4BNRA

Extremely stable complex of crayfish trypsin with bovine trypsin inhibitor
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
237
structure length
237
Chain Sequence
IVGGTDATLGEFPYQLSFQETFIGFSFHFCGASIYNENYAITAGHCVYGDDYENPSGLQIVAGELDMSVNEGSEQIITVSKIILHENFDYNLLDNDISLLKLSGSLTFNDNVAPIALPEQGHTATGDVIVTGWGTTSEGGNTPDVLQKVTVPLVSDEDCRADYGADEILDSMICAGVPEGGKDSCQGDSGGPLAASDTGSTYLAGIVSWGYGCARPGYPGVYTEVSYHVDWIKANAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydolase/inhibitor
molecule keywords HEPATOPANCREAS TRYPSIN
publication title Comparison of Complexes Formed by a Crustacean and a Vertebrate Trypsin with Bovine Pancreatic Trypsin Inhibitor - the Key to Achieving Extreme Stability?
pubmed doi rcsb
total genus 54
structure length 237
sequence length 237
chains with identical sequence B
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2013-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4bnrA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4bnrA02
1SQAA 1TYNA 2FMJA 2VVUA 1QB6A 5DP5A 3RMOH 1SGCA 2A7CA 2VB0A 2ZU1A 1W13U 3QTVH 5A2MH 2V0BA 3HKJB 1P09A 1SGIB 3GCNA 3P17H 5JBCS 1YPGH 2J95A 4F49A 1K1JA 4MQAA 1O3DA 2QAAA 4FUGA 1LQDB 2BVRH 2FX4A 3TGJE 4Z0KA 1V2WT 3M37A 4JYVH 4NGAH 3QWCH 3L6PA 1DWCH 2ZGHA 1S0RA 2XC5A 4GCHG 1E0FD 1EASA 1QA7A 1ZGVA 2HALA 1T8OA 1UTQA 1Z8JB 5GWZA 3M35A 2A2QH 2V3OH 2FOFA 3GY2A 4AFQA 5ETXA 4A6LA 1W0ZU 2GZ9A 5HM9A 3K6ZA 3P6ZB 4CH2B 4Y76A 1WU1A 2BDCA 3ENSB 1C1TA 1G3BA 3NKKA 3ZVDA 1ELAA 4I8KA 2SGQE 1AE8H 1IHTH 3CS0A 1EKBB 2P59A 3SZNA 1PPGE 1F0RA 3MMGA 1O36A 3PLBA 2ZI2H 3MU5A 1G2MA 1O3GA 1FXYA 1MTNB 3SUDA 1C2EA 4O97A 1NT1A 1B0FA 4MLFB 3W95A 1SG8B 3MFJA 1CO7E 1ZJKA 1WYKA 1KXEA 4Y6DA 3ZZ4A 4X2YA 2BOKA 1FIZA 5A0BA 1C5WB 1DOJA 3ZZAA 4NA7A 5HXFA 2FODA 2VIQA 1EZXC 4H6TA 1C5MD 1GMDG 1FJSA 1FAKH 4AZ2B 2BLQA 4CBNA 4X0WU 5FHTA 1DUEA 1AFEH 1C1SA 5EXNA 1Y3WA 3DFJA 1GBKA 1JRTA 1ELTA 1O3NA 2PKSB 7GCHF 2C3SA 3FZDA 2A4GA 3SOSA 1AVXA 4KGAA 2WPLS 1T31A 3VXFH 1SVPA 1FY8E 2VGCB 1UTJA 2W3KA 3SGBE 1HAVB 8GCHG 1UVUH 3BV9B 2FEQH 4ABJA 1EZSC 4B73A 2C8ZB 1AO5A 2CF8H 2J34A 1EPTC 1QQUA 2G55A 3UR6A 5LPFA 1AB9C 3RXTA 3RC4A 2HRVA 3ZZ8A 3UR9A 2VVCA 2HLCA 4FU7A 1IQIA 3ZYEA 1GWAA 1DY9A 2VNTA 4D8NA 3GY5A 3PWCA 3EE0B 1NPMA 4B75A 1MTVA 4Q7ZA 4OS4A 5L2YH 3SU6A 1G2LA 1Q3XA 2D1JA 3S9AA 1C5XB 1O30A 5DG6A 3VB6A 4YT7H 3P8GA 2ZNKH 4IBLH 4NSVA 3RXCA 3KIDU 5T3HA 1NRQH 1QBNA 2F9UA 2XBYA 3ZZ5A 4D7GA 1GCTB 2B0FA 1MKWK 2H9HA 2SGPE 2PSYA 3MH5A 1TA2A 4IS5A 4WVPE 1MKXK 1C2GA 1ZSKA 1C1MA 2TGPZ 2Z9KA 1P01A 1FQ3A 4AX9H 4DOQA 1OWKA 1OYQA 3TU7H 4IMQA 3U8RH 5EQRA 1CBWC 1GDNA 1KLTA 3ZZ9A 1F0SA 1NFYA 4H42U 3TNSA 1Q31A 2G00A 1OYTH 2VIWA 4ZUHA 3BTDE 1AQ7A 1T32A 5E0GA 2VU8E 1P3EA 3MNBA 2FP7B 3RXOA 2ZEBA 3TPIZ 3B23B 1HAXB 1O2LA 5EXMA 3Q3YA 3AVZA 1UCYK 3M61U 3RXUA 2F9OA 1V2PT 3PMJA 4O03A 1GCDA 3MH7A 1PPBH 5EODA 1NFUA 1PJPA 1BHXF 2ZU2A 3RM0H 1TMUH 1ZPBA 3RXBA 4MDSA 1IHSH 2GV7A 2WPIS 1TONA 1ZMLA 4BAKB 4DT7B 4I7YH 1P06A 1LHEH 3RXSA 4ESTE 1J14A 1E35B 1TNGA 1C5NH 2BM2A 2F91A 5TCCA 3RXQA 1ABIH 1OWHA 2JH6D 4ZHMU 1TRYA 3A84A 1O5GH 1S6HA 4UFEH 1P9SA 4ABBA 4I8JA 3DA9B 3OSYA 1HAIH 1NFWA 3C1KA 1C1WH 1QNJA 1FY1A 3LOXA 4IN2A 3SJKA 1GMDF 4B76A 3SU3A 1Z6EA 1BJVA 3TGIE 3WY8A 1SLUB 1XXFA 1XUIA 1P3CA 1GHXH 2BD8A 5SGAE 2Y7XA 2BQ6B 1EOLA 3DT0H 5ESTE 3GY8A 1K1OA 4OS7A 2BVSH 5A8YA 3RUOA 2QF3A 2SGDE 1BRUP 2BQWB 2W7SA 1J17T 1PQ7A 1A0HB 5JBTA 3MYWA 5JPMH 5I25A 1JIMA 2PR3A 1YGCH 1VCQA 3GCTF 2QV1A 1V2LT 1UMAH 3ZYDA 1TAWA 2ZGCA 1OP8A 4Y11E 2F9VA 4YOJA 5C1UA 2WPKS 2H2ZA 1BTWA 2IJOB 1GI7B 1G3DA 1CA8B 1Y3XA 1HAGE 2Z9IA 1JIRA 1IQKA 1Y3UA 3I29A 1DWEH 3ZZ6A 2BDIA 5L30H 4FUDA 1D3QB 3PTBA 4A5TS 1HAPH 2O9QA 4ISLA 4AG2A 1C5TA 1QRWA 1HAOH 4MNYA 3Q77A 4ZHLU 4Y10E 4B74A 2JKHA 1NC6A 4JZFH 4X1QU 1F0TA 2CJIA 3PMHB 1B5GH 2JETB 1C5QA 1WTGH 4JK6A 3RXJA 2ZDKA 3UQVA 1ZPCA 1UTNA 4GPGA 3SBKA 1XKAC 2PGQB 3V0XA 2ANMH 1JWTA 4BTUB 1AWFH 5AFZH 1SGEE 1W3CA 1SR5C 1WSSH 2NU0E 3EAJA 1FNIA 1H4WA 4LXBH 4O3UA 4RSPA 1ZRKA 3VGCC 1BCUH 1YPHE 3STIA 1FAXA 1O0DH 2EA3A 4NCYA 3F1SB 3LONA 2GDDA 1PQAA 2FOCA 1K1NA 1HJ8A 4K3JA 1AZZA 1CA0C 5DJ7A 3U98H 1Z1JA 3A83A 2OC0A 1O32A 1OWJA 3SORA 1SGPE 3BG4B 1KSNA 1TX8A 5F8XA 1AKSA 2QXJA 3AASA 2C4FH 2B8OH 4RKOB 2A7HA 1T4UH 2ZFTA 4INKA 4FUIA 4NG9H 1LPGB 3OY6U 1FN6A 5C1XA 1MBMA 4ZKSU 2QYIA 1ETRH 1A7SA 5C2ZA 1WOFA 2ODQA 1C2LA 2BD2A 1A61H 1QL8A 2GMTB 1KY9A 1UCYE 2CGAA 2KAIA 1ZRBA 4ZAEA 2RG3A 5GDSH 2FO9A 1Z71A 1GI6A 2UWLA 1QBVH 4B2CA 2BZ6H 2M5TA 1OWEA 1GHAG 1W2KH 2VIDA 3A8AA 1O2TA 1GI1A 2FX6A 2ZWLH 3A82A 5EXLA 1A1RA 4A1XA 2AGGX 2ASUB 1EAUA 3QK1A 2NU3E 1K1IA 1C9TA 2K1QA 2Y5HA 2QGRA 1YLDA 1XM1A 1V2KT 1C5SA 5BRRE 1GBAA 1KLIH 2ZTXA 1VITF 1ZHRA 5AHGH 3RXMA 1FLEE 2UWOA 3F9EA 1RIWC 2Z7FE 3P8FA 3OY5U 1GBCA 1HGTH 1TRNA 1ZJDA 4RN6A 2GCTB 2WUCA 2UUFB 2R0KA 1HBTH 1QIXB 4TY6A 3A86A 1SMFE 5PTPA 4FUFA 2A2XH 5C5OA 1TPAE 1SGFA 2ZHFH 2XC4A 4ABAA 1GL0E 3EA8A 3TGKE 3T25A 3RXDA 3ZZDA 3RP2A 3QUMP 3NXPA 3F68H 1O2JA 3T29A 1P03A 2FOGA 2I6SA 1IQNA 1AIXH 1O5FH 1SPJA 3MNCA 1AMHA 2ZPRA 1QB9A 1BBRH 3E0PB 4JYUH 1C9PA 1LPKB 1DE7H 1O2VA 1K1MA 4CRFA 3PO1B 3MH4A 2WPJS 1QGFA 2BMGB 1BRBE 2W7UA 2PW8H 1DS2E 2SGEE 5CMXH 2ILNA 1CU1A 1GJ9B 2ZDVH 2CF9H 1F0UA 2FS8A 3GISB 4AGJA 1DX5M 1GBIA 1QL9A 3GCHB 1GBHA 1MQ5A 1AUTC 1GJ6A 1UHBB 3LGWA 4AYVB 5C1YA 1V2VT 6CHAC 4Y8YA 2FTMA 2AIPA 4GHQA 1O3LA 2BDGA 4PROA 3KCGH 2BY9X 1HJAC 1Z1IA 1DT2A 4Q7YA 1NFXA 1PYTD 1MH0A 1HXFH 2HNTE 3O8DA 2F9BH 1MCTA 2ZFQH 1O2GH 4Y0ZE 2GV6A 4OS6A 1PQ5A 2OBQA 2XXLA 1O2QA 3BTEE 4KTSA 4YM9A 1GHZA 1SOTA 2C93B 4K8BA 4SGAE 1BJUA 3RLYH 5A8XA 1THRH 1W11U 4I33A 1FPHH 1XUFA 2GTBA 2B7DH 2Z9GA 2F9NA 4XBCA 1DVAH 1K1PA 3D49H 4X2XA 2ZPSA 1NM6A 3NWUA 3RU4E 4VGCC 1Y5UT 2HGTH 4MPUA 1INCA 1O3EA 4MNVA 1UO6A 3BTHE 3A8DA 4Y8XA 1TQ7B 1QCPA 4A92A 5E0JA 1BT7A 1BTXA 1K1LA 1G37A 2ZDLA 3SU2A 1HAYB 1IAUA 1O3PB 1AFQB 1BTZA 2BY8X 3HGPA 3SW2B 1THPB 4KKDA 2BLWA 2BXUH 1EB2A 1ZGIA 4I8LA 2D2DA 4B1TA 2OTVA 1DANH 4AFZA 1LTOA 1A0LA 7GCHG 4SGBE 5DP4A 3ZVBA 1UK4A 2G8TA 1UTKA 3UQOA 1N8OB 2CHAC 1ELEE 1GBDA 4WXVA 6ESTA 1CQQA 3S9CA 1F2SE 1VITH 2ZU3A 1NU9A 3GY6A 2ESTE 4GSOA 3M36A 3I78A 1FY5A 2GZ8A 1TPOA 1HXEH 1MTNC 5T6FA 4ABDA 1K2I1 1O3KA 1PQ8A 1ELFA 1F5KU 2J94A 1P2QA 1W8BH 1QJ7B 2VIOA 3T27A 3MO3A 3O8CA 1NN6A 1RD3B 2QC2A 1ZMJA 1LCYA 1KDQA 4CHAC 3UWIA 3GCOA 2BY7X 4Y71A 3A7WA 1BTPA 1UTMA 4CR9A 2RA0A 4DURA 4ZMAH 3BEUA 1NRRH 1ELGA 1TGTA 4ZHAA 1AVWA 1C5LH 2V6NA 2AERH 4I31A 3RXHA 5C5NA 3U1JB 2OUAA 1W7GH 2TGAA 4H4FA 4ZKOU 2AEIH 5JDUB 1O3BA 2ZGJA 3OU0A 2VVVA 1LVMA 3K6YA 3A88A 3H7OA 2GKVE 1BUIA 1RTKA 1C2FA 1SQTA 2P93A 3T5FH 3FZZA 1QY6A 4XBDA 1BRCE 2BZAA 1VZQH 1RS0A 2XBWA 2A31A 3MU8A 3TITA 2HWLB 5HGGA 1XUHA 3VEQB 1S81A 1GG6C 1O2ZA 2PHBA 1JRSA 2OBOA 4UE7H 1P9UA 1XVMA 3QN7A 5L2ZH 5GCHG 4I8GA 5CE1A 1SLVB 1P12E 1LPZB 1TB6H 2HPPH 1EPTA 2ANWA 3FFGA 3SNCA 3V3MA 4DGJA 4DIHH 2J4IA 3IG6B 1MAYA 1W12U 1HRTH 1FONA 4DVAU 1TMTH 4NWKA 2WYJA 1NO9H 3RXEA 1C1VH 1P2KA 1DM4B 2O8WA 1L0ZA 5EQQA 5EU8A 3KN2A 5DKMA 1SGTA 1TNLA 1AN1E 2WUBA 1ELVA 3BIVH 1S5SA 1O3IA 4CREA 2AYWA 5F03A 1CSOE 2G4UA 1P2MA 5FX6A 2IN2A 3LH3A 1EP5A 2YNBA 3U8OH 2ZGXH 1VGCB 5K0HA 4KTUA 1S0QA 2Y82A 2FLRH 5E2PA 3SNAA 3LJOA 1GJCB 1YPMH 1KXFA 1P2OA 4NA8A 1EP6A 5JB9S 3ATWA 3PROA 1C4V2 4H6SB 3SV7A 1CT0E 2R3YA 3ODFA 1O39A 4U2WA 1HAHH 1BOQA 2VWLA 2BHGA 1C4U2 3RU4T 2NU1E 4ABEA 4BAHB 2FOBA 3ZVEA 3P8OA 1C1PA 3KF2A 3SGAE 4WF8A 1SSXA 4YOIA 1GGDC 3R0FA 1DLEA 2STBE 4X2VA 4JYTA 3URDA 1CT4E 2FIRH 3BTGE 1KLJH 1UTPA 1FY4A 4GVUA 3MNSA 1H8DH 1O5EH 1D3TB 3GCTG 3TK5A 4X1RU 1T4VH 1IQLA 1FY3A 2P3UB 5H4IB 4NIYA 2AGEX 3LPRA 1YYY1 4FU9A 3SNBA 5A8ZA 5K7RA 1EUFA 2VIPA 1DY8A 1GI9B 3SU0A 1P0SH 4E06H 5FCRA 3ZZ7A 1LMWB 2DE9A 3SUEA 1GVKB 1TA6A 2OQUA 5A0AE 2NWNA 1ETSH 3UOUA 1MTSA 2ZDAH 1W0YH 3VXEH 1YKTA 2OLGA 2ZECA 1WUNH 4X8TH 1RTFB 4BANB 1AI8H 2FM2A 2ZP0H 3A8BA 2GDEH 2ZU5A 1O3HA 2LPRA 3Q3XA 5FPTA 2SNWA 3GY3A 3U8TH 4D7FA 3ATIA 3A87A 3Q00A 1TNHA 2OXSA 4Z6AH 1KDQB 3RM2H 2ZG0H 1XUJA 1BMAA 5ESBA 2A32A 1BITA 4ISIH 4M7GA 1YLCA 3P70B 1O3JA 4AYYB 2PGBB 3VB7A 1D4PB 4THNH 3RXAA 1QRZA 3UIRA 3RXRA 3PV4A 3SJ8A 2A4OA 3SN8A 3LGVA 2O8LA 2QXHA 3GICB 2AIQA 2FI4E 3M7QA 5GCHF 3SV9A 2ZHDA 1YPEH 3E1XB 1RJXB 3EYDA 4FXGH 2ALVA 1O33A 3AAVA 2VWMA 1J16A 1IOEA 2I6QA 1K9OE 2A1DB 2Q1JA 1TGBA 1GBBA 1TNKA 1GMHG 2EEKA 2WINI 2Y81A 3H7TA 3URCA 1GJAB 1RRKA 2WV5A 3LU9B 4YLQH 3M3SA 3B8JA 2ZC9H 3A7VA 3L3TA 3A7XA 5DP9A 3A7TA 1L1NA 2GP9B 3DHKH 2BTCE 2XTTB 5E0HA 5FPSA 1IQHA 4Y8ZA 1AB9B 1ZHPA 4ZKNU 1SGDE 4UFGH 1FV9A 4YZUA 3S69A 1AUJA 4XDEA 2G52A 3M3VA 2CMYA 1XUKA 1MD8A 4E05H 1T8LA 2VH6A 1C5UA 2FOEA 3V13A 3K9XB 2ULLA 1X7AC 4AG1A 4BAOB 1VITG 3KEEA 2NU2E 3KNXA 3LKWA 4NZLA 3E0NB 3ZZCA 1V2NT 2BQ7B 3TK9A 1YPKH 2Y5FA 2ZFFH 4TPIZ 2BDAA 1SBWA 3MU4A 4DIIH 1KTTB 1FDPA 9LPRA 1CBWB 1ZPZA 2ODPA 1SLXB 2J38A 1GBEA 1ELBA 2AMQA 1A3EH 1ESBA 1G30B 2VWNA 4YT6H 4ABFA 2WV4A 4O9VA 3MH6A 3BEIB 8ESTE 1EOJA 1UVOA 1VJAU 5HM2A 3MI4A 3PTNA 5JBAS 1C1OA 3DUXH 2G51A 3CP7A 1ORFA 3NZIA 4E7RG 1OP0A 3UUZA 2J2UA 1ANDA 2EI7A 1MTUA 5LH8A 1QURH 4BXWA 2ZCHP 1ELCA 1ACBE 3STJA 1W7XH 1KIGH 1MQ6A 1HYLA 1DDJA 4JZIA 3OTJE 3E3TA 3JZ1B 5FAHA 5FPYA 4CR5A 4JK5A 2UUJB 1TX6A 4NFEA 3ODDA 1TGSZ 5LPEA 1FIWA 1F92A 2ZO3H 3KGPA 1LHFH 1IQJA 3QGJA 1C2JA 1QRXA 1IQGA 2Q6FA 4Y79A 5LGOA 1NTPA 4X6NA 3S7HB 1BBRK 3MO9A 1HDTH 1NZQH 1G3EA 4CRAA 1SI5H 2FLBH 3U69H 4BOHA 1B0EA 5EG4A 4XSKU 3SO3A 1GMHF 2R9PA 1V6DA 1H9HE 1O3FA 1O2NA 4CRCA 4TWYA 4TWWA 1D3DB 4K69A 1DSTA 2BB4A 1UVPA 2P3TB 1P2IA 2Z9LA 1MCVA 3UREA 4GLYA 1HPGA 3HK6B 4WMDA 1UTLM 3RU4D 4R8TB 2Y7ZA 3UWJH 2Y5GA 2H6MA 1GPZA 4ASHA 4JZDH 2BX3A 2A0QB 4NIXA 2WPHS 4QT8C 1DWBH 4X8UH 3TIUA 1G3CA 2BLOA 4X2WA 6GCHF 1V2QT 3RXIA 1TALA 3NPSA 3GYMA 4YESB 9ESTA 1W14U 2BDYA 3LJJA 1LHGH 3FP8E 2Q6DA 2VINA 3QO6A 1GBLA 1Y8TA 4U30A 1WCZA 1Z8GA 2ZIQH 1OS8A 1GDQA 3TJVA 3TNTA 3CENA 3UNQA 1C2HA 4UEHH 2AS9A 4HI3A 4LK4A 8KME2 3FANA 4DCDA 2P94A 1B7XB 2FTLE 2D26C 1TFXA 4B2AA 4AOQA 5FBIA 1GI5A 3IWMA 1E36B 1H9LB 1L1JA 1F7ZA 3SV8A 1GBFA 3VGCB 5J4QA 1NRPH 2XWBI 2BX4A 3S9BA 1PPEE 4WMEA 1S6FA 5EW1H 2PV9B 1BQYA 4UONA 3KQCA 1P2NA 1S85A 1G36A 2OP9A 1CA0B 1GHYH 5EGMA 1MUEB 3EA9A 2P8OC 4J1YA 2ZFPH 3GDUA 1RXPA 4K1SA 1S83A 5AF9H 1YF4A 3EA7A 1A5HA 1MU8B 3LGTA 5C3NA 2V35A 8LPRA 1C2IA 2H9TH 2OC8A 1D6RA 1NRSH 3MTYA 4Q2KA 5DP6A 1BMMH 3W94A 3FAOA 3O8RA 1LKBA 3T62A 2D8WA 1AY6H 3LIWA 1N8OC 3ZVAA 1DUAA 1YP9A 1Z8IB 2OD3B 2Z3EA 2GX4A 1SGQE 3BG8A 1C1NA 3B9FH 5C20A 2FZZA 2SGAA 1O2IA 1O2PA 1TQ0B 1XVOA 4KELA 1JOUB 1NROH 3SQHE 1AE5A 3TH3H 1SOZA 4OS5A 5CHAC 1KXDA 1OWIA 4YTAA 2FYRA 1OKXA 3H5CB 3EQ0H 1O2RA 4LOYH 3TLOA 1YC0A 1FN8A 3SI3H 2XNIA 1GJBB 1L2EA 2EI8A 1SQOA 2F3CE 3SHAH 4HGCA 1SGYE 1PYTC 1Y5AT 2ODYB 1TBQH 1QB1A 2H1UA 1G32B 2W26A 3BEFB 3BN9A 1RIWB 5JYIA 2UUYA 1C1UH 3LDXH 1QA0A 1AKSB 1ZHMA 1EAIA 3BSQA 1O3OA 1D9IA 1A46H 1TBZH 2TBSA 3TJUA 3UPEA 1O2UA 1EAWA 1V2UT 1DXPA 1T8MA 2R3UA 1MMJN 5IDKA 2J9NA 3ZZBA 1C5YB 1OX1A 1SGRE 3E8LA 2A5KA 1PPZA 2KAIB 1SB1H 4INLA 3F9HA 7KMEH 1SFIA 4F4OC 3PMAB 4AN7A 2OQ5A 3ESTA 1P2JA 3GY7A 2QY0B 1GJ4H 3D65E 2C90B 4IC5A 1P57B 1T8NA 4X8SH 4XE4A 2BD3A 1CGJE 5JBBS 1VJ9U 2IOTA 2XYAA 4IW4E 1BMLA 3MU0A 2VH0A 1HAVA 2QN5T 1BTHH 1TE0A 2GD4B 3AW0A 4X1NU 3MHWU 1LHCH 3O8BA 2CV3A 2ZFSA 1GDUA 2EI6A 3P92A 2A5IA 4ZKRU 2Q6GA 1YBWA 2XBVA 3RXLA 3VB4A 5L6NH 1O2OA 3LH1A 2LNCA 4FUBA 2SGFE 1TPSA 3A7ZA 3MWIU 1O34A 4IN1A 1F5LA 6CHAB 3Q3KA 1O5AB 4ISHH 4BAMB 5G4BA 5FCKA 1AZ8A 3L33A 1HJAB 4K1TA 2ANKH 2P3FH 3MU1A 4FVDA 5DGJA 3S7KB 1TX7A 1QJ6B 2J92A 2SNVA 2FWWA 4X6MA 1F5RA 1MD7A 1C2KA 2AGIX 4XFQA 3GDVA 2C8YB 1BB0B 2FS9A 1EJNA 3DD2H 1TGNA 3RC6A 1O2WA 3M5NA 3Q76A 1JXPA 1HFDA 1MTWA 2PKSC 5A0CA 1JMOH 5DP7A 4MVNA 5TJXA 1Y59T 1DITH 4HTCH 5HMAA 3UY9A 3TJNA 3BIUH 2ZHEH 4FU8A 3F6UH 2BD4A 3FVFB 2OC7A 2VGCC 4MG3A 2A45B 4BTTB 1GL1A 4VGCB 1UJ1A 1ZTLA 4Q7XA 3MO6A 3RXVA 4B71A 3D62A 2ZDNA 1HCGA 3R3GB 4X1SU 2AMPA 3D23A 3ZZ3A 5EPYA 1E37B 1H8IH 1FZZA 2FOHA 2PUQH 4TY7A 2GT8A 1L1GA 3SJOA 3K2UA 5BPEA 2YOLA 3HK3B 4U32A 5AFYH 4Y7BA 1QQ4A 1BZXE 1Y3YA 3A7YA 3QLPH 4ABGA 2FXRA 2Z6BD 3ATLA 2DE8A 4BNRA 1GI2A 5DK1A 1O2KA 1GMCG 3SI4H 2XBXA 1GCTC 3M7UA 2CHAB 4ABIA 2TGTA 2ALPA 4GHTA 1SL3A 1SGNE 4FUHA 7LPRA 5C67A 1YCPH 3LGIA 4D9QA 1GVLA 1KXCA 1O3CA 3E16B 4ZROA 3QZRA 2FI3E 2W5EA 1ZLRA 5EW2H 2QCYA 1WBGB 1TNIA 2ZU4A 1WQSA 2GCHG 4GUXA 1TNJA 2TPIZ 3QGNB 1V2RT 1MZDA 2B5TB 4Y7AA 1HNEE 1SHHB 4CHAB 3EGKH 4GAWA 1CGIE 1P02A 3BTME 4MNWA 4WJG2 3QTOH 4X1PU 2HPQH 3A8CA 3T26A 4YOGA 4BXSA 3QDZB 1Z8RA 5TCAA 1EZUC 4WMFA 3E90B 4WWYA 5B6OA 2PTCE 5A09A 2BOHB 2ZTYA 3PWBA 1QFKH 4A7IB 1HIAA 2ZHQH 3VPKA 1QL7A 3UOPA 4FVBA 1V2TT 1K22H 2Y6TA 5FBEA 2PFEA 2TIOA 4Y0YE 2G4TA 3MNXA 1GVZA 1WTHD 4OGYA 3EDXB 1Z7KA 4D76A 2OINA 3LT3A 1J8AA 1THSH 3GYLB 1GI0A 2C8WB 3GDSA 3KQBA 4B2BA 1D6WA 3TH4H 4UDWH 3ZV8A 4LZ4B 1UTOA 2BLVA 3ATMA 2G5NA 1GG6B 1ZR0A 1GBJA 4CRBA 1XMNB 5J4SA 1DLKB 3OX7U 2CN0H 1A3BH 1O38A 1ZTKA 4AB9A 4BAQB 1RFNA 2ZKSA 3VFEA 1M9UA 1DXWA 3KQDA 2DUCA 4WH8A 1GJ8B 1LVYA 2WYGA 4DG4A 1AHTH 3CS7A 1HV7A 1OXGA 5JB8S 1BTUA 1EJMA 1RTLA 1WAYB 3SJ9A 3HPTB 2A4RA 5F8TA 5FX5A 5GXPA 2RCEA 1TGCA 2BXTH 3UNRA 1BRAA 1G9IE 4ZXXH 1QBOA 2YNAA 3SV6A 1CGHA 2BDHA 1NU7B 1A5GH 3M5MA 1YPHC 1TBRH 4GCHF 1PPHE 3A81A 3BTTE 4DJZB 1ABJH 3A85A 1CHOG 4WY3A 2QA9E 4JCNA 1CVWH 1GMCF 1SLWB 3FP6E 4AFSA 3HATH 2OCVB 2BVXH 1J9CH 1W10U 2JH5D 1C5ZB 1CT2E 1YM0A 2ZQ2A 1YCPM 1GGDB 3FP7E 1TOMH 4IGDA 2A4QA 3M3TA 1EPTB 1ARBA 1PFXC 2JETC 3I77A 3TK6A 4KP0A 1ETTH 2F83A 2ZPQA 5T6GA 1J15A 3KQEA 1O5DH 1HUTH 1IQMA 1V2JT 2GCHF 2WPMS 5DP3A 1TLDA 4MTBA 1MU6B 1P04A 1NRNH 5T6DA 6GCHG 1VR1H 1O2SA 2ZCKP 3N7OA 4Q80A 1EQ9A 4E7NA 1S82A 2ZQ1A 1C1RA 1XXDA 2VWOA 1EX3A 2FOAA 2FYQA 4ZXYH 3PYHA 3RC5A 2C8XB 5AVDA 2QIQA 3RXPA 3BTQE 1EZQA 1GI8B 1V3XA 2GT7A 3A89A 4JZEH 3BG4C 1UVSH 2XRCA 4JZ1A 1DPOA 1NESE 3GY4A 1TWXB 1YPLH 2FDAA 1DICA 2VIVA 4NFFA 1A5IA 1O2MA 3ZVGA 1GJ5H 1N6YA 1NY22 4KTCA 3OYPA 8GCHF 3LGUA 2IPHA 1ANBA 1LVBA 2GMTC 2HNTF 4ISOA 1HB0B 3A80A 4K1EA 1JBUH 3SU5A 4ABHA 1MKWH 1FMGA 4X6OA 3P95A 5FXLA 1HIAB 4NIWA 1LDTT 3E6PH 3ITIA 4AGKA 1MKXH 3SV2H 4O3TA 1ZSLA 1ARCA 1QHRB 1EJAA 1H1BA 1SGFG 3KL6A 2PWXA 3HGNA 4AORA 2FPZA 1C5PA 1GI3A 4FUEA 2HOBA 4K5ZA 2P95A 4K8YA 1DSUA 1ESTA 2SFAA 3LGYA 4INHA 2RDLA 3UFAA 5DO4H 3BTKE 4D9RA 1QJ1B 1IQEA 1UCYH 2O8MA 3PLKA 2EC9H 2PUXB 1K21H 2FESH 4CBOA 4ZH8A 1UHBA 1TMBH 4AFUA 1CHGA 2BY6X 1RGQA 4CRGA 2QF0A 1HLTH 5E2OA 3K65B 2GCTC 1XKBC 4X6PA 3RMLH 3QZQA 2UUKB 2VJ1A 1ZSJA 2AH4X 1TABE 2OC1A 1CHOF 1UK2A 1WQVH 1N1LA 2Z3DA 1C2MA 1ZOMA 1A2CH 1LVOA 3RMNH 2Z9JA 1C1QA 2H5CA 3SHCH 1ZMNA 3ZVFA 1GHBG 4IMZA 1AD8H 1H9IE 2HNTC 5GJ4B 2BYAX 4R0IA 3RXKA 1O31A 3SNDA 4K2YA 5HYOA 4RKJB 4AB8A 3PO1C 1LO6A 4BTIB 3ZV9A 2O8UA 2ZCLP 2P16A 3BTFE 1OWDA 3GOVB 1ANCA 1BIOA 1BHXB 2BY5X 3LC5A 4OGXA 1BA8B 1FI8A 4A1VA 1V2OT 2XW9A 1D3PB 3PMBB 1SFQB 3T28A 1P11E 3GCHC 4FUJA 4YO9A 4A1TA 3V7TA 1Z6JH 1TRMA 3SQEE 2PKAA 4NZQA 2F9PA 2NU4E 2TRMA 2GVFA 4MNXA 3SNEA 1Y3VA 1LKAA 1S84A 2UWPA 3DFLA 1C4Y2 1E38B 5GIBA 2BD7A 1GBMA 2AMDA 1FPCH 4IC6A 1AVGH 1ZYOA 4OS2A 4U01A 4UD9H 6LPRA 1KXBA 1EAXA 4ISNA 5DPAA 3JZ2B 1OOKB 4I32A 2BD5A 2ANYA 2Z3CA 1AU8A 1E34B 1ZTJA 3RXFA 3V12A 1P05A 4MPWA 7ESTE 4FUCA 2XCFA 2Y80A 2V3HH 1PPCE 4DY7B 1YPJH 1KTSB 4CRDA 1TIOA 2THFB 3M5LA 4NIVA 5DP8A 1O3AA 1QR3E 1OSSA 1TOCB 2A7JA 1Y5BT 2BDBA 3AW1A 3P8NA 1Q2WA 1MAXA 1L4DA 3SJIA 4XBBA 4MPVA 1IQFA 5IYTA 1KYNA 1BTYA 3TH2H 2G81E 3HKIB 2B9LA 5GPIB 1L4ZA 3BTWE 1UVTH 2HVXA 2Z94A 1O2YA 1AFQC 3VB5A 2RA3A 4HFPB 2FOMB 3RMMH 3IITA 3VB3A 1A4WH 1GI4A 1EB1H 1P8VC 1QTFA 3NCLA 4CH8B 1CE5A 1SC8U 2G5VA 3UNSA 4WH6A 3RDZA 1C2DA 3LC3A 2R2MB 3MOCA 2H5DA 2GGVB 4K60A 3PB1E 3QX5H 3KHVA 4DW2U 1GHWH 1SHYA 3RXGA 1V2MT 2PLXA 2CXVA 1PPFE 1LHDH 2R0LA 2FI5E 2PTNA 3SU1A 3BF6H 1GHBF 1AWHB 1BDAA 1OPHB 4UFDH 2QXGA 2AFQB 2XC0A 2XCNA 4TPYA 4NWLA 1GHVH 3NUMA 1BBRE 1HJ9A 4TYDA 2PSXA 1T7CA 2ZF0H 2GZ7A 2JH0D 2XWAA 5F8ZA 3UTUH 1ZZZA 1ID5H 3ATKA 1ANEA 1HAZB 1V2ST 4OS1A 4NSYA 1O2XA 3SGQE 3SUGA 3TVJB 4J2YB 4XOJA 5EQSA 5F6MA 3M7TA 4JMYA 2ZTZA 4X8VH 3F9FA 2ZDMA 3TJOA 1KXAA 2H9EH 5E8EH 1A0JA 2ZGBH 3S0NA 1NS3A 1GHAF 2ZFRH 1C5OH 4YLUA 1C5VA 1O37A 5LPRA 1MZAA 3C27B 1UK3A 2P8OB 2QXIA 5I46H 4WXIA 3PLPA 1MBQA 1GJDB 1P10A 3PM3A 1K28D 4NA9H 2ZA5A 1DFPA 3SU4A 4MPXA 4HZHA 2PKAB 3AAUA 1YCPK 1WV7H 5ABWA 2ZZUH 1O5BB 1O3MA 1O5CB 1XUGA 1N6XA 1VCWA 3U9AH 4LZ1H 2O8TA 3SUFA 2BD9A 2R2WU 3M5OA 1EATA 1U6QA 1DWDH 1OP2A 1O35A 5EOKA 1GBTA 3NK8A 1TPPA 2W3IA 3T2NA 5EPNA 1O2HA 2A5AA 2TGDA 1BMNH 3ZVCA 5CHAB 2STAE 1EXFA 1VGCC 1LQEA 3G01A 3E91A 4UFFH 1AGJA 1FUJA 2ZHWH 3F9GA 1GJ7B 1ESAA 4I8HA 1ELDE 1VCPA 3RLWH 1C5RA 3ELAH 1XX9A 3U1IB
chains in the Genus database with same CATH superfamily
1SQAA 1TYNA 2FMJA 2VVUA 1QB6A 5DP5A 3RMOH 1SGCA 2A7CA 2VB0A 2ZU1A 1W13U 3QTVH 5A2MH 2V0BA 3HKJB 1P09A 1SGIB 3GCNA 3P17H 5JBCS 1YPGH 2J95A 4F49A 1K1JA 4MQAA 1O3DA 2QAAA 4FUGA 1LQDB 2BVRH 2FX4A 3TGJE 4Z0KA 1V2WT 3KYFA 3M37A 4JYVH 4NGAH 3QWCH 3L6PA 5KECA 1DWCH 2ZGHA 1S0RA 2EQNA 2XC5A 4GCHG 1E0FD 1EASA 1QA7A 1ZGVA 2HALA 3PV2A 1T8OA 1UTQA 1Z8JB 5GWZA 3M35A 2A2QH 2V3OH 2FOFA 3GY2A 4AFQA 5ETXA 4A6LA 1W0ZU 2GZ9A 3WWBA 5HM9A 3K6ZA 4P00A 3P6ZB 5C0UA 4CH2B 4Y76A 1WU1A 2BDCA 3ENSB 1C1TA 1G3BA 3NKKA 3ZVDA 1ELAA 4I8KA 2SGQE 1AE8H 1IHTH 3CS0A 1EKBB 2P59A 3SZNA 1PPGE 1F0RA 3MMGA 1O36A 1MABB 3PLBA 2VBCA 2ZI2H 3MU5A 1G2MA 1O3GA 1FXYA 1MTNB 3SUDA 1C2EA 4O97A 4XRNA 1NT1A 1B0FA 4MLFB 3W95A 1SG8B 3MFJA 1CO7E 1ZJKA 1WYKA 1KXEA 4Y6DA 4OM9A 3ZZ4A 4X2YA 2BOKA 1FIZA 5A0BA 1C5WB 1DOJA 3ZZAA 4NA7A 5HXFA 2FODA 2VIQA 1EZXC 4H6TA 1C5MD 1GMDG 1FJSA 1FAKH 4AZ2B 2YMSB 2BLQA 4CBNA 5DSFA 4X0WU 5FHTA 1DUEA 1AFEH 1C1SA 5EXNA 1Y3WA 3DFJA 1GBKA 1JRTA 1ELTA 1O3NA 2PKSB 7GCHF 2C3SA 3FZDA 2A4GA 3SOSA 1AVXA 4KGAA 2WPLS 1T31A 3F2FA 1SVPA 1FY8E 2VGCB 3VXFH 1UTJA 2W3KA 3SGBE 1HAVB 8GCHG 1UVUH 3UB0A 3BV9B 2FEQH 4ABJA 1EZSC 4B73A 2C8ZB 1AO5A 2CF8H 2J34A 1EPTC 1QQUA 2G55A 3UR6A 5LPFA 1AB9C 3RXTA 3RC4A 4Q63A 2HRVA 3ZZ8A 3UR9A 2VVCA 2HLCA 4FU7A 1IQIA 3ZYEA 1GWAA 1DY9A 2VNTA 4D8NA 3GY5A 3PWCA 3EE0B 1NPMA 4B75A 2JDID 1MTVA 4Q7ZA 4OS4A 3FOAA 5L2YH 2JJ2D 3SU6A 1G2LA 1Q3XA 2D1JA 3S9AA 1C5XB 1O30A 5DG6A 3VB6A 4YT7H 3P8GA 4Z1MD 2ZNKH 4IBLH 4NSVA 3RXCA 3KIDU 5T3HA 1NRQH 1QBNA 2F9UA 2XBYA 5HIYA 3ZZ5A 4D7GA 1GCTB 2B0FA 1MKWK 2H9HA 2SGPE 2PSYA 1H8HD 3MH5A 1TA2A 4IS5A 4WVPE 1MKXK 1C2GA 1ZSKA 2J98A 1C1MA 2TGPZ 2Z9KA 1P01A 1FQ3A 4AX9H 4DOQA 1OWKA 1OYQA 3TU7H 4IMQA 3U8RH 3MQKC 5EIYA 5EQRA 1CBWC 1GDNA 1KLTA 3ZZ9A 1F0SA 1K0HA 1NFYA 4H42U 3TNSA 3WW7A 1Q31A 2G00A 1OYTH 2VIWA 4ZUHA 3BTDE 1AQ7A 1T32A 5E0GA 2VU8E 1P3EA 3MNBA 2FP7B 3RXOA 2ZEBA 3TPIZ 3B23B 1HAXB 1O2LA 5EXMA 3Q3YA 3AVZA 1UCYK 2IPQX 3M61U 3RXUA 2F9OA 1V2PT 3PMJA 4O03A 1GCDA 1QZ8A 3MH7A 1PPBH 5EODA 1NFUA 1PJPA 1BHXF 4ASUD 2ZU2A 3RM0H 4RT1A 1TMUH 1ZPBA 3RXBA 4MDSA 1IHSH 2GV7A 2WPIS 1TONA 5EJZA 1ZMLA 4BAKB 4DT7B 4I7YH 1P06A 1LHEH 3RXSA 4ESTE 1J14A 1E35B 1TNGA 1C5NH 2BM2A 2F91A 5TCCA 3RXQA 1ABIH 1OWHA 2JH6D 4ZHMU 1TRYA 3A84A 1O5GH 1S6HA 4UFEH 1P9SA 4ABBA 4I8JA 3DA9B 3OSYA 1HAIH 1NFWA 3C1KA 1C1WH 1QNJA 1FY1A 3F0PA 3LOXA 4IN2A 3SJKA 1GMDF 4B76A 3SU3A 2RFKC 1Z6EA 2KFWA 1BJVA 3TGIE 3WY8A 1E79D 2KCAA 1SLUB 1XXFA 1XUIA 1P3CA 1GHXH 2BD8A 5SGAE 2Y7XA 2BQ6B 1EOLA 3DT0H 5ESTE 3GY8A 1S6LA 1K1OA 4OS7A 2BVSH 5A8YA 3RUOA 2QF3A 2SGDE 1BRUP 2BQWB 2W7SA 1J17T 1PQ7A 1A0HB 5JBTA 3MYWA 5JPMH 5I25A 1JIMA 2PR3A 1YGCH 1VCQA 3GCTF 2QV1A 1V2LT 1UMAH 3ZYDA 1TAWA 2ZGCA 1OP8A 4Y11E 2F9VA 5B6LA 4YOJA 5C1UA 2WPKS 2H2ZA 1BTWA 2IJOB 1GI7B 1G3DA 1CA8B 3OAAD 1Y3XA 1HAGE 2Z9IA 1JIRA 1IQKA 1Y3UA 3I29A 1DWEH 3ZZ6A 2BDIA 5L30H 4FUDA 1D3QB 3PTBA 4A5TS 1HAPH 2O9QA 4ISLA 4AG2A 1C5TA 1QRWA 1HAOH 4MNYA 3Q77A 4ZHLU 4Y10E 4B74A 2JKHA 1NC6A 4JZFH 4X1QU 1F0TA 2CJIA 3PMHB 1B5GH 2JETB 1C5QA 1WTGH 4JK6A 3RXJA 2ZDKA 3UQVA 1ZPCA 1UTNA 4GPGA 3SBKA 1XKAC 2PGQB 3V0XA 2ANMH 1JWTA 4BTUB 1AWFH 5AFZH 1SGEE 1W3CA 1SR5C 1WSSH 2NU0E 3EAJA 1FNIA 1H4WA 4LXBH 4O3UA 4RSPA 1ZRKA 3VGCC 1BCUH 1YPHE 3STIA 1FAXA 1O0DH 2EA3A 4NCYA 3F1SB 3LONA 2GDDA 1PQAA 2FOCA 1K1NA 1HJ8A 1SKYE 4K3JA 1AZZA 1CA0C 5DJ7A 3U98H 1Z1JA 3A83A 2OC0A 1O32A 1OWJA 3SORA 1SGPE 3BG4B 1KSNA 1TX8A 5F8XA 1AKSA 2QXJA 3AASA 2C4FH 2B8OH 4RKOB 2A7HA 1T4UH 2ZFTA 4INKA 4FUIA 4NG9H 1LPGB 3OY6U 1FN6A 5C1XA 1MBMA 4ZKSU 2QYIA 1ETRH 1A7SA 5C2ZA 1WOFA 2ODQA 1C2LA 2BD2A 1A61H 1QL8A 2GMTB 1KY9A 1UCYE 2CGAA 2KAIA 1ZRBA 4ZAEA 2RG3A 5GDSH 2FO9A 1Z71A 1GI6A 2UWLA 1QBVH 4B2CA 2BZ6H 2M5TA 1OWEA 1GHAG 1W2KH 2VIDA 3A8AA 1O2TA 1GI1A 2FX6A 3GS9A 2ZWLH 3A82A 5EXLA 3F0OA 1A1RA 4A1XA 2AGGX 2ASUB 1EAUA 3QK1A 2NU3E 1K1IA 1C9TA 2K1QA 2Y5HA 2QGRA 1YLDA 1XM1A 1V2KT 1C5SA 5BRRE 1GBAA 1KLIH 3FO8D 2ZTXA 1VITF 1ZHRA 5AHGH 3RXMA 1FLEE 2UWOA 3F9EA 1RIWC 2Z7FE 2KCYA 3P8FA 3OY5U 1GBCA 1HGTH 1TRNA 1ZJDA 4RN6A 2GCTB 2WUCA 2UUFB 2R0KA 3KQ5A 1HBTH 1QIXB 4TY6A 3A86A 1SMFE 5PTPA 4FUFA 2A2XH 5C5OA 1TPAE 1SGFA 2ZHFH 2XC4A 4ABAA 1GL0E 3EA8A 3TGKE 3T25A 3RXDA 3ZZDA 3RP2A 3QUMP 3NXPA 3F68H 1O2JA 3T29A 1P03A 2FOGA 2I6SA 1IQNA 1AIXH 1O5FH 1SPJA 3MNCA 1AMHA 2ZPRA 1QB9A 1BBRH 3E0PB 4JYUH 1C9PA 1LPKB 1DE7H 1O2VA 1K1MA 4CRFA 3PO1B 3MH4A 2WPJS 1QGFA 2BMGB 1BRBE 2W7UA 2PW8H 1DS2E 2SGEE 3PV5A 2ILNA 5CMXH 1CU1A 1GJ9B 2ZDVH 2CF9H 1F0UA 2FS8A 3GISB 4AGJA 1DX5M 3PRBA 1GBIA 1QL9A 3GCHB 1GBHA 1MQ5A 1AUTC 1GJ6A 1UHBB 3LGWA 4AYVB 5C1YA 1V2VT 2LELA 6CHAC 4Y8YA 2FTMA 2AIPA 4GHQA 1O3LA 2BDGA 4PROA 3KCGH 2BY9X 1HJAC 1Z1IA 5KEDA 1DT2A 4Q7YA 1NFXA 1PYTD 1MH0A 1HXFH 2HNTE 3O8DA 2F9BH 1MCTA 2ZFQH 1O2GH 4Y0ZE 2GV6A 4OS6A 1PQ5A 2OBQA 2XXLA 1O2QA 3BTEE 4KTSA 2KCPA 4YM9A 1GHZA 1SOTA 2C93B 4K8BA 4SGAE 1BJUA 3RLYH 5A8XA 1THRH 1W11U 4I33A 1FPHH 1XUFA 2GTBA 2B7DH 2Z9GA 2F9NA 4XBCA 3F2GA 1DVAH 1K1PA 3D49H 4X2XA 2ZPSA 1NM6A 3NWUA 3RU4E 4VGCC 1Y5UT 2HGTH 4MPUA 1INCA 1O3EA 4MNVA 1UO6A 3BTHE 3A8DA 4Y8XA 1E1RD 1TQ7B 1QCPA 4A92A 5E0JA 4RI0A 1BT7A 1BTXA 1K1LA 2WPDD 1G37A 2ZDLA 3SU2A 1HAYB 1IAUA 1O3PB 1AFQB 1BTZA 2BY8X 3HGPA 3SW2B 1THPB 4KKDA 2BLWA 2BXUH 3WWFA 1EB2A 1ZGIA 4I8LA 2D2DA 4B1TA 2OTVA 1DANH 4AFZA 1LTOA 1A0LA 7GCHG 4SGBE 5DP4A 3ZVBA 1UK4A 2G8TA 3SYJA 1UTKA 3UQOA 1N8OB 2CHAC 1ELEE 1GBDA 4WXVA 6ESTA 1CQQA 3S9CA 1F2SE 1VITH 2ZU3A 1NU9A 3GY6A 2ESTE 4GSOA 5HIZA 3M36A 3I78A 2V7QD 1FY5A 2GZ8A 2EY4C 1TPOA 1HXEH 1MTNC 3DSPA 5T6FA 4ABDA 1K2I1 1O3KA 1PQ8A 1ELFA 1F5KU 2J94A 1P2QA 1W8BH 1QJ7B 2VIOA 3T27A 3MO3A 3O8CA 1NN6A 1RD3B 2QC2A 1ZMJA 2YMSD 3AK5A 1LCYA 1KDQA 1KMHB 4CHAC 3UWIA 3GCOA 2BY7X 4Y71A 3A7WA 1BTPA 1UTMA 4CR9A 2RA0A 4DURA 4ZMAH 3BEUA 3ZIAD 1NRRH 1ELGA 1TGTA 4ZHAA 1AVWA 1C5LH 2V6NA 2AERH 4I31A 3RXHA 5C5NA 3U1JB 2W6JD 2OUAA 1W7GH 2TGAA 4H4FA 4ZKOU 1UW7A 2AEIH 5JDUB 1O3BA 2ZGJA 3OU0A 2VVVA 1LVMA 3K6YA 3A88A 3H7OA 2GKVE 1BUIA 1RTKA 1C2FA 1SQTA 2P93A 3T5FH 3FZZA 1QY6A 4XBDA 3W1EA 1BRCE 2BZAA 1VZQH 1RS0A 2XBWA 2A31A 3MU8A 3TITA 2HWLB 3OEED 5HGGA 1XUHA 3VEQB 1S81A 1GG6C 1O2ZA 5C0TA 2PHBA 1JRSA 2OBOA 4UE7H 3F3BA 1EFRD 1P9UA 1XVMA 3QN7A 5L2ZH 5GCHG 4I8GA 5CE1A 1SLVB 1P12E 1LPZB 1TB6H 2HPPH 1EPTA 2ANWA 3FFGA 3SNCA 3V3MA 4DGJA 4DIHH 2J4IA 3IG6B 4AC9A 1MAYA 1W12U 1HRTH 1FONA 4DVAU 2WZQA 1TMTH 4NWKA 2WYJA 1NO9H 3RXEA 1C1VH 1P2KA 1DM4B 2O8WA 1L0ZA 5EQQA 5EU8A 3KN2A 5DKMA 1SGTA 1TNLA 1AN1E 2WUBA 1ELVA 3BIVH 1S5SA 1O3IA 2AHME 4CREA 2AYWA 5F03A 1CSOE 2G4UA 1P2MA 2KX4A 5FX6A 2IN2A 3LH3A 1EP5A 2YNBA 3U8OH 2ZGXH 1VGCB 4FOUC 4KTUA 5K0HA 1S0QA 2Y82A 2FLRH 5E2PA 3SNAA 3LJOA 1GJCB 1YPMH 1KXFA 1P2OA 4NA8A 1EP6A 5JB9S 3ATWA 3PROA 1C4V2 4H6SB 3SV7A 1CT0E 2R3YA 3ODFA 1O39A 4U2WA 1HAHH 1BOQA 2VWLA 2BHGA 1C4U2 2L6OA 3RU4T 2NU1E 4ABEA 4BAHB 2FOBA 3ZVEA 3N99A 3P8OA 1C1PA 3KF2A 3SGAE 4WF8A 1SSXA 4YOIA 2W6ID 1GGDC 3R0FA 1DLEA 2STBE 4X2VA 4JYTA 2F4LA 3URDA 1CT4E 2FIRH 3BTGE 1KLJH 1UTPA 1FY4A 4GVUA 3MNSA 1H8DH 1O5EH 1D3TB 3GCTG 3TK5A 1YLNA 4X1RU 1T4VH 1IQLA 1FY3A 2P3UB 5H4IB 4NIYA 2AGEX 3U28C 3LPRA 1YYY1 4FU9A 3SNBA 5A8ZA 5K7RA 1EUFA 2VIPA 1DY8A 1GI9B 3SU0A 1P0SH 4E06H 5FCRA 3ZZ7A 1LMWB 2DE9A 3SUEA 1GVKB 1TA6A 2OQUA 5A0AE 2NWNA 1ETSH 3UOUA 1MTSA 2ZDAH 1W0YH 3VXEH 1YKTA 2OLGA 2ZECA 1WUNH 4X8TH 1RTFB 4BANB 1AI8H 2FM2A 2ZP0H 3A8BA 2GDEH 2ZU5A 1O3HA 2LPRA 3Q3XA 5FPTA 2SNWA 3GY3A 3U8TH 4D7FA 3ATIA 3A87A 3Q00A 1TNHA 2OXSA 4Z6AH 1KDQB 1WDIA 3RM2H 2ZG0H 1XUJA 1BMAA 2V3MA 5ESBA 2A32A 1BITA 4ISIH 3OFND 4M7GA 1YLCA 5DN6D 3P70B 1O3JA 4AYYB 2PGBB 3VB7A 1D4PB 4THNH 3RXAA 1QRZA 3UIRA 3RXRA 3PV4A 3SJ8A 2A4OA 3SN8A 2JIZD 3LGVA 2O8LA 2QXHA 3GICB 2AIQA 2FI4E 3M7QA 2XNDD 5GCHF 3SV9A 2ZHDA 1YPEH 3E1XB 1RJXB 3EYDA 4FXGH 2ALVA 1O33A 3AAVA 2VWMA 3KYGA 1J16A 1IOEA 2I6QA 1K9OE 2A1DB 2Q1JA 1TGBA 1GBBA 1TNKA 1GMHG 2EEKA 2WINI 2Y81A 3H7TA 3URCA 4F55A 1GJAB 1RRKA 2WV5A 3LU9B 4YLQH 3M3SA 3SZEA 3B8JA 5HKKD 2ZC9H 3A7VA 3L3TA 3A7XA 5DP9A 3A7TA 1L1NA 2GP9B 3DHKH 2BTCE 2XTTB 5E0HA 5FPSA 3CNRA 1IQHA 4Y8ZA 5T1VA 1AB9B 1ZHPA 4ZKNU 1SGDE 4UFGH 1FV9A 4YZUA 3S69A 1AUJA 4XDEA 2G52A 3M3VA 2CMYA 1XUKA 1MD8A 4E05H 1T8LA 2VH6A 1C5UA 2FOEA 3V13A 3K9XB 2ULLA 1X7AC 4AG1A 4BAOB 1VITG 5GNDA 3KEEA 2NU2E 3KNXA 3LKWA 4NZLA 3E0NB 3ZZCA 1V2NT 2BQ7B 3TK9A 1YPKH 2Y5FA 2ZFFH 4TPIZ 2BDAA 1SBWA 3MU4A 4DIIH 1KTTB 1FDPA 9LPRA 1CBWB 1ZPZA 2ODPA 1SLXB 2J38A 1GBEA 1ELBA 2AMQA 1A3EH 1ESBA 1G30B 2VWNA 2KM0A 4YT6H 4ABFA 2WV4A 4O9VA 3MH6A 3BEIB 8ESTE 1EOJA 1UVOA 1VJAU 5HM2A 3MI4A 3PTNA 5JBAS 1C1OA 3DUXH 2G51A 3CP7A 1ORFA 3NZIA 4E7RG 1OP0A 3UUZA 2J2UA 1ANDA 2EI7A 1MTUA 5LH8A 1QURH 4BXWA 2ZCHP 1ELCA 1ACBE 4HG6A 3STJA 1W7XH 2RDEA 1KIGH 1MQ6A 1HYLA 1DDJA 4JZIA 3OTJE 3E3TA 3JZ1B 5FAHA 5FPYA 2IJD1 4CR5A 4JK5A 2UUJB 1TX6A 4NFEA 3ODDA 1TGSZ 5LPEA 1FIWA 1F92A 2ZO3H 3KGPA 1LHFH 1IQJA 2J98B 3QGJA 1C2JA 1COWD 1QRXA 1IQGA 2Q6FA 4Y79A 5LGOA 1NTPA 4X6NA 3S7HB 1BBRK 3MO9A 1HDTH 1NZQH 1G3EA 4CRAA 1SI5H 2FLBH 3U69H 4BOHA 1B0EA 5EG4A 4XSKU 2LP6A 3SO3A 1GMHF 2R9PA 1V6DA 1H9HE 1O3FA 1O2NA 4CRCA 4TWYA 4TWWA 1D3DB 4K69A 1DSTA 2BB4A 1UVPA 2P3TB 1P2IA 2Z9LA 5IK2D 1MCVA 3UREA 4GLYA 1HPGA 1SQRA 3HK6B 4WMDA 1UTLM 3RU4D 1BMFD 4R8TB 2Y7ZA 3UWJH 2Y5GA 2H6MA 1GPZA 4ASHA 4JZDH 2BX3A 2A0QB 4NIXA 2WPHS 4QT8C 4B6EA 1DWBH 4X8UH 3TIUA 1G3CA 2BLOA 4X2WA 6GCHF 1V2QT 5EJLA 3RXIA 2QF5A 1TALA 3NPSA 3GYMA 4YESB 9ESTA 4ZCNA 1W14U 1YWUA 2BDYA 3LJJA 1LHGH 3FP8E 2Q6DA 2VINA 3QO6A 1GBLA 1Y8TA 4U30A 1WCZA 1Z8GA 2ZIQH 1OS8A 1GDQA 3TJVA 3TNTA 3CENA 3UNQA 5EJ1A 2GJGA 1C2HA 4UEHH 2AS9A 4HI3A 4LK4A 8KME2 3FN8A 3FANA 4DCDA 2P94A 1B7XB 2FTLE 2D26C 1TFXA 4B2AA 4AOQA 5FBIA 1GI5A 3IWMA 1E36B 1H9LB 1L1JA 4ACBA 1F7ZA 3SV8A 1GBFA 3VGCB 5J4QA 1NRPH 2XWBI 1OHHD 2BX4A 3S9BA 1PPEE 4WMEA 1S6FA 5EW1H 2PV9B 1BQYA 4UONA 3KQCA 1P2NA 1S85A 1G36A 2OP9A 1CA0B 1GHYH 5EGMA 1MUEB 3EA9A 2P8OC 4J1YA 2ZFPH 3GDUA 1RXPA 4K1SA 1S83A 5AF9H 1YF4A 3EA7A 2HLDD 1A5HA 1MU8B 3LGTA 5C3NA 2V35A 8LPRA 1C2IA 4YXWD 2H9TH 2OC8A 1D6RA 1NRSH 3MTYA 2K0QA 4Q2KA 5DP6A 1BMMH 3W94A 3FAOA 3O8RA 1LKBA 3T62A 2D8WA 1AY6H 3LIWA 1N8OC 3ZVAA 1DUAA 4RT0A 1YP9A 1Z8IB 2OD3B 2Z3EA 2GX4A 1SGQE 3BG8A 1C1NA 3B9FH 5KGOA 5C20A 2FZZA 2SGAA 1O2IA 1O2PA 1TQ0B 1XVOA 4KELA 3DSOA 1JOUB 1NROH 3SQHE 1AE5A 3TH3H 1SOZA 4OS5A 5CHAC 1KXDA 1OWIA 4YTAA 2FYRA 1OKXA 3H5CB 3EQ0H 1O2RA 4LOYH 3TLOA 1YC0A 1FN8A 3SI3H 2XNIA 1GJBB 1L2EA 2EI8A 1SQOA 2F3CE 3SHAH 4HGCA 1SGYE 1PYTC 1Y5AT 2ODYB 1TBQH 1QB1A 2H1UA 1G32B 2W26A 3BEFB 3BN9A 1RIWB 5JYIA 2UUYA 1C1UH 3LDXH 1QA0A 1AKSB 1ZHMA 1FX0B 1EAIA 3BSQA 1O3OA 2F43B 1D9IA 1A46H 1TBZH 2K8IA 2TBSA 3TJUA 3UPEA 4P02A 1O2UA 1EAWA 1V2UT 1DXPA 1T8MA 2R3UA 1MMJN 5IDKA 2J9NA 3ZZBA 1C5YB 1OX1A 1SGRE 3E8LA 2A5KA 1PPZA 2KAIB 2CK3D 1SB1H 4INLA 3F9HA 7KMEH 1SFIA 4F4OC 3PMAB 4AN7A 3N7EA 2OQ5A 3ESTA 1P2JA 3GY7A 2QY0B 1GJ4H 3D65E 2C90B 3OEHD 4IC5A 1P57B 1T8NA 4X8SH 4XE4A 2BD3A 1CGJE 5JBBS 1VJ9U 2IOTA 2XYAA 4IW4E 1BMLA 3MU0A 2VH0A 1HAVA 2QN5T 1BTHH 1VKYA 1TE0A 2GD4B 3AW0A 4X1NU 3MHWU 1LHCH 1W0JD 3O8BA 2CV3A 2ZFSA 1GDUA 2EI6A 3P92A 2A5IA 4ZKRU 2Q6GA 1YBWA 2XBVA 3RXLA 3VB4A 5L6NH 1O2OA 3LH1A 2LNCA 4FUBA 2SGFE 1TPSA 3A7ZA 3MWIU 1O34A 4IN1A 1F5LA 6CHAB 3Q3KA 1O5AB 4ISHH 5C17A 4BAMB 5G4BA 5FCKA 1AZ8A 3L33A 1HJAB 4K1TA 2ANKH 2P3FH 3MU1A 4FVDA 5DGJA 3S7KB 1TX7A 1QJ6B 2J92A 2SNVA 2FWWA 4X6MA 1F5RA 1MD7A 1C2KA 2AGIX 4XFQA 3GDVA 2C8YB 1BB0B 2FS9A 2YMSC 1EJNA 3DD2H 1TGNA 3RC6A 1O2WA 3M5NA 3Q76A 1JXPA 1HFDA 1MTWA 2PKSC 5A0CA 1JMOH 5DP7A 4MVNA 5TJXA 1Y59T 1DITH 4HTCH 5HMAA 3UY9A 3TJNA 3BIUH 2ZHEH 4FU8A 3F6UH 2BD4A 3FVFB 2OC7A 2VGCC 4MG3A 2A45B 4BTTB 1GL1A 4VGCB 1UJ1A 4Q4LA 1ZTLA 2QF4A 4Q7XA 3MO6A 3RXVA 4B71A 3D62A 2ZDNA 1HCGA 3R3GB 4X1SU 2AMPA 3D23A 1NBME 3ZZ3A 5EPYA 1E37B 1H8IH 1FZZA 2FOHA 2PUQH 4TY7A 2GT8A 5F53A 1L1GA 3SJOA 3K2UA 5BPEA 2YOLA 4TT3D 3HK3B 4U32A 5AFYH 4Y7BA 1QQ4A 1BZXE 1Y3YA 3A7YA 3QLPH 4ABGA 2FXRA 2Z6BD 3ATLA 2DE8A 4BNRA 1GI2A 5DK1A 1O2KA 1GMCG 3SI4H 2XBXA 1GCTC 3M7UA 2CHAB 4ABIA 2TGTA 2ALPA 2WV9A 4GHTA 1SL3A 1SGNE 4FUHA 7LPRA 5C67A 1YCPH 3LGIA 4D9QA 1GVLA 1KXCA 1O3CA 3E16B 4ZROA 3QZRA 2FI3E 2W5EA 1ZLRA 5EW2H 2QCYA 1WBGB 1TNIA 2ZU4A 1WQSA 2GCHG 4GUXA 3EE7A 1TNJA 2TPIZ 3QGNB 1V2RT 1MZDA 2B5TB 4Y7AA 1HNEE 1SHHB 4CHAB 3EGKH 4GAWA 1CGIE 1P02A 3BTME 4MNWA 4WJG2 3QTOH 4X1PU 2HPQH 3A8CA 3T26A 4YOGA 4BXSA 3QDZB 1Z8RA 5TCAA 1EZUC 4WMFA 3E90B 4WWYA 5B6OA 2PTCE 5A09A 2BOHB 2J5UA 2ZTYA 2L74A 3PWBA 1QFKH 4A7IB 1HIAA 2ZHQH 3VPKA 1QL7A 3UOPA 4FVBA 1V2TT 1K22H 2Y6TA 5FBEA 2PFEA 2TIOA 4Y0YE 2G4TA 3MNXA 1GVZA 1WTHD 4OGYA 3EDXB 1Z7KA 4D76A 2OINA 3LT3A 1J8AA 1THSH 3GYLB 1GI0A 2C8WB 3GDSA 3KQBA 4B2BA 1D6WA 3TH4H 4UDWH 3ZV8A 4LZ4B 1UTOA 2BLVA 3ATMA 2G5NA 1GG6B 1ZR0A 5FL7D 1GBJA 4CRBA 1XMNB 5J4SA 1DLKB 3OX7U 2CN0H 1A3BH 1O38A 1ZTKA 4AB9A 4BAQB 1RFNA 2ZKSA 3VFEA 1M9UA 1DXWA 3KQDA 2DUCA 4WH8A 1GJ8B 1LVYA 2WYGA 2HVYB 4DG4A 1AHTH 3CS7A 1HV7A 1OXGA 5JB8S 1BTUA 1EJMA 1RTLA 1WAYB 3SJ9A 3HPTB 5CHBA 2A4RA 5F8TA 5FX5A 5GXPA 2RCEA 1TGCA 2BXTH 3UNRA 1BRAA 1G9IE 4ZXXH 1QBOA 2YNAA 3SV6A 1CGHA 2BDHA 1NU7B 1A5GH 3H09A 3M5MA 1YPHC 1TBRH 4GCHF 1PPHE 3A81A 3BTTE 4DJZB 1ABJH 3A85A 1CHOG 4WY3A 2KCOA 2QA9E 4JCNA 1CVWH 1GMCF 1SLWB 3OE7D 3FP6E 4AFSA 3HATH 2OCVB 2BVXH 1J9CH 1W10U 2JH5D 1C5ZB 1CT2E 1YM0A 2ZQ2A 1YCPM 1GGDB 3FP7E 1TOMH 4IGDA 2A4QA 3M3TA 1EPTB 1ARBA 1PFXC 2JETC 3I77A 3TK6A 4KP0A 1ETTH 2F83A 2ZPQA 5T6GA 1J15A 3KQEA 1O5DH 1HUTH 1IQMA 1V2JT 2GCHF 2WPMS 5DP3A 1TLDA 4MTBA 1MU6B 3VG8A 1P04A 1NRNH 5T6DA 6GCHG 1VR1H 1O2SA 2ZCKP 3N7OA 4Q80A 1EQ9A 4E7NA 1S82A 2WHXA 2ZQ1A 1C1RA 1XXDA 2VWOA 1EX3A 2FOAA 2FYQA 4ZXYH 3UAIC 2QE7D 3PYHA 3RC5A 2C8XB 5AVDA 2QIQA 3RXPA 3BTQE 1EZQA 1GI8B 1V3XA 2GT7A 3A89A 4JZEH 4M9FA 3BG4C 1UVSH 2XRCA 4JZ1A 1DPOA 1NESE 3GY4A 1TWXB 1YPLH 2FDAA 1DICA 3PRDA 2VIVA 4NFFA 1A5IA 1O2MA 3ZVGA 1E1QD 1GJ5H 1N6YA 1NY22 4KTCA 3OYPA 8GCHF 3LGUA 2IPHA 1W0KD 1ANBA 1LVBA 2GMTC 2HNTF 4ISOA 1HB0B 3A80A 4FETA 4K1EA 1JBUH 3SU5A 4ABHA 1MKWH 1FMGA 4X6OA 3P95A 5FXLA 1HIAB 4NIWA 1LDTT 3E6PH 3ITIA 4AGKA 1MKXH 3SV2H 4O3TA 1ZSLA 1ARCA 1QHRB 1EJAA 1H1BA 1SGFG 3KL6A 2PWXA 3HGNA 4AORA 1WXRA 2FPZA 1C5PA 1GI3A 4FUEA 2HOBA 4K5ZA 2P95A 4K8YA 1DSUA 1ESTA 2SFAA 3LGYA 3N7DA 2RDLA 4INHA 3UFAA 5DO4H 3BTKE 4D9RA 3OTPA 1QJ1B 1IQEA 1UCYH 2O8MA 3PLKA 2EC9H 2PUXB 1K21H 2FESH 4CBOA 4ZH8A 1UHBA 1TMBH 4AFUA 1CHGA 2BY6X 1RGQA 4CRGA 2QF0A 1HLTH 5E2OA 3K65B 2GCTC 1XKBC 4X6PA 3RMLH 3QZQA 2UUKB 2VJ1A 1ZSJA 2AH4X 1TABE 2OC1A 1CHOF 1UK2A 1WQVH 1N1LA 2Z3DA 2JJ1D 1C2MA 1ZOMA 1A2CH 1LVOA 3RMNH 2Z9JA 1C1QA 2H5CA 3SHCH 1ZMNA 3ZVFA 1GHBG 2J97A 3DCLA 4IMZA 1AD8H 1H9IE 2HNTC 5GJ4B 2BYAX 4R0IA 3RXKA 1O31A 3SNDA 4K2YA 5HYOA 4RKJB 4AB8A 3PO1C 1LO6A 4BTIB 3ZV9A 2O8UA 2ZCLP 2P16A 3BTFE 1OWDA 3GOVB 1ANCA 1BIOA 1BHXB 2BY5X 3LC5A 4OGXA 1BA8B 1FI8A 4A1VA 1V2OT 2XW9A 1D3PB 3PMBB 1SFQB 3T28A 1P11E 3GCHC 4FUJA 4YO9A 4A1TA 3V7TA 1Z6JH 1TRMA 3SQEE 2PKAA 4NZQA 2F9PA 2NU4E 2TRMA 2GVFA 4MNXA 4TSFD 3SNEA 1Y3VA 1LKAA 1S84A 2UWPA 2PP6A 3DFLA 1C4Y2 1E38B 1YY3A 5GIBA 2BD7A 1GBMA 2AMDA 1FPCH 4IC6A 1AVGH 1ZYOA 4OS2A 4U01A 4UD9H 6LPRA 1KXBA 1EAXA 4ISNA 5DPAA 3JZ2B 1OOKB 3FKSD 4I32A 2BD5A 2ANYA 2Z3CA 1AU8A 1E34B 1ZTJA 3RXFA 3V12A 1P05A 4MPWA 7ESTE 4FUCA 2XCFA 2Y80A 2V3HH 1PPCE 4DY7B 1YPJH 1KTSB 4CRDA 1TIOA 2THFB 3M5LA 4NIVA 5DP8A 1O3AA 1QR3E 1OSSA 1TOCB 2A7JA 1Y5BT 2BDBA 3AW1A 3P8NA 1Q2WA 1MAXA 1L4DA 3SJIA 4XBBA 4MPVA 1IQFA 5IYTA 1KYNA 1BTYA 3TH2H 2G81E 3HKIB 2B9LA 5GPIB 1L4ZA 3BTWE 1UVTH 2XOKD 2HVXA 2Z94A 1O2YA 1AFQC 3VB5A 2RA3A 4HFPB 2FOMB 3RMMH 3IITA 3VB3A 1A4WH 1GI4A 1EB1H 1P8VC 1QTFA 3NCLA 4CH8B 1CE5A 1SC8U 2G5VA 3UNSA 4WH6A 3RDZA 1C2DA 3LC3A 5CDFE 2R2MB 3MOCA 2H5DA 2GGVB 2KR7A 3PB1E 3QX5H 4K60A 3KHVA 4DW2U 1GHWH 1SHYA 3RXGA 1V2MT 1NBMD 2PLXA 2CXVA 1PPFE 1LHDH 2R0LA 3NRLA 2FI5E 2PTNA 3SU1A 3BF6H 4F48B 1GHBF 1AWHB 1BDAA 1OPHB 4UFDH 2QXGA 2AFQB 2XC0A 2XCNA 4TPYA 4NWLA 1GHVH 3NUMA 1BBRE 1HJ9A 4TYDA 2PSXA 3DSGA 1T7CA 2ZF0H 2GZ7A 2JH0D 2XWAA 5F8ZA 3UTUH 1ZZZA 1ID5H 2WSSD 3ATKA 1ANEA 1HAZB 1V2ST 4OS1A 4NSYA 1O2XA 3SGQE 3SUGA 3TVJB 4J2YB 4XOJA 5EQSA 5F6MA 3M7TA 4JMYA 2KZ4A 2ZTZA 4X8VH 3F9FA 2ZDMA 3TJOA 1KXAA 2H9EH 5E8EH 4I86A 1A0JA 2ZGBH 3S0NA 1NS3A 1GHAF 2ZFRH 1C5OH 4YLUA 1C5VA 1O37A 5LPRA 1MZAA 3C27B 1UK3A 2P8OB 2QXIA 5I46H 4WXIA 3PLPA 1MBQA 1GJDB 1P10A 3PM3A 1K28D 4NA9H 4ACAA 2ZA5A 1DFPA 3SU4A 4MPXA 5C94A 4HZHA 2PKAB 3AAUA 1YCPK 1WV7H 5ABWA 2ZZUH 1O5BB 1O3MA 1O5CB 1XUGA 1N6XA 1VCWA 3U9AH 4LZ1H 2O8TA 3SUFA 2BD9A 3F2HA 2R2WU 3M5OA 1EATA 1U6QA 1DWDH 1OP2A 1O35A 5EOKA 1GBTA 3NK8A 1TPPA 4DT4A 2W3IA 3T2NA 5EPNA 1O2HA 2A5AA 2TGDA 1H8ED 2OK5A 1BMNH 3ZVCA 5CHAB 2M2AA 2STAE 1EXFA 1VGCC 1LQEA 3G01A 4XD7D 3E91A 4UFFH 1AGJA 1FUJA 2ZHWH 3F9GA 1GJ7B 1ESAA 4I8HA 1ELDE 1VCPA 3RLWH 1C5RA 4B6FA 3ELAH 1XX9A 3U1IB
chains in the Genus database with same CATH topology
1SQAA 1TYNA 2FMJA 2VVUA 1QB6A 5DP5A 3RMOH 1SGCA 2A7CA 2VB0A 2ZU1A 1W13U 3QTVH 5A2MH 2V0BA 3HKJB 1P09A 1SGIB 3GCNA 3P17H 5JBCS 1YPGH 2J95A 4F49A 1K1JA 4MQAA 1O3DA 2QAAA 4FUGA 1LQDB 2BVRH 2FX4A 3TGJE 4Z0KA 1V2WT 3M37A 4JYVH 4NGAH 3QWCH 3L6PA 1DWCH 2ZGHA 1S0RA 2XC5A 4GCHG 1E0FD 1EASA 1QA7A 1ZGVA 2HALA 1T8OA 1UTQA 1Z8JB 5GWZA 3M35A 2A2QH 2V3OH 2FOFA 3GY2A 4AFQA 5ETXA 4A6LA 1W0ZU 2GZ9A 5HM9A 3K6ZA 3P6ZB 4CH2B 4Y76A 1WU1A 2BDCA 3ENSB 1C1TA 1G3BA 3NKKA 3ZVDA 1ELAA 4I8KA 2SGQE 1AE8H 1IHTH 3CS0A 1EKBB 2P59A 3SZNA 1PPGE 1F0RA 3MMGA 1O36A 3PLBA 2ZI2H 3MU5A 1G2MA 1O3GA 1FXYA 1MTNB 3SUDA 1C2EA 4O97A 1NT1A 1B0FA 4MLFB 3W95A 1SG8B 3MFJA 1CO7E 1ZJKA 1WYKA 1KXEA 4Y6DA 3ZZ4A 4X2YA 2BOKA 1FIZA 5A0BA 1C5WB 1DOJA 3ZZAA 4NA7A 5HXFA 2FODA 2VIQA 1EZXC 4H6TA 1C5MD 1GMDG 1FJSA 1FAKH 4AZ2B 2BLQA 4CBNA 4X0WU 5FHTA 1DUEA 1AFEH 1C1SA 5EXNA 1Y3WA 3DFJA 1GBKA 1JRTA 1ELTA 1O3NA 2PKSB 7GCHF 2C3SA 3FZDA 2A4GA 3SOSA 1AVXA 4KGAA 2WPLS 1T31A 3VXFH 1SVPA 1FY8E 2VGCB 1UTJA 2W3KA 3SGBE 1HAVB 8GCHG 1UVUH 3BV9B 2FEQH 4ABJA 1EZSC 4B73A 2C8ZB 1AO5A 2CF8H 2J34A 1EPTC 1QQUA 2G55A 3UR6A 5LPFA 1AB9C 3RXTA 3RC4A 2HRVA 3ZZ8A 3UR9A 2VVCA 2HLCA 4FU7A 1IQIA 3ZYEA 1GWAA 1DY9A 2VNTA 4D8NA 3GY5A 3PWCA 3EE0B 1NPMA 4B75A 1MTVA 4Q7ZA 4OS4A 5L2YH 3SU6A 1G2LA 1Q3XA 2D1JA 3S9AA 1C5XB 1O30A 5DG6A 3VB6A 4YT7H 3P8GA 2ZNKH 4IBLH 4NSVA 3RXCA 3KIDU 5T3HA 1NRQH 1QBNA 2F9UA 2XBYA 3ZZ5A 4D7GA 1GCTB 2B0FA 1MKWK 2H9HA 2SGPE 2PSYA 3MH5A 1TA2A 4IS5A 4WVPE 1MKXK 1C2GA 1ZSKA 1C1MA 2TGPZ 2Z9KA 1P01A 1FQ3A 4AX9H 4DOQA 1OWKA 1OYQA 3TU7H 4IMQA 3U8RH 5EQRA 1CBWC 1GDNA 1KLTA 3ZZ9A 1F0SA 1NFYA 4H42U 3TNSA 1Q31A 2G00A 1OYTH 2VIWA 4ZUHA 3BTDE 1AQ7A 1T32A 5E0GA 2VU8E 1P3EA 3MNBA 2FP7B 3RXOA 2ZEBA 3TPIZ 3B23B 1HAXB 1O2LA 5EXMA 3Q3YA 3AVZA 1UCYK 3M61U 3RXUA 2F9OA 1V2PT 3PMJA 4O03A 1GCDA 3MH7A 1PPBH 5EODA 1NFUA 1PJPA 1BHXF 2ZU2A 3RM0H 1TMUH 1ZPBA 3RXBA 4MDSA 1IHSH 2GV7A 2WPIS 1TONA 1ZMLA 4BAKB 4DT7B 4I7YH 1P06A 1LHEH 3RXSA 4ESTE 1J14A 1E35B 1TNGA 1C5NH 2BM2A 2F91A 5TCCA 3RXQA 1ABIH 1OWHA 2JH6D 4ZHMU 1TRYA 3A84A 1O5GH 1S6HA 4UFEH 1P9SA 4ABBA 4I8JA 3DA9B 3OSYA 1HAIH 1NFWA 3C1KA 1C1WH 1QNJA 1FY1A 3LOXA 4IN2A 3SJKA 1GMDF 4B76A 3SU3A 1Z6EA 1BJVA 3TGIE 3WY8A 1SLUB 1XXFA 1XUIA 1P3CA 1GHXH 2BD8A 5SGAE 2Y7XA 2BQ6B 1EOLA 3DT0H 5ESTE 3GY8A 1K1OA 4OS7A 2BVSH 5A8YA 3RUOA 2QF3A 2SGDE 1BRUP 2BQWB 2W7SA 1J17T 1PQ7A 1A0HB 5JBTA 3MYWA 5JPMH 5I25A 1JIMA 2PR3A 1YGCH 1VCQA 3GCTF 2QV1A 1V2LT 1UMAH 3ZYDA 1TAWA 2ZGCA 1OP8A 4Y11E 2F9VA 4YOJA 5C1UA 2WPKS 2H2ZA 1BTWA 2IJOB 1GI7B 1G3DA 1CA8B 1Y3XA 1HAGE 2Z9IA 1JIRA 1IQKA 1Y3UA 3I29A 1DWEH 3ZZ6A 2BDIA 5L30H 4FUDA 1D3QB 3PTBA 4A5TS 1HAPH 2O9QA 4ISLA 4AG2A 1C5TA 1QRWA 1HAOH 4MNYA 3Q77A 4ZHLU 4Y10E 4B74A 2JKHA 1NC6A 4JZFH 4X1QU 1F0TA 2CJIA 3PMHB 1B5GH 2JETB 1C5QA 1WTGH 4JK6A 3RXJA 2ZDKA 3UQVA 1ZPCA 1UTNA 4GPGA 3SBKA 1XKAC 2PGQB 3V0XA 2ANMH 1JWTA 4BTUB 1AWFH 5AFZH 1SGEE 1W3CA 1SR5C 1WSSH 2NU0E 3EAJA 1FNIA 1H4WA 4LXBH 4O3UA 4RSPA 1ZRKA 3VGCC 1BCUH 1YPHE 3STIA 1FAXA 1O0DH 2EA3A 4NCYA 3F1SB 3LONA 2GDDA 1PQAA 2FOCA 1K1NA 1HJ8A 4K3JA 1AZZA 1CA0C 5DJ7A 3U98H 1Z1JA 3A83A 2OC0A 1O32A 1OWJA 3SORA 1SGPE 3BG4B 1KSNA 1TX8A 5F8XA 1AKSA 2QXJA 3AASA 2C4FH 2B8OH 4RKOB 2A7HA 1T4UH 2ZFTA 4INKA 4FUIA 4NG9H 1LPGB 3OY6U 1FN6A 5C1XA 1MBMA 4ZKSU 2QYIA 1ETRH 1A7SA 5C2ZA 1WOFA 2ODQA 1C2LA 2BD2A 1A61H 1QL8A 2GMTB 1KY9A 1UCYE 2CGAA 2KAIA 1ZRBA 4ZAEA 2RG3A 5GDSH 2FO9A 1Z71A 1GI6A 2UWLA 1QBVH 4B2CA 2BZ6H 2M5TA 1OWEA 1GHAG 1W2KH 2VIDA 3A8AA 1O2TA 1GI1A 2FX6A 2ZWLH 3A82A 5EXLA 1A1RA 4A1XA 2AGGX 2ASUB 1EAUA 3QK1A 2NU3E 1K1IA 1C9TA 2K1QA 2Y5HA 2QGRA 1YLDA 1XM1A 1V2KT 1C5SA 5BRRE 1GBAA 1KLIH 2ZTXA 1VITF 1ZHRA 5AHGH 3RXMA 1FLEE 2UWOA 3F9EA 1RIWC 2Z7FE 3P8FA 3OY5U 1GBCA 1HGTH 1TRNA 1ZJDA 4RN6A 2GCTB 2WUCA 2UUFB 2R0KA 1HBTH 1QIXB 4TY6A 3A86A 1SMFE 5PTPA 4FUFA 2A2XH 5C5OA 1TPAE 1SGFA 2ZHFH 2XC4A 4ABAA 1GL0E 3EA8A 3TGKE 3T25A 3RXDA 3ZZDA 3RP2A 3QUMP 3NXPA 3F68H 1O2JA 3T29A 1P03A 2FOGA 2I6SA 1IQNA 1AIXH 1O5FH 1SPJA 3MNCA 1AMHA 2ZPRA 1QB9A 1BBRH 3E0PB 4JYUH 1C9PA 1LPKB 1DE7H 1O2VA 1K1MA 4CRFA 3PO1B 3MH4A 2WPJS 1QGFA 2BMGB 1BRBE 2W7UA 2PW8H 1DS2E 2SGEE 5CMXH 2ILNA 1CU1A 1GJ9B 2ZDVH 2CF9H 1F0UA 2FS8A 3GISB 4AGJA 1DX5M 1GBIA 1QL9A 3GCHB 1GBHA 1MQ5A 1AUTC 1GJ6A 1UHBB 3LGWA 4AYVB 5C1YA 1V2VT 6CHAC 4Y8YA 2FTMA 2AIPA 4GHQA 1O3LA 2BDGA 4PROA 3KCGH 2BY9X 1HJAC 1Z1IA 1DT2A 4Q7YA 1NFXA 1PYTD 1MH0A 1HXFH 2HNTE 3O8DA 2F9BH 1MCTA 2ZFQH 1O2GH 4Y0ZE 2GV6A 4OS6A 1PQ5A 2OBQA 2XXLA 1O2QA 3BTEE 4KTSA 4YM9A 1GHZA 1SOTA 2C93B 4K8BA 4SGAE 1BJUA 3RLYH 5A8XA 1THRH 1W11U 4I33A 1FPHH 1XUFA 2GTBA 2B7DH 2Z9GA 2F9NA 4XBCA 1DVAH 1K1PA 3D49H 4X2XA 2ZPSA 1NM6A 3NWUA 3RU4E 4VGCC 1Y5UT 2HGTH 4MPUA 1INCA 1O3EA 4MNVA 1UO6A 3BTHE 3A8DA 4Y8XA 1TQ7B 1QCPA 4A92A 5E0JA 1BT7A 1BTXA 1K1LA 1G37A 2ZDLA 3SU2A 1HAYB 1IAUA 1O3PB 1AFQB 1BTZA 2BY8X 3HGPA 3SW2B 1THPB 4KKDA 2BLWA 2BXUH 1EB2A 1ZGIA 4I8LA 2D2DA 4B1TA 2OTVA 1DANH 4AFZA 1LTOA 1A0LA 7GCHG 4SGBE 5DP4A 3ZVBA 1UK4A 2G8TA 1UTKA 3UQOA 1N8OB 2CHAC 1ELEE 1GBDA 4WXVA 6ESTA 1CQQA 3S9CA 1F2SE 1VITH 2ZU3A 1NU9A 3GY6A 2ESTE 4GSOA 3M36A 3I78A 1FY5A 2GZ8A 1TPOA 1HXEH 1MTNC 5T6FA 4ABDA 1K2I1 1O3KA 1PQ8A 1ELFA 1F5KU 2J94A 1P2QA 1W8BH 1QJ7B 2VIOA 3T27A 3MO3A 3O8CA 1NN6A 1RD3B 2QC2A 1ZMJA 1LCYA 1KDQA 4CHAC 3UWIA 3GCOA 2BY7X 4Y71A 3A7WA 1BTPA 1UTMA 4CR9A 2RA0A 4DURA 4ZMAH 3BEUA 1NRRH 1ELGA 1TGTA 4ZHAA 1AVWA 1C5LH 2V6NA 2AERH 4I31A 3RXHA 5C5NA 3U1JB 2OUAA 1W7GH 2TGAA 4H4FA 4ZKOU 2AEIH 5JDUB 1O3BA 2ZGJA 3OU0A 2VVVA 1LVMA 3K6YA 3A88A 3H7OA 2GKVE 1BUIA 1RTKA 1C2FA 1SQTA 2P93A 3T5FH 3FZZA 1QY6A 4XBDA 1BRCE 2BZAA 1VZQH 1RS0A 2XBWA 2A31A 3MU8A 3TITA 2HWLB 5HGGA 1XUHA 3VEQB 1S81A 1GG6C 1O2ZA 2PHBA 1JRSA 2OBOA 4UE7H 1P9UA 1XVMA 3QN7A 5L2ZH 5GCHG 4I8GA 5CE1A 1SLVB 1P12E 1LPZB 1TB6H 2HPPH 1EPTA 2ANWA 3FFGA 3SNCA 3V3MA 4DGJA 4DIHH 2J4IA 3IG6B 1MAYA 1W12U 1HRTH 1FONA 4DVAU 1TMTH 4NWKA 2WYJA 1NO9H 3RXEA 1C1VH 1P2KA 1DM4B 2O8WA 1L0ZA 5EQQA 5EU8A 3KN2A 5DKMA 1SGTA 1TNLA 1AN1E 2WUBA 1ELVA 3BIVH 1S5SA 1O3IA 4CREA 2AYWA 5F03A 1CSOE 2G4UA 1P2MA 5FX6A 2IN2A 3LH3A 1EP5A 2YNBA 3U8OH 2ZGXH 1VGCB 5K0HA 4KTUA 1S0QA 2Y82A 2FLRH 5E2PA 3SNAA 3LJOA 1GJCB 1YPMH 1KXFA 1P2OA 4NA8A 1EP6A 5JB9S 3ATWA 3PROA 1C4V2 4H6SB 3SV7A 1CT0E 2R3YA 3ODFA 1O39A 4U2WA 1HAHH 1BOQA 2VWLA 2BHGA 1C4U2 3RU4T 2NU1E 4ABEA 4BAHB 2FOBA 3ZVEA 3P8OA 1C1PA 3KF2A 3SGAE 4WF8A 1SSXA 4YOIA 1GGDC 3R0FA 1DLEA 2STBE 4X2VA 4JYTA 3URDA 1CT4E 2FIRH 3BTGE 1KLJH 1UTPA 1FY4A 4GVUA 3MNSA 1H8DH 1O5EH 1D3TB 3GCTG 3TK5A 4X1RU 1T4VH 1IQLA 1FY3A 2P3UB 5H4IB 4NIYA 2AGEX 3LPRA 1YYY1 4FU9A 3SNBA 5A8ZA 5K7RA 1EUFA 2VIPA 1DY8A 1GI9B 3SU0A 1P0SH 4E06H 5FCRA 3ZZ7A 1LMWB 2DE9A 3SUEA 1GVKB 1TA6A 2OQUA 5A0AE 2NWNA 1ETSH 3UOUA 1MTSA 2ZDAH 1W0YH 3VXEH 1YKTA 2OLGA 2ZECA 1WUNH 4X8TH 1RTFB 4BANB 1AI8H 2FM2A 2ZP0H 3A8BA 2GDEH 2ZU5A 1O3HA 2LPRA 3Q3XA 5FPTA 2SNWA 3GY3A 3U8TH 4D7FA 3ATIA 3A87A 3Q00A 1TNHA 2OXSA 4Z6AH 1KDQB 3RM2H 2ZG0H 1XUJA 1BMAA 5ESBA 2A32A 1BITA 4ISIH 4M7GA 1YLCA 3P70B 1O3JA 4AYYB 2PGBB 3VB7A 1D4PB 4THNH 3RXAA 1QRZA 3UIRA 3RXRA 3PV4A 3SJ8A 2A4OA 3SN8A 3LGVA 2O8LA 2QXHA 3GICB 2AIQA 2FI4E 3M7QA 5GCHF 3SV9A 2ZHDA 1YPEH 3E1XB 1RJXB 3EYDA 4FXGH 2ALVA 1O33A 3AAVA 2VWMA 1J16A 1IOEA 2I6QA 1K9OE 2A1DB 2Q1JA 1TGBA 1GBBA 1TNKA 1GMHG 2EEKA 2WINI 2Y81A 3H7TA 3URCA 1GJAB 1RRKA 2WV5A 3LU9B 4YLQH 3M3SA 3B8JA 2ZC9H 3A7VA 3L3TA 3A7XA 5DP9A 3A7TA 1L1NA 2GP9B 3DHKH 2BTCE 2XTTB 5E0HA 5FPSA 1IQHA 4Y8ZA 1AB9B 1ZHPA 4ZKNU 1SGDE 4UFGH 1FV9A 4YZUA 3S69A 1AUJA 4XDEA 2G52A 3M3VA 2CMYA 1XUKA 1MD8A 4E05H 1T8LA 2VH6A 1C5UA 2FOEA 3V13A 3K9XB 2ULLA 1X7AC 4AG1A 4BAOB 1VITG 3KEEA 2NU2E 3KNXA 3LKWA 4NZLA 3E0NB 3ZZCA 1V2NT 2BQ7B 3TK9A 1YPKH 2Y5FA 2ZFFH 4TPIZ 2BDAA 1SBWA 3MU4A 4DIIH 1KTTB 1FDPA 9LPRA 1CBWB 1ZPZA 2ODPA 1SLXB 2J38A 1GBEA 1ELBA 2AMQA 1A3EH 1ESBA 1G30B 2VWNA 4YT6H 4ABFA 2WV4A 4O9VA 3MH6A 3BEIB 8ESTE 1EOJA 1UVOA 1VJAU 5HM2A 3MI4A 3PTNA 5JBAS 1C1OA 3DUXH 2G51A 3CP7A 1ORFA