4AG2A

Human chymase - fynomer complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
226
structure length
223
Chain Sequence
b'IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHYMASE
publication title Generation, Characterization and Structural Data of Chymase Binding Proteins Based on the Human Fyn Kinase SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/de novo protein
total genus 51
structure length 223
sequence length 226
chains with identical sequence B
ec nomenclature ec 3.4.21.39: Chymase.
pdb deposition date 2012-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ag2A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ag2A02
3JZ1B 2RA3A 5L2YH 1QQ4A 2OINA 4BTTB 3U98H 1WAYB 3A87A 1NRQH 2H9TH 3RXOA 4B2AA 1OYTH 1MCVA 1SR5C 2YNBA 4ABGA 4AGJA 3E6PH 4I32A 4CRAA 3F6UH 1INCA 3D49H 2QN5T 3L33A 3RXJA 2XCFA 3UWIA 2CF9H 2O8WA 4I8GA 1OWJA 1G30B 3MFJA 3QO6A 1UO6A 5FPTA 4Y79A 2G5VA 4UFGH 1MKXK 1DUEA 1ETTH 4FUCA 3ZZ5A 5EW1H 3UUZA 3PLKA 4WY3A 2XBYA 4TY6A 3F9HA 2K1QA 5F8XA 4RKJB 1P3CA 2AMPA 1MKWK 3DFJA 3OYPA 1NRPH 5HMAA 3C27B 2R3YA 1MZAA 2HWLB 5EXLA 1PPHE 5CHAC 3GY7A 3FAOA 4AFQA 1THRH 4X8TH 1V6DA 4DOQA 1ZMNA 8GCHF 3MTYA 2GT8A 5C5OA 3W95A 1IQEA 4BOHA 1AN1E 1V2TT 1C1PA 4YTAA 1K2I1 3E16B 2ZDVH 2FI4E 3VB7A 2WUCA 2UUYA 3RXRA 3FANA 3PMJA 3RU4T 5GDSH 1P2OA 2TGAA 3OTJE 2H2ZA 1H9IE 2GT7A 1EPTC 1IQHA 2Q6DA 1LPGB 2PTNA 3KF2A 3VXFH 3GY4A 3LC5A 1Q3XA 1O38A 1TGNA 4WXVA 3D62A 4AGKA 1QRWA 3MO3A 1HCGA 1WBGB 3LONA 1TPPA 1SLWB 5L30H 2HLCA 3RXDA 1ZRBA 1ZPBA 2XC5A 2G5NA 2TBSA 2ZFTA 2GZ7A 4ISLA 5LGOA 1ELBA 4H4FA 1TMUH 4FUIA 3ZVDA 2AERH 5EW2H 3GCNA 2P3TB 5AHGH 1GJ4H 1AUJA 1ELAA 1VJ9U 1JRSA 3UQVA 1XUFA 1NFUA 1YYY1 2SGQE 3M7TA 1S0QA 4CRFA 4DIHH 3OU0A 1KXDA 1TGCA 1SGDE 1W10U 1WOFA 3P8NA 4A7IB 1JWTA 2BM2A 2FOFA 1S5SA 3OX7U 4FUEA 1C5PA 2F3CE 2Z3CA 2FXRA 1MTNC 2GZ9A 3P6ZB 2ZI2H 3RM2H 1C5WB 1AWHB 1CO7E 3FP7E 3M3TA 3QZQA 2V35A 2WV5A 1AFEH 4Y7BA 1YPLH 5DK1A 4ZMAH 1C2FA 4OGYA 1LHFH 1AVGH 1ZGIA 1C5QA 1SGTA 4RN6A 1AB9B 1GI1A 1JBUH 3EAJA 1HAZB 1QY6A 3P70B 1GJCB 3TH2H 3PWBA 3ZVFA 1HAPH 1OWIA 1KXFA 1FONA 1L1NA 4IC5A 1TWXB 1EX3A 4F49A 1SGIB 2GCTB 3U8TH 1NRNH 1IHTH 5FCKA 4K8YA 2SGFE 1WQVH 4YM9A 4JYTA 2P8OB 3LT3A 4ISHH 3EA7A 2P93A 1XUIA 1EZSC 2CJIA 2NU4E 2Z94A 1YF4A 3A8CA 1UTMA 1BRAA 2P16A 2WUBA 1C1TA 1AFQB 2ZKSA 4IS5A 3UY9A 1J8AA 1SGNE 1XMNB 2ZDNA 2ANWA 5E0GA 3U69H 4Q7XA 1QJ1B 1RD3B 1O31A 1GCTC 1GHAF 4KTCA 5EGMA 1KLTA 1YPGH 2ZGJA 5SGAE 1HXEH 3P8GA 1CBWC 6CHAC 4JK5A 2Y80A 3GCOA 1Z8GA 1GBIA 4NWLA 1F0RA 2IPHA 1SMFE 2FX4A 1ELCA 2ZNKH 1EAWA 2BY9X 2AFQB 2ANYA 4LZ1H 3BIUH 4PROA 1GJBB 2C8XB 2TGDA 3UOPA 7LPRA 1QL7A 3PB1E 3PMBB 2BDYA 3F9FA 5LPFA 4X6NA 4ISOA 5FBIA 1O5DH 2BX4A 1T8NA 2FX6A 1TB6H 1NFYA 4B74A 3MO9A 3AW1A 1HAXB 1NU7B 3SOSA 1TNJA 3SNEA 1YBWA 1GMDF 2W3IA 1FPHH 5HGGA 5AF9H 4Y6DA 2V6NA 3TIUA 1SSXA 2ZHWH 1B5GH 4CH8B 1ZPCA 2HVXA 1FN8A 1K22H 3RMOH 4CBOA 3I77A 1GBJA 4FUDA 2F91A 3SJIA 1C4U2 1P11E 3GY6A 1P03A 1UCYH 3UOUA 1DXPA 2FOMB 1LVBA 5F03A 4MPWA 1BBRK 3BG8A 1P2MA 3B23B 1EJMA 2STAE 2FYRA 1P12E 1QBNA 2SGEE 1O3MA 3K2UA 1T7CA 1DSUA 3UNQA 1ZMJA 2W7UA 2EI6A 2VGCB 4BAOB 2NU2E 1UTJA 3M5OA 2ZDKA 2B5TB 1RFNA 4WMFA 1AVWA 5IDKA 2OD3B 1C5ZB 2FZZA 3S9BA 4Q2KA 3ZYDA 1GBFA 3A7VA 3TNTA 1UTOA 4X2VA 2EEKA 5JBCS 2BTCE 1GG6C 2AGIX 1EB1H 1AZZA 2ZQ2A 4MQAA 4R0IA 5C1XA 3ATLA 3L3TA 1SQTA 2P95A 4WMDA 3RU4D 5JPMH 4D9QA 4JZ1A 4AG1A 2ZZUH 3T29A 1D3TB 4Y8XA 5GCHF 1C2LA 1LVMA 1YPJH 1O3AA 1ZSLA 2A4OA 1K9OE 1D6RA 7GCHG 3HATH 1TPAE 1KDQB 2OCVB 2ZCHP 3LIWA 4YT6H 2A5AA 1DM4B 3GCHB 1NFXA 5I46H 4FU8A 4GAWA 4Q7YA 1N1LA 2XW9A 1AD8H 4RSPA 2VWLA 4E05H 2V3OH 3E0NB 1Y5AT 3H5CB 1UHBB 4OS2A 1D3QB 4JZIA 3MNBA 1OP8A 3LJOA 1C2IA 4B76A 1IQIA 1T8MA 3OY6U 4BAQB 2HNTC 3ZVAA 3TJVA 1X7AC 3D65E 1QB9A 1DITH 5C5NA 1KTTB 3RXHA 3SNCA 1WSSH 3GYMA 1J15A 1G3CA 2ZHQH 2BZ6H 9ESTA 3SV2H 3V7TA 1J9CH 2ZHFH 1Y59T 1TGSZ 3SW2B 4GCHF 2XWBI 2SFAA 2ODPA 1RTFB 1UMAH 2R0KA 4UDWH 2BX3A 2AMQA 1K1MA 4I8LA 3NXPA 2C4FH 2OC0A 1EQ9A 4THNH 1H9LB 3U1IB 2ZPQA 2QXGA 3A8BA 5T3HA 3RMMH 3A8DA 1TBQH 3SO3A 3UR6A 2CHAC 3SJ8A 3SUFA 1NM6A 1CVWH 2Z9GA 1HRTH 1ANBA 4AX9H 1HLTH 1QTFA 1ZHRA 2ZQ1A 4X1RU 3G01A 1N8OC 1TPOA 4OS5A 1A7SA 4XBBA 4D7FA 2WPHS 1HV7A 1EOLA 1TOCB 1MU6B 1Z6EA 1FY1A 4AFZA 1O2XA 1P2JA 1UK2A 1GHXH 4DGJA 1O2LA 4ZH8A 2BQ6B 5A09A 2CMYA 1T4UH 2XYAA 3MOCA 1QBVH 3M3VA 1C5TA 2PGQB 4IC6A 4U2WA 5ESTE 5HYOA 1IQNA 1A5HA 2UWLA 1DXWA 1BQYA 1F0TA 2ZDMA 4DIIH 1F5LA 2CV3A 5ABWA 2I6QA 3F1SB 2G8TA 1BB0B 1C5YB 4FUFA 2UWPA 4X0WU 1F0SA 1EAIA 1SBWA 3Q3YA 3FP8E 3BTQE 4NIYA 2EI7A 1P02A 2ZU5A 5C3NA 4YLQH 1SOZA 3B8JA 1O2GH 2J4IA 1TNIA 3SJKA 1DICA 3NKKA 5PTPA 2VB0A 3SI3H 1THSH 1LPZB 3P8FA 3TVJB 4YT7H 2R2MB 2GMTC 1YKTA 5F8TA 2Y6TA 1TALA 1GHBG 1UTNA 2FPZA 1XXFA 1DE7H 4AB9A 3MH7A 1QA7A 1YPKH 3SORA 1SGEE 1BITA 2AIQA 1LVYA 2JH0D 1TX6A 1H4WA 1HYLA 2W26A 1GBEA 3RXBA 1NZQH 1C1MA 1RXPA 4ZUHA 1SHHB 1BOQA 1B7XB 1MUEB 3SU6A 4NCYA 1C1NA 2BDBA 2UWOA 1A0HB 2VVUA 4NA9H 1WU1A 1NY22 1RS0A 2PW8H 4UEHH 2FIRH 1GHWH 1XM1A 4ISIH 1Y3XA 2Q1JA 1S6FA 2BLVA 2ZTZA 1MZDA 1GBDA 4WXIA 1LKAA 4K1EA 4QT8C 1GBCA 1O3OA 1HAVA 1GJAB 4D9RA 1P09A 2BQWB 5AFZH 3RXKA 1OS8A 2D2DA 4HTCH 2FS8A 2SGAA 1G36A 2PGBB 3QDZB 4DG4A 4ZKOU 1UVTH 4LOYH 1HXFH 3M35A 1NT1A 3Q00A 3TLOA 1HJAB 1G3DA 1S82A 1YPMH 1O2ZA 1O3HA 1RJXB 2D26C 1ANDA 3B9FH 4XBCA 1QBOA 3MMGA 3I78A 4GPGA 1H8DH 2BXTH 2ZF0H 2OLGA 3ZZ3A 1SLUB 1WTGH 1CGJE 3E91A 1QNJA 2BB4A 4VGCB 2BY7X 3CS0A 1OOKB 2ZC9H 1O37A 3DHKH 1WCZA 4FUGA 3GY3A 2C8YB 1HGTH 4RKOB 4OS4A 3LU9B 1OXGA 1CE5A 4SGBE 2WV4A 1KIGH 2ZA5A 1QB6A 4CHAC 3RXEA 1O5GH 1O5CB 3PM3A 3ATWA 1KXCA 2SNWA 3BTGE 2ZO3H 1MU8B 1O3FA 1YCPK 2PLXA 1JXPA 2QGRA 1O3NA 1SLXB 1BRCE 1ABIH 2BD9A 2QA9E 1C4V2 3MHWU 1NRRH 4IN1A 2C8WB 4H42U 6ESTA 3A88A 3OY5U 5EPYA 1FDPA 2Q6FA 3W94A 3F9EA 2ANMH 3RP2A 1SPJA 5JB9S 2UUJB 2ZGHA 2HPPH 3MNCA 3TH3H 2O9QA 2BHGA 5K7RA 3KN2A 4O3TA 4U30A 2D1JA 1C5VA 1TYNA 1T32A 2ZU4A 1TLDA 3Q77A 3A7XA 4Y0YE 1LKBA 2WPLS 3TK9A 3U8RH 2A5KA 2ILNA 1HJ9A 2GV7A 1SGFG 3SU4A 5G4BA 2P94A 4LK4A 1SGQE 3MH4A 1P9SA 3D23A 7KMEH 2NU3E 1EASA 1BBRE 3KQBA 1F7ZA 1O3GA 5E8EH 3PO1C 1HAHH 5T6FA 1PQ7A 3T27A 3UNRA 5C20A 4NA8A 3P8OA 2DE9A 2ZIQH 2M5TA 1BHXF 2V3HH 3S7KB 1GDUA 1N6XA 4BTUB 5BRRE 2FLBH 4KGAA 4BXSA 1S84A 3VGCC 1IOEA 1TGTA 2AGEX 1T8OA 4CRDA 3KL6A 3MH6A 2BD7A 4Y76A 4HGCA 3LDXH 4WMEA 2FOGA 2ZCLP 3ZVGA 2PKSC 2WPJS 1G3EA 3A7YA 5LPEA 4GSOA 1V2NT 1BCUH 2STBE 2CXVA 6GCHG 1SQAA 1AO5A 3N7OA 3QTVH 4Z6AH 2W3KA 1MTSA 1CA8B 1FNIA 3FFGA 1FJSA 1AB9C 1MKWH 4K2YA 4DURA 1CU1A 1A5IA 1F2SE 1NTPA 1ZOMA 1GHVH 3SI4H 3VB6A 1V2VT 1P2IA 2F9PA 1MAYA 3KHVA 3GISB 1QURH 3GDUA 2F83A 1C2GA 5DO4H 1CA0B 1QL9A 1TFXA 1UVPA 4AORA 1EP5A 5JBAS 1O5BB 5DGJA 5EXNA 5LPRA 3VFEA 2C8ZB 4O9VA 2GVFA 1GI0A 2SNVA 3S7HB 1F0UA 4KP0A 1TAWA 5BPEA 2CF8H 2WPKS 3BG4B 4B1TA 1J16A 1GGDB 1OP2A 2PSXA 4GVUA 5JB8S 1UK4A 4ZAEA 4MNYA 1IQKA 1PPGE 1P8VC 2XXLA 2Y5HA 2A7JA 1QGFA 1GVLA 3RLYH 1VCPA 5T6GA 1KTSB 3PTNA 2OXSA 1A2CH 1YP9A 3V13A 4YOIA 1WTHD 1DLKB 1FZZA 1FIWA 1OWEA 2XC0A 3RC4A 1HPGA 1YM0A 1G2LA 3MU0A 4NZLA 1O2TA 5GJ4B 4K60A 3DA9B 1P3EA 1K1JA 1EPTB 1OYQA 2FOAA 1OWHA 5DP7A 1S85A 4X1QU 5FPYA 4HI3A 2LNCA 1ZGVA 3RXGA 2DE8A 2ZPSA 1O2RA 1OWDA 1LHDH 3A7TA 1EXFA 1TOMH 4CRGA 1MTWA 1EUFA 2NWNA 1MTUA 1P10A 1GI9B 1L2EA 2PFEA 1TNGA 2VH6A 3KNXA 4K1SA 2F9UA 4CRBA 7GCHF 2GX4A 2VNTA 2Z9JA 4GLYA 4F4OC 1XUJA 1K21H 2VH0A 1WUNH 2ZU2A 4X8VH 5TCAA 8ESTE 1CHGA 2AIPA 3LGTA 1GBKA 3QN7A 3UTUH 4OS6A 5TCCA 3H7TA 3T26A 3TJOA 1C1VH 4B73A 5EU8A 4JYVH 3M37A 1HDTH 1NU9A 4UFEH 4AN7A 1O36A 2OQ5A 4XSKU 3UREA 4MLFB 3SNDA 3DD2H 4CRCA 5HXFA 1JMOH 4UE7H 3MYWA 1MTNB 3PLBA 3STJA 2BDCA 5EOKA 4WH6A 1GJ8B 1ZPZA 3RXPA 2VVCA 3E90B 5DKMA 3TNSA 4X6OA 5F6MA 1CHOG 2HGTH 1W0YH 1TNHA 3BTFE 3SQEE 1SGPE 2B0FA 1XKAC 1P9UA 2NU1E 5L2ZH 1J14A 1O2MA 1SFIA 1SGFA 2VGCC 4I8HA 3TU7H 2ZFSA 1QB1A 3LH1A 3VPKA 1SQOA 3SUEA 1V2PT 2GGVB 1C5XB 1RTKA 1AHTH 2QF3A 2A1DB 1XUGA 1GPZA 1C2DA 4Y71A 3VEQB 5IYTA 1O5AB 1VITH 2G55A 3ZZDA 2EC9H 1GDNA 2BLQA 1RRKA 2QC2A 5EPNA 4Q7ZA 4Q80A 3RMLH 1O2NA 3JZ2B 3HK3B 4M7GA 4NIWA 3T62A 4MPUA 4INLA 1GHYH 3M7QA 1HBTH 1T31A 3QGJA 5EODA 2BDAA 5E0HA 2ZTYA 1BHXB 1C9TA 2PV9B 4B2BA 1BTHH 1GCTB 1E37B 1ELGA 1EPTA 2XBWA 1BMLA 2C3SA 3SZNA 1CBWB 6CHAB 1RGQA 2A4QA 1NESE 5E2OA 2ALPA 2A7HA 3VB5A 4A6LA 1ZSJA 1FLEE 3O8DA 3LGUA 1GBTA 2BMGB 1J17T 2AYWA 2RDLA 3E3TA 1M9UA 1YGCH 3SU2A 4WWYA 3PV4A 1MQ6A 1ELEE 2A2QH 1PPCE 1O3PB 1NPMA 3UNSA 4Y8YA 1A4WH 2ZU1A 4KTUA 3U8OH 2B7DH 1O2YA 1P2NA 5HM2A 1V2OT 4A1TA 1T4VH 1V2ST 1GHBF 3ITIA 1V2JT 2A45B 1B0EA 1AUTC 2QYIA 1BBRH 1BMAA 2ZFPH 1GDQA 1DWCH 1FY3A 3ZV9A 2WINI 4DJZB 1C1QA 1Q2WA 1BT7A 1A61H 1SGCA 3MU1A 5FBEA 1O39A 2ASUB 1ABJH 2H1UA 2J94A 1V2QT 1Z71A 3SV8A 2FESH 1RIWC 1C1RA 3S9CA 6LPRA 1ZTLA 5FPSA 3TK5A 5TJXA 1W11U 1GMCG 1LHEH 2RA0A 1EZUC 2QV1A 3URCA 1DY9A 1BTPA 4XDEA 1AE8H 4K69A 1LHCH 1GBAA 3FVFB 3HK6B 1PPFE 2ZCKP 1P2QA 4WF8A 2H6MA 2Y81A 3Q3XA 3RXFA 2OBQA 3ZVEA 4TPIZ 3NPSA 1OKXA 1XXDA 4ZHAA 1Y5UT 2ANKH 2ZDLA 5EQQA 1YC0A 3SNBA 1HAVB 3SHCH 3EDXB 1GG6B 1P57B 3ZZ9A 1BMNH 1L4DA 2GDDA 3UIRA 2C93B 4BXWA 4NG9H 4ZKNU 1BTYA 1O3IA 3GDVA 1FAXA 2XCNA 4NSYA 3K65B 3GY2A 3UWJH 1NO9H 2PKAB 3FP6E 1IQMA 2Z3EA 1S0RA 3RUOA 3GY5A 2C90B 3NUMA 4TWWA 4Y0ZE 1QQUA 1GJ9B 1ANCA 3U9AH 3URDA 1C5SA 4OS1A 2HOBA 4H6SB 4O03A 3O8RA 4X2YA 2UUKB 3KQCA 1GI7B 3EQ0H 2XWAA 4MVNA 5A0CA 2A7CA 4Y8ZA 4AFSA 1DPOA 2J92A 1ETRH 4ZXYH 3M5NA 1QJ6B 2FM2A 2J9NA 3LOXA 4Y10E 4LZ4B 4JZEH 2A2XH 1D4PB 3M5MA 3BTEE 1BJVA 1JRTA 1A3EH 2VJ1A 3MU8A 4A92A 1GBBA 1HFDA 1ZHPA 3MNSA 1FUJA 1GJ6A 1KLJH 3T25A 1CSOE 1Y3VA 2VWOA 3VXEH 2XTTB 2G00A 1YPHE 2ULLA 4J2YB 2BLOA 2H9HA 4KKDA 1KXBA 1P06A 3EE0B 1C9PA 1LQDB 5A8XA 1W7XH 2A31A 1PYTC 2JETB 1YCPM 1K1PA 2EI8A 3RC6A 3A84A 3ATKA 1HJAC 3RXSA 1SHYA 4ABEA 1HIAB 5GXPA 1S81A 1ZMLA 2HPQH 4MDSA 2ZTXA 4SGAE 4ABHA 4BAKB 3O8BA 2FO9A 3E1XB 1NC6A 1AGJA 4YOJA 1SGYE 3NK8A 3SU3A 2QY0B 5DP8A 3PROA 2FODA 5C1YA 4NFFA 3TGIE 2ZFQH 1OP0A 4IW4E 1GBHA 1SL3A 4VGCC 1Y3UA 1JIRA 5C1UA 1GI6A 1IQLA 1O3DA 3DT0H 1GL1A 1LO6A 3TJNA 2YOLA 3CENA 1IHSH 3OSYA 4BAMB 1EAUA 4XE4A 4FU7A 5GIBA 5A0AE 3MO6A 3S69A 2I6SA 1L1GA 1LTOA 2W7SA 1C5RA 1WQSA 1O3LA 1HAOH 1TONA 2R0LA 1K1IA 5EQRA 2BOKA 2F9VA 1MAXA 6GCHF 3KGPA 4TPYA 4X1PU 3QLPH 1H9HE 3T5FH 1ZLRA 2FWWA 2FI3E 4BNRA 1HUTH 1V3XA 3AAVA 1F92A 2Y82A 1O2JA 1TABE 1H1BA 3LGWA 2BVXH 4MPXA 5H4IB 2Z7FE 5FX5A 4ABBA 2G4UA 2PKAA 1O2HA 4NA7A 1G9IE 1TA2A 1MMJN 2OC1A 2R3UA 2ZP0H 4UD9H 3LH3A 1DVAH 1K1NA 1DWBH 1O2QA 1V2KT 1OPHB 2XC4A 5L6NH 1VGCB 5A0BA 1A0LA 4KTSA 3A80A 1O2OA 2R2WU 1UTKA 2H5DA 4I31A 1LVOA 3EA8A 1Z8JB 2JH6D 4YO9A 1LCYA 1PFXC 4AB8A 3K9XB 3PTBA 1H8IH 3TPIZ 1CGIE 1W7GH 2BYAX 5DPAA 3ODDA 1TRMA 1P0SH 1BA8B 1C1OA 3C1KA 1GL0E 2OBOA 1ZJKA 4CR9A 1NROH 1MBQA 5DP4A 2AH4X 1TRYA 1A46H 4BAHB 3GDSA 3STIA 4I8KA 4O3UA 2OC8A 1PPBH 1P05A 1E36B 1NN6A 1QJ7B 4OS7A 4ASHA 2Y7XA 1EATA 4AOQA 2J38A 3SV9A 1AQ7A 1PQ5A 4IGDA 1KSNA 1PYTD 3RDZA 3SUGA 2GP9B 2KAIB 2ZGXH 3PYHA 1BMMH 2GCHG 1UCYE 2BD3A 2FLRH 1DWDH 2OC7A 4MNXA 1C4Y2 1FI8A 1NFWA 4ISNA 1HIAA 1C5UA 3KQDA 4MTBA 4UONA 1FY4A 1FXYA 4ESTE 2Z6BD 5F8ZA 1DS2E 2XBVA 2Q6GA 1C2EA 2VIPA 4J1YA 1GCDA 2BY6X 3VB4A 3KIDU 2ODYB 8KME2 2OP9A 1Z8RA 1DDJA 1UK3A 1HAGE 1C1WH 2CGAA 4CBNA 3P17H 2YNAA 1BRBE 1ZRKA 2P3FH 2Y5FA 3RC5A 4X8SH 3FZDA 3LGVA 1YCPH 1E38B 1NS3A 2Z3DA 3Q76A 1EZXC 4MNVA 1CA0C 1GI2A 1N6YA 1V2WT 3A8AA 3QTOH 3ZVBA 1G3BA 2ZPRA 3RM0H 3A7ZA 4E06H 2ESTE 5GPIB 4IMZA 3O8CA 2BQ7B 3TITA 1SFQB 3BG4C 4ZXXH 4ABDA 5DP5A 3ZZBA 4CHAB 1O2IA 2J95A 3SV7A 1CHOF 1GGDC 3SU5A 4GUXA 1C5MD 3SN8A 1C5LH 2TPIZ 1JIMA 1L4ZA 1Y8TA 1KXEA 1GBMA 3DUXH 3RU4E 1MKXH 2H9EH 2WYGA 5J4SA 2B9LA 2VWNA 2CN0H 2HRVA 2BY8X 1V2MT 4Z0KA 1O32A 1Z7KA 2VIQA 1QRXA 2ZDAH 1MBMA 2IJOB 1A3BH 1T8LA 3P95A 4GHTA 1AZ8A 3BV9B 2GV6A 3FZZA 1DOJA 1FAKH 3A86A 2XRCA 1GBLA 2G81E 5A8ZA 4NWKA 3UQOA 1GI3A 2ZFFH 1NRSH 3UPEA 1HB0B 8LPRA 1O30A 1BZXE 1DUAA 1WV7H 4K8BA 2GCTC 2J2UA 1UVUH 4Y7AA 3BEFB 2GDEH 4BTIB 5CE1A 3S0NA 4I7YH 3P92A 4I8JA 4AG2A 2P8OC 1FIZA 1SLVB 4IN2A 4JCNA 1UTPA 5CHAB 1VR1H 1GVZA 1TBRH 1VITG 1GJ7B 3BF6H 3PO1B 1W14U 4A1VA 1ETSH 3H7OA 3KEEA 1AFQC 1CT0E 2Y7ZA 3ZZCA 2FOBA 2FS9A 2KAIA 2DUCA 2BDIA 1GMHG 2G4TA 1BTZA 4Y11E 3RXQA 3BTKE 1GJ5H 1O3JA 4HZHA 2FOHA 1KLIH 3GY8A 3TH4H 1C1SA 3MU5A 3VGCB 4D76A 1W12U 1ZSKA 2QAAA 3V3MA 4DT7B 3ZV8A 1RTLA 3HKIB 3ATMA 2BD8A 1SVPA 2PKSB 1UVSH 2OUAA 3L6PA 2A4GA 3M5LA 2F9BH 1ANEA 1S83A 3ESTA 4AFUA 3ATIA 3NWUA 3Q3KA 3EGKH 3GCTG 4ABAA 2FOCA 2FEQH 1HNEE 1LMWB 1W13U 3BTTE 3IG6B 2A4RA 1AU8A 4MNWA 2OQUA 1C5NH 2QXJA 2ZHEH 1ESAA 1GJDB 1FY8E 3RXIA 4JZFH 3A7WA 1K1OA 3LPRA 3HGNA 3QWCH 4JK6A 1TE0A 4ABJA 2BD4A 3A85A 1DLEA 1TMBH 4XBDA 1TPSA 2VIDA 4NIXA 1Z6JH 1P01A 1GMCF 3M36A 1EB2A 1V2LT 3ZZ4A 1GI4A 2ZEBA 4WVPE 3LKWA 1AWFH 2XBXA 1VCQA 2PUXB 1EKBB 1TRNA 3CP7A 1GI5A 3U1JB 4NIVA 2W5EA 4X1NU 3ODFA 1O5FH 2B8OH 3A89A 3RXMA 1VCWA 2SGDE 1P2KA 1AKSB 5DP9A 1ZTJA 2HNTF 1DWEH 4NZQA 1IAUA 4B2CA 3HGPA 8GCHG 1QL8A 4FVDA 1ELFA 1MCTA 2VINA 4UFDH 4NFEA 1AI8H 2SGPE 2VIVA 4XFQA 3SGBE 5JYIA 5A8YA 5K0HA 4K5ZA 3BSQA 1FN6A 1DANH 1BTUA 1UCYK 2HNTE 3K6ZA 3CS7A 4UFFH 4D7GA 3RXAA 1FY5A 1TIOA 1TX7A 3GICB 3MU4A 1HJ8A 1PQAA 1ID5H 1O2UA 3KCGH 3QZRA 2P3UB 4K3JA 1TX8A 1Y3WA 1QIXB 1QR3E 4R8TB 3T2NA 2BD2A 1JOUB 1E0FD 1O2PA 1K28D 5JBBS 1ZR0A 3SBKA 1C5OH 2ZECA 3F9GA 5AFYH 3TJUA 1O2KA 3EA9A 1Y3YA 4NSVA 3KQEA 3SQHE 3ZZ8A 4IBLH 3GCHC 1EOJA 9LPRA 3ENSB 3EYDA 2LPRA 4B71A 3ZZ7A 1TQ7B 3RXTA 2THFB 3PLPA 1L0ZA 5ETXA 2TIOA 2O8UA 3SJOA 1ELVA 4X6MA 5E2PA 2PHBA 1OSSA 1UTQA 1QRZA 3SU1A 3K6YA 1ZZZA 5DP6A 2VWMA 2VVVA 3LGYA 1THPB 3PMAB 3NZIA 4OGXA 1YLCA 4U01A 1CGHA 1PPEE 3IITA 3RXLA 1K1LA 1O2VA 1VZQH 1SC8U 1D3PB 4H6TA 1IQJA 1UVOA 4FUBA 3VB3A 3BIVH 1LHGH 4X2XA 2AMDA 1FMGA 3UR9A 2BLWA 1U6QA 2UUFB 2V0BA 3MH5A 2XNIA 1XX9A 4IMQA 2ZU3A 1GHZA 5ESBA 1KXAA 4JYUH 2F9NA 3TK6A 4INHA 1A5GH 3GOVB 4ZHLU 4TWYA 5JBTA 5E0JA 3WY8A 4YLUA 4DW2U 1EAXA 3RLWH 1AKSA 4ABIA 3V0XA 4INKA 3DFLA 2ZFRH 1TNKA 2BXUH 2O8MA 1PPZA 2RCEA 1F5RA 5C2ZA 1ARCA 2VIOA 1XVOA 1BDAA 2PUQH 2TGPZ 5EQSA 1WYKA 1D6WA 1E34B 2PTCE 4AYYB 1DSTA 1CT2E 3AASA 3RXUA 3RXCA 4JZDH 4ABFA 1MQ5A 1BIOA 1O5EH 1AIXH 5T6DA 2FP7B 1A0JA 2ZGCA 1HAIH 3RXVA 2JH5D 1YLDA 1BTXA 2BDGA 1GHAG 2PSYA 1AE5A 1ARBA 2PWXA 1UJ1A 2QF0A 4YZUA 1MH0A 3LJJA 4CREA 5AVDA 3MWIU 2Z9KA 3T28A 3SGAE 2FTMA 1GWAA 2G51A 4WH8A 2ZGBH 3QGNB 1O0DH 1IQFA 4LXBH 1D3DB 1O33A 1SOTA 1VJAU 1QHRB 5FCRA 3AAUA 4WJG2 3AVZA 2OTVA 2ZHDA 1G2MA 3E8LA 1TMTH 4E7RG 3I29A 3GYLB 2FI5E 1ESBA 1EJAA 1Q31A 3MNXA 2F9OA 5FHTA 1GI8B 1FV9A 2H5CA 3A83A 1MTVA 2WPIS 2O8LA 1AY6H 2FYQA 2JETC 2WYJA 1DT2A 1ESTA 3QUMP 2VU8E 1O3BA 3A81A 1V2UT 3BTHE 1GMDG 3V12A 2BVRH 1RIWB 1B0FA 3E0PB 3IWMA 1YPEH 3F68H 5FAHA 4DVAU 5J4QA 3M3SA 2ODQA 1HAYB 3A82A 4X1SU 1LDTT 2J34A 3BEIB 3SUDA 4MPVA 4B75A 2FMJA 3S9AA 2FTLE 2GCHF 4XOJA 1G37A 1C2HA 4U32A 1A1RA 2ZWLH 1O2SA 3NCLA 2QXIA 3ELAH 3SNAA 1XVMA 1P04A 5A2MH 4A1XA 5LH8A 4YESB 4AZ2B 1O3EA 1TNLA 1ZHMA 3BTME 2VIWA 7ESTE 3PMHB 1L1JA 2AS9A 1SB1H 4I33A 1LQEA 2ALVA 1ACBE 5I25A 4CR5A 2O8TA 1TQ0B 2R9PA 2BY5X 1O34A 3UFAA 1FQ3A 2CHAB 1DY8A 1D9IA 1QA0A 3LGIA 1S6HA 3BTDE 1KDQA 4YOGA 4HFPB 1SG8B 1VGCC 1Z1IA 2EA3A 2GKVE 4TYDA 3ZVCA 4E7NA 3BEUA 1N8OB 5DG6A 1TBZH 1EP6A 5EG4A 1V2RT 2P59A 1W0ZU 5CMXH 3BTWE 5GCHG 2BVSH 1TGBA 4DCDA 1O3KA 2RG3A 3HPTB 1ZTKA 3TGKE 1ORFA 1OWKA 1UHBA 1OX1A 1C2KA 3TGJE 2HALA 2IN2A 2WPMS 1TA6A 1AMHA 2GD4B 3SJ9A 1XKBC 1PQ8A 4FU9A 1XUHA 5HM9A 1E35B 1Y5BT 5C67A 1DX5M 3R3GB 3SHAH 2ZG0H 1BUIA 1LPKB 1PJPA 2Y5GA 3M7UA 4ZKRU 4ZKSU 4ZROA 3AW0A 1O35A 4KELA 1SI5H 4MG3A 3MI4A 1Z1JA 2Z9LA 1KY9A 2BD5A 1IQGA 2PR3A 4X8UH 2FDAA 3ZYEA 1AVXA 1GVKB 4FUHA 4BANB 5FX6A 4X6PA 1ZYOA 3BN9A 1F5KU 1CQQA 2GTBA 2A32A 3M61U 2G52A 3PWCA 1ELDE 2Z9IA 4FVBA 1EJNA 1MD7A 2D8WA 2QCYA 2A0QB 1ZJDA 1MD8A 3QX5H 1KYNA 3ZZAA 2GMTB 1G32B 3LC3A 4D8NA 2QIQA 1DFPA 4GCHG 2FOEA 5DP3A 5FXLA 1W2KH 2AEIH 1O3CA 3SV6A 1C2JA 1VITF 2QXHA 2BOHB 4CH2B 4FXGH 1BTWA 3R0FA 4FUJA 1FPCH 4NGAH 2AGGX 1GMHF 2IOTA 1QFKH 4X2WA 2BDHA 5JDUB 4JMYA 2TGTA 2NU0E 2A5IA 4K1TA 5DJ7A 4ZHMU 1Z8IB 5GWZA 1BRUP 1EZQA 4O97A 2TRMA 1SGRE 4TY7A 4DY7B 2JKHA 1W3CA 2GZ8A 4GHQA 1CT4E 3QK1A 3SU0A 1XUKA 1W8BH 1C1UH 1C2MA 3SGQE 3HKJB 1UTLM 2BZAA 1YPHC 5B6OA 5EXMA 1BJUA 4A5TS 1O2WA 1QCPA 4AYVB 3RMNH 3ZZ6A 3GCTF 1ELTA
chains in the Genus database with same CATH superfamily
3JZ1B 2RA3A 5L2YH 1QQ4A 2OINA 4BTTB 3U98H 1WAYB 3A87A 1NRQH 2H9TH 3RXOA 4B2AA 1OYTH 1MCVA 1QZ8A 1SR5C 2YNBA 4ABGA 4AGJA 3E6PH 4I32A 4CRAA 3F6UH 1INCA 3D49H 2QN5T 3L33A 3RXJA 2XCFA 3UWIA 2GJGA 2CF9H 2O8WA 4I8GA 1OWJA 1G30B 3MFJA 3QO6A 1UO6A 5FPTA 4Y79A 2G5VA 4UFGH 1MKXK 1DUEA 1ETTH 4FUCA 3ZZ5A 5EW1H 3UUZA 3PLKA 4WY3A 2XBYA 4TY6A 3F9HA 1COWD 2K1QA 5F8XA 1SKYE 4RKJB 1P3CA 2AMPA 1MKWK 3DFJA 3OYPA 1NRPH 5HMAA 3C27B 2R3YA 1MZAA 2HWLB 5EXLA 1PPHE 5CHAC 3GY7A 3FAOA 4AFQA 1THRH 4X8TH 1V6DA 4DOQA 1ZMNA 8GCHF 3MTYA 2GT8A 5C5OA 3W95A 1IQEA 1MABB 4BOHA 4ZCNA 1AN1E 1V2TT 1C1PA 4YTAA 1K2I1 3E16B 2ZDVH 2FI4E 3VB7A 2WUCA 2UUYA 3RXRA 3FANA 3PMJA 3RU4T 5GDSH 1P2OA 2TGAA 2WSSD 3OTJE 2H2ZA 1H9IE 2GT7A 1EPTC 1IQHA 2Q6DA 1LPGB 2PTNA 3KF2A 3VXFH 3GY4A 3LC5A 1Q3XA 1O38A 1TGNA 4WXVA 3D62A 4AGKA 1QRWA 3MO3A 2JJ2D 1HCGA 1WBGB 3LONA 2M2AA 1TPPA 1SLWB 5L30H 2HLCA 3RXDA 1ZRBA 1ZPBA 2XC5A 2G5NA 2TBSA 2ZFTA 2GZ7A 2LP6A 4ISLA 5LGOA 1ELBA 5EJ1A 4H4FA 1TMUH 4FUIA 3ZVDA 2AERH 5EW2H 3GCNA 2P3TB 5AHGH 1GJ4H 1AUJA 1ELAA 1VJ9U 1JRSA 3UQVA 1XUFA 1NFUA 1YYY1 2K0QA 2SGQE 3M7TA 1S0QA 4Q63A 4CRFA 4DIHH 3OU0A 1KXDA 1TGCA 1SGDE 1W10U 1WOFA 3P8NA 4TSFD 4A7IB 1JWTA 2BM2A 2FOFA 1S5SA 3OX7U 4FUEA 1C5PA 2F3CE 2Z3CA 2FXRA 1MTNC 2GZ9A 3P6ZB 2ZI2H 2EY4C 3RM2H 3U28C 1C5WB 1AWHB 1CO7E 3FP7E 3M3TA 2J97A 3QZQA 2V35A 2WV5A 1AFEH 4Y7BA 1YPLH 2JDID 5DK1A 4ZMAH 1C2FA 4OGYA 1LHFH 1AVGH 1ZGIA 1C5QA 1SGTA 4RN6A 1AB9B 1GI1A 1JBUH 3EAJA 5FL7D 1HAZB 1QY6A 3P70B 1GJCB 3TH2H 3PWBA 1YLNA 3ZVFA 1HAPH 1OWIA 1KXFA 1FONA 1L1NA 4IC5A 1TWXB 1FX0B 1EX3A 4F49A 1SGIB 2GCTB 3U8TH 1NRNH 1IHTH 5FCKA 4K8YA 2SGFE 1WQVH 4YM9A 4JYTA 3KQ5A 2P8OB 3LT3A 4ISHH 3EA7A 2P93A 1XUIA 1EZSC 2CJIA 2NU4E 2Z94A 1YF4A 3A8CA 1UTMA 1BRAA 2P16A 2WUBA 1C1TA 1AFQB 2ZKSA 4IS5A 3UY9A 1J8AA 1SGNE 1XMNB 2ZDNA 2ANWA 5E0GA 3U69H 4Q7XA 1QJ1B 1RD3B 1O31A 1GCTC 1GHAF 4KTCA 5EGMA 1KLTA 1YPGH 2J5UA 2ZGJA 5SGAE 1HXEH 3P8GA 1CBWC 6CHAC 1H8ED 2Y80A 3GCOA 1Z8GA 1GBIA 4JK5A 4NWLA 1F0RA 2IPHA 1SMFE 2FX4A 5C17A 1ELCA 2ZNKH 1EAWA 2BY9X 2AFQB 2ANYA 4LZ1H 3BIUH 4PROA 1GJBB 2C8XB 2TGDA 3UOPA 7LPRA 1QL7A 3PB1E 3PMBB 2BDYA 3F9FA 5LPFA 4X6NA 4ISOA 5FBIA 1O5DH 2BX4A 1T8NA 2FX6A 1TB6H 1NFYA 4B74A 1OHHD 3MO9A 3AW1A 1HAXB 1NU7B 3SOSA 1TNJA 3SNEA 1YBWA 1GMDF 2W3IA 1FPHH 5HGGA 5AF9H 4Y6DA 2V6NA 3TIUA 1SSXA 2ZHWH 1B5GH 4CH8B 1ZPCA 2HVXA 1FN8A 1K22H 3RMOH 2V7QD 4CBOA 3PRBA 3I77A 1GBJA 4FUDA 2F91A 3SJIA 1C4U2 1P11E 4FOUC 3GY6A 1P03A 1UCYH 3UOUA 2HVYB 2JJ1D 1DXPA 3WWFA 2FOMB 1LVBA 2KFWA 5F03A 4MPWA 1BBRK 3BG8A 1P2MA 3B23B 1EJMA 2STAE 2FYRA 1P12E 1QBNA 2SGEE 1O3MA 3K2UA 1T7CA 1DSUA 3UNQA 1ZMJA 2W7UA 2EI6A 2VGCB 4BAOB 2NU2E 1UTJA 3M5OA 2ZDKA 2B5TB 1RFNA 4WMFA 1AVWA 5IDKA 2OD3B 1C5ZB 2FZZA 3S9BA 4Q2KA 3ZYDA 1GBFA 3A7VA 3TNTA 1UTOA 4X2VA 2EEKA 5JBCS 2BTCE 1GG6C 2AGIX 1EB1H 1AZZA 2ZQ2A 4MQAA 1E79D 4R0IA 5C1XA 3ATLA 3L3TA 4M9FA 1SQTA 2P95A 4WMDA 3RU4D 5JPMH 4D9QA 4JZ1A 4AG1A 2ZZUH 3T29A 1D3TB 4Y8XA 5GCHF 3KYGA 1C2LA 1LVMA 1YPJH 1O3AA 1ZSLA 2A4OA 1K9OE 1D6RA 7GCHG 3HATH 1TPAE 1KDQB 2OCVB 2ZCHP 3LIWA 4YT6H 2A5AA 1DM4B 4FETA 3GCHB 1NFXA 5I46H 4FU8A 4GAWA 4Q7YA 1N1LA 2XW9A 1AD8H 4RSPA 3KYFA 2VWLA 4E05H 2V3OH 3E0NB 1Y5AT 3H5CB 1UHBB 4OS2A 1D3QB 4JZIA 3MNBA 1OP8A 3LJOA 1C2IA 4B76A 1IQIA 1T8MA 3OY6U 4BAQB 2HNTC 3ZVAA 3TJVA 1X7AC 3D65E 1QB9A 1DITH 5C5NA 1KTTB 3RXHA 3SNCA 1WSSH 3GYMA 1WXRA 1J15A 1G3CA 2ZHQH 2BZ6H 9ESTA 3SV2H 3V7TA 1J9CH 2ZHFH 1Y59T 3OFND 1TGSZ 3SW2B 4GCHF 2XWBI 2SFAA 2ODPA 1RTFB 1UMAH 2R0KA 4UDWH 2BX3A 2AMQA 5DSFA 1K1MA 4I8LA 3NXPA 2C4FH 2OC0A 1EQ9A 4THNH 1H9LB 3U1IB 2ZPQA 2QXGA 3A8BA 5T3HA 3RMMH 3A8DA 1TBQH 3SO3A 4OM9A 3UR6A 2CHAC 3SJ8A 3SUFA 1NM6A 1CVWH 2Z9GA 1HRTH 1ANBA 4AX9H 1HLTH 1QTFA 1ZHRA 2ZQ1A 4X1RU 3G01A 1N8OC 1TPOA 4OS5A 1A7SA 4XBBA 4D7FA 2WPHS 1HV7A 1EOLA 1TOCB 1MU6B 1Z6EA 1FY1A 2IPQX 4AFZA 1O2XA 1P2JA 1S6LA 1UK2A 1GHXH 4DGJA 1O2LA 4ZH8A 2BQ6B 5A09A 2CMYA 1T4UH 2XYAA 3MOCA 1QBVH 3M3VA 1C5TA 2PGQB 4IC6A 4U2WA 5ESTE 5HYOA 1IQNA 1A5HA 2UWLA 1DXWA 1BQYA 1F0TA 2ZDMA 4DIIH 1F5LA 2CV3A 5ABWA 2I6QA 3F1SB 2G8TA 1BB0B 1C5YB 4FUFA 2UWPA 4X0WU 3NRLA 1F0SA 1EAIA 1SBWA 3Q3YA 3FP8E 3BTQE 4NIYA 2EI7A 1P02A 2ZU5A 5C3NA 4YLQH 1SOZA 3B8JA 1O2GH 2J4IA 1TNIA 3SJKA 1DICA 3NKKA 5PTPA 2VB0A 3SI3H 1THSH 1LPZB 2J98A 3P8FA 3TVJB 4YT7H 2R2MB 2GMTC 1YKTA 5F8TA 2Y6TA 1TALA 1GHBG 1UTNA 2FPZA 1XXFA 1DE7H 4AB9A 3MH7A 1QA7A 1YPKH 3SORA 1SGEE 1BITA 2AIQA 1LVYA 2JH0D 1TX6A 1H4WA 1HYLA 2W26A 4P00A 1GBEA 3RXBA 1NZQH 1C1MA 1RXPA 3FN8A 4ZUHA 1SHHB 1BOQA 1B7XB 1MUEB 3SU6A 4NCYA 1C1NA 2BDBA 2UWOA 1A0HB 2VVUA 5GNDA 4NA9H 5IK2D 1WU1A 1NY22 1RS0A 2PW8H 4UEHH 2FIRH 1GHWH 1XM1A 4ISIH 1Y3XA 2Q1JA 1S6FA 2BLVA 2ZTZA 4XRNA 1MZDA 1GBDA 4WXIA 1LKAA 4K1EA 4QT8C 1GBCA 1O3OA 1HAVA 1GJAB 4D9RA 1P09A 2BQWB 5AFZH 3RXKA 1OS8A 2D2DA 4HTCH 2FS8A 2SGAA 1G36A 2PGBB 3QDZB 4DG4A 4ZKOU 1UVTH 4LOYH 1HXFH 3M35A 1NT1A 3Q00A 3TLOA 1HJAB 1NBMD 1G3DA 1S82A 1YPMH 1O2ZA 1O3HA 1RJXB 2D26C 1ANDA 3B9FH 4XBCA 1QBOA 3FOAA 3MMGA 3I78A 4GPGA 1H8DH 2WV9A 2BXTH 2ZF0H 2OLGA 3ZZ3A 1SLUB 1WTGH 1CGJE 3E91A 1QNJA 2BB4A 4VGCB 2BY7X 5CDFE 3CS0A 1OOKB 2ZC9H 1O37A 3DHKH 1WCZA 4FUGA 3GY3A 2W6JD 2C8YB 1HGTH 4RKOB 4OS4A 3LU9B 1OXGA 1CE5A 3F0OA 3OEED 2XOKD 4SGBE 2WV4A 1KIGH 2ZA5A 2WHXA 1QB6A 5C94A 3RXEA 4CHAC 1O5GH 1O5CB 3PM3A 3ATWA 1KXCA 2SNWA 3BTGE 2ZO3H 1MU8B 1O3FA 1YCPK 2PLXA 1JXPA 2QGRA 1O3NA 1SLXB 1BRCE 1ABIH 2BD9A 2QA9E 1C4V2 3MHWU 1NRRH 4IN1A 2C8WB 4H42U 6ESTA 3A88A 3OY5U 5EPYA 1FDPA 2AHME 2Q6FA 3W94A 3F9EA 2ANMH 3RP2A 1SPJA 5JB9S 2UUJB 5C0UA 2ZGHA 2HPPH 3MNCA 3TH3H 2O9QA 2BHGA 5K7RA 3KN2A 4O3TA 4U30A 2D1JA 1C5VA 1TYNA 1T32A 2ZU4A 1TLDA 3Q77A 3A7XA 4Y0YE 1LKBA 2WPLS 3TK9A 3U8RH 2A5KA 2ILNA 1HJ9A 2GV7A 1SGFG 3SU4A 5G4BA 2P94A 4LK4A 1SGQE 3MH4A 1P9SA 3D23A 7KMEH 2NU3E 1EASA 1BBRE 3KQBA 1F7ZA 1O3GA 5E8EH 3PO1C 1HAHH 5T6FA 1PQ7A 3T27A 3UNRA 5C20A 2EQNA 4NA8A 3P8OA 2DE9A 2ZIQH 5HIYA 2M5TA 1BHXF 2V3HH 3S7KB 1GDUA 1N6XA 4BTUB 5BRRE 2FLBH 4KGAA 4BXSA 1S84A 3VGCC 1IOEA 1TGTA 2AGEX 1T8OA 4CRDA 3KL6A 3MH6A 2BD7A 4Y76A 4HGCA 3LDXH 4WMEA 2FOGA 2KX4A 2ZCLP 3ZVGA 2PKSC 2WPJS 1G3EA 3A7YA 5LPEA 4GSOA 1V2NT 1BCUH 2KCPA 2CXVA 2STBE 6GCHG 1SQAA 1AO5A 3N7OA 3QTVH 4Z6AH 2W3KA 1MTSA 1CA8B 1FNIA 3FFGA 1FJSA 1AB9C 1MKWH 4K2YA 4DURA 1CU1A 1A5IA 1F2SE 1NTPA 1ZOMA 1GHVH 3SI4H 3VB6A 1V2VT 1P2IA 2F9PA 1MAYA 3KHVA 3GISB 1QURH 3GDUA 2F83A 1C2GA 5DO4H 1CA0B 1QL9A 1TFXA 1UVPA 4AORA 5HIZA 1EP5A 5JBAS 1E1RD 1O5BB 5DGJA 5EXNA 5LPRA 3VFEA 2C8ZB 4O9VA 2GVFA 1GI0A 2SNVA 3S7HB 1F0UA 4KP0A 1TAWA 5BPEA 2CF8H 2OK5A 2WPKS 3BG4B 4B1TA 1J16A 1GGDB 1OP2A 2PSXA 4GVUA 5JB8S 1UK4A 4ZAEA 4MNYA 5DN6D 1IQKA 1PPGE 3F0PA 1P8VC 2XXLA 2Y5HA 2A7JA 1QGFA 1GVLA 3RLYH 1VCPA 2CK3D 5T6GA 1KTSB 3PTNA 2OXSA 1A2CH 1YP9A 3V13A 4YOIA 1WTHD 1DLKB 1FZZA 1FIWA 1OWEA 2XC0A 3RC4A 1HPGA 1YM0A 1G2LA 3MU0A 4NZLA 1O2TA 5GJ4B 4K60A 3DA9B 1P3EA 1K1JA 1EPTB 1OYQA 2FOAA 1OWHA 5DP7A 1S85A 4X1QU 5FPYA 5B6LA 4HI3A 2LNCA 1ZGVA 3RXGA 2DE8A 2ZPSA 1O2RA 1OWDA 1LHDH 3A7TA 1EXFA 1TOMH 4CRGA 1MTWA 1EUFA 2QE7D 2NWNA 1MTUA 1P10A 1GI9B 1L2EA 2PFEA 1TNGA 2VH6A 3KNXA 3PV5A 4K1SA 2F9UA 4CRBA 7GCHF 2KR7A 2GX4A 2VNTA 2Z9JA 4GLYA 4F4OC 1XUJA 1K21H 2VH0A 1WUNH 2ZU2A 4X8VH 5TCAA 8ESTE 1CHGA 2AIPA 3LGTA 1GBKA 3QN7A 3UTUH 4OS6A 5TCCA 3H7TA 3T26A 2IJD1 1C1VH 3TJOA 5EU8A 4B73A 5EIYA 4JYVH 3M37A 1HDTH 1NU9A 4UFEH 4AN7A 1O36A 2OQ5A 4XSKU 3UREA 4MLFB 3SNDA 3DD2H 4CRCA 5HXFA 1JMOH 4UE7H 3MYWA 1MTNB 1K0HA 3PLBA 3STJA 2BDCA 5EOKA 4WH6A 1GJ8B 1ZPZA 3PRDA 3RXPA 1UW7A 2VVCA 3E90B 5DKMA 3TNSA 4X6OA 5F6MA 1CHOG 2HGTH 1W0YH 1TNHA 3BTFE 3SQEE 1SGPE 2B0FA 1XKAC 1P9UA 2NU1E 5L2ZH 1J14A 1O2MA 1SFIA 1SGFA 2VGCC 4I8HA 3TU7H 2ZFSA 1QB1A 3LH1A 3VPKA 1SQOA 3SUEA 1V2PT 2GGVB 1C5XB 1RTKA 1AHTH 2QF3A 2A1DB 1XUGA 1GPZA 1C2DA 4Y71A 3VEQB 5IYTA 1O5AB 1VITH 2G55A 3ZZDA 2EC9H 1GDNA 2BLQA 1RRKA 2QC2A 5EPNA 4Q7ZA 4Q80A 3RMLH 1O2NA 2L74A 3JZ2B 3HK3B 4M7GA 4NIWA 3T62A 4MPUA 4INLA 1GHYH 3M7QA 1HBTH 1T31A 3QGJA 5EODA 2BDAA 5E0HA 2ZTYA 2YMSC 1BHXB 1C9TA 2PV9B 4B2BA 1BTHH 1GCTB 1E37B 1ELGA 1EPTA 2XBWA 1BMLA 2C3SA 3SZNA 1CBWB 6CHAB 1RGQA 2A4QA 1NESE 5E2OA 2ALPA 2A7HA 3VB5A 4A6LA 1ZSJA 1FLEE 1NBME 3O8DA 3LGUA 1GBTA 2BMGB 4RT1A 4DT4A 1J17T 2AYWA 2RDLA 3E3TA 1M9UA 1YGCH 3SU2A 4WWYA 3PV4A 1MQ6A 1ELEE 2A2QH 1PPCE 5HKKD 1O3PB 1NPMA 3UNSA 4Y8YA 1A4WH 2ZU1A 4KTUA 3U8OH 2B7DH 1O2YA 1P2NA 5HM2A 1V2OT 4A1TA 1T4VH 1V2ST 1GHBF 4XD7D 3ITIA 1V2JT 2A45B 1B0EA 1AUTC 2QYIA 1BBRH 1BMAA 2ZFPH 1GDQA 1DWCH 1FY3A 3ZV9A 2WINI 4DJZB 1C1QA 1Q2WA 1BT7A 1A61H 1SGCA 3MU1A 5FBEA 1O39A 2J98B 2ASUB 1ABJH 2H1UA 2J94A 1V2QT 1Z71A 3SV8A 3DCLA 1VKYA 2FESH 1RIWC 1C1RA 3S9CA 6LPRA 1ZTLA 4P02A 5FPSA 3TK5A 5TJXA 1W11U 1GMCG 1LHEH 2RA0A 3UAIC 1EZUC 2QV1A 3URCA 1DY9A 1BTPA 4XDEA 1AE8H 4K69A 1LHCH 1GBAA 3FVFB 3HK6B 1PPFE 2ZCKP 1P2QA 4WF8A 2H6MA 2Y81A 3Q3XA 3RXFA 3WW7A 2OBQA 3ZVEA 4TPIZ 3NPSA 1OKXA 1XXDA 4ZHAA 1Y5UT 2KCOA 2ANKH 2ZDLA 5EQQA 1YC0A 3SNBA 1HAVB 2KCYA 3SHCH 3EDXB 1GG6B 1P57B 3ZZ9A 1BMNH 1L4DA 2GDDA 2VBCA 2C93B 3UIRA 2YMSD 4BXWA 4NG9H 4ZKNU 1BTYA 1O3IA 3GDVA 1FAXA 2XCNA 4NSYA 3K65B 3GY2A 3UWJH 1NO9H 2PKAB 3FP6E 1IQMA 2Z3EA 1S0RA 3RUOA 3GY5A 2C90B 3NUMA 4TWWA 4Y0ZE 1QQUA 1GJ9B 1ANCA 3U9AH 3URDA 1C5SA 4OS1A 2HOBA 2LELA 4H6SB 4O03A 3O8RA 4X2YA 2UUKB 3KQCA 1GI7B 3EQ0H 2XWAA 4MVNA 5A0CA 2A7CA 3SZEA 4Y8ZA 4AFSA 1DPOA 2J92A 1ETRH 4ZXYH 3M5NA 1QJ6B 3F2HA 2FM2A 2J9NA 3LOXA 4Y10E 4LZ4B 4JZEH 2A2XH 1D4PB 3M5MA 3BTEE 1BJVA 1JRTA 1A3EH 2VJ1A 3MU8A 2QF5A 4A92A 1GBBA 1HFDA 1ZHPA 3MNSA 1FUJA 1GJ6A 1KLJH 3T25A 1CSOE 1Y3VA 2VWOA 3VXEH 2RFKC 2XTTB 2G00A 1YPHE 2ULLA 2F4LA 4J2YB 2BLOA 2H9HA 4KKDA 3AK5A 1KXBA 1P06A 3EE0B 4ACAA 1C9PA 4F55A 1LQDB 5A8XA 1W7XH 2A31A 1PYTC 2JETB 1YCPM 1K1PA 2EI8A 3RC6A 3A84A 3ATKA 1HJAC 3RXSA 1SHYA 4ABEA 1HIAB 5GXPA 1S81A 1ZMLA 2HPQH 4MDSA 2ZTXA 4SGAE 4ABHA 4BAKB 3O8BA 2FO9A 3E1XB 1NC6A 1AGJA 4YOJA 5KECA 1SGYE 3NK8A 3SU3A 2QY0B 5DP8A 3PROA 2FODA 5C1YA 4NFFA 3TGIE 2ZFQH 1OP0A 4IW4E 1GBHA 1SL3A 4VGCC 1Y3UA 1JIRA 5C1UA 1GI6A 1IQLA 1O3DA 3DT0H 1GL1A 1LO6A 3EE7A 3TJNA 2YOLA 3CENA 1IHSH 3OSYA 4BAMB 1EAUA 4XE4A 4FU7A 5GIBA 5A0AE 2QF4A 3MO6A 3S69A 2I6SA 1L1GA 1LTOA 2W7SA 1C5RA 1WQSA 1O3LA 1HAOH 1TONA 2R0LA 1K1IA 3MQKC 5EQRA 2BOKA 2F9VA 1MAXA 6GCHF 3KGPA 4TPYA 4X1PU 3QLPH 1H9HE 3T5FH 1ZLRA 2FWWA 2FI3E 4BNRA 1HUTH 1V3XA 3AAVA 1F92A 2Y82A 1O2JA 1TABE 1H1BA 3LGWA 2BVXH 4MPXA 5H4IB 2Z7FE 5FX5A 4ABBA 2G4UA 2PKAA 1O2HA 4NA7A 1G9IE 1TA2A 1MMJN 2OC1A 2R3UA 2ZP0H 4UD9H 3LH3A 1DVAH 1K1NA 1DWBH 1O2QA 1V2KT 1OPHB 2XC4A 5L6NH 1VGCB 5A0BA 1A0LA 4KTSA 3A80A 1O2OA 2R2WU 1UTKA 2H5DA 4I31A 1LVOA 3EA8A 1Z8JB 2JH6D 4YO9A 3PV2A 1LCYA 1PFXC 4AB8A 3K9XB 3PTBA 1H8IH 3TPIZ 1CGIE 1W7GH 2BYAX 5DPAA 1W0JD 3ODDA 1TRMA 1P0SH 1BA8B 1C1OA 3C1KA 1GL0E 2OBOA 1ZJKA 4CR9A 1NROH 1MBQA 5DP4A 2AH4X 1TRYA 1A46H 4BAHB 3GDSA 3STIA 4I8KA 4O3UA 2OC8A 1PPBH 1P05A 1E36B 1NN6A 1QJ7B 4OS7A 4ASHA 2Y7XA 1EATA 3W1EA 4AOQA 2J38A 3SV9A 1AQ7A 1PQ5A 4IGDA 1KSNA 1PYTD 3RDZA 3SUGA 2GP9B 2KAIB 2ZGXH 3PYHA 1BMMH 2GCHG 1UCYE 2BD3A 2FLRH 1DWDH 2OC7A 4MNXA 1C4Y2 4Q4LA 1FI8A 1NFWA 4ISNA 1HIAA 1C5UA 3KQDA 4MTBA 4UONA 1FY4A 1FXYA 4ESTE 1WDIA 2Z6BD 5F8ZA 1DS2E 2XBVA 3OTPA 2Q6GA 1C2EA 2VIPA 4J1YA 1GCDA 2BY6X 3VB4A 3KIDU 2ODYB 8KME2 2OP9A 1Z8RA 1DDJA 1UK3A 1HAGE 1C1WH 2CGAA 4CBNA 3P17H 2YNAA 1BRBE 1ZRKA 2P3FH 2Y5FA 3RC5A 4X8SH 3FZDA 3LGVA 4YXWD 1YCPH 1E38B 1NS3A 2Z3DA 3Q76A 1EZXC 4MNVA 4I86A 1CA0C 1BMFD 1GI2A 1N6YA 1V2WT 3A8AA 3QTOH 3ZVBA 1G3BA 2ZPRA 3RM0H 3A7ZA 4E06H 3SYJA 2ESTE 5GPIB 4IMZA 3O8CA 2BQ7B 3TITA 1SFQB 3BG4C 4ZXXH 4ABDA 5DP5A 3ZZBA 4CHAB 1O2IA 2J95A 3SV7A 1CHOF 1GGDC 3SU5A 4GUXA 1C5MD 3SN8A 1C5LH 2TPIZ 1JIMA 1L4ZA 1Y8TA 1KXEA 1GBMA 3DUXH 3RU4E 1MKXH 2H9EH 2WYGA 5J4SA 2B9LA 2VWNA 2CN0H 2HRVA 2BY8X 1V2MT 2KM0A 4Z0KA 1O32A 1Z7KA 3OE7D 3WWBA 2JIZD 2VIQA 1QRXA 2ZDAH 1MBMA 2IJOB 1A3BH 1T8LA 3P95A 4GHTA 1AZ8A 3BV9B 2GV6A 3FZZA 1DOJA 1FAKH 3A86A 2PP6A 2XRCA 1GBLA 2G81E 5A8ZA 4NWKA 3UQOA 1GI3A 2ZFFH 1NRSH 3UPEA 1HB0B 8LPRA 1O30A 1BZXE 1DUAA 1WV7H 4K8BA 2GCTC 2J2UA 1UVUH 4Y7AA 3BEFB 2GDEH 4BTIB 5CE1A 3S0NA 4I7YH 2KZ4A 3P92A 4I8JA 4AG2A 2P8OC 1FIZA 1YY3A 1SLVB 4IN2A 4JCNA 1UTPA 5CHAB 1VR1H 1GVZA 1TBRH 1VITG 1GJ7B 3BF6H 3PO1B 1W14U 4A1VA 1ETSH 3H7OA 3KEEA 1AFQC 1CT0E 2Y7ZA 3VG8A 2FOBA 3ZZCA 2FS9A 2KAIA 5CHBA 2DUCA 2BDIA 1GMHG 2G4TA 1BTZA 4Y11E 3F2GA 3RXQA 3BTKE 1GJ5H 1O3JA 4HZHA 2FOHA 1KLIH 3GY8A 3TH4H 1C1SA 3MU5A 3VGCB 4D76A 1W12U 1ZSKA 2QAAA 3V3MA 4HG6A 3ZV8A 4DT7B 1RTLA 3HKIB 3ATMA 2BD8A 1SVPA 2PKSB 1UVSH 2OUAA 3L6PA 2A4GA 3M5LA 2XNDD 3N99A 2F9BH 1ANEA 1S83A 3ESTA 4RT0A 4AFUA 3DSOA 3ATIA 3NWUA 3Q3KA 3EGKH 3GCTG 4ABAA 2FOCA 2FEQH 1HNEE 1LMWB 1W13U 3BTTE 3IG6B 2A4RA 1AU8A 4MNWA 2OQUA 1C5NH 2WPDD 2QXJA 2RDEA 2ZHEH 1ESAA 1GJDB 1FY8E 3RXIA 4JZFH 3A7WA 1K1OA 3LPRA 3HGNA 3QWCH 4JK6A 1TE0A 4ABJA 4F48B 2BD4A 3A85A 1DLEA 1TMBH 4XBDA 1TPSA 2VIDA 4NIXA 1Z6JH 1P01A 1GMCF 3M36A 1EB2A 1V2LT 3ZZ4A 1GI4A 2ZEBA 4WVPE 3LKWA 1AWFH 2XBXA 1VCQA 2PUXB 1EKBB 1TRNA 3CP7A 1GI5A 3U1JB 4NIVA 2W5EA 4X1NU 3ODFA 1O5FH 2B8OH 2WZQA 3A89A 3RXMA 1VCWA 2SGDE 1P2KA 1AKSB 5DP9A 1ZTJA 2HNTF 1DWEH 4NZQA 1IAUA 4B2CA 3HGPA 1KMHB 8GCHG 1QL8A 4FVDA 4B6FA 1ELFA 1MCTA 2VINA 4UFDH 4NFEA 1AI8H 2SGPE 2VIVA 4XFQA 3SGBE 5JYIA 5A8YA 5K0HA 4K5ZA 3BSQA 1FN6A 4B6EA 1DANH 1BTUA 1UCYK 2HNTE 3K6ZA 3CS7A 4UFFH 4D7GA 3RXAA 1FY5A 1TIOA 1TX7A 3GICB 3MU4A 1HJ8A 1PQAA 1ID5H 1O2UA 3KCGH 3QZRA 2P3UB 4K3JA 1TX8A 1Y3WA 1QIXB 1QR3E 4Z1MD 4R8TB 3T2NA 2BD2A 1JOUB 1E0FD 1O2PA 1K28D 5JBBS 1ZR0A 3SBKA 1EFRD 1C5OH 2ZECA 3F9GA 5AFYH 3TJUA 1O2KA 3EA9A 1Y3YA 4NSVA 3KQEA 3SQHE 3ZZ8A 4IBLH 3GCHC 1EOJA 3CNRA 9LPRA 3ENSB 3EYDA 2LPRA 4B71A 3ZZ7A 1TQ7B 3RXTA 2THFB 3PLPA 1L0ZA 5ETXA 2TIOA 2O8UA 3SJOA 1ELVA 4X6MA 5E2PA 2PHBA 5T1VA 5F53A 1OSSA 1UTQA 1QRZA 3SU1A 3K6YA 1ZZZA 5DP6A 2VWMA 2VVVA 3LGYA 1THPB 3PMAB 3NZIA 4OGXA 1YLCA 4U01A 2W6ID 1CGHA 1PPEE 3IITA 3RXLA 1K1LA 1O2VA 1VZQH 1SC8U 1D3PB 4H6TA 1IQJA 1UVOA 4FUBA 3VB3A 3BIVH 1LHGH 4X2XA 2AMDA 1FMGA 3UR9A 2BLWA 1U6QA 2UUFB 2V0BA 3MH5A 2XNIA 1XX9A 4IMQA 2ZU3A 1GHZA 5ESBA 1KXAA 4JYUH 2F9NA 3TK6A 4INHA 1A5GH 3GOVB 4ZHLU 2F43B 4TWYA 5JBTA 5E0JA 3WY8A 4YLUA 4DW2U 1EAXA 3RLWH 1AKSA 4ABIA 3V0XA 4INKA 3DFLA 2ZFRH 1TNKA 2BXUH 2O8MA 1PPZA 2RCEA 1F5RA 5C2ZA 1ARCA 2VIOA 2YMSB 1XVOA 1BDAA 2PUQH 2TGPZ 5EQSA 1WYKA 1D6WA 1E34B 2HLDD 2PTCE 4AYYB 1DSTA 1CT2E 3AASA 3RXUA 3RXCA 4JZDH 4ABFA 3UB0A 1MQ5A 1BIOA 1O5EH 3FKSD 1AIXH 5T6DA 3N7DA 2FP7B 1A0JA 2ZGCA 1HAIH 3RXVA 2JH5D 1YLDA 1BTXA 2BDGA 1GHAG 2PSYA 1AE5A 1ARBA 2PWXA 1UJ1A 2QF0A 5KGOA 4YZUA 1MH0A 3LJJA 4CREA 5AVDA 3MWIU 2Z9KA 3T28A 3SGAE 2FTMA 1GWAA 2G51A 4WH8A 2ZGBH 3QGNB 1O0DH 1IQFA 4LXBH 1D3DB 1O33A 1SOTA 1VJAU 1QHRB 4RI0A 5FCRA 3AAUA 4WJG2 3AVZA 2OTVA 2ZHDA 1G2MA 3E8LA 1TMTH 4E7RG 3I29A 3GYLB 2FI5E 3H09A 1ESBA 1EJAA 1Q31A 3MNXA 2F9OA 5EJLA 5FHTA 1GI8B 1FV9A 1YWUA 2H5CA 3A83A 1MTVA 2WPIS 3FO8D 2O8LA 1AY6H 2FYQA 2JETC 2WYJA 1DT2A 1ESTA 3QUMP 2VU8E 1O3BA 3A81A 1V2UT 1W0KD 1GMDG 3BTHE 3V12A 2BVRH 1RIWB 1B0FA 3E0PB 3IWMA 1YPEH 3F68H 5FAHA 4DVAU 5J4QA 3M3SA 2ODQA 1HAYB 1SQRA 3A82A 4X1SU 1LDTT 2J34A 3BEIB 3SUDA 4MPVA 4B75A 2FMJA 3S9AA 2FTLE 2GCHF 4XOJA 1G37A 1C2HA 4U32A 1A1RA 4TT3D 2ZWLH 1O2SA 3NCLA 2QXIA 3ELAH 3SNAA 1XVMA 1P04A 5A2MH 4A1XA 5LH8A 4YESB 4AZ2B 1O3EA 1H8HD 1TNLA 1ZHMA 3BTME 2VIWA 7ESTE 3PMHB 1L1JA 2AS9A 1SB1H 2K8IA 4I33A 1LQEA 2ALVA 1ACBE 5I25A 5EJZA 4CR5A 2O8TA 1TQ0B 2R9PA 2BY5X 1O34A 3UFAA 1FQ3A 2CHAB 3GS9A 1DY8A 1D9IA 1QA0A 3LGIA 1S6HA 3BTDE 1KDQA 4YOGA 4HFPB 1SG8B 1VGCC 1Z1IA 2EA3A 2GKVE 4TYDA 3ZVCA 4E7NA 3BEUA 1N8OB 5DG6A 1E1QD 1TBZH 1EP6A 5EG4A 1V2RT 2P59A 1W0ZU 5CMXH 3BTWE 5GCHG 4ASUD 2BVSH 1TGBA 4DCDA 1O3KA 2RG3A 3HPTB 1ZTKA 3TGKE 1ORFA 1OWKA 1UHBA 1OX1A 1C2KA 3TGJE 2HALA 2IN2A 2WPMS 1TA6A 1AMHA 2GD4B 3SJ9A 1XKBC 1PQ8A 4FU9A 1XUHA 5HM9A 1E35B 1Y5BT 5KEDA 5C67A 1DX5M 3R3GB 3SHAH 2ZG0H 1BUIA 1LPKB 1PJPA 2Y5GA 3M7UA 4ZKRU 4ZKSU 4ZROA 3AW0A 1O35A 4KELA 1SI5H 4MG3A 3MI4A 3N7EA 1Z1JA 2Z9LA 1KY9A 2BD5A 1IQGA 2PR3A 4X8UH 2FDAA 3ZYEA 3OAAD 3OEHD 1AVXA 1GVKB 4FUHA 4BANB 5FX6A 4X6PA 1ZYOA 3BN9A 1F5KU 1CQQA 2GTBA 2A32A 3M61U 2G52A 3PWCA 1ELDE 2Z9IA 4FVBA 1EJNA 1MD7A 2D8WA 2QCYA 2A0QB 1ZJDA 1MD8A 3QX5H 1KYNA 3ZZAA 2GMTB 1G32B 3LC3A 2V3MA 4AC9A 4D8NA 2QIQA 1DFPA 4GCHG 2FOEA 5DP3A 5FXLA 1W2KH 2AEIH 1O3CA 2L6OA 3SV6A 1C2JA 1VITF 2QXHA 2BOHB 4CH2B 4FXGH 3F3BA 1BTWA 3R0FA 4FUJA 1FPCH 4NGAH 2AGGX 1GMHF 2IOTA 1QFKH 4X2WA 2BDHA 3F2FA 5JDUB 4JMYA 2TGTA 3DSGA 2NU0E 2A5IA 4K1TA 5DJ7A 4ZHMU 1Z8IB 5GWZA 1BRUP 1EZQA 4O97A 2TRMA 3DSPA 1SGRE 4TY7A 4DY7B 2JKHA 1W3CA 2GZ8A 4GHQA 1CT4E 3QK1A 3SU0A 5C0TA 4ACBA 1XUKA 2KCAA 1W8BH 3ZIAD 1C1UH 1C2MA 3SGQE 3HKJB 1UTLM 2BZAA 1YPHC 5B6OA 5EXMA 1BJUA 4A5TS 1O2WA 1QCPA 4AYVB 3RMNH 3ZZ6A 3GCTF 1ELTA
chains in the Genus database with same CATH topology
3JZ1B 2RA3A 5L2YH 1QQ4A 2OINA 4BTTB 3U98H 1WAYB 3A87A 1NRQH 2H9TH 3RXOA 4B2AA 1OYTH 1MCVA 1SR5C 2YNBA 4ABGA 4AGJA 3E6PH 4I32A 4CRAA 3F6UH 1INCA 3D49H 2QN5T 3L33A 3RXJA 2XCFA 3UWIA 2CF9H 2O8WA 4I8GA 1OWJA 1G30B 3MFJA 3QO6A 1UO6A 5FPTA 4Y79A 2G5VA 4UFGH 1MKXK 1DUEA 1ETTH 4FUCA 3ZZ5A 5EW1H 3UUZA 3PLKA 4WY3A 2XBYA 4TY6A 3F9HA 2K1QA 5F8XA 4RKJB 1P3CA 2AMPA 1MKWK 3DFJA 3OYPA 1NRPH 5HMAA 3C27B 2R3YA 1MZAA 2HWLB 5EXLA 1PPHE 5CHAC 3GY7A 3FAOA 4AFQA 1THRH 4X8TH 1V6DA 4DOQA 1ZMNA 8GCHF 3MTYA 2GT8A 5C5OA 3W95A 1IQEA 4BOHA 1AN1E 1V2TT 1C1PA 4YTAA 1K2I1 3E16B 2ZDVH 2FI4E 3VB7A 2WUCA 2UUYA 3RXRA 3FANA 3PMJA 3RU4T 5GDSH 1P2OA 2TGAA 3OTJE 2H2ZA 1H9IE 2GT7A 1EPTC 1IQHA 2Q6DA 1LPGB 2PTNA 3KF2A 3VXFH 3GY4A 3LC5A 1Q3XA 1O38A 1TGNA 4WXVA 3D62A 4AGKA 1QRWA 3MO3A 1HCGA 1WBGB 3LONA 1TPPA 1SLWB 5L30H 2HLCA 3RXDA 1ZRBA 1ZPBA 2XC5A 2G5NA 2TBSA 2ZFTA 2GZ7A 4ISLA 5LGOA 1ELBA 4H4FA 1TMUH 4FUIA 3ZVDA 2AERH 5EW2H 3GCNA 2P3TB 5AHGH 1GJ4H 1AUJA 1ELAA 1VJ9U 1JRSA 3UQVA 1XUFA 1NFUA 1YYY1 2SGQE 3M7TA 1S0QA 4CRFA 4DIHH 3OU0A 1KXDA 1TGCA 1SGDE 1W10U 1WOFA 3P8NA 4A7IB 1JWTA 2BM2A 2FOFA 1S5SA 3OX7U 4FUEA 1C5PA 2F3CE 2Z3CA 2FXRA 1MTNC 2GZ9A 3P6ZB 2ZI2H 3RM2H 1C5WB 1AWHB 1CO7E 3FP7E 3M3TA 3QZQA 2V35A 2WV5A 1AFEH 4Y7BA 1YPLH 5DK1A 4ZMAH 1C2FA 4OGYA 1LHFH 1AVGH 1ZGIA 1C5QA 1SGTA 4RN6A 1AB9B 1GI1A 1JBUH 3EAJA 1HAZB 1QY6A 3P70B 1GJCB 3TH2H 3PWBA 3ZVFA 1HAPH 1OWIA 1KXFA 1FONA 1L1NA 4IC5A 1TWXB 1EX3A 4F49A 1SGIB 2GCTB 3U8TH 1NRNH 1IHTH 5FCKA 4K8YA 2SGFE 1WQVH 4YM9A 4JYTA 2P8OB 3LT3A 4ISHH 3EA7A 2P93A 1XUIA 1EZSC 2CJIA 2NU4E 2Z94A 1YF4A 3A8CA 1UTMA 1BRAA 2P16A 2WUBA 1C1TA 1AFQB 2ZKSA 4IS5A 3UY9A 1J8AA 1SGNE 1XMNB 2ZDNA 2ANWA 5E0GA 3U69H 4Q7XA 1QJ1B 1RD3B 1O31A 1GCTC 1GHAF 4KTCA 5EGMA 1KLTA 1YPGH 2ZGJA 5SGAE 1HXEH 3P8GA 1CBWC 6CHAC 4JK5A 2Y80A 3GCOA 1Z8GA 1GBIA 4NWLA 1F0RA 2IPHA 1SMFE 2FX4A 1ELCA 2ZNKH 1EAWA 2BY9X 2AFQB 2ANYA 4LZ1H 3BIUH 4PROA 1GJBB 2C8XB 2TGDA 3UOPA 7LPRA 1QL7A 3PB1E 3PMBB 2BDYA 3F9FA 5LPFA 4X6NA 4ISOA 5FBIA 1O5DH 2BX4A 1T8NA 2FX6A 1TB6H 1NFYA 4B74A 3MO9A 3AW1A 1HAXB 1NU7B 3SOSA 1TNJA 3SNEA 1YBWA 1GMDF 2W3IA 1FPHH 5HGGA 5AF9H 4Y6DA 2V6NA 3TIUA 1SSXA 2ZHWH 1B5GH 4CH8B 1ZPCA 2HVXA 1FN8A 1K22H 3RMOH 4CBOA 3I77A 1GBJA 4FUDA 2F91A 3SJIA 1C4U2 1P11E 3GY6A 1P03A 1UCYH 3UOUA 1DXPA 2FOMB 1LVBA 5F03A 4MPWA 1BBRK 3BG8A 1P2MA 3B23B 1EJMA 2STAE 2FYRA 1P12E 1QBNA 2SGEE 1O3MA 3K2UA 1T7CA 1DSUA 3UNQA 1ZMJA 2W7UA 2EI6A 2VGCB 4BAOB 2NU2E 1UTJA 3M5OA 2ZDKA 2B5TB 1RFNA 4WMFA 1AVWA 5IDKA 2OD3B 1C5ZB 2FZZA 3S9BA 4Q2KA 3ZYDA 1GBFA 3A7VA 3TNTA 1UTOA 4X2VA 2EEKA 5JBCS 2BTCE 1GG6C 2AGIX 1EB1H 1AZZA 2ZQ2A 4MQAA 4R0IA 5C1XA 3ATLA 3L3TA 1SQTA 2P95A 4WMDA 3RU4D 5JPMH 4D9QA 4JZ1A 4AG1A 2ZZUH 3T29A 1D3TB 4Y8XA 5GCHF 1C2LA 1LVMA 1YPJH 1O3AA 1ZSLA 2A4OA 1K9OE 1D6RA 7GCHG 3HATH 1TPAE 1KDQB 2OCVB 2ZCHP 3LIWA 4YT6H 2A5AA 1DM4B 3GCHB 1NFXA 5I46H 4FU8A 4GAWA 4Q7YA 1N1LA 2XW9A 1AD8H 4RSPA 2VWLA 4E05H 2V3OH 3E0NB 1Y5AT 3H5CB 1UHBB 4OS2A 1D3QB 4JZIA 3MNBA 1OP8A 3LJOA 1C2IA 4B76A 1IQIA 1T8MA 3OY6U 4BAQB 2HNTC 3ZVAA 3TJVA 1X7AC 3D65E 1QB9A 1DITH 5C5NA 1KTTB 3RXHA 3SNCA 1WSSH 3GYMA 1J15A 1G3CA 2ZHQH 2BZ6H 9ESTA 3SV2H 3V7TA 1J9CH 2ZHFH 1Y59T 1TGSZ 3SW2B 4GCHF 2XWBI 2SFAA 2ODPA 1RTFB 1UMAH 2R0KA 4UDWH 2BX3A 2AMQA 1K1MA 4I8LA 3NXPA 2C4FH 2OC0A 1EQ9A 4THNH 1H9LB 3U1IB 2ZPQA 2QXGA 3A8BA 5T3HA 3RMMH 3A8DA 1TBQH 3SO3A 3UR6A 2CHAC 3SJ8A 3SUFA 1NM6A 1CVWH 2Z9GA 1HRTH 1ANBA 4AX9H 1HLTH 1QTFA 1ZHRA 2ZQ1A 4X1RU 3G01A 1N8OC 1TPOA 4OS5A 1A7SA 4XBBA 4D7FA 2WPHS 1HV7A 1EOLA 1TOCB 1MU6B 1Z6EA 1FY1A 4AFZA 1O2XA 1P2JA 1UK2A 1GHXH 4DGJA 1O2LA 4ZH8A 2BQ6B 5A09A 2CMYA 1T4UH 2XYAA 3MOCA 1QBVH 3M3VA 1C5TA 2PGQB 4IC6A 4U2WA 5ESTE 5HYOA 1IQNA 1A5HA 2UWLA 1DXWA 1BQYA 1F0TA 2ZDMA 4DIIH 1F5LA 2CV3A 5ABWA 2I6QA 3F1SB 2G8TA 1BB0B 1C5YB 4FUFA 2UWPA 4X0WU 1F0SA 1EAIA 1SBWA 3Q3YA 3FP8E 3BTQE 4NIYA 2EI7A 1P02A 2ZU5A 5C3NA 4YLQH 1SOZA 3B8JA 1O2GH 2J4IA 1TNIA 3SJKA 1DICA 3NKKA 5PTPA 2VB0A 3SI3H 1THSH 1LPZB 3P8FA 3TVJB 4YT7H 2R2MB 2GMTC 1YKTA 5F8TA 2Y6TA 1TALA 1GHBG 1UTNA 2FPZA 1XXFA 1DE7H 4AB9A 3MH7A 1QA7A 1YPKH 3SORA 1SGEE 1BITA 2AIQA 1LVYA 2JH0D 1TX6A 1H4WA 1HYLA 2W26A 1GBEA 3RXBA 1NZQH 1C1MA 1RXPA 4ZUHA 1SHHB 1BOQA 1B7XB 1MUEB 3SU6A 4NCYA 1C1NA 2BDBA 2UWOA 1A0HB 2VVUA 4NA9H 1WU1A 1NY22 1RS0A 2PW8H 4UEHH 2FIRH 1GHWH 1XM1A 4ISIH 1Y3XA 2Q1JA 1S6FA 2BLVA 2ZTZA 1MZDA 1GBDA 4WXIA 1LKAA 4K1EA 4QT8C 1GBCA 1O3OA 1HAVA 1GJAB 4D9RA 1P09A 2BQWB 5AFZH 3RXKA 1OS8A 2D2DA 4HTCH 2FS8A 2SGAA 1G36A 2PGBB 3QDZB 4DG4A 4ZKOU 1UVTH 4LOYH 1HXFH 3M35A 1NT1A 3Q00A 3TLOA 1HJAB 1G3DA 1S82A 1YPMH 1O2ZA 1O3HA 1RJXB 2D26C 1ANDA 3B9FH 4XBCA 1QBOA 3MMGA 3I78A 4GPGA 1H8DH 2BXTH 2ZF0H 2OLGA 3ZZ3A 1SLUB 1WTGH 1CGJE 3E91A 1QNJA 2BB4A 4VGCB 2BY7X 3CS0A 1OOKB 2ZC9H 1O37A 3DHKH 1WCZA 4FUGA 3GY3A 2C8YB 1HGTH 4RKOB 4OS4A 3LU9B 1OXGA 1CE5A 4SGBE 2WV4A 1KIGH 2ZA5A 1QB6A 4CHAC 3RXEA 1O5GH 1O5CB 3PM3A 3ATWA 1KXCA 2SNWA 3BTGE 2ZO3H 1MU8B 1O3FA 1YCPK 2PLXA 1JXPA 2QGRA 1O3NA 1SLXB 1BRCE 1ABIH 2BD9A 2QA9E 1C4V2 3MHWU 1NRRH 4IN1A 2C8WB 4H42U 6ESTA 3A88A 3OY5U 5EPYA 1FDPA 2Q6FA 3W94A 3F9EA 2ANMH 3RP2A 1SPJA 5JB9S 2UUJB 2ZGHA 2HPPH 3MNCA 3TH3H 2O9QA 2BHGA 5K7RA 3KN2A 4O3TA 4U30A 2D1JA 1C5VA 1TYNA 1T32A 2ZU4A 1TLDA 3Q77A 3A7XA 4Y0YE 1LKBA 2WPLS 3TK9A 3U8RH 2A5KA 2ILNA 1HJ9A 2GV7A 1SGFG 3SU4A 5G4BA 2P94A 4LK4A 1SGQE 3MH4A 1P9SA 3D23A 7KMEH 2NU3E 1EASA 1BBRE 3KQBA 1F7ZA 1O3GA 5E8EH 3PO1C 1HAHH 5T6FA 1PQ7A 3T27A 3UNRA 5C20A 4NA8A 3P8OA 2DE9A 2ZIQH 2M5TA 1BHXF 2V3HH 3S7KB 1GDUA 1N6XA 4BTUB 5BRRE 2FLBH 4KGAA 4BXSA 1S84A 3VGCC 1IOEA 1TGTA 2AGEX 1T8OA 4CRDA 3KL6A 3MH6A 2BD7A 4Y76A 4HGCA 3LDXH 4WMEA 2FOGA 2ZCLP 3ZVGA 2PKSC 2WPJS 1G3EA 3A7YA 5LPEA 4GSOA 1V2NT 1BCUH 2STBE 2CXVA 6GCHG 1SQAA 1AO5A 3N7OA 3QTVH 4Z6AH 2W3KA 1MTSA 1CA8B 1FNIA 3FFGA 1FJSA 1AB9C 1MKWH 4K2YA 4DURA 1CU1A 1A5IA 1F2SE 1NTPA 1ZOMA 1GHVH 3SI4H 3VB6A 1V2VT 1P2IA 2F9PA 1MAYA 3KHVA 3GISB 1QURH 3GDUA 2F83A 1C2GA 5DO4H 1CA0B 1QL9A 1TFXA 1UVPA 4AORA 1EP5A 5JBAS 1O5BB 5DGJA 5EXNA 5LPRA 3VFEA 2C8ZB 4O9VA 2GVFA 1GI0A 2SNVA 3S7HB 1F0UA 4KP0A 1TAWA 5BPEA 2CF8H 2WPKS 3BG4B 4B1TA 1J16A 1GGDB 1OP2A 2PSXA 4GVUA 5JB8S 1UK4A 4ZAEA 4MNYA 1IQKA 1PPGE 1P8VC 2XXLA 2Y5HA 2A7JA 1QGFA 1GVLA 3RLYH 1VCPA 5T6GA 1KTSB 3PTNA 2OXSA 1A2CH 1YP9A 3V13A 4YOIA 1WTHD 1DLKB 1FZZA 1FIWA 1OWEA 2XC0A 3RC4A 1HPGA 1YM0A 1G2LA 3MU0A 4NZLA 1O2TA 5GJ4B 4K60A 3DA9B 1P3EA 1K1JA 1EPTB 1OYQA 2FOAA 1OWHA 5DP7A 1S85A 4X1QU 5FPYA 4HI3A 2LNCA 1ZGVA 3RXGA 2DE8A 2ZPSA 1O2RA 1OWDA 1LHDH 3A7TA 1EXFA 1TOMH 4CRGA 1MTWA 1EUFA 2NWNA 1MTUA 1P10A 1GI9B 1L2EA 2PFEA 1TNGA 2VH6A 3KNXA 4K1SA 2F9UA 4CRBA 7GCHF 2GX4A 2VNTA 2Z9JA 4GLYA 4F4OC 1XUJA 1K21H 2VH0A 1WUNH 2ZU2A 4X8VH 5TCAA 8ESTE 1CHGA 2AIPA 3LGTA 1GBKA 3QN7A 3UTUH 4OS6A 5TCCA 3H7TA 3T26A 3TJOA 1C1VH 4B73A 5EU8A 4JYVH 3M37A 1HDTH 1NU9A 4UFEH 4AN7A 1O36A 2OQ5A 4XSKU 3UREA 4MLFB 3SNDA 3DD2H 4CRCA 5HXFA 1JMOH 4UE7H 3MYWA 1MTNB 3PLBA 3STJA 2BDCA 5EOKA 4WH6A 1GJ8B 1ZPZA 3RXPA 2VVCA 3E90B 5DKMA 3TNSA 4X6OA 5F6MA 1CHOG 2HGTH 1W0YH 1TNHA 3BTFE 3SQEE 1SGPE 2B0FA 1XKAC 1P9UA 2NU1E 5L2ZH 1J14A 1O2MA 1SFIA 1SGFA 2VGCC 4I8HA 3TU7H 2ZFSA 1QB1A 3LH1A 3VPKA 1SQOA 3SUEA 1V2PT 2GGVB 1C5XB 1RTKA 1AHTH 2QF3A 2A1DB 1XUGA 1GPZA 1C2DA 4Y71A 3VEQB 5IYTA 1O5AB 1VITH 2G55A 3ZZDA 2EC9H 1GDNA 2BLQA 1RRKA 2QC2A 5EPNA 4Q7ZA 4Q80A 3RMLH 1O2NA 3JZ2B 3HK3B 4M7GA 4NIWA 3T62A 4MPUA 4INLA 1GHYH 3M7QA 1HBTH 1T31A 3QGJA 5EODA 2BDAA 5E0HA 2ZTYA 1BHXB 1C9TA 2PV9B 4B2BA 1BTHH 1GCTB 1E37B 1ELGA 1EPTA 2XBWA 1BMLA 2C3SA 3SZNA 1CBWB 6CHAB 1RGQA 2A4QA 1NESE 5E2OA 2ALPA 2A7HA 3VB5A 4A6LA 1ZSJA 1FLEE 3O8DA 3LGUA 1GBTA 2BMGB 1J17T 2AYWA 2RDLA 3E3TA 1M9UA 1YGCH 3SU2A 4WWYA 3PV4A 1MQ6A 1ELEE 2A2QH 1PPCE 1O3PB 1NPMA 3UNSA 4Y8YA 1A4WH 2ZU1A 4KTUA 3U8OH 2B7DH 1O2YA 1P2NA 5HM2A 1V2OT 4A1TA 1T4VH 1V2ST 1GHBF 3ITIA 1V2JT 2A45B 1B0EA 1AUTC 2QYIA 1BBRH 1BMAA 2ZFPH 1GDQA 1DWCH 1FY3A 3ZV9A 2WINI 4DJZB 1C1QA