4AG2A

Human chymase - fynomer complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
226
structure length
223
Chain Sequence
IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/de novo protein
molecule keywords CHYMASE
publication title Generation, Characterization and Structural Data of Chymase Binding Proteins Based on the Human Fyn Kinase SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 223
sequence length 226
chains with identical sequence B
ec nomenclature ec 3.4.21.39: Chymase.
pdb deposition date 2012-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ag2A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ag2A02
1AZ8A 2Z9LA 5HXFA 1A5IA 2TRMA 1TX7A 1CO7E 1DLKB 1HXFH 2ZA5A 5FAHA 2NU2E 2OC0A 3TH3H 3SU5A 4FUGA 1B0FA 2EI6A 1ABIH 2BZ6H 4GCHG 4K1EA 3ZZ8A 4U01A 2GD4B 2RA3A 1K21H 1C2HA 5GXPA 1V2PT 2J94A 1M9UA 4E7NA 2PGQB 1HAOH 2FDAA 1HPGA 1GMHG 3VGCC 2A7CA 1O2KA 2FOMB 4X1RU 4WJG2 3A8BA 1CA0C 1DICA 4B73A 1J17T 4DT7B 2ZGJA 4KTSA 1QBVH 3QDZB 1XKBC 3HPTB 1V2VT 2ZU5A 3MH7A 4Y6DA 1MH0A 4CBNA 1EP5A 3MNXA 4O3UA 5GPIB 1VCQA 1ZMNA 4R8TB 2BD5A 2WV5A 4DCDA 2VH6A 3NXPA 2GGVB 2Q6GA 1SPJA 3VEQB 1GMDG 1SFIA 1UTJA 5E2OA 1K1OA 4DVAU 2BD2A 1O2OA 2QN5T 1GHBF 1HLTH 1S5SA 1ZYOA 3NKKA 3M7TA 1FQ3A 1O2QA 1KDQA 2O8MA 1ID5H 4FU7A 3BTFE 1BBRE 2Y7ZA 1P05A 4NG9H 1ZOMA 2RDLA 1C9PA 1GCTC 4ISIH 3RXTA 1GJ5H 2BLQA 3SW2B 2BZAA 4TPIZ 3T2NA 3EYDA 1ETRH 4Y7BA 2ZFQH 1ANBA 1G37A 1UVUH 2VU8E 3U8TH 1HB0B 2QXHA 1SGEE 3NWUA 2CMYA 4X0WU 4X8SH 1TNKA 1BCUH 1BTPA 4I7YH 2VJ1A 2GV7A 2HNTC 1TPOA 3TPIZ 3A81A 1GI0A 3AW1A 3T62A 1P09A 1EP6A 3KF2A 4FXGH 1BRAA 1QA0A 2WUBA 4A5TS 2VGCC 2GTBA 2I6QA 2BD9A 1A1RA 4MNVA 2ZHWH 1BMNH 1QQ4A 2J4IA 3A8CA 3FAOA 3HK3B 4YLUA 1O2ZA 3KL6A 4FUCA 1SG8B 3GY7A 4ZXXH 3SN8A 1V6DA 4D7FA 2BLVA 1HJ9A 1YCPM 2H6MA 2A45B 4BOHA 4TYDA 1EZXC 2Y82A 1YF4A 3A7YA 2ZHFH 4FUDA 2PSXA 1JRSA 1PQ7A 5LGOA 3KQBA 3OSYA 4X2XA 1GGDC 1ORFA 3RLYH 3P8GA 1SQAA 1HYLA 1QIXB 2FS8A 4AORA 2V35A 2C8XB 3MYWA 5JBTA 2C8WB 2GCHG 2A4OA 2P8OB 1HJ8A 1P57B 1PPFE 1TRMA 2XC4A 3E8LA 1DWBH 1RTLA 1GI3A 2W7UA 1F0RA 2XRCA 7LPRA 1G3BA 1W2KH 1GI7B 1D3TB 1FY5A 4CH8B 2CF8H 1K28D 2EC9H 2R2MB 1L1JA 2FPZA 3EGKH 1AWHB 2ZGCA 3RXCA 1O3EA 3VB7A 3GY8A 1GBCA 5C1YA 2NU4E 2O8TA 1VGCC 5L2ZH 2B8OH 4FVDA 1FXYA 3JZ2B 1W11U 1XUHA 3QGNB 1DITH 1C9TA 1GVLA 3SGQE 2P93A 3G01A 2ZFSA 1GJCB 1YP9A 2GT7A 2H9EH 4MPUA 1E36B 1LCYA 4OGYA 3RMLH 4LZ4B 1OP8A 1TOMH 4A6LA 1NM6A 3KQEA 5GJ4B 2A1DB 3A88A 2AIPA 1BTWA 1JIRA 1O2PA 1JRTA 1DY9A 3PLKA 4Q7YA 2WUCA 1Y5AT 2PKSC 1CGIE 1BMLA 1D4PB 1JBUH 1KY9A 3IG6B 4CHAC 3ZVAA 1T32A 4OS6A 1TMUH 4ZHAA 4ISHH 1C5XB 2ODPA 4U30A 5T6DA 1O30A 1UO6A 1OWKA 3MO9A 1XVOA 3ZVDA 4CR9A 3DFLA 3E0NB 1T8OA 1F92A 4YO9A 2FI3E 4CRGA 1QL7A 3TVJB 1DWDH 3BTEE 1UK3A 5DP7A 4I8KA 1KXDA 3SUGA 3U98H 4Z0KA 2PKAB 4K69A 1A2CH 1NRPH 3MU5A 3ZZ5A 1IQHA 1Z8IB 5EPNA 1ZSJA 1CSOE 1C1TA 1SGFG 1TFXA 1F0TA 3SJ9A 3MTYA 1C5QA 4BXSA 2A7HA 2PGBB 1C1VH 2AERH 1RIWB 3TIUA 5A8YA 1P02A 2ZFFH 3MHWU 4Q7ZA 3BF6H 4JMYA 3RXPA 3QTOH 2G55A 4ZKOU 2RA0A 3RUOA 1PFXC 3VXEH 5B6OA 1QB6A 1MBMA 1NO9H 4XBCA 4DG4A 3MFJA 1VZQH 4WVPE 1AO5A 2ZDVH 3SU4A 1CHOG 3I77A 1BTUA 4WMEA 2FODA 4A1XA 1QGFA 3FP7E 1Z6EA 3RXIA 1H1BA 1FLEE 1VITH 1MBQA 3CS0A 1S6HA 1ARCA 2SNWA 2J2UA 1P2OA 1DWEH 2IJOB 2PTCE 3AW0A 3U9AH 3RXJA 1W13U 1A46H 1GBJA 3MH6A 2ILNA 3MU0A 3ZZ7A 2XC0A 1LTOA 2VIWA 3TGJE 1DT2A 1P9SA 4HTCH 1TNLA 1TGNA 1Y59T 2ZNKH 4IC5A 5AFZH 3RXMA 1G3EA 1W7XH 1HAYB 1UVSH 1DXPA 1BTZA 4E06H 2C4FH 4GAWA 1HFDA 1BTXA 1UTKA 4FVBA 5AF9H 3SJIA 2R0KA 4I8HA 3BG8A 2Z3CA 2Z9IA 1E37B 1O3PB 1O2TA 3RLWH 3U1JB 2XW9A 5A0BA 3BIUH 3UNSA 2ZDKA 5EOKA 4GHTA 2FYQA 3LGTA 3PWBA 1O2XA 5DO4H 1MKXH 3TK9A 1O38A 1BQYA 4ZROA 3A82A 2BXTH 1TAWA 1Z7KA 1EX3A 2G8TA 1HXEH 3KCGH 1O35A 2SGEE 1ZGVA 1G30B 1SGQE 3R0FA 4R0IA 4Y11E 1RFNA 2C8ZB 1SGCA 1NN6A 2PUXB 4X6PA 2AEIH 3UQOA 4O3TA 3LGYA 2FEQH 1DSUA 1EPTB 1GI8B 3SO3A 1E34B 2BXUH 2A31A 2ZDMA 1O3OA 1HJAB 3ATWA 3RXOA 1KSNA 3GCHB 1HNEE 4CREA 4X1SU 1H9LB 1AVXA 3QLPH 1CBWB 1V2JT 1F7ZA 4AFUA 1SLXB 3FVFB 4FUJA 1K1PA 5GWZA 5FPYA 4HGCA 1CGHA 1A0LA 5J4SA 4DOQA 1FPHH 1UK4A 5E0HA 1GHAG 2XNIA 2ZGXH 3UR9A 1LQEA 3MNCA 2FLBH 3QUMP 4IBLH 2HNTE 3P70B 5TCCA 1O2LA 1NFXA 3NUMA 1Q2WA 4JCNA 4WH6A 1QRZA 1SLVB 4NA8A 2D1JA 2BDYA 3LGUA 1MKWH 2PSYA 2ZF0H 2ZIQH 3SI3H 1UTPA 2THFB 1WBGB 2EI7A 1C1RA 1PPGE 2B7DH 1D3DB 1HBTH 1XVMA 4JYVH 1INCA 2G51A 2TBSA 4ZKRU 1W0YH 3V3MA 3SNAA 3AAVA 4CRFA 4B1TA 1SOZA 4UONA 4XSKU 2Y5HA 1YPMH 2W7SA 1CGJE 2OUAA 2OQUA 1WUNH 3E90B 1A61H 4DIHH 5A0AE 2FOEA 3VB6A 1DWCH 1DX5M 2A2QH 1MTVA 3MU4A 1NROH 3F9HA 3RC4A 5DP5A 2P94A 1MD7A 2NU3E 1LMWB 3D49H 4KP0A 3RXSA 2ZZUH 1ELAA 5JB9S 5TCAA 3SJKA 5DP4A 4Q7XA 1C1QA 3RU4T 1GBLA 2ZI2H 1NRNH 2YOLA 3E3TA 1A0JA 4IC6A 4AX9H 1LPZB 1OXGA 2FM2A 1AB9C 1PPZA 4J1YA 1E38B 1GL0E 2W3KA 3BTDE 1TB6H 2ZQ1A 1C2EA 1AZZA 1Z1JA 1DOJA 5CHAB 5LPEA 5ESBA 1O3KA 2C8YB 2R0LA 2OBOA 5L6NH 2BVRH 1P06A 2JKHA 4YM9A 2P16A 1V2QT 3UREA 3I29A 4B71A 2ZTXA 1O32A 1CT4E 4PROA 4THNH 1ABJH 3RC5A 1FDPA 5EQSA 1SGPE 2ZKSA 3LT3A 5GIBA 4B76A 5C67A 2XBYA 2BLOA 1P0SH 1XX9A 1GI4A 2Y5FA 3A87A 3UY9A 3ZZ9A 1FJSA 2C93B 1BRBE 1C5NH 3T25A 4I32A 1X7AC 1J9CH 3MU1A 3RXUA 3UNRA 3V7TA 2F9OA 2OCVB 3BTQE 5GCHG 3SNDA 4OS5A 1QHRB 1BIOA 1MKXK 1EB2A 2SGQE 1H9IE 2W3IA 1F0UA 1GHBG 4IMZA 5T6GA 2XBVA 5HM2A 3TGIE 1GWAA 1J14A 4AZ2B 3GCOA 1ELCA 2BDIA 4NGAH 4A7IB 1RGQA 1GBTA 3PO1C 1FAKH 2FI5E 3Q3KA 1P2MA 2BDHA 1XXDA 1C5UA 1G2MA 3V13A 2Z3EA 3T29A 1ZSKA 1QB1A 1GJ6A 1EXFA 4IS5A 2F9BH 3PWCA 1NESE 3FP8E 1IQMA 4O97A 1UVTH 2FX4A 1WQVH 1GHVH 4JK5A 1GBEA 2FOCA 3Q00A 2VVUA 1NRQH 3SU2A 1N8OC 1TPSA 6CHAC 4AB9A 4AGJA 2A7JA 1YYY1 2GKVE 4OS2A 2BHGA 1MCVA 1BHXF 1Q3XA 1KLIH 2CHAC 1JIMA 3RMNH 3RXDA 2FTLE 4D9QA 1GI2A 1CA0B 4AYVB 6GCHF 1FY4A 4IN2A 1O36A 2BY9X 5F6MA 2ZU1A 5EQQA 3RXEA 4AG2A 3U69H 1HAZB 4I33A 1FV9A 4FU8A 4X6NA 4NCYA 1DSTA 2QCYA 1GJBB 3LDXH 5BPEA 2QGRA 1YPLH 1EAXA 1FY1A 5EQRA 4ABBA 1C2LA 1C5VA 1TIOA 2DE8A 2FLRH 1P10A 1DXWA 4X8TH 1C1NA 3LH3A 4F4OC 1GBAA 2ZHQH 4UFDH 1PQ5A 1SI5H 5K0HA 4FUFA 1LHGH 3V12A 1BRCE 1MU6B 2VIVA 3SORA 2BQ6B 1SQOA 3BTTE 1LVBA 1AWFH 3MH4A 4I8GA 1S83A 1HAGE 3A7VA 1GCTB 4YT6H 1FY8E 1PPHE 2ANYA 1W14U 1UHBB 2OLGA 1DS2E 3PROA 5JYIA 1KYNA 2BVSH 2ZECA 4YESB 1LPGB 2STAE 4ZUHA 1O34A 1ZRBA 1NRSH 1THRH 3BEUA 1QJ1B 4XE4A 5DP3A 1GVZA 1MU8B 3S7KB 2AMDA 2GCTC 3ZV8A 1BITA 2K1QA 1LO6A 5TJXA 1TX8A 2BY6X 3M5LA 1G9IE 1NZQH 3S0NA 2FO9A 4GPGA 3HK6B 4Y8YA 1BMMH 2ZEBA 4WMFA 1O5BB 5E0JA 1BMAA 1FNIA 2BDAA 2VGCB 4ABIA 1C1PA 1YPHE 2ZCLP 1J15A 2XWBI 3OTJE 2P3FH 3LJJA 1FI8A 1UCYH 2P3TB 4XDEA 1PQAA 1IOEA 4NZLA 1SGNE 1TGSZ 1QBNA 1CT0E 2PW8H 1EZQA 1CE5A 1RTKA 1SBWA 2SGFE 3SHCH 1O2MA 4RKOB 1YPKH 1GPZA 1AMHA 4YOIA 1IQLA 4K60A 4ZHLU 3MU8A 1OYQA 1OKXA 4K1TA 2TGTA 4H6SB 2V6NA 1W3CA 3LC3A 1GGDB 1Y5BT 4HI3A 4D76A 2Z94A 2ZCHP 4NSYA 4UFEH 1LQDB 2PUQH 5F03A 2QY0B 9LPRA 1C2DA 3ZZ3A 3W94A 3M5MA 1AKSB 4FU9A 3OX7U 4HFPB 2HALA 4H4FA 3N7OA 1HUTH 2FYRA 2AH4X 1E35B 1SSXA 2Z6BD 3SV9A 5DP8A 3A7TA 1O0DH 2G52A 1LHEH 2VB0A 1G3DA 4OS4A 1ELVA 3O8DA 3BEIB 3UOUA 2H1UA 3SHAH 1D6RA 1H4WA 1C5WB 3R3GB 1P3CA 3H5CB 1EQ9A 4B2BA 1VGCB 1K1LA 2IN2A 1O2GH 3HKJB 1HGTH 3UFAA 1A4WH 1P2IA 3A7XA 2ZC9H 1T8NA 2WPKS 4X1PU 5DG6A 5FCRA 4AFZA 2HWLB 2PTNA 1MAYA 4DJZB 1K2I1 4I8LA 4NFEA 1UHBA 3F6UH 1WV7H 4RN6A 4ASHA 3MO6A 4A1TA 1KXEA 1LPKB 2BM2A 3KQCA 1BJVA 3GDUA 3GOVB 4U2WA 2BVXH 3M5OA 3TNTA 1QCPA 3UWIA 2Q6FA 3GCTG 1NS3A 2PKSB 3SUFA 2G5VA 5CMXH 3RXGA 1FY3A 4CHAB 1O2YA 1OWHA 2BY5X 1W10U 4GCHF 3A8DA 1OS8A 2ULLA 3HGPA 1GI9B 3CENA 4MNYA 1UVPA 1GMHF 1TOCB 2WPIS 1XXFA 2UUYA 1QY6A 4AGKA 3FP6E 4GHQA 1GG6C 1TE0A 3RDZA 1C4U2 1S84A 2AS9A 1ZHRA 1VJ9U 3GY4A 2UWLA 3ATMA 1HDTH 1LVYA 1ZGIA 1GMDF 1GMCG 1TMBH 1ZSLA 3BG4C 2BMGB 4B2CA 2H5CA 1DFPA 3PTNA 3SV6A 1SMFE 3RXFA 2GX4A 1IQIA 1BUIA 2O8WA 3E0PB 5JBCS 2GDDA 2UUJB 1QURH 1AKSA 2P8OC 1WYKA 7ESTE 2BDBA 1OP2A 4IN1A 2BY7X 1P12E 3LJOA 1P2QA 1O5DH 1THPB 1YLDA 1Y3VA 1DUAA 5DP6A 3T26A 4TWWA 1UCYK 1O31A 3BTGE 3BSQA 1DANH 2FXRA 3P92A 3TITA 2BD4A 1GHXH 1ZMJA 1RRKA 5JPMH 5EW2H 4Q80A 1SGTA 5FCKA 1QR3E 4SGBE 1TNIA 3SV8A 5EPYA 2HRVA 4OS1A 2HLCA 1L2EA 4SGAE 3K9XB 1MTNC 2J38A 1TWXB 4NIWA 1TGCA 1H9HE 4OS7A 2FX6A 1PPEE 1Z1IA 3BN9A 2ZU2A 4UE7H 1GJ8B 3LKWA 4INLA 1YCPH 1WTHD 3C1KA 2FS9A 2R9PA 2QC2A 5EXMA 2ZPSA 4ABDA 1A0HB 5HM9A 1NC6A 4H42U 3M61U 3F9EA 1ZMLA 3M3TA 2ESTE 1TNJA 3ATIA 1NTPA 2BDGA 2H9HA 1SGFA 4UD9H 4WMDA 2CF9H 1VITG 2FP7B 1F5RA 2FOHA 2GCHF 1SLUB 2EI8A 1B5GH 3F9GA 2JH5D 3SJ8A 4FUBA 1ELGA 2YNBA 2GMTC 4DURA 1VCWA 4WWYA 1P2NA 1TONA 1K1NA 1QB9A 3PMJA 3TK5A 4AFSA 1GBMA 1GJAB 1L4ZA 9ESTA 2G81E 4UFFH 3M7UA 2VWMA 3SU3A 1V2NT 2OBQA 2STBE 1VJAU 1HIAB 1UTNA 4IW4E 3DD2H 2JETC 4MPXA 1T31A 1ACBE 2C90B 1V3XA 5FX5A 4ABJA 1TALA 1GI5A 3UUZA 3EA7A 2F83A 3SV7A 4JZIA 5C20A 1O2VA 1T4UH 3RXKA 1AHTH 1WOFA 4WXIA 1FPCH 2ZPRA 3RXRA 5FPTA 4Y71A 1KLTA 2BOKA 1UCYE 1D6WA 2SFAA 1JOUB 4M7GA 3EA8A 5HMAA 3UOPA 2B0FA 3A7WA 1L0ZA 4NIXA 3QK1A 1C1OA 2H5DA 1ZJKA 1ZHMA 3P95A 1C2JA 3STIA 2V0BA 2PKAA 2VIOA 4Z6AH 1DM4B 3VXFH 1MCTA 1ELEE 3PLPA 1SGRE 1GJ4H 3I78A 5GDSH 5FHTA 2H9TH 1SLWB 3SQHE 1BDAA 3NCLA 1BT7A 2A5AA 3A83A 3GICB 7GCHG 4K8YA 3GY5A 3PM3A 4Y10E 5C5NA 4A92A 1D3QB 4ABEA 1IQFA 1D3PB 1ZRKA 1UTMA 2VVVA 5JBBS 1HAXB 1O2SA 2OC8A 3EDXB 3F68H 3IITA 3DT0H 3WY8A 2A4GA 2Z3DA 3BTHE 3L33A 5EODA 5A2MH 1O5GH 4O9VA 1PQ8A 1YPEH 3LIWA 3PV4A 1O3CA 1C5YB 4MTBA 1EAWA 3D62A 2BX3A 1OPHB 4WXVA 2H2ZA 2ASUB 1AB9B 1OOKB 6ESTA 1ELBA 2CXVA 1QL9A 2XCFA 2WPLS 2AGEX 3O8BA 5E0GA 1AFQC 5DK1A 5A09A 1K22H 1HV7A 1CHOF 2NU1E 3ZV9A 3UQVA 1P2KA 1TGBA 1EJNA 5T6FA 1JWTA 2P95A 2ZHEH 3MNBA 1AD8H 2PWXA 3RXAA 2SGPE 4B75A 2TGDA 2VWOA 6GCHG 1C5PA 1TQ7B 1TRNA 4ISOA 4DIIH 4O03A 2EA3A 1AE5A 1HIAA 1YCPK 2VVCA 3A89A 3ATLA 1CBWC 2HOBA 5EXNA 2BY8X 1XUGA 1SB1H 2XBXA 3D23A 2ANWA 2F9NA 2ZQ2A 5DPAA 1ANDA 3GDVA 3TLOA 3P8NA 1AUTC 1NY22 2BLWA 4TY6A 3UIRA 4Y79A 3ZZBA 1UTQA 3ENSB 1OWEA 3K6ZA 4Y7AA 1C5ZB 1S85A 3EQ0H 5FXLA 2BD7A 1S0QA 2WV4A 1T4VH 1P11E 4Y76A 1IHTH 1C5LH 2ZGBH 6LPRA 1OP0A 3EE0B 3ODFA 3A8AA 1AIXH 4KELA 2ZP0H 5LH8A 1SGDE 4OGXA 2WINI 4GUXA 4ABAA 1HAPH 3ZVEA 4BAHB 1EPTA 4KTCA 3QZQA 2BYAX 4I31A 4CH2B 4Q2KA 2XYAA 3D65E 1G2LA 1J16A 3TNSA 2RCEA 1MUEB 3RXHA 1NU7B 1BB0B 2OQ5A 3S9BA 4MNXA 3L6PA 1BJUA 1JMOH 2FESH 2HVXA 1O2JA 1P2JA 1W12U 1N8OB 3OY6U 4MLFB 6CHAB 1ZR0A 1THSH 3AAUA 3TJOA 4ZH8A 1XUJA 1U6QA 2OTVA 1XUKA 3Q76A 1O2RA 1T7CA 1G32B 2QXIA 2CHAB 1V2MT 1Z71A 3L3TA 2AYWA 3M3SA 4NFFA 1DDJA 5ABWA 1K9OE 3T28A 2Y80A 1P03A 3TJNA 2VH0A 2VIQA 3SBKA 4LXBH 2PHBA 1Z8RA 2SNVA 1YKTA 1Z8JB 1KLJH 2J9NA 3QX5H 2FI4E 1ELFA 1V2ST 5A8ZA 1P01A 3KGPA 2R3YA 1QJ7B 4LK4A 3F9FA 1AQ7A 1EAIA 3S69A 1V2WT 4D9RA 1KIGH 4KTUA 3GDSA 2Y6TA 4NIVA 5L30H 2D8WA 4FUHA 3RXQA 2ZCKP 1IQKA 1DVAH 3DHKH 5E8EH 1O37A 3RXVA 2UUKB 1GBHA 1MZAA 1AFEH 1H8DH 1C1UH 5AHGH 3QO6A 1G36A 1EB1H 3K2UA 5EG4A 1FUJA 2QF3A 2TGAA 2XTTB 1SGIB 3VGCB 1W8BH 1C2IA 1EZUC 4MNWA 2QXJA 4X8UH 4AG1A 1XMNB 1YC0A 2P59A 1QJ6B 3U8OH 1MKWK 3A85A 1A5HA 2ZFRH 5C2ZA 3BTME 4AFQA 1V2OT 1ZLRA 5LPFA 3LGIA 1GDQA 2VIDA 2KAIB 1GJDB 3M35A 3TJVA 7KMEH 1GBKA 1K1MA 5ETXA 2ZFTA 1RS0A 2XC5A 3GCNA 3QN7A 2R3UA 4BTUB 1SFQB 1O3BA 4VGCC 2C3SA 1IQJA 2WPMS 2Z9KA 1K1JA 3TH4H 1GBIA 2A4RA 3MNSA 4XOJA 1W0ZU 4FUEA 1H8IH 1EOJA 5A8XA 1PYTC 1KTTB 3SUEA 3ZVGA 3ZYDA 3OYPA 5HYOA 3EAJA 4AB8A 1TYNA 2WYJA 2ZGHA 4K5ZA 1C5MD 1OWJA 3W95A 1BTYA 1S82A 1ZJDA 5FBEA 1O5AB 2CJIA 4BANB 3BTWE 1QQUA 2ANKH 1GI6A 3BTKE 3PYHA 3TU7H 1TX6A 4CRBA 8LPRA 2BD8A 2PLXA 1LVOA 2QA9E 2ZG0H 3MH5A 3T5FH 3VFEA 1AUJA 1C1SA 2P3UB 1PPCE 1YBWA 3NPSA 3PMHB 1F0SA 1V2TT 2Z9GA 1GJ7B 1GI1A 5JBAS 5E2PA 5EXLA 3S7HB 2F3CE 4INKA 5DP9A 1GBDA 1KXBA 4HZHA 4A1VA 2VWNA 4NZQA 3CP7A 2ALPA 1IQNA 5CE1A 5GCHF 2IPHA 3ELAH 3H7TA 2Z7FE 3PLBA 1S81A 3M36A 3URDA 4X6MA 1GHYH 1QL8A 1YPJH 1F5KU 4NA7A 1V2KT 2A5IA 1YM0A 1C5OH 1QTFA 1EJMA 3GYMA 1QRWA 1C5RA 3MMGA 3AVZA 1O3IA 3UPEA 1J8AA 3OU0A 5AVDA 4BNRA 2BTCE 1ELDE 3P8FA 2FOGA 3SNBA 2BDCA 5HGGA 3SU1A 1DLEA 4QT8C 1MTUA 3ZZCA 1O3NA 1BA8B 2GP9B 1ELTA 4JZEH 8GCHF 5IDKA 3A7ZA 5A0CA 1A3EH 4DY7B 1P3EA 1QNJA 4ABFA 1LKAA 4YTAA 4YZUA 2F9VA 2BQ7B 4AYYB 1O3FA 1UTLM 2SGDE 1BOQA 2FOAA 3RU4E 4NSVA 4TPYA 2ZU3A 1N6XA 2KAIA 1C1MA 2ZPQA 5J4QA 1V2RT 1O2IA 2XXLA 4CRAA 1XM1A 2A5KA 4MDSA 3SZNA 1SHYA 3AASA 1NFYA 3P8OA 2VIPA 4X6OA 2WPJS 2CV3A 1GG6B 1LDTT 5C1XA 4UFGH 2EEKA 3Q3YA 1S6FA 1LKBA 4BAQB 3MOCA 3RM2H 4ZMAH 2GZ7A 3Q3XA 2G4UA 1C1WH 1TBZH 1TNGA 4JYTA 1Z6JH 2A4QA 5L2YH 1EAUA 2ZDAH 4LOYH 3H7OA 1FZZA 3B8JA 3DUXH 1XUIA 1Y3UA 3BG4B 5ESTE 3SV2H 3ZZAA 1UMAH 2BD3A 3STJA 3MI4A 1IAUA 3PB1E 4XBDA 1O2HA 4MPWA 4BXWA 3NK8A 1HRTH 1O3DA 1QRXA 2UUFB 1CHGA 4I8JA 3EA9A 3HGNA 2CGAA 4D8NA 2GV6A 3S9AA 1NPMA 2FZZA 2Z9JA 4ZKNU 1E0FD 1EJAA 2OD3B 1IHSH 1TBQH 1Y8TA 3NZIA 3U8RH 3P17H 2AMPA 1O3MA 4DGJA 1UK2A 2B5TB 3MWIU 5BRRE 4BTTB 3LGWA 1SOTA 1OX1A 5DGJA 3VB4A 4CRDA 1MTWA 1PJPA 3RXLA 1D9IA 1XUFA 1WTGH 1ZTKA 1C4V2 3ZYEA 2LNCA 2XCNA 1O3JA 1MTNB 1Y3WA 3SU6A 4NIYA 2ZDLA 1V2LT 2J92A 4MQAA 2OXSA 1VR1H 2QV1A 3KHVA 4IGDA 4ZHMU 2AFQB 2OC7A 1O2WA 2B9LA 4Y0YE 1KXCA 2D26C 3FFGA 5AFYH 1K1IA 1KXFA 4Y8XA 1ESTA 1Y3YA 4NWKA 2Y7XA 2O8LA 1GDNA 1MTSA 1AI8H 2WPHS 2A0QB 1NFWA 1ANEA 1AN1E 5SGAE 2HPPH 4YOJA 1AE8H 3CS7A 2D2DA 5K7RA 3RC6A 4KKDA 1B7XB 2AGIX 2G5NA 2BB4A 3LPRA 1BZXE 1A5GH 3U1IB 1DUEA 3FZDA 2ODYB 4MG3A 3RMMH 5LPRA 4DW2U 1KXAA 2XBWA 4ZAEA 2BQWB 2GMTB 4Y0ZE 3UNQA 2HPQH 3VPKA 4H6TA 1IQGA 1WCZA 1ZPZA 3LOXA 2LPRA 2HNTF 3Q77A 2JETB 3DFJA 3PTBA 2SGAA 3ITIA 3ODDA 4WF8A 1A3BH 2DE9A 2UWOA 2GT8A 1CU1A 2W5EA 1EOLA 3E1XB 3M37A 2VINA 3UTUH 1NFUA 1RXPA 1QA7A 4YOGA 2YNAA 4CR5A 5DJ7A 3SOSA 1FONA 1MQ5A 1HAHH 4BTIB 3SI4H 3M7QA 4ESTE 1UJ1A 4E7RG 3QZRA 3E16B 2V3OH 3GCTF 4XBBA 1O3AA 2G00A 8KME2 3KEEA 1LHFH 2ANMH 1OYTH 1WSSH 2JH0D 4INHA 3E6PH 2PR3A 1P04A 2A2XH 1O33A 1TABE 4X8VH 1O5FH 3SNCA 3M3VA 1DPOA 3BIVH 1Y3XA 3OY5U 3GY2A 1RIWC 2Y81A 4JZFH 2Q6DA 5DKMA 1DY8A 3PMBB 1P9UA 1P8VC 4D7GA 1RD3B 2J95A 2R2WU 4GSOA 1CA8B 2BX4A 1TPAE 1O3HA 3A86A 1GMCF 3DA9B 1BHXB 4F49A 2WYGA 1O5EH 2AGGX 4MVNA 3KIDU 5F8ZA 3LH1A 1ZHPA 3S9CA 1TA6A 3TH2H 2M5TA 3RM0H 1EZSC 2ALVA 2OINA 3PMAB 3IWMA 3GISB 1ETSH 2Y5GA 1O3LA 2FTMA 1YPHC 1OWDA 1AFQB 4X2WA 1RTFB 1SR5C 4KGAA 5PTPA 1GVKB 3ZVFA 1C2GA 1SC8U 5G4BA 2FMJA 2TGPZ 5T3HA 5C1UA 1FN8A 1ZPCA 2GZ8A 2BOHB 1TMTH 3LC5A 3FANA 1O2NA 4ZKSU 1AVWA 2ZDNA 5IYTA 4CRCA 2OP9A 4WH8A 2ZHDA 2CN0H 4ISNA 4K8BA 3RP2A 3ZVBA 1BBRH 3RU4D 3C27B 3VB3A 1UVOA 1MAXA 2NWNA 2ZFPH 3ESTA 5I46H 1B0EA 1HAVB 4ISLA 2QIQA 3GY3A 2O9QA 2ZTZA 1GHZA 1GDUA 3TGKE 1C5TA 2V3HH 1TRYA 5JB8S 1CVWH 1C4Y2 3A80A 1O39A 4ABHA 3LONA 2QAAA 1TBRH 1SGYE 4AOQA 1GBBA 3SJOA 1ZZZA 3KNXA 1MMJN 1MD8A 1MQ6A 4TWYA 1YPGH 3SU0A 1N6YA 3UR6A 2F91A 1EPTC 3A84A 4IMQA 4K3JA 1O2UA 4XFQA 4B74A 5F8XA 3TK6A 2GDEH 1HJAC 1AVGH 1ARBA 2UWPA 3GCHC 1G3CA 3E91A 3URCA 1C2FA 1FIZA 1S0RA 1N1LA 1LVMA 1VITF 1AGJA 4Y8ZA 4K1SA 3JZ1B 2XWAA 5JDUB 4BAMB 1LHCH 2DUCA 1EKBB 2ZTYA 1BTHH 1FIWA 4MPVA 3GY6A 4J2YB 4K2YA 4YT7H 1ZPBA 1YGCH 2NU0E 3ZZ4A 5F8TA 4BAKB 1JXPA 1NRRH 2FOBA 4JZ1A 5C5OA 5FX6A 2FIRH 3VB5A 5EW1H 1YLCA 4FUIA 1V2UT 1UTOA 3V0XA 3PO1B 1VCPA 2FWWA 1MZDA 1O5CB 1C2KA 2G4TA 2OC1A 4CBOA 1AU8A 3SNEA 1T8LA 1L4DA 4X1QU 1KTSB 4GLYA 2JH6D 1WAYB 1RJXB 1WQSA 5H4IB 2GVFA 2QYIA 1ETTH 1CQQA 3SQEE 4YLQH 3SGAE 3K6YA 1ZTJA 2W26A 3QGJA 1FAXA 3F1SB 2TPIZ 8ESTE 2VNTA 3M5NA 1IQEA 4GVUA 3UWJH 3KN2A 3HATH 1QBOA 2RG3A 1CT2E 1TA2A 4U32A 1BRUP 1GCDA 1ANCA 1TGTA 2AMQA 1SHHB 3SUDA 4UDWH 1OWIA 1T8MA 2QF0A 7GCHF 4X2VA 3K65B 5I25A 3B9FH 5EGMA 1HAVA 1A7SA 1ESAA 5FBIA 1SVPA 3HKIB 5EU8A 2Q1JA 3KQDA 1GHAF 4AN7A 1F2SE 1WU1A 3SGBE 1Z8GA 1C5SA 4X1NU 1L1NA 1EASA 1GL1A 1GBFA 2FOFA 1TQ0B 3B23B 4VGCB 1KDQB 2J34A 1PPBH 5CHAC 4UEHH 3O8RA 2A32A 1OSSA 2TIOA 4RKJB 3ATKA 1HCGA 1XKAC 2ODQA 3RXBA 1FMGA 1ZTLA 1W7GH 3LGVA 3ZZ6A 8GCHG 2ZWLH 1GHWH 1SQTA 3BEFB 4LZ1H 2GZ9A 2PV9B 3MO3A 4NWLA 3O8CA 3QWCH 4X2YA 4TY7A 1BBRK 2VWLA 4ABGA 2IOTA 2ZO3H 5FPSA 4E05H 1SL3A 1NT1A 1TPPA 2HGTH 2GCTB 4JK6A 1DE7H 1L1GA 4JYUH 1Q31A 4RSPA 3GYLB 3LU9B 4JZDH 3BV9B 4ZXYH 1EUFA 1F5LA 2AIQA 4WY3A 1O3GA 2QXGA 3T27A 2F9PA 1C2MA 2ZU4A 1Y5UT 2I6SA 3ZZDA 1QFKH 4BAOB 3QTVH 1ESBA 2F9UA 1HAIH 5C3NA 3FZZA 1EATA 4NA9H 1LHDH 3ZVCA 1TNHA 3P6ZB 1TLDA 1PYTD 2O8UA 4B2AA 1NU9A 1FN6A 1GJ9B 1AY6H 3TJUA 3RMOH 2PFEA
chains in the Genus database with same CATH superfamily
1AZ8A 2Z9LA 5HXFA 1A5IA 2TRMA 3OAAD 1TX7A 1CO7E 1DLKB 1HXFH 2ZA5A 5FAHA 2NU2E 2OC0A 3TH3H 3SU5A 4FUGA 1B0FA 2EI6A 1ABIH 2BZ6H 4GCHG 4K1EA 3ZZ8A 4U01A 2RFKC 2GD4B 2RA3A 1K21H 1C2HA 5GXPA 1V2PT 2J94A 1M9UA 4E7NA 2PGQB 1HAOH 2FDAA 1HPGA 1GMHG 3VGCC 2A7CA 1O2KA 2FOMB 4X1RU 4WJG2 3A8BA 1CA0C 1DICA 1MABB 4B73A 1J17T 4DT7B 2ZGJA 1QZ8A 4KTSA 1QBVH 3QDZB 1XKBC 3HPTB 1V2VT 2ZU5A 3MH7A 4Y6DA 1MH0A 4CBNA 1EP5A 3MNXA 4O3UA 5GPIB 1VCQA 1ZMNA 4R8TB 2BD5A 2WV5A 4DCDA 2VH6A 4F48B 3NXPA 2GGVB 2Q6GA 1SPJA 3VEQB 4P02A 1GMDG 1SFIA 1UTJA 5E2OA 1K1OA 4DVAU 2BD2A 1O2OA 2QN5T 1GHBF 1HLTH 1S5SA 1YLNA 1ZYOA 3NKKA 3M7TA 1FQ3A 1O2QA 1KDQA 2O8MA 1ID5H 4FU7A 3BTFE 1BBRE 2Y7ZA 1P05A 4NG9H 1ZOMA 2RDLA 1C9PA 1GCTC 3N7DA 4ISIH 3RXTA 1GJ5H 2BLQA 3SW2B 2BZAA 4TPIZ 3T2NA 3EYDA 4B6FA 1ETRH 4Y7BA 2ZFQH 1ANBA 1G37A 1UVUH 2VU8E 3U8TH 1HB0B 2QXHA 1SGEE 3NWUA 2CMYA 4X0WU 4X8SH 1TNKA 1BCUH 1BTPA 4I7YH 2VJ1A 2GV7A 4RT0A 2HNTC 1TPOA 3TPIZ 3A81A 1GI0A 3AW1A 3T62A 1P09A 1EP6A 3F0OA 2WHXA 3KF2A 3F0PA 4FXGH 1BRAA 1QA0A 2WUBA 4A5TS 2VGCC 2GTBA 2I6QA 2BD9A 1A1RA 4MNVA 2ZHWH 1BMNH 1QQ4A 2J4IA 3A8CA 3FAOA 3HK3B 4YLUA 1O2ZA 3KL6A 4FUCA 1SG8B 3GY7A 4ZXXH 3SN8A 1V6DA 4D7FA 2BLVA 1HJ9A 1YCPM 2H6MA 2A45B 4BOHA 4TYDA 1EZXC 2Y82A 1YF4A 3A7YA 2ZHFH 4FUDA 2PSXA 1JRSA 1PQ7A 5LGOA 3KQBA 3OSYA 4X2XA 1GGDC 1ORFA 3RLYH 3P8GA 1SQAA 1HYLA 1QIXB 2FS8A 4AORA 2V35A 2C8XB 3MYWA 5JBTA 2C8WB 2GCHG 2A4OA 2P8OB 1HJ8A 1P57B 1PPFE 1TRMA 2XC4A 3E8LA 1DWBH 1RTLA 1GI3A 2W7UA 1F0RA 2XRCA 7LPRA 1G3BA 1W2KH 1GI7B 1D3TB 2KCYA 1FY5A 4CH8B 2CF8H 1K28D 2EC9H 2R2MB 1L1JA 2FPZA 3EGKH 1AWHB 2ZGCA 3RXCA 1O3EA 3VB7A 3GY8A 1GBCA 5C1YA 2NU4E 2O8TA 1VGCC 5L2ZH 2B8OH 4FVDA 1FXYA 3JZ2B 1W11U 1XUHA 3QGNB 1DITH 1C9TA 1GVLA 3SGQE 2P93A 3G01A 2ZFSA 1GJCB 1YP9A 2GT7A 2H9EH 4MPUA 1E36B 1LCYA 4OGYA 3RMLH 4LZ4B 1OP8A 1TOMH 4A6LA 1EFRD 1NM6A 3KQEA 5GJ4B 2A1DB 3A88A 2HVYB 2AIPA 1BTWA 1JIRA 1O2PA 1JRTA 1DY9A 3PLKA 4Q7YA 2WUCA 1Y5AT 2PKSC 1CGIE 1BMLA 1D4PB 1JBUH 1KY9A 3DSGA 3IG6B 4CHAC 3ZVAA 5KGOA 1T32A 4OS6A 1TMUH 4ZHAA 4ISHH 1C5XB 2ODPA 4U30A 5T6DA 1O30A 1UO6A 3VG8A 1OWKA 3MO9A 1XVOA 3ZVDA 4CR9A 3DFLA 3E0NB 5C94A 1T8OA 1F92A 2LP6A 4YO9A 2FI3E 4CRGA 1QL7A 3TVJB 1DWDH 3BTEE 1UK3A 5DP7A 4I8KA 1KXDA 3SUGA 3U98H 4Z0KA 2PKAB 4K69A 1A2CH 1NRPH 3MU5A 3ZZ5A 1IQHA 1Z8IB 5EPNA 1ZSJA 1CSOE 2WPDD 1C1TA 1SGFG 1TFXA 1F0TA 3SJ9A 3MTYA 1C5QA 4BXSA 2A7HA 2PGBB 1C1VH 2AERH 2F43B 1RIWB 3TIUA 5A8YA 1P02A 2ZFFH 3MHWU 4Q7ZA 3BF6H 4JMYA 3RXPA 3QTOH 2G55A 4ZKOU 2RA0A 3RUOA 1PFXC 3VXEH 5B6OA 1QB6A 1MBMA 1NO9H 4XBCA 4DG4A 3MFJA 1VZQH 4WVPE 1AO5A 2ZDVH 3SU4A 1CHOG 3I77A 1BTUA 4WMEA 2FODA 4A1XA 1QGFA 2JIZD 3FP7E 1Z6EA 3RXIA 1H1BA 1FLEE 1VITH 1MBQA 3CS0A 1S6HA 1ARCA 2SNWA 4XD7D 2J2UA 1P2OA 1DWEH 2IJOB 2PTCE 3AW0A 3U9AH 3RXJA 1W13U 1A46H 1GBJA 3MH6A 2ILNA 3MU0A 3ZZ7A 2XC0A 3KYGA 1LTOA 2VIWA 3TGJE 1DT2A 1P9SA 4HTCH 1TNLA 1TGNA 1Y59T 2ZNKH 4IC5A 5AFZH 3RXMA 1G3EA 1W7XH 1HAYB 1UVSH 1DXPA 1BTZA 4E06H 1WXRA 2C4FH 4GAWA 1HFDA 1BTXA 1UTKA 4FVBA 5AF9H 3SJIA 2R0KA 4I8HA 3BG8A 2M2AA 2Z3CA 2Z9IA 1E37B 1O3PB 1O2TA 3RLWH 3U1JB 2XW9A 5A0BA 3BIUH 3UNSA 2ZDKA 5EOKA 4GHTA 2FYQA 3LGTA 3PWBA 1O2XA 5DO4H 1MKXH 3TK9A 1O38A 1BQYA 4ZROA 3A82A 2BXTH 1TAWA 1Z7KA 1EX3A 2G8TA 1HXEH 3KCGH 1O35A 2SGEE 1ZGVA 1G30B 1SGQE 3R0FA 4R0IA 4Y11E 1RFNA 2C8ZB 1SGCA 1NN6A 2PUXB 4X6PA 2AEIH 3UQOA 4O3TA 3LGYA 2FEQH 1DSUA 1EPTB 1GI8B 3SO3A 1E34B 2BXUH 2A31A 2ZDMA 1O3OA 1HJAB 3ATWA 5T1VA 3RXOA 1KSNA 3GCHB 1HNEE 4CREA 4X1SU 1H9LB 1AVXA 2KCOA 3QLPH 1CBWB 1V2JT 1F7ZA 4AFUA 1SLXB 3FVFB 4FUJA 1K1PA 5GWZA 1OHHD 5FPYA 4HG6A 4HGCA 1CGHA 1A0LA 5J4SA 4DOQA 1FPHH 1UK4A 5E0HA 1GHAG 2XNIA 2ZGXH 3UR9A 1LQEA 3MNCA 2FLBH 3QUMP 4IBLH 2HNTE 3P70B 5TCCA 1O2LA 1NFXA 3NUMA 1Q2WA 4JCNA 4WH6A 1QRZA 1SLVB 4NA8A 2D1JA 2BDYA 3F2GA 3LGUA 1MKWH 3FN8A 2PSYA 2ZF0H 2ZIQH 3SI3H 1UTPA 2THFB 1WBGB 2EI7A 1C1RA 1PPGE 2B7DH 1D3DB 1HBTH 1XVMA 4JYVH 1INCA 2G51A 2TBSA 4ZKRU 1W0YH 3V3MA 3SNAA 3AAVA 4CRFA 2XOKD 4B1TA 1SOZA 4UONA 4XSKU 2Y5HA 1YPMH 2W7SA 1CGJE 1VKYA 2OUAA 2OQUA 1WUNH 3E90B 1A61H 4DIHH 5A0AE 2FOEA 3VB6A 1DWCH 1DX5M 2A2QH 1MTVA 5CDFE 3MU4A 1NROH 3F9HA 3RC4A 5DP5A 2P94A 1MD7A 2NU3E 1LMWB 3D49H 4KP0A 3RXSA 2YMSB 2ZZUH 1ELAA 5JB9S 5TCAA 3SJKA 5DP4A 4Q7XA 1C1QA 3RU4T 1GBLA 2ZI2H 1NRNH 2YOLA 3E3TA 1A0JA 4IC6A 4AX9H 1LPZB 1OXGA 2FM2A 1AB9C 1PPZA 4J1YA 1E38B 2PP6A 1GL0E 2W3KA 3BTDE 4DT4A 1TB6H 2ZQ1A 1C2EA 1AZZA 1Z1JA 3FKSD 1DOJA 5CHAB 5LPEA 5ESBA 1O3KA 2AHME 2C8YB 2R0LA 1YY3A 2OBOA 5L6NH 2BVRH 1P06A 2JKHA 4YM9A 2P16A 1V2QT 3UREA 3I29A 4B71A 2ZTXA 1O32A 4RT1A 1CT4E 4PROA 4THNH 1ABJH 3RC5A 1H8HD 1FDPA 5EQSA 1SGPE 2ZKSA 3LT3A 5GIBA 4B76A 5C67A 5IK2D 2XBYA 2BLOA 1P0SH 1XX9A 1GI4A 2Y5FA 3A87A 3UY9A 3ZZ9A 5KEDA 1FJSA 2C93B 1BRBE 1C5NH 3T25A 4I32A 1X7AC 1J9CH 3MU1A 3RXUA 3UNRA 3V7TA 2F9OA 2OCVB 3BTQE 5GCHG 5EJ1A 3SNDA 4OS5A 1QHRB 1BIOA 1MKXK 1EB2A 2SGQE 1H9IE 2W3IA 1F0UA 1GHBG 4IMZA 5T6GA 2XBVA 5HM2A 3TGIE 1GWAA 1J14A 4AZ2B 3GCOA 1ELCA 2BDIA 4NGAH 4A7IB 1RGQA 1GBTA 3PO1C 3U28C 1FAKH 2FI5E 3Q3KA 1P2MA 2BDHA 1XXDA 1C5UA 1G2MA 3V13A 2Z3EA 3T29A 1ZSKA 1QB1A 1GJ6A 1EXFA 4IS5A 2F9BH 1UW7A 3PWCA 1NESE 3FP8E 1IQMA 4O97A 1UVTH 2IJD1 2FX4A 1WQVH 1GHVH 4JK5A 1GBEA 2FOCA 3Q00A 2VVUA 1NRQH 3SU2A 1N8OC 1TPSA 6CHAC 4AB9A 4AGJA 2A7JA 1YYY1 1W0KD 3DCLA 2GKVE 4OS2A 2BHGA 1MCVA 1BHXF 2KZ4A 1Q3XA 1KLIH 2CHAC 3MQKC 1JIMA 3RMNH 3RXDA 2FTLE 4D9QA 1GI2A 1CA0B 4AYVB 6GCHF 2JDID 1FY4A 1NBME 4IN2A 1O36A 2BY9X 5F6MA 2ZU1A 5EQQA 3RXEA 4AG2A 3U69H 1HAZB 4I33A 1FV9A 5EJZA 4FU8A 4X6NA 4NCYA 2OK5A 1DSTA 2QCYA 1GJBB 3LDXH 5BPEA 2QGRA 1YPLH 1EAXA 1FY1A 5EQRA 3WWBA 4ABBA 1C2LA 1C5VA 1TIOA 2DE8A 2FLRH 1P10A 1DXWA 4X8TH 1C1NA 3LH3A 4F4OC 1GBAA 2ZHQH 4UFDH 1PQ5A 1SI5H 5K0HA 4FUFA 1LHGH 3V12A 1BRCE 1MU6B 2J98B 2VIVA 3SORA 2BQ6B 1SQOA 3BTTE 1LVBA 1AWFH 3MH4A 4I8GA 1S83A 1HAGE 3A7VA 1GCTB 4YT6H 1FY8E 1PPHE 2ANYA 1W14U 1UHBB 2OLGA 1DS2E 3PROA 5JYIA 1KYNA 2BVSH 2ZECA 4YESB 1LPGB 2STAE 4ZUHA 1O34A 1ZRBA 1NRSH 1THRH 3BEUA 1QJ1B 4XE4A 5DP3A 1GVZA 1MU8B 3S7KB 2AMDA 2GCTC 3ZV8A 1BITA 2K1QA 1LO6A 5TJXA 1TX8A 2BY6X 2KCAA 3M5LA 1G9IE 1NZQH 3S0NA 3KYFA 2FO9A 4GPGA 3HK6B 4Y8YA 1BMMH 2ZEBA 4WMFA 1O5BB 5E0JA 1BMAA 1E1RD 1FNIA 2BDAA 2VGCB 4ABIA 1C1PA 4I86A 1YPHE 2ZCLP 1J15A 2XWBI 3OTJE 2P3FH 3LJJA 1FI8A 1UCYH 2P3TB 4XDEA 1PQAA 2QE7D 1IOEA 4NZLA 1SGNE 2KFWA 1TGSZ 1QBNA 1CT0E 2PW8H 1EZQA 1CE5A 1RTKA 1SBWA 2SGFE 3SHCH 1O2MA 4RKOB 1YPKH 1GPZA 1AMHA 4YOIA 1IQLA 4K60A 4ZHLU 3MU8A 1OYQA 1OKXA 4K1TA 2TGTA 4H6SB 2V6NA 1W3CA 3LC3A 5DN6D 1GGDB 1Y5BT 4HI3A 4D76A 2Z94A 2ZCHP 4NSYA 4UFEH 1LQDB 2PUQH 5F03A 2QY0B 9LPRA 1C2DA 1COWD 3ZZ3A 3W94A 3M5MA 1AKSB 4FU9A 3OX7U 4HFPB 2HALA 4H4FA 3N7OA 1HUTH 2FYRA 2AH4X 1E35B 1SSXA 2Z6BD 3SV9A 4FETA 5DP8A 3A7TA 1O0DH 2G52A 1LHEH 2CK3D 2VB0A 1G3DA 4OS4A 1ELVA 3O8DA 3BEIB 2IPQX 3UOUA 2H1UA 3SHAH 1D6RA 1H4WA 1C5WB 3R3GB 1P3CA 3H5CB 1EQ9A 4B2BA 1VGCB 1K1LA 2IN2A 1O2GH 3HKJB 1HGTH 3UFAA 1A4WH 1P2IA 3A7XA 2ZC9H 1T8NA 2J98A 2WPKS 4X1PU 5DG6A 5FCRA 4AFZA 2HWLB 2PTNA 1MAYA 4DJZB 1K2I1 2QF5A 4I8LA 4NFEA 1UHBA 3F6UH 1WV7H 4RN6A 4ASHA 3MO6A 4A1TA 1KXEA 1LPKB 2BM2A 3KQCA 1BJVA 3GDUA 3GOVB 4U2WA 2BVXH 3M5OA 3TNTA 1QCPA 3UWIA 2Q6FA 3GCTG 1NS3A 2PKSB 3SUFA 2G5VA 5CMXH 3RXGA 1FY3A 4CHAB 1O2YA 1OWHA 2BY5X 1W10U 4GCHF 3A8DA 1OS8A 2ULLA 3HGPA 1GI9B 5GNDA 3CENA 4MNYA 1UVPA 1GMHF 4FOUC 1TOCB 2WPIS 1XXFA 2UUYA 1QY6A 4AGKA 3FO8D 3FP6E 4GHQA 3F2FA 1GG6C 1TE0A 1S6LA 3RDZA 2HLDD 2WZQA 1C4U2 1S84A 2AS9A 1ZHRA 1VJ9U 3GY4A 2UWLA 3ATMA 5C0UA 1HDTH 3OEED 1LVYA 1ZGIA 1GMDF 1GMCG 3F2HA 1TMBH 1ZSLA 3BG4C 2BMGB 4B2CA 2H5CA 1DFPA 1KMHB 3PTNA 3F3BA 3SV6A 1SMFE 3RXFA 2GX4A 1IQIA 1BUIA 2O8WA 3E0PB 5JBCS 5C0TA 2GDDA 2UUJB 1QURH 1AKSA 2P8OC 1WYKA 7ESTE 2BDBA 1OP2A 4IN1A 2BY7X 1P12E 3LJOA 1P2QA 1O5DH 1THPB 1YLDA 1Y3VA 1DUAA 5DP6A 3T26A 5B6LA 4TWWA 1UCYK 1O31A 3BTGE 3BSQA 1DANH 2FXRA 3P92A 3TITA 2BD4A 1GHXH 1ZMJA 1SQRA 1RRKA 5JPMH 5EW2H 4Q80A 1SGTA 5FCKA 1QR3E 2W6ID 4SGBE 1TNIA 3SV8A 5EPYA 2HRVA 4OS1A 2HLCA 1L2EA 4SGAE 3K9XB 1MTNC 2J38A 1TWXB 3KQ5A 4NIWA 1TGCA 1H9HE 4OS7A 2FX6A 1PPEE 1Z1IA 3BN9A 1NBMD 2ZU2A 4UE7H 1GJ8B 3LKWA 4INLA 1YCPH 1WTHD 3C1KA 2FS9A 2R9PA 2QC2A 5EXMA 2ZPSA 2W6JD 4ABDA 1A0HB 5HM9A 1NC6A 4H42U 3M61U 3F9EA 1ZMLA 3M3TA 2ESTE 2VBCA 1TNJA 3ATIA 1NTPA 2BDGA 2H9HA 1SGFA 4UD9H 4WMDA 4M9FA 2CF9H 1VITG 2FP7B 1F5RA 2FOHA 2GCHF 1SLUB 3OEHD 5EIYA 2EI8A 1B5GH 3F9GA 2JH5D 2V7QD 3SJ8A 4FUBA 5C17A 1ELGA 2YNBA 1WDIA 2GMTC 4DURA 1VCWA 4WWYA 1P2NA 1TONA 1K1NA 1QB9A 3PMJA 3TK5A 4AFSA 1GBMA 1GJAB 1L4ZA 9ESTA 2G81E 4UFFH 3M7UA 2VWMA 3SU3A 1V2NT 2OBQA 2STBE 1VJAU 2LELA 1HIAB 1UTNA 4IW4E 3DD2H 2JETC 4MPXA 1T31A 1ACBE 2C90B 1V3XA 2J97A 5FX5A 4ABJA 5HKKD 1TALA 1GI5A 3UUZA 1W0JD 3EA7A 2F83A 3SV7A 3AK5A 4JZIA 5C20A 3PRDA 1O2VA 1T4UH 3RXKA 1AHTH 1WOFA 4WXIA 1FPCH 2ZPRA 3RXRA 5FPTA 4Y71A 1KLTA 2BOKA 1UCYE 1D6WA 2SFAA 2L6OA 1JOUB 4M7GA 3EA8A 5HMAA 3UOPA 2B0FA 2K0QA 3A7WA 1L0ZA 4NIXA 3QK1A 1C1OA 2H5DA 1ZJKA 1ZHMA 3P95A 1C2JA 3STIA 2V0BA 2PKAA 2VIOA 3N7EA 4Z6AH 1DM4B 3VXFH 1MCTA 1ELEE 3PLPA 1SGRE 1GJ4H 3I78A 5GDSH 5FHTA 4ASUD 2H9TH 1SLWB 3SQHE 1BDAA 3NCLA 1BT7A 2A5AA 3A83A 3GICB 7GCHG 4K8YA 3GY5A 3PM3A 4Y10E 5C5NA 4A92A 1D3QB 4ABEA 1IQFA 1D3PB 1ZRKA 1UTMA 2VVVA 5JBBS 1HAXB 1O2SA 2OC8A 3EDXB 3F68H 3IITA 3DT0H 3WY8A 2A4GA 2Z3DA 3BTHE 3L33A 5EODA 5A2MH 1O5GH 4O9VA 1PQ8A 1YPEH 3LIWA 3PV4A 1O3CA 1C5YB 4MTBA 1EAWA 3D62A 2BX3A 1OPHB 4WXVA 2H2ZA 2ASUB 1AB9B 1OOKB 6ESTA 1ELBA 2CXVA 1QL9A 2XCFA 2WPLS 5HIYA 2AGEX 3O8BA 5E0GA 1AFQC 5DK1A 5A09A 1K22H 1HV7A 1CHOF 2NU1E 3ZV9A 3UQVA 2F4LA 1P2KA 1TGBA 1EJNA 5T6FA 1JWTA 2P95A 2ZHEH 3MNBA 1AD8H 2PWXA 3RXAA 2SGPE 4B75A 2TGDA 2VWOA 6GCHG 1C5PA 1TQ7B 1TRNA 4ISOA 4DIIH 4O03A 2EA3A 1AE5A 1HIAA 1YCPK 2VVCA 3A89A 3ATLA 1CBWC 2HOBA 5EXNA 2BY8X 1XUGA 1SB1H 2XBXA 3D23A 1K0HA 2ANWA 2F9NA 2ZQ2A 5DPAA 1ANDA 3GDVA 3TLOA 3P8NA 1AUTC 1NY22 2BLWA 4TY6A 3UIRA 4Y79A 3ZZBA 1UTQA 3ENSB 1OWEA 3K6ZA 4Y7AA 1C5ZB 3OFND 1S85A 3EQ0H 5FXLA 2BD7A 5HIZA 1S0QA 4Q4LA 2WV4A 1T4VH 1P11E 4Y76A 1IHTH 1C5LH 2ZGBH 6LPRA 1OP0A 3EE0B 3ODFA 3A8AA 1AIXH 4KELA 2ZP0H 5F53A 5LH8A 1SGDE 4OGXA 2WINI 4GUXA 4ABAA 1HAPH 3ZVEA 4BAHB 1EPTA 4KTCA 3QZQA 2BYAX 4I31A 4CH2B 4Q2KA 2XYAA 3D65E 1G2LA 1J16A 3TNSA 2RCEA 1MUEB 3RXHA 1NU7B 1BB0B 2OQ5A 3S9BA 4MNXA 3L6PA 1BJUA 1JMOH 2FESH 2HVXA 1O2JA 1P2JA 2YMSD 3DSOA 1W12U 1N8OB 3OY6U 4MLFB 6CHAB 1ZR0A 1THSH 3AAUA 3TJOA 4ZH8A 1XUJA 1U6QA 2OTVA 1XUKA 3Q76A 4AC9A 1O2RA 1T7CA 1G32B 2QXIA 2QF4A 2CHAB 1V2MT 1Z71A 3L3TA 2K8IA 2AYWA 3M3SA 4NFFA 1DDJA 5ABWA 1K9OE 3T28A 2Y80A 1P03A 3TJNA 2VH0A 1BMFD 2VIQA 3SBKA 4LXBH 2PHBA 1Z8RA 2SNVA 2GJGA 1YKTA 1Z8JB 1KLJH 2J9NA 3QX5H 2FI4E 1ELFA 1V2ST 5A8ZA 1P01A 3KGPA 2KR7A 2R3YA 1QJ7B 1FX0B 4LK4A 3F9FA 1AQ7A 1EAIA 3S69A 1V2WT 4D9RA 1KIGH 4KTUA 3GDSA 2Y6TA 4NIVA 5L30H 2D8WA 4FUHA 3RXQA 2ZCKP 1IQKA 1DVAH 3DHKH 5E8EH 1O37A 3RXVA 2UUKB 1GBHA 1MZAA 4TT3D 1AFEH 1H8DH 1C1UH 5AHGH 3QO6A 1G36A 1EB1H 3K2UA 5EG4A 1FUJA 2QF3A 2TGAA 2XTTB 1SGIB 3VGCB 1W8BH 1C2IA 1EZUC 4MNWA 2QXJA 4X8UH 4AG1A 1XMNB 1YC0A 2P59A 1QJ6B 2WV9A 3U8OH 1MKWK 3A85A 1A5HA 2ZFRH 5C2ZA 3BTME 4AFQA 1V2OT 1ZLRA 5LPFA 3LGIA 1GDQA 2VIDA 2KAIB 1GJDB 3M35A 3TJVA 7KMEH 1GBKA 1K1MA 5DSFA 2ZFTA 1RS0A 5ETXA 2XC5A 3GCNA 3QN7A 2R3UA 4BTUB 1SFQB 1O3BA 4VGCC 2C3SA 1IQJA 2WPMS 2Z9KA 1K1JA 3TH4H 1GBIA 2A4RA 5CHBA 3MNSA 4XOJA 1W0ZU 4FUEA 1H8IH 1EOJA 5A8XA 1PYTC 1KTTB 3SUEA 3DSPA 3ZVGA 3ZYDA 3OYPA 4ACBA 5HYOA 3EAJA 4AB8A 1TYNA 3WWFA 4F55A 2WYJA 2ZGHA 4K5ZA 1C5MD 1OWJA 3W95A 1BTYA 1S82A 1ZJDA 3EE7A 5FBEA 1O5AB 2CJIA 4BANB 3BTWE 1QQUA 2ANKH 1GI6A 3BTKE 3PYHA 3TU7H 1TX6A 4CRBA 8LPRA 2BD8A 2PLXA 1LVOA 2QA9E 2ZG0H 3MH5A 3T5FH 3VFEA 1AUJA 1C1SA 2P3UB 4RI0A 1PPCE 1YBWA 3NPSA 3PMHB 1F0SA 1V2TT 2Z9GA 1GJ7B 1GI1A 5JBAS 5E2PA 5EXLA 3S7HB 2F3CE 4INKA 5DP9A 1GBDA 1KXBA 4HZHA 4A1VA 2VWNA 4ACAA 4NZQA 3CP7A 2ALPA 1IQNA 5CE1A 5GCHF 2IPHA 3ELAH 3H7TA 2Z7FE 3PLBA 1S81A 3M36A 3PV5A 2J5UA 2XNDD 4X6MA 3URDA 1GHYH 1QL8A 1YPJH 1F5KU 4NA7A 1V2KT 2A5IA 4OM9A 1YM0A 1C5OH 1QTFA 1EJMA 3GYMA 1QRWA 1C5RA 3MMGA 3AVZA 1O3IA 3UPEA 1J8AA 3OU0A 5AVDA 4BNRA 2BTCE 1ELDE 3P8FA 2FOGA 3SNBA 2BDCA 2KCPA 5HGGA 3SU1A 1DLEA 3PRBA 1MTUA 4QT8C 3ZZCA 1O3NA 1BA8B 2GP9B 1ELTA 4JZEH 8GCHF 5IDKA 3A7ZA 5A0CA 1A3EH 4DY7B 1P3EA 1QNJA 4ABFA 1LKAA 4YTAA 4YZUA 2F9VA 2BQ7B 4AYYB 1O3FA 1UTLM 2SGDE 1BOQA 2FOAA 3RU4E 4NSVA 4TPYA 2ZU3A 1N6XA 2KAIA 3PV2A 5KECA 1C1MA 2ZPQA 5J4QA 1V2RT 1O2IA 2XXLA 4CRAA 1XM1A 2A5KA 4MDSA 3SZNA 1SHYA 3AASA 1NFYA 1YWUA 3P8OA 2VIPA 4X6OA 2WPJS 2CV3A 1GG6B 1LDTT 5C1XA 4UFGH 2EEKA 3Q3YA 1S6FA 1LKBA 4BAQB 3MOCA 3RM2H 4ZMAH 2GZ7A 3Q3XA 2G4UA 3OE7D 1C1WH 1TBZH 1TNGA 4JYTA 1Z6JH 2A4QA 5L2YH 1EAUA 2ZDAH 4LOYH 3H7OA 1FZZA 3B8JA 3DUXH 1XUIA 1Y3UA 3BG4B 5ESTE 3SV2H 3ZZAA 1UMAH 2BD3A 3STJA 3MI4A 1IAUA 3PB1E 4XBDA 1O2HA 4MPWA 4BXWA 3NK8A 1HRTH 1O3DA 1QRXA 2UUFB 1CHGA 4I8JA 3EA9A 1E79D 3HGNA 2CGAA 4D8NA 2GV6A 3S9AA 1NPMA 2FZZA 2Z9JA 4ZKNU 3UB0A 1E0FD 1EJAA 2OD3B 1IHSH 1TBQH 1Y8TA 3NZIA 3U8RH 3P17H 2AMPA 1O3MA 4DGJA 1UK2A 2B5TB 3MWIU 5BRRE 2RDEA 4BTTB 3LGWA 1SOTA 1OX1A 5DGJA 3VB4A 2V3MA 4CRDA 1MTWA 1PJPA 3RXLA 1D9IA 1XUFA 1WTGH 1ZTKA 1C4V2 3ZYEA 2LNCA 2XCNA 1O3JA 1MTNB 1Y3WA 3SU6A 4NIYA 2ZDLA 1V2LT 2J92A 4MQAA 2OXSA 1VR1H 2QV1A 3KHVA 4IGDA 1H8ED 4ZHMU 2AFQB 2OC7A 1O2WA 2B9LA 4Y0YE 1KXCA 2D26C 3FFGA 5AFYH 1K1IA 1KXFA 4Y8XA 1ESTA 1Y3YA 4NWKA 2Y7XA 2O8LA 1GDNA 1MTSA 1AI8H 2WPHS 2A0QB 1NFWA 1ANEA 1AN1E 5SGAE 2HPPH 4YOJA 1AE8H 3CS7A 2D2DA 5K7RA 3RC6A 4KKDA 1B7XB 2AGIX 2G5NA 2BB4A 3LPRA 1BZXE 1A5GH 3U1IB 1DUEA 3FZDA 2ODYB 4MG3A 3RMMH 3CNRA 5LPRA 4DW2U 1KXAA 2XBWA 4ZAEA 2BQWB 2GMTB 4Y0ZE 3UNQA 2HPQH 3VPKA 4H6TA 1IQGA 1WCZA 1ZPZA 3LOXA 1E1QD 2LPRA 2HNTF 3Q77A 2JETB 3DFJA 3UAIC 3PTBA 2SGAA 3ITIA 3ODDA 4B6EA 4WF8A 1A3BH 2DE9A 2UWOA 2GT8A 1CU1A 2W5EA 1EOLA 3E1XB 3M37A 2VINA 3UTUH 1NFUA 1RXPA 1QA7A 4YOGA 2YNAA 4CR5A 5DJ7A 3SOSA 1FONA 1MQ5A 1HAHH 4BTIB 3SI4H 3M7QA 4ESTE 1UJ1A 4E7RG 3QZRA 3E16B 2V3OH 3GCTF 4XBBA 1O3AA 2G00A 8KME2 3KEEA 1LHFH 2ANMH 1OYTH 1WSSH 2JH0D 4INHA 3E6PH 2PR3A 2KM0A 1P04A 2A2XH 1O33A 1TABE 4X8VH 1O5FH 3SNCA 3M3VA 1DPOA 3BIVH 1Y3XA 3OY5U 3GY2A 1RIWC 2Y81A 4JZFH 2Q6DA 5DKMA 1DY8A 3PMBB 1P9UA 1P8VC 4D7GA 1RD3B 2J95A 2R2WU 4GSOA 1CA8B 4ZCNA 2BX4A 4YXWD 1TPAE 1O3HA 3A86A 2KX4A 1GMCF 3DA9B 1BHXB 4F49A 2WYGA 1O5EH 2AGGX 4MVNA 3KIDU 5F8ZA 3LH1A 1ZHPA 3S9CA 1TA6A 3TH2H 2M5TA 3H09A 3RM0H 1EZSC 2ALVA 2OINA 3PMAB 2JJ2D 3IWMA 3GISB 1ETSH 2Y5GA 1O3LA 2FTMA 1YPHC 1OWDA 2EY4C 1AFQB 4X2WA 1RTFB 1SR5C 4KGAA 5PTPA 1GVKB 3ZVFA 1C2GA 1SC8U 5G4BA 2FMJA 2TGPZ 5T3HA 5C1UA 1FN8A 1ZPCA 2GZ8A 2BOHB 1TMTH 3LC5A 3FANA 1O2NA 4ZKSU 1AVWA 2ZDNA 2L74A 5IYTA 4CRCA 2OP9A 4WH8A 2ZHDA 2CN0H 4ISNA 4K8BA 3RP2A 3ZIAD 3ZVBA 1BBRH 3RU4D 3C27B 3VB3A 1UVOA 1MAXA 2NWNA 2ZFPH 3ESTA 3WW7A 5I46H 1B0EA 1HAVB 4ISLA 2QIQA 5FL7D 3GY3A 2O9QA 2ZTZA 1GHZA 1GDUA 3TGKE 1C5TA 1SKYE 1TRYA 2V3HH 5JB8S 1CVWH 1C4Y2 3A80A 1O39A 4ABHA 3LONA 2QAAA 1TBRH 1SGYE 4AOQA 1GBBA 3N99A 3SJOA 1ZZZA 3KNXA 1MMJN 5EJLA 1MD8A 1MQ6A 4TWYA 1YPGH 3SU0A 1N6YA 3UR6A 2F91A 1EPTC 3A84A 4IMQA 4K3JA 1O2UA 4XFQA 4B74A 3SYJA 5F8XA 3TK6A 2GDEH 1HJAC 1AVGH 1ARBA 2UWPA 3GCHC 1G3CA 3E91A 3URCA 1C2FA 1FIZA 1S0RA 1N1LA 1LVMA 1VITF 1AGJA 4Y8ZA 4K1SA 3JZ1B 2XWAA 5JDUB 4BAMB 1LHCH 2DUCA 1EKBB 2ZTYA 1BTHH 1FIWA 4MPVA 3SZEA 3GY6A 4J2YB 4K2YA 4YT7H 1ZPBA 1YGCH 2NU0E 3ZZ4A 5F8TA 4BAKB 3NRLA 1JXPA 1NRRH 2FOBA 4JZ1A 5C5OA 5FX6A 2FIRH 3VB5A 5EW1H 1YLCA 4FUIA 1V2UT 1UTOA 3V0XA 3PO1B 1VCPA 2FWWA 1MZDA 1O5CB 1C2KA 2G4TA 2OC1A 4CBOA 1AU8A 3SNEA 1T8LA 1L4DA 4X1QU 1KTSB 4GLYA 2JH6D 1WAYB 1RJXB 1WQSA 5H4IB 2GVFA 2QYIA 1ETTH 1CQQA 3SQEE 3W1EA 4YLQH 3SGAE 3K6YA 1ZTJA 3GS9A 2W26A 3QGJA 1FAXA 3F1SB 2TPIZ 8ESTE 2VNTA 3M5NA 1IQEA 4GVUA 3UWJH 3KN2A 3HATH 1QBOA 2RG3A 4P00A 1CT2E 1TA2A 4U32A 1BRUP 1GCDA 1ANCA 1TGTA 2AMQA 1SHHB 3SUDA 4UDWH 1OWIA 2YMSC 1T8MA 2QF0A 7GCHF 2EQNA 4X2VA 3K65B 5I25A 3B9FH 5EGMA 1HAVA 1A7SA 4XRNA 1ESAA 5FBIA 1SVPA 3HKIB 5EU8A 2Q1JA 3KQDA 1GHAF 4AN7A 1F2SE 1WU1A 3SGBE 1Z8GA 1C5SA 4X1NU 1L1NA 1EASA 1GL1A 4Q63A 1GBFA 2FOFA 1TQ0B 3B23B 4VGCB 1KDQB 2J34A 1PPBH 5CHAC 4UEHH 3O8RA 2A32A 1OSSA 2TIOA 4RKJB 3ATKA 1HCGA 1XKAC 2ODQA 3RXBA 1FMGA 1ZTLA 1W7GH 3LGVA 3ZZ6A 8GCHG 2ZWLH 1GHWH 1SQTA 3BEFB 4LZ1H 2GZ9A 2PV9B 3MO3A 4NWLA 3O8CA 3QWCH 4X2YA 4TY7A 1BBRK 2VWLA 4ABGA 2IOTA 2ZO3H 5FPSA 4E05H 1SL3A 1NT1A 1TPPA 2HGTH 2GCTB 4JK6A 1DE7H 1L1GA 4JYUH 2WSSD 4Z1MD 1Q31A 4RSPA 3GYLB 3LU9B 4JZDH 3BV9B 4TSFD 1EUFA 1F5LA 2AIQA 4WY3A 4ZXYH 1O3GA 2QXGA 3T27A 2F9PA 3OTPA 1C2MA 2ZU4A 1Y5UT 2I6SA 3ZZDA 1QFKH 4BAOB 3QTVH 1ESBA 2F9UA 1HAIH 3FOAA 5C3NA 3FZZA 1EATA 4NA9H 1LHDH 3ZVCA 1TNHA 3P6ZB 1TLDA 1PYTD 2O8UA 4B2AA 1NU9A 2JJ1D 1FN6A 1GJ9B 1AY6H 3TJUA 3RMOH 2PFEA
chains in the Genus database with same CATH topology
1AZ8A 2Z9LA 5HXFA 1A5IA 2TRMA 1TX7A 1CO7E 1DLKB 1HXFH 2ZA5A 5FAHA 2NU2E 2OC0A 3TH3H 3SU5A 4FUGA 1B0FA 2EI6A 1ABIH 2BZ6H 4GCHG 4K1EA 3ZZ8A 4U01A 2GD4B 2RA3A 1K21H 1C2HA 5GXPA 1V2PT 2J94A 1M9UA 4E7NA 2PGQB 1HAOH 2FDAA 1HPGA 1GMHG 3VGCC 2A7CA 1O2KA 2FOMB 4X1RU 4WJG2 3A8BA 1CA0C 1DICA 4B73A 1J17T 4DT7B 2ZGJA 4KTSA 1QBVH 3QDZB 1XKBC 3HPTB 1V2VT 2ZU5A 3MH7A 4Y6DA 1MH0A 4CBNA 1EP5A 3MNXA 4O3UA 5GPIB 1VCQA 1ZMNA 4R8TB 2BD5A 2WV5A 4DCDA 2VH6A 3NXPA 2GGVB 2Q6GA 1SPJA 3VEQB 1GMDG 1SFIA 1UTJA 5E2OA 1K1OA 4DVAU 2BD2A 1O2OA 2QN5T 1GHBF 1HLTH 1S5SA 1ZYOA 3NKKA 3M7TA 1FQ3A 1O2QA 1KDQA 2O8MA 1ID5H 4FU7A 3BTFE 1BBRE 2Y7ZA 1P05A 4NG9H 1ZOMA 2RDLA 1C9PA 1GCTC 4ISIH 3RXTA 1GJ5H 2BLQA 3SW2B 2BZAA 4TPIZ 3T2NA 3EYDA 1ETRH 4Y7BA 2ZFQH 1ANBA 1G37A 1UVUH 2VU8E 3U8TH 1HB0B 2QXHA 1SGEE 3NWUA 2CMYA 4X0WU 4X8SH 1TNKA 1BCUH 1BTPA 4I7YH 2VJ1A 2GV7A 2HNTC 1TPOA 3TPIZ 3A81A 1GI0A 3AW1A 3T62A 1P09A 1EP6A 3KF2A 4FXGH 1BRAA 1QA0A 2WUBA 4A5TS 2VGCC 2GTBA 2I6QA 2BD9A 1A1RA 4MNVA 2ZHWH 1BMNH 1QQ4A 2J4IA 3A8CA 3FAOA 3HK3B 4YLUA 1O2ZA 3KL6A 4FUCA 1SG8B 3GY7A 4ZXXH 3SN8A 1V6DA 4D7FA 2BLVA 1HJ9A 1YCPM 2H6MA 2A45B 4BOHA 4TYDA 1EZXC 2Y82A 1YF4A 3A7YA 2ZHFH 4FUDA 2PSXA 1JRSA 1PQ7A 5LGOA 3KQBA 3OSYA 4X2XA 1GGDC 1ORFA 3RLYH 3P8GA 1SQAA 1HYLA 1QIXB 2FS8A 4AORA 2V35A 2C8XB 3MYWA 5JBTA 2C8WB 2GCHG 2A4OA 2P8OB 1HJ8A 1P57B 1PPFE 1TRMA 2XC4A 3E8LA 1DWBH 1RTLA 1GI3A 2W7UA 1F0RA 2XRCA 7LPRA 1G3BA 1W2KH 1GI7B 1D3TB 1FY5A 4CH8B 2CF8H 1K28D 2EC9H 2R2MB 1L1JA 2FPZA 3EGKH 1AWHB 2ZGCA 3RXCA 1O3EA 3VB7A 3GY8A 1GBCA 5C1YA 2NU4E 2O8TA 1VGCC 5L2ZH 2B8OH 4FVDA 1FXYA 3JZ2B 1W11U 1XUHA 3QGNB 1DITH 1C9TA 1GVLA 3SGQE 2P93A 3G01A 2ZFSA 1GJCB 1YP9A 2GT7A 2H9EH 4MPUA 1E36B 1LCYA 4OGYA 3RMLH 4LZ4B 1OP8A 1TOMH 4A6LA 1NM6A 3KQEA 5GJ4B 2A1DB 3A88A 2AIPA 1BTWA 1JIRA 1O2PA 1JRTA 1DY9A 3PLKA 4Q7YA 2WUCA 1Y5AT 2PKSC 1CGIE 1BMLA 1D4PB 1JBUH 1KY9A 3IG6B 4CHAC 3ZVAA 1T32A 4OS6A 1TMUH 4ZHAA 4ISHH 1C5XB 2ODPA 4U30A 5T6DA 1O30A 1UO6A 1OWKA 3MO9A 1XVOA 3ZVDA 4CR9A 3DFLA 3E0NB 1T8OA 1F92A 4YO9A 2FI3E 4CRGA 1QL7A 3TVJB 1DWDH 3BTEE 1UK3A 5DP7A 4I8KA 1KXDA 3SUGA 3U98H 4Z0KA 2PKAB 4K69A 1A2CH 1NRPH 3MU5A 3ZZ5A 1IQHA 1Z8IB 5EPNA 1ZSJA 1CSOE 1C1TA 1SGFG 1TFXA 1F0TA 3SJ9A 3MTYA 1C5QA 4BXSA 2A7HA 2PGBB 1C1VH 2AERH 1RIWB 3TIUA 5A8YA 1P02A 2ZFFH 3MHWU 4Q7ZA 3BF6H 4JMYA 3RXPA 3QTOH 2G55A 4ZKOU 2RA0A 3RUOA 1PFXC 3VXEH 5B6OA 1QB6A 1MBMA 1NO9H 4XBCA 4DG4A 3MFJA 1VZQH 4WVPE 1AO5A 2ZDVH 3SU4A 1CHOG 3I77A 1BTUA 4WMEA 2FODA 4A1XA 1QGFA 3FP7E 1Z6EA 3RXIA 1H1BA 1FLEE 1VITH 1MBQA 3CS0A 1S6HA 1ARCA 2SNWA 2J2UA 1P2OA 1DWEH 2IJOB 2PTCE 3AW0A 3U9AH 3RXJA 1W13U 1A46H 1GBJA 3MH6A 2ILNA 3MU0A 3ZZ7A 2XC0A 1LTOA 2VIWA 3TGJE 1DT2A 1P9SA 4HTCH 1TNLA 1TGNA 1Y59T 2ZNKH 4IC5A 5AFZH 3RXMA 1G3EA 1W7XH 1HAYB 1UVSH 1DXPA 1BTZA 4E06H 2C4FH 4GAWA 1HFDA 1BTXA 1UTKA 4FVBA 5AF9H 3SJIA 2R0KA 4I8HA 3BG8A 2Z3CA 2Z9IA 1E37B 1O3PB 1O2TA 3RLWH 3U1JB 2XW9A 5A0BA 3BIUH 3UNSA 2ZDKA 5EOKA 4GHTA 2FYQA 3LGTA 3PWBA 1O2XA 5DO4H 1MKXH 3TK9A 1O38A 1BQYA 4ZROA 3A82A 2BXTH 1TAWA 1Z7KA 1EX3A 2G8TA 1HXEH 3KCGH 1O35A 2SGEE 1ZGVA 1G30B 1SGQE 3R0FA 4R0IA 4Y11E 1RFNA 2C8ZB 1SGCA 1NN6A 2PUXB 4X6PA 2AEIH 3UQOA 4O3TA 3LGYA 2FEQH 1DSUA 1EPTB 1GI8B 3SO3A 1E34B 2BXUH 2A31A 2ZDMA 1O3OA 1HJAB 3ATWA 3RXOA 1KSNA 3GCHB 1HNEE 4CREA 4X1SU 1H9LB 1AVXA 3QLPH 1CBWB 1V2JT 1F7ZA 4AFUA 1SLXB 3FVFB 4FUJA 1K1PA 5GWZA 5FPYA 4HGCA 1CGHA 1A0LA 5J4SA 4DOQA 1FPHH 1UK4A 5E0HA 1GHAG 2XNIA 2ZGXH 3UR9A 1LQEA 3MNCA 2FLBH 3QUMP 4IBLH 2HNTE 3P70B 5TCCA 1O2LA 1NFXA 3NUMA 1Q2WA 4JCNA 4WH6A 1QRZA 1SLVB 4NA8A 2D1JA 2BDYA 3LGUA 1MKWH 2PSYA 2ZF0H 2ZIQH 3SI3H 1UTPA 2THFB 1WBGB 2EI7A 1C1RA 1PPGE 2B7DH 1D3DB 1HBTH 1XVMA 4JYVH 1INCA 2G51A 2TBSA 4ZKRU 1W0YH 3V3MA 3SNAA 3AAVA 4CRFA 4B1TA 1SOZA 4UONA 4XSKU 2Y5HA 1YPMH 2W7SA 1CGJE 2OUAA 2OQUA 1WUNH 3E90B 1A61H 4DIHH 5A0AE 2FOEA 3VB6A 1DWCH 1DX5M 2A2QH 1MTVA 3MU4A 1NROH 3F9HA 3RC4A 5DP5A 2P94A 1MD7A 2NU3E 1LMWB 3D49H 4KP0A 3RXSA 2ZZUH 1ELAA 5JB9S 5TCAA 3SJKA 5DP4A 4Q7XA 1C1QA 3RU4T 1GBLA 2ZI2H 1NRNH 2YOLA 3E3TA 1A0JA 4IC6A 4AX9H 1LPZB 1OXGA 2FM2A 1AB9C 1PPZA 4J1YA 1E38B 1GL0E 2W3KA 3BTDE 1TB6H 2ZQ1A 1C2EA 1AZZA 1Z1JA 1DOJA 5CHAB 5LPEA 5ESBA 1O3KA 2C8YB 2R0LA 2OBOA 5L6NH 2BVRH 1P06A 2JKHA 4YM9A 2P16A 1V2QT 3UREA 3I29A 4B71A 2ZTXA 1O32A 1CT4E 4PROA 4THNH 1ABJH 3RC5A 1FDPA 5EQSA 1SGPE 2ZKSA 3LT3A 5GIBA 4B76A 5C67A 2XBYA 2BLOA 1P0SH 1XX9A 1GI4A 2Y5FA 3A87A 3UY9A 3ZZ9A 1FJSA 2C93B 1BRBE 1C5NH 3T25A 4I32A 1X7AC 1J9CH 3MU1A 3RXUA 3UNRA 3V7TA 2F9OA 2OCVB 3BTQE 5GCHG 3SNDA 4OS5A 1QHRB 1BIOA 1MKXK 1EB2A 2SGQE 1H9IE 2W3IA 1F0UA 1GHBG 4IMZA 5T6GA 2XBVA 5HM2A 3TGIE 1GWAA 1J14A 4AZ2B 3GCOA 1ELCA 2BDIA 4NGAH 4A7IB 1RGQA 1GBTA 3PO1C 1FAKH 2FI5E 3Q3KA 1P2MA 2BDHA 1XXDA 1C5UA 1G2MA 3V13A 2Z3EA 3T29A 1ZSKA 1QB1A 1GJ6A 1EXFA 4IS5A 2F9BH 3PWCA 1NESE 3FP8E 1IQMA 4O97A 1UVTH 2FX4A 1WQVH 1GHVH 4JK5A 1GBEA 2FOCA 3Q00A 2VVUA 1NRQH 3SU2A 1N8OC 1TPSA 6CHAC 4AB9A 4AGJA 2A7JA 1YYY1 2GKVE 4OS2A 2BHGA 1MCVA 1BHXF 1Q3XA 1KLIH 2CHAC 1JIMA 3RMNH 3RXDA 2FTLE 4D9QA 1GI2A 1CA0B 4AYVB 6GCHF 1FY4A 4IN2A 1O36A 2BY9X 5F6MA 2ZU1A 5EQQA 3RXEA 4AG2A 3U69H 1HAZB 4I33A 1FV9A 4FU8A 4X6NA 4NCYA 1DSTA 2QCYA 1GJBB 3LDXH 5BPEA 2QGRA 1YPLH 1EAXA 1FY1A 5EQRA 4ABBA 1C2LA 1C5VA 1TIOA 2DE8A 2FLRH 1P10A 1DXWA 4X8TH 1C1NA 3LH3A 4F4OC 1GBAA 2ZHQH 4UFDH 1PQ5A 1SI5H 5K0HA 4FUFA 1LHGH 3V12A 1BRCE 1MU6B 2VIVA 3SORA 2BQ6B 1SQOA 3BTTE 1LVBA 1AWFH 3MH4A 4I8GA 1S83A 1HAGE 3A7VA 1GCTB 4YT6H 1FY8E 1PPHE 2ANYA 1W14U 1UHBB 2OLGA 1DS2E 3PROA 5JYIA 1KYNA 2BVSH 2ZECA 4YESB 1LPGB 2STAE 4ZUHA 1O34A 1ZRBA 1NRSH 1THRH 3BEUA 1QJ1B 4XE4A 5DP3A 1GVZA 1MU8B 3S7KB 2AMDA 2GCTC 3ZV8A 1BITA 2K1QA 1LO6A 5TJXA 1TX8A 2BY6X 3M5LA 1G9IE 1NZQH 3S0NA 2FO9A 4GPGA 3HK6B 4Y8YA 1BMMH 2ZEBA 4WMFA 1O5BB 5E0JA 1BMAA 1FNIA 2BDAA 2VGCB 4ABIA 1C1PA 1YPHE 2ZCLP 1J15A 2XWBI 3OTJE 2P3FH 3LJJA 1FI8A 1UCYH 2P3TB 4XDEA 1PQAA 1IOEA 4NZLA 1SGNE 1TGSZ 1QBNA 1CT0E 2PW8H 1EZQA 1CE5A 1RTKA 1SBWA 2SGFE 3SHCH 1O2MA 4RKOB 1YPKH 1GPZA 1AMHA 4YOIA 1IQLA 4K60A 4ZHLU 3MU8A 1OYQA 1OKXA 4K1TA 2TGTA 4H6SB 2V6NA 1W3CA 3LC3A 1GGDB 1Y5BT 4HI3A 4D76A 2Z94A 2ZCHP 4NSYA 4UFEH 1LQDB 2PUQH 5F03A 2QY0B 9LPRA 1C2DA 3ZZ3A 3W94A 3M5MA 1AKSB 4FU9A 3OX7U 4HFPB 2HALA 4H4FA 3N7OA 1HUTH 2FYRA 2AH4X 1E35B 1SSXA 2Z6BD 3SV9A 5DP8A 3A7TA 1O0DH 2G52A 1LHEH 2VB0A 1G3DA 4OS4A 1ELVA 3O8DA 3BEIB 3UOUA 2H1UA 3SHAH 1D6RA 1H4WA 1C5WB 3R3GB 1P3CA 3H5CB 1EQ9A 4B2BA 1VGCB 1K1LA 2IN2A 1O2GH 3HKJB 1HGTH 3UFAA 1A4WH 1P2IA 3A7XA 2ZC9H 1T8NA 2WPKS 4X1PU 5DG6A 5FCRA 4AFZA 2HWLB 2PTNA 1MAYA 4DJZB 1K2I1 4I8LA 4NFEA 1UHBA 3F6UH 1WV7H 4RN6A 4ASHA 3MO6A 4A1TA 1KXEA 1LPKB 2BM2A 3KQCA 1BJVA 3GDUA 3GOVB 4U2WA 2BVXH 3M5OA 3TNTA 1QCPA 3UWIA 2Q6FA 3GCTG 1NS3A 2PKSB 3SUFA 2G5VA 5CMXH 3RXGA 1FY3A 4CHAB 1O2YA 1OWHA 2BY5X 1W10U 4GCHF 3A8DA 1OS8A 2ULLA 3HGPA 1GI9B 3CENA 4MNYA 1UVPA 1GMHF 1TOCB 2WPIS 1XXFA 2UUYA 1QY6A 4AGKA 3FP6E 4GHQA 1GG6C 1TE0A 3RDZA 1C4U2 1S84A 2AS9A 1ZHRA 1VJ9U 3GY4A 2UWLA 3ATMA 1HDTH 1LVYA 1ZGIA 1GMDF 1GMCG 1TMBH 1ZSLA 3BG4C 2BMGB 4B2CA 2H5CA 1DFPA 3PTNA 3SV6A 1SMFE 3RXFA 2GX4A 1IQIA 1BUIA 2O8WA 3E0PB 5JBCS 2GDDA 2UUJB 1QURH 1AKSA 2P8OC 1WYKA 7ESTE 2BDBA 1OP2A 4IN1A 2BY7X 1P12E 3LJOA 1P2QA 1O5DH 1THPB 1YLDA 1Y3VA 1DUAA 5DP6A 3T26A 4TWWA 1UCYK 1O31A 3BTGE 3BSQA 1DANH 2FXRA 3P92A 3TITA 2BD4A 1GHXH 1ZMJA 1RRKA 5JPMH 5EW2H 4Q80A 1SGTA 5FCKA 1QR3E 4SGBE 1TNIA 3SV8A 5EPYA 2HRVA 4OS1A 2HLCA 1L2EA 4SGAE 3K9XB 1MTNC 2J38A 1TWXB 4NIWA 1TGCA 1H9HE 4OS7A 2FX6A 1PPEE 1Z1IA 3BN9A 2ZU2A 4UE7H 1GJ8B 3LKWA 4INLA 1YCPH 1WTHD 3C1KA 2FS9A 2R9PA 2QC2A 5EXMA 2ZPSA 4ABDA 1A0HB 5HM9A 1NC6A 4H42U 3M61U 3F9EA 1ZMLA 3M3TA 2ESTE 1TNJA 3ATIA 1NTPA 2BDGA 2H9HA 1SGFA 4UD9H 4WMDA 2CF9H 1VITG 2FP7B 1F5RA 2FOHA 2GCHF 1SLUB 2EI8A 1B5GH 3F9GA 2JH5D 3SJ8A 4FUBA 1ELGA 2YNBA 2GMTC 4DURA 1VCWA 4WWYA 1P2NA 1TONA 1K1NA 1QB9A 3PMJA 3TK5A 4AFSA 1GBMA 1GJAB 1L4ZA 9ESTA 2G81E 4UFFH 3M7UA