 3ATLA 1VCPA 4X2XA 3U1IB 5F03A 1UVOA 2FM2A 2V3HH 4KELA 4D7FA 2Q6GA 1KIGH 1NFWA 4ISIH 5LPEA 1PPFE 5GJ4B 1YPLH 3SOSA 1AY6H 2CN0H 2UWLA 2R3UA 4ZH8A 4AGKA 2JKHA 4OGXA 4DY7B 5I25A 3PMAB 1K1PA 1MCTA 1YPGH 1LKBA 4Y7AA 1KXDA 1W3CA 3A86A 4HI3A 2ANKH 5L6NH 3T26A 4IBLH 3PTBA 4ISLA 2OTVA 2FOAA 2NWNA 1UMAH 3MH4A 1T32A 3QUMP 1DS2E 3RXSA 3GY6A 1O3HA 1EOLA 3MH6A 7GCHG 1HAXB 2SFAA 3O8DA 1AVWA 1QBVH 2H9TH 4BXSA 1QBNA 5EPYA 1Z6EA 4JZDH 2ANYA 4BNRA 2BDYA 1QR3E 5JBTA 1FJSA 3MNBA 4FU8A 4TY7A 1FZZA 4KKDA 1DUAA 1XMNB 2CHAC 1TX7A 1ETRH 3SJ8A 3M37A 4XBCA 2PTNA 2IN2A 2BTCE 4WH8A 2VGCC 3FVFB 1SSXA 2WUBA 4GPGA 4O03A 3FZDA 3PYHA 2BY8X 1S0RA 2ZPSA 1IQJA 2D8WA 1D3PB 1BHXF 1QB6A 1LHCH 1VJ9U 1Y8TA 5C20A 2TGAA 3RXEA 1WBGB 2OQUA 2V0BA 4AFUA 1AKSA 1C1MA 1MUEB 2OC0A 1DLEA 4MPWA 1GI7B 2ZHDA 1SGPE 1Z1IA 5GIBA 4BAOB 2OCVB 4JYTA 1XKBC 1K21H 3MU5A 4A1VA 1G30B 5A0BA 4U01A 1LVMA 1QQ4A 3LIWA 3RMNH 3A7WA 4INHA 1EZSC 1BTXA 1VZQH 3U8TH 1MTNB 3H7TA 4ZXXH 5L2ZH 3P17H 1Q31A 4FUIA 1GG6C 1GDNA 1A61H 2WPIS 1E38B 1P06A 3KF2A 1G3CA 1HAOH 4K2YA 2GT7A 2CXVA 3SU3A 4FUJA 1SR5C 1QB9A 1ABIH 1MBMA 2BHGA 3M3TA 2PKSB 2TIOA 1DWEH 1ESBA 1FY1A 1C2DA 3F9EA 1D6RA 2BYAX 1MTWA 3A85A 2GMTB 1NU7B 4I8LA 1LTOA 1NZQH 5EGMA 1ARCA 1CHOG 4X6OA 1K1OA 1WQVH 4A5TS 3T2NA 4K8YA 2P8OC 5DP3A 1EPTC 3GCTF 4WWYA 1UK3A 3KN2A 1ELDE 5CMXH 4AYVB 3MH5A 1FV9A 1IQGA 3UY9A 2FIRH 4JZIA 1AFEH 1CHGA 1GCTC 2Z6BD 4I33A 1JRSA 1TPPA 3M36A 1OP2A 4ABAA 1GMHF 2J9NA 5AHGH 1G3DA 2ZDNA 4BTUB 1DLKB 3MNXA 1UVUH 4X8TH 1O33A 2ZTYA 4CH8B 1NY22 5A09A 1EXFA 2XCFA 1AO5A 1BJUA 3L6PA 2VWNA 4F49A 1SFIA 3TLOA 1AU8A 1AQ7A 3TK9A 1QJ7B 3TNSA 4YLUA 2DE9A 3NWUA 4O3TA 4H6SB 4LXBH 1LHDH 2I6SA 1F2SE 1T8OA 1JOUB 1HAYB 3E0PB 1SGQE 2SGAA 3PO1B 2H6MA 3UQOA 2FOFA 1NROH 4INKA 5J4QA 1TMUH 1G9IE 2HNTC 2Y5GA 1HUTH 4CREA 4BAKB 1AGJA 2OLGA 3VXFH 2FP7B 2QC2A 4UFEH 3D23A 4K60A 3TPIZ 3M3SA 3KQDA 1TMBH 1E35B 4ZKRU 4TPIZ 1DX5M 3SUFA 2GVFA 2V35A 3T5FH 4I8KA 1UO6A 1YYY1 4IN1A 1C4Y2 1P09A 2C93B 3EA8A 1AHTH 3DFLA 3A7TA 1QL9A 2BD5A 1FY5A 2GCHF 2FX4A 5I46H 3SU1A 4QT8C 1TNLA 1ZTKA 4JZEH 1AWHB 1EB1H 1SPJA 2BDBA 2UUJB 3RXQA 1GJ5H 1ELCA 4DVAU 4Y76A 4K69A 4JMYA 4TWWA 2ZTZA 1SC8U 3U8OH 1P8VC 5A2MH 1SGDE 2UUYA 2R0LA 1XUHA 1B0EA 8GCHG 1BMNH 1GBJA 5DP7A 2GCTB 4O97A 2O8LA 3ODDA 3VFEA 2AH4X 1P2NA 3SNEA 4CRAA 1QBOA 2J4IA 1TPAE 3M7UA 5BPEA 4XBBA 4D76A 1AZZA 2FO9A 5EXLA 4VGCC 1DDJA 2P59A 2M5TA 1EP5A 1MKWK 3TGJE 4J1YA 2BDAA 4Q80A 3RXGA 1HAPH 2G5NA 1XUFA 2QXIA 1LCYA 5T6DA 1DXPA 1P01A 2VB0A 3CENA 2ALPA 5E8EH 3DA9B 1HLTH 1PPHE 2HALA 4I7YH 1ZSKA 1Z8JB 1ESTA 1RIWC 3QTOH 1GHYH 5A0CA 2H2ZA 4X6PA 2ILNA 4DG4A 1AIXH 4CRCA 6ESTA 3RXDA 1AWFH 1P2OA 2CHAB 4WMFA 4X1RU 4OS6A 4ABGA 2TGDA 2JETC 3SBKA 3RDZA 3ZZ3A 1DVAH 2A31A 1XUJA 2VGCB 1ZPBA 5GPIB 3KCGH 4Z0KA 3K65B 1W8BH 1ZPZA 5ETXA 5LH8A 1C4V2 1HGTH 2Q1JA 3ATWA 1BHXB 2SNWA 1W10U 4DIIH 4CBOA 2ZTXA 3LONA 3S7HB 1VGCC 2QXJA 4PROA 5C1XA 3PWBA 1IAUA 4ABHA 2FYRA 2PUXB 3MI4A 2VH0A 3SU6A 5E2PA 4X1PU 2ZHFH 4AZ2B 1VITG 3C1KA 1S5SA 2R2MB 3GOVB 4X6NA 1OYTH 3U98H 3SZNA 4ZKSU 1TIOA 1FNIA 3GYMA 3MO3A 1V2LT 2BY9X 5E0HA 1NU9A 3AASA 3D62A 7ESTE 4MDSA 1DPOA 1GMHG 3B8JA 2QF3A 3MHWU 1S0QA 1GG6B 2QCYA 1GBMA 2FXRA 4FUFA 1TGSZ 3WY8A 1GHBF 4I31A 1CSOE 1QA7A 1C2KA 1OWEA 1YPMH 3SUEA 1FY4A 4BTTB 1SLXB 2ZNKH 4Y8YA 1HB0B 1BZXE 5HGGA 2A32A 1KLTA 2AGIX 2GDEH 3RXVA 1TQ0B 1K1MA 1XM1A 3GCHC 2K1QA 3PMBB 4Y6DA 1EAXA 4FVDA 2AIPA 2QIQA 4AFZA 1W14U 3P8GA 3DFJA 1EQ9A 1PQAA 2P8OB 1EPTB 2GZ8A 3BSQA 7KMEH 3P8OA 1KDQA 1PJPA 3EQ0H 3E0NB 1SQTA 1Y3WA 2FOCA 1GBDA 1GI6A 5K0HA 3ATMA 3TJNA 1GCTB 1J14A 2AYWA 1SGIB 2KAIA 2WV4A 2VIQA 3BTME 3PTNA 1MMJN 2ZCHP 1NRSH 1C5MD 3T28A 1TBQH 2ZFTA 1C1OA 2HWLB 1C2IA 1TGBA 1P04A 1HNEE 3U8RH 1IOEA 2ZDLA 2D26C 1ZYOA 4B73A 2DUCA 7GCHF 1TYNA 1EB2A 1ZHRA 1TGCA 3QTVH 1Y59T 1K1LA 2BLVA 1P2JA 1G2LA 1KTSB 2YNBA 5LGOA 3ZV8A 1FIZA 2ODYB 1IQMA 1O2RA 4GAWA 3P92A 3TGKE 1CBWC 1GGDC 3BEFB 3F68H 3ZYDA 2NU3E 3BTEE 4WH6A 1RFNA 1TE0A 5F8ZA 1F0SA 1OWHA 3SU4A 4R8TB 1P05A 4JCNA 1D4PB 1V2TT 1A3BH 1LPGB 1V3XA 1SGNE 4A1TA 3ZZ9A 1XUIA 2HRVA 2WPKS 1ZR0A 1O3IA 3PWCA 3NPSA 3SO3A 3GCOA 2F91A 3RM0H 1BCUH 2GT8A 2PR3A 3Q77A 1N8OC 1SI5H 1FMGA 1PYTC 4MPVA 3UWJH 2FLRH 3Q3YA 2OQ5A 4IMZA 5C5NA 2XCNA 3MTYA 4JZ1A 1GBTA 2ZPQA 3UFAA 1O2SA 3URDA 1XX9A 2OBOA 4I8JA 5EXMA 5F6MA 2Z94A 3LGVA 4GCHF 4E06H 1C1SA 4FUDA 4YM9A 1ARBA 3OTJE 3STIA 4FUHA 1TGNA 2A0QB 3SGBE 2ZWLH 1P3CA 1DSTA 1SGRE 3RXIA 1FAKH 1X7AC 1O2TA 3RXLA 1VCQA 1GVZA 4VGCB 3GDSA 4AYYB 1O2XA 1FN6A 1RTLA 2ZFSA 1MTUA 1ETTH 1Z8IB 3UNRA 2F9NA 5IYTA 2CJIA 2AMDA 3BIVH 3UNQA 2FS8A 3BTDE 1C5XB 2A2QH 2PGBB 3ZZ7A 1RS0A 1FAXA 1K1IA 1MTVA 3BTQE 2FESH 1F5RA 2FOHA 4WMDA 2NU0E 2Q6DA 3PM3A 1RIWB 2HOBA 1C5NH 4RN6A 5JPMH 1N6YA 4K5ZA 4K1EA 2BD8A 2QGRA 2NU2E 4OS5A 3BF6H 4YOIA 1KSNA 3NK8A 1C2EA 1MU8B 1T8LA 5PTPA 2HPQH 4JYVH 4AFSA 3BEIB 7LPRA 2JETB 3HGPA 5JBCS 1KXCA 4X8UH 1RTKA 2W7UA 1ACBE 2J95A 3V0XA 1LVYA 1CT0E 4NIXA 1YLDA 5EQRA 1RRKA 1SGYE 2DE8A 1C1TA 1KYNA 1O3MA 3MU0A 3OY6U 3T62A 4K8BA 3ZZ4A 1S6FA 1AE8H 5T6GA 1VGCB 3A8CA 1MZAA 2THFB 4ZHMU 1O5CB 2FLBH 2BXUH 3LGIA 1C5YB 4MNXA 3A7YA 1O5FH 1C1RA 1Z8GA 3A83A 1QRZA 1C5RA 2A5AA 4YT6H 1A0LA 1C5QA 1NFXA 1BTWA 4K1SA