4AG2A

Human chymase - fynomer complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
226
structure length
223
Chain Sequence
IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHYMASE
publication title Generation, Characterization and Structural Data of Chymase Binding Proteins Based on the Human Fyn Kinase SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/de novo protein
total genus 51
structure length 223
sequence length 226
chains with identical sequence B
ec nomenclature ec 3.4.21.39: Chymase.
pdb deposition date 2012-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ag2A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ag2A02
5C20A 2OCVB 3T28A 1M9UA 1XX9A 1B0FA 2BLWA 1EAUA 1O39A 1CQQA 2SGDE 4TYDA 1GBMA 3UWIA 3JZ1B 3M5NA 3FZZA 3UQOA 3PMAB 2J9NA 2QN5T 4XBBA 3T29A 3M5OA 4IMZA 5GWZA 1BTPA 3RXVA 5JBBS 5DP6A 3UFAA 4E05H 4FXGH 3RXEA 3AAUA 3S9AA 1GI4A 3RXAA 3SU4A 4AFUA 4CRBA 4Q7YA 1IHSH 1YF4A 1FMGA 1MU6B 4CH2B 8GCHF 1S5SA 1O2VA 4Y0ZE 4ZMAH 1K1IA 2OC8A 1T32A 2DE8A 4Y8YA 1WAYB 1O3BA 2A32A 2Q6GA 2FOFA 1ZRBA 1GBIA 2FI5E 1FONA 1HDTH 4F49A 3MU8A 1BIOA 3M7TA 1MH0A 4GPGA 3A8CA 3RMOH 2PUQH 3QZRA 2Z6BD 3ZVEA 4AYYB 1W0YH 5A8XA 1XKBC 3CS0A 1YLDA 1YP9A 4YZUA 1O3FA 1J14A 2BY9X 2Y82A 1O3IA 2B8OH 2NWNA 5EPYA 5EW2H 3G01A 1EPTB 1P11E 2OLGA 4LK4A 3F9HA 2A5IA 3BF6H 4RKJB 1G32B 4FUCA 2ZG0H 4AX9H 1LO6A 1GL1A 6LPRA 1EAIA 5DGJA 2ZFPH 3RC5A 1YPHC 3DA9B 2GT8A 2SGEE 3D49H 5FX6A 3N7OA 1P06A 1TA6A 5FBIA 3STJA 1CE5A 2W7UA 2BDCA 5L6NH 2Q6DA 1Q3XA 2B7DH 4VGCC 4XDEA 2D26C 2FOCA 1IQJA 3RMLH 1BQYA 1NRPH 2GVFA 3DFLA 1LPZB 4OS2A 1KTTB 2PKAB 3UWJH 1C1VH 2XBYA 1LHDH 1C2FA 1GHXH 1P9UA 3MI4A 2FM2A 3EE0B 1AZ8A 1AUJA 2BQ6B 3OYPA 3SV8A 3KGPA 4HGCA 5L30H 5HYOA 2HLCA 1CU1A 1J9CH 3A8AA 1TNIA 1JRSA 1NY22 5SGAE 2ESTE 1NRRH 1HAYB 1LVOA 5EQRA 2ANYA 1DXWA 4YT6H 1A0JA 4ABEA 2ZU3A 5AF9H 2Y81A 2A2XH 5C5NA 1BA8B 3RU4E 1TX8A 5FPYA 2R0KA 5C1UA 2A4OA 1ELBA 2A7CA 4INKA 3E6PH 1FLEE 1TQ7B 4NWKA 2BVXH 1U6QA 1O2NA 2XCNA 4I8LA 4R8TB 1QL8A 1V2OT 2A5AA 3RM0H 3SU5A 2VNTA 3SU2A 1V2LT 2A7JA 3B9FH 2Z94A 1EPTC 2PGBB 3TU7H 4X1SU 4UE7H 3S0NA 1JXPA 4BAMB 1BMMH 3SUEA 1UTNA 5JB8S 3DFJA 1ARCA 1BZXE 4MLFB 4BANB 1EB1H 1L1GA 5F6MA 3QTOH 1T4UH 4CBOA 4ZHAA 1EATA 3QGJA 5T6GA 1XUIA 2ZGXH 2QCYA 1YGCH 1UJ1A 5JPMH 1ZR0A 2HALA 5LGOA 1RFNA 2ZU1A 3TVJB 1SGEE 4Q7ZA 1TLDA 2AGEX 4YOIA 4KTSA 1TB6H 1O2TA 2VJ1A 2XBWA 3U8TH 2BDIA 1XM1A 2C8WB 1IQEA 1D3QB 2ZTZA 4CREA 2C4FH 2NU1E 1CHGA 2O8LA 2Q6FA 1K9OE 5L2ZH 1L4DA 5A8ZA 2FOGA 1DANH 3TGKE 2CMYA 2ZCLP 1Y5AT 1QB6A 3TH4H 1NU9A 2OC1A 4TPYA 1V2WT 1ZTLA 3RMMH 5CHAB 3PV4A 3RXJA 3SZNA 4A7IB 2BD3A 3A82A 3GDSA 3MNBA 4BAOB 4D9RA 1DDJA 2G55A 1MBQA 3RXSA 1D9IA 1MAYA 2WPJS 4K5ZA 4GCHG 8KME2 4WMDA 4FUIA 2ODQA 2OTVA 1HIAB 1E0FD 4INHA 1O5AB 1O37A 1KIGH 5TJXA 4ZROA 1ETTH 1EZSC 1Z71A 2AGGX 3BG4B 5HGGA 1BDAA 1ETRH 5DK1A 2ZKSA 1ZMJA 5A8YA 4X6MA 2FODA 3ZVDA 1ZGIA 1E37B 1HPGA 2R3YA 1DY8A 3L33A 2ZEBA 1BRAA 1O36A 1BJVA 1Q2WA 2VIOA 2BD5A 3GY5A 4FU8A 4AFQA 3TJUA 1TMUH 2BMGB 1H8IH 1KLIH 3BTME 1DLKB 2AH4X 5FBEA 1FI8A 1SGTA 1GMCG 3LJJA 2ANMH 2TRMA 1SB1H 2P95A 4NZQA 1DFPA 4Z6AH 4I8JA 2VH0A 3VB4A 4BXWA 1S84A 1YPJH 1G3CA 4IN1A 2R2MB 1MTNC 1V2KT 1TPAE 4B73A 1Z8IB 3GY7A 1NFXA 1D6RA 1Y3UA 2J38A 4D7FA 2QC2A 3BEIB 1C5WB 4WMEA 5HM2A 1NRNH 3P17H 3W94A 2ALVA 2FESH 5E0JA 2WV4A 1DE7H 1GVZA 5EW1H 1KLJH 1A5IA 2AFQB 1V3XA 3EQ0H 4ABIA 1TA2A 2PSYA 3ZZ4A 1CVWH 4UEHH 4ABBA 1UTLM 4CHAB 2BD9A 4WH6A 4GCHF 1C5NH 2XBXA 3H5CB 5E8EH 1GI7B 3EA7A 5FX5A 3U1JB 2UWPA 2VWLA 2Q1JA 4XBCA 4Y11E 2ILNA 1XXFA 2ZTXA 1RRKA 7KMEH 1CBWB 4JYUH 1P3EA 3T5FH 1Y8TA 1ESTA 1C2LA 2OQ5A 1S6FA 3ZVCA 1DWCH 2ZQ1A 1VR1H 2BHGA 1VJAU 1GCTC 4WJG2 4M7GA 3SUFA 1BMAA 1MTUA 2FI4E 4IW4E 2GCHG 1QL9A 1IQHA 1TOCB 3E91A 1GMCF 1HJAC 1EP6A 3RXTA 4X6OA 4Y79A 3FP8E 2Z9KA 1TGNA 1UHBB 3LH3A 1IQNA 2V3HH 1QA7A 1TE0A 2GT7A 2FOAA 3M7QA 1G3DA 1HJ9A 1L0ZA 2ZCHP 2ZHEH 2IJOB 2TGPZ 3A80A 2GD4B 4NSYA 1ZTKA 1EXFA 3RXFA 4DG4A 1MBMA 3SV7A 1S0RA 4FUGA 3L3TA 1UVSH 1O32A 2BD8A 3B8JA 3ZV9A 1MU8B 1KDQA 1D6WA 1C5OH 3A89A 2HPPH 2OBOA 2C3SA 4ABAA 1RIWB 2FPZA 2EEKA 3RUOA 2WV5A 1Z8RA 2G5NA 1A46H 3KQDA 4YESB 1LQEA 1P3CA 3NWUA 1AKSA 3TGJE 3TNTA 3R3GB 3EGKH 3KEEA 1GBBA 5LPEA 1ZPZA 3HK6B 3F6UH 5F03A 1UTPA 1UVOA 3SV9A 2A7HA 3QTVH 2WPMS 4NSVA 1XUJA 3FVFB 3ZZDA 1FY4A 2IOTA 2VVUA 4MPWA 3SO3A 3UREA 3MHWU 1C5PA 2FWWA 4JK5A 1E36B 1EZXC 2SGAA 1DOJA 3UIRA 3TGIE 2GCHF 1NFUA 3BIUH 1CBWC 1K1OA 3EA9A 3ZZCA 4X2WA 1DSUA 4ZHLU 4HTCH 3SOSA 1O2KA 4SGAE 1FN6A 4ZKNU 1CGHA 1TPOA 3LC5A 4X8SH 2H6MA 3KL6A 3RM2H 3TLOA 1UTOA 2F9PA 1ZZZA 1A3BH 1AE8H 3SUDA 1O3PB 1HAPH 4UFGH 1HLTH 1PPGE 1TX6A 2VH6A 3LGUA 4BAHB 2CF9H 2SGPE 4I7YH 1V2VT 1TNHA 2JH6D 1UVPA 4O3UA 1OWEA 2ZP0H 4Z0KA 1P2NA 3PO1B 1L2EA 1GJ5H 2QXJA 1DX5M 1FDPA 1Y5UT 4Y0YE 1T4VH 3F9GA 5CE1A 5A2MH 1TPSA 1B0EA 2FOHA 1KXCA 2PLXA 4AOQA 1RTKA 1SGNE 3LC3A 3LOXA 4UFFH 1YPLH 4OS6A 4UD9H 3SGQE 4AFZA 1YKTA 5TCAA 4DGJA 3FFGA 1A61H 3ELAH 5F8XA 1LHEH 1O2XA 1P03A 3LT3A 1O2QA 2C90B 2ZDVH 4ZH8A 2ZI2H 3UR9A 2AS9A 2PSXA 3BTTE 3RMNH 4YM9A 1OWDA 3UNQA 4D8NA 4B75A 3E0NB 1UTJA 1RTLA 4YO9A 1GHBF 1QR3E 3HGNA 1Q31A 2HWLB 3P70B 2I6SA 1DY9A 1BRBE 2ZECA 2UWOA 5DP4A 2WPHS 1TNKA 1EJAA 1ZRKA 1F5RA 1HUTH 1HAOH 2VU8E 5GPIB 3C27B 2YOLA 5PTPA 4B2CA 1YLCA 3FP6E 4ABHA 1GPZA 3SHCH 1GHVH 3KF2A 4I31A 3TK5A 2ZNKH 1O5GH 1GI3A 1UTKA 2GZ9A 7LPRA 4AB8A 3TJNA 1DM4B 1SGFA 4ISIH 1QJ6B 4IMQA 1SSXA 1FAXA 3Q77A 3TIUA 2BM2A 1HAVA 1OWKA 2ZHFH 1NU7B 3SV2H 1QQ4A 2GZ8A 1DITH 5A0AE 3GCTG 1V2TT 3GCHB 2P8OB 5E2OA 2SGFE 2IN2A 1FN8A 2UUFB 2ZFSA 1J8AA 4VGCB 2Y80A 2ASUB 3BV9B 2ZO3H 1DXPA 4JZDH 4OGXA 1WV7H 1ZPCA 3PTBA 1QHRB 1AFEH 3URDA 5F8TA 1LQDB 1GI0A 2WYGA 1W7XH 1IOEA 1GVLA 2WUBA 1Z6EA 3SQEE 3VXEH 4XOJA 1F5KU 2A1DB 3M37A 1D4PB 1SLXB 1ZHRA 2PTNA 3RC6A 1WCZA 1IQGA 2HOBA 2TGDA 2VGCB 1QRWA 1RS0A 2XBVA 3PMJA 1ZSKA 3PO1C 4I32A 1C9PA 5EXNA 4NIXA 4YLUA 1AE5A 3UNRA 1EX3A 1C5MD 4ZXYH 4IC5A 1PPFE 1RGQA 1XXDA 1XUGA 2PHBA 1HV7A 1F0TA 1UTQA 3RXOA 1SGPE 1UK3A 3Q76A 1QB1A 1GDQA 1C1QA 1ZSJA 4ZHMU 2ZWLH 3UY9A 1VGCB 1BHXF 3OY6U 1QTFA 3LJOA 1GHWH 1UCYK 3P6ZB 3ZYEA 2ZTYA 1A1RA 1IQMA 4YOGA 2B9LA 4FUDA 2ANKH 1C2MA 1C2JA 1TMBH 1CA0C 1TNGA 4AYVB 1ORFA 1DLEA 2AMPA 1UMAH 2G51A 1AWHB 2AMQA 5DJ7A 1SVPA 4Y7BA 1YPEH 1C1SA 3O8BA 3GCTF 1FUJA 6CHAC 2V0BA 2PKSB 1S0QA 2AGIX 2FS9A 2SGQE 1WYKA 1Z1IA 1EQ9A 1C1UH 1A0LA 2ZDLA 4FU9A 1ZLRA 1ANBA 1D3DB 3SJ8A 1N6YA 1WUNH 4MPXA 3M61U 2QIQA 1TOMH 1Z1JA 1SGDE 3VGCB 1LHGH 3F1SB 3S9CA 1GJBB 3GCHC 5EU8A 2P8OC 3OU0A 4H42U 1XVMA 3NPSA 6GCHG 3GYLB 1EZQA 2FMJA 3ZZ7A 2H9HA 1GWAA 3URCA 4FVBA 3T27A 2STAE 4BXSA 4AORA 3TJVA 3VPKA 3SNDA 3ESTA 2G81E 1C2KA 2VGCC 3V3MA 3UR6A 2F9NA 1PQ7A 2FTMA 1O3GA 1OXGA 3ZVBA 4WH8A 3LKWA 4RKOB 1W10U 3V13A 5EOKA 4U2WA 4ESTE 1V2UT 1LVYA 2BVRH 2C8ZB 5EXMA 3BEUA 1A4WH 1AY6H 1CT2E 5FCRA 5DG6A 5CMXH 1K1PA 5C1YA 2Z3CA 4FVDA 1F7ZA 1O31A 3KNXA 2H2ZA 2GDDA 2P3TB 3LGWA 2VIWA 1VGCC 1C4U2 2W3IA 1V2NT 2AYWA 1SQTA 2QV1A 4KGAA 1J15A 3OX7U 1JBUH 2Z9GA 1C1PA 2AMDA 2ZPQA 3AAVA 4HZHA 4A1VA 1HYLA 1FZZA 1W3CA 3RXHA 2XC5A 2QYIA 5TCCA 3GDVA 3BTDE 4OS4A 1O38A 4X1QU 1TBQH 2PKSC 2FOEA 1EAXA 2XCFA 1NRSH 1TABE 2O9QA 3DD2H 2Y5FA 3A7ZA 3PMBB 2CGAA 1D3TB 1MTNB 1SPJA 1TAWA 3ODFA 3W95A 3VGCC 1SHYA 2PGQB 3MU4A 1DUAA 1GJ8B 1P2KA 4K3JA 1C5LH 4MNYA 4TWWA 1L1NA 1A3EH 3MMGA 1W2KH 3OTJE 2W5EA 2DUCA 1TGBA 1YPGH 7GCHG 2P93A 4TY7A 5DKMA 1DS2E 2BDGA 2NU0E 4AGJA 1GBKA 1FNIA 1KSNA 3ZVGA 3QUMP 1H9IE 2F9UA 1N6XA 1MAXA 2BQWB 1ZJKA 3SUGA 3A7VA 1ANDA 2A4RA 3Q3KA 9LPRA 4JK6A 4OS1A 2WINI 5AHGH 4Y71A 1AGJA 4ZKOU 1BT7A 1G37A 1MTWA 1T8LA 2P3UB 3BSQA 2ZHQH 5EQSA 1PPCE 1OKXA 1MKWK 3FZDA 1J16A 1O5FH 4ZAEA 1AMHA 2QXIA 4CR9A 2QXGA 2ZDNA 2FYRA 1H8DH 2Z3EA 3E90B 1GCTB 1JWTA 2G00A 4K2YA 3LU9B 4ABGA 3PWCA 1N8OB 3BTEE 1BOQA 2ZGJA 1QRXA 4DURA 2A4GA 4GHTA 1HJAB 1QL7A 1ELDE 4DY7B 2BDYA 1F2SE 1BB0B 2FI3E 3RLWH 1DPOA 5BRRE 2V3OH 4BOHA 5HXFA 5I25A 1YPMH 1SI5H 1Y59T 1WBGB 3D65E 2AEIH 1SLVB 2GCTB 1A2CH 3LIWA 1QCPA 1V2RT 3ATMA 3BTQE 4MDSA 1G2LA 1O3EA 3MNCA 1WTHD 1T8MA 2BOHB 2RG3A 2FTLE 3U98H 1FY8E 1FY3A 2GZ7A 1W14U 4LOYH 5HM9A 3A8DA 3BTKE 4I8KA 3U9AH 2DE9A 4DIHH 4AG2A 1QY6A 3ITIA 4DJZB 7GCHF 3LDXH 4DOQA 3GICB 3GY8A 1FJSA 2O8UA 1S6HA 1AN1E 2HNTC 1BBRK 1P02A 1GI2A 3PTNA 4JCNA 1MCTA 4O9VA 5ETXA 1K28D 1WQVH 4JYVH 3CS7A 2D1JA 4XFQA 1QBNA 2GV7A 1P04A 3KIDU 2ZGBH 4X2XA 2ZZUH 1P09A 1GI1A 2BLOA 3KQCA 1ELTA 1JIRA 1ACBE 4E7NA 2R2WU 1O2WA 1O3AA 1QJ7B 5EG4A 5K0HA 1S85A 2H9EH 1BTWA 3RLYH 1LMWB 2A5KA 2QXHA 4CRGA 1BITA 1NESE 3R0FA 2YNBA 2F83A 1HRTH 1PPHE 1OYTH 1SBWA 3LGYA 5LPRA 4FUFA 2FLRH 1ESBA 3GOVB 1GBTA 2VWMA 3QX5H 1LPGB 2BXUH 1UCYE 1W11U 3MH7A 3FAOA 3UQVA 2QF3A 1OS8A 1SGQE 5GCHG 1QFKH 1BCUH 3UUZA 3MWIU 1WQSA 1SFIA 2C8YB 1KXFA 4KELA 5L2YH 1N8OC 5GDSH 1GJAB 2TGAA 2FZZA 1OWIA 2RA0A 2RA3A 4IBLH 2Z7FE 4ZXXH 4I8HA 1IHTH 1HAGE 2BQ7B 1A0HB 1SQAA 2A4QA 2BX3A 2A45B 1G2MA 1GBLA 2CF8H 1Y3XA 1ZPBA 4GAWA 5A0BA 2GCTC 2WPKS 3SNCA 2BTCE 3GY2A 5E2PA 2R9PA 4KTCA 2ZC9H 3VB5A 2BD4A 4MPUA 2OBQA 3TJOA 1ZTJA 3TK9A 3QWCH 1TBZH 4FUJA 1HXEH 2PKAA 3H7OA 1TWXB 4YLQH 3PM3A 2UUKB 1AU8A 1VITH 2ZU2A 3LGVA 3SV6A 1FV9A 2BLVA 3K2UA 2BLQA 1TMTH 1K1MA 4E06H 2G4UA 3M36A 3A81A 1CGIE 5T6DA 1O5EH 2H1UA 3A84A 4X0WU 3SJIA 3E8LA 3EDXB 1B7XB 1DSTA 3QDZB 3DHKH 1V2PT 1HNEE 3D23A 2JETC 3STIA 3ZZ3A 5GXPA 4UONA 1GDNA 3RXGA 3T25A 4D7GA 3H7TA 3TK6A 1UCYH 1P2MA 1GHAG 4CRFA 3SJ9A 1ELCA 4IS5A 2KAIA 3O8RA 1AIXH 4DW2U 3ZZBA 3AW1A 4YOJA 5GCHF 4JZ1A 1TRYA 4O3TA 1DUEA 1HFDA 5T3HA 1HB0B 1MQ6A 2BDHA 1BTUA 1P12E 4DIIH 1UVUH 3BIVH 2Y5GA 1TGSZ 1O0DH 1TALA 1GI5A 1MZAA 3QLPH 5FPSA 4XSKU 1K21H 4WXIA 3UNSA 5LPFA 2EI7A 4NCYA 4TPIZ 1P9SA 4NA8A 1C2IA 1ELGA 2GKVE 2P94A 3Q00A 4JYTA 4YTAA 3RXIA 1DWDH 1KXEA 4AZ2B 2QGRA 4U32A 1JMOH 3K6ZA 2ZU5A 3S9BA 3SNBA 1T7CA 1XUKA 1P2QA 8ESTE 1D3PB 1O2SA 1EOLA 1EAWA 1AVGH 4FUEA 1O3LA 1N1LA 2UWLA 4B2AA 4D76A 1GBJA 1V2ST 3S69A 4O03A 1C5RA 4A6LA 2CJIA 1O2OA 2SNVA 4JZEH 1NN6A 1YPHE 2V35A 2P16A 2HPQH 4K1TA 4BTIB 1H4WA 3MU1A 1P57B 3SI3H 1O2RA 1P2OA 1FY1A 3OSYA 3RDZA 3P8OA 4ASHA 3GYMA 5FCKA 4B76A 1VITG 2GP9B 3P8GA 1GHAF 1SFQB 1AQ7A 1K2I1 1O3HA 2P3FH 3GY4A 4RN6A 2JH0D 1FPHH 2FLBH 2GTBA 3A7YA 5T6FA 2OQUA 2XXLA 3RXPA 2A31A 3A8BA 2OC7A 2ZGCA 1CA0B 3A86A 3ATWA 1WU1A 5GJ4B 3MU0A 5DP8A 2OD3B 1LKBA 1ELVA 1GBHA 1F5LA 1HIAA 2NU4E 2Y7XA 6CHAB 1AB9C 1SGYE 3HPTB 4AGKA 1ANEA 3HKIB 2Y5HA 3NK8A 2D8WA 1UVTH 3MH5A 1BMNH 1GL0E 1MQ5A 4GLYA 2YNAA 2XRCA 1H9HE 4MVNA 4ABDA 1O5DH 1OPHB 3VB3A 3TNSA 1QGFA 1C1TA 2ALPA 2ZPSA 4NWLA 2TIOA 1OP2A 3ZZAA 3S7HB 2AIPA 2BZAA 1F0UA 1LHCH 1MTVA 2J95A 4NGAH 2BDBA 3E1XB 1YBWA 4X1PU 1FXYA 1ZMNA 2VIDA 2BOKA 2G52A 1HBTH 2STBE 3SHAH 1O2LA 1X7AC 4ZUHA 5JDUB 1INCA 2ZFTA 5FHTA 2OP9A 1O34A 1VITF 2VIVA 5C1XA 3WY8A 4RSPA 1LVBA 3BN9A 2ZHDA 4FUHA 4X8UH 1Z6JH 3OY5U 1O3OA 1BBRE 4UFDH 1MCVA 3UTUH 2PTCE 1EJNA 4R0IA 1GDUA 2OINA 1AO5A 1A5HA 1ZHPA 2W3KA 3SORA 4DCDA 4X1RU 2FX4A 3D62A 1CGJE 1SMFE 3A83A 2EC9H 1TQ0B 3KHVA 3MH6A 2AERH 1SG8B 2ULLA 1H1BA 5G4BA 1C4Y2 1MKWH 3RC4A 1Z7KA 3QO6A 1YCPK 3IITA 2ZHWH 1WSSH 3U69H 4BNRA 3SJKA 2O8MA 2HRVA 1UK2A 1LTOA 1G36A 3RXCA 4KP0A 3B23B 3GISB 2W26A 2HGTH 1K1NA 4IN2A 1G3EA 2F3CE 3RXDA 1W7GH 2WPIS 2FX6A 1UK4A 4GVUA 5B6OA 2M5TA 1GBAA 2XTTB 4Y10E 3U8RH 3K65B 3LH1A 4LZ4B 1BMLA 5DPAA 1WOFA 1KTSB 1ZJDA 4SGBE 1LCYA 4O97A 3ZVFA 1KY9A 2ZPRA 1C5YB 2VWNA 1GBCA 2QY0B 1EB2A 1AUTC 2WYJA 5IYTA 1GJCB 1GI9B 1NPMA 2ZFRH 3MH4A 1YM0A 3P92A 4OS7A 5DP7A 1KXBA 4AB9A 1O33A 1UHBA 2OUAA 4LXBH 4B1TA 1TNLA 1NO9H 4WVPE 1O2ZA 4A5TS 4K8BA 3RXKA 1RXPA 1TFXA 2CV3A 4YT7H 4H6TA 1OX1A 1NT1A 4WY3A 2VINA 1PQAA 2HVXA 1A7SA 2EI8A 1Z8JB 1BBRH 5A0CA 1Y3VA 2UUJB 1VJ9U 5JBCS 5DO4H 3AVZA 1C1RA 2J34A 1EASA 4X1NU 5K7RA 4BTUB 1PPZA 3MNXA 4AN7A 3PLPA 4THNH 2Z9JA 4Y6DA 4Y76A 1O3DA 1Y5BT 1BUIA 3M3TA 2F9OA 4Q80A 2BXTH 1CT4E 1TBRH 4BTTB 3F9EA 3QN7A 1P2JA 3IWMA 4NIYA 1JIMA 1BTZA 2OC0A 4NG9H 2CHAB 4WF8A 1GHYH 3SQHE 1KDQB 2HNTE 3SGAE 3V12A 1HCGA 2H9TH 1FQ3A 2BVSH 2BY6X 1DWBH 2I6QA 3RXLA 1W13U 4Q7XA 5ESBA 1OSSA 4H4FA 1MUEB 1EZUC 5J4SA 2BD7A 1HAHH 1MKXK 2VVCA 1AKSB 2A2QH 2FYQA 1NZQH 3KQBA 4K1EA 4U01A 2FS8A 1TGTA 1C9TA 5HMAA 4X8VH 6ESTA 4CRCA 2GGVB 1FPCH 3IG6B 2B5TB 2WPLS 1VCPA 5FAHA 5AVDA 3HK3B 1PYTC 2ZU4A 1AVXA 1A5GH 1S82A 3VXFH 1ZYOA 3RU4T 1V6DA 4K60A 1XMNB 5H4IB 5C5OA 1TIOA 2KAIB 1BTXA 1LDTT 1BRUP 1PJPA 5JBAS 1GVKB 5EXLA 4Y8XA 3SU1A 2CXVA 1C5QA 1L1JA 3SBKA 4BAQB 1C1OA 1GBFA 1TPPA 1TGCA 3UPEA 6GCHF 3K6YA 2IPHA 3I78A 2JKHA 1RTFB 1YC0A 1S83A 1NRQH 4Q2KA 2ODPA 1ZSLA 2XNIA 4GSOA 3GY3A 4TWYA 5DP9A 3MO3A 1Z8GA 4Y8ZA 1ABJH 2Z3DA 1GMDG 3NKKA 3PROA 1AZZA 1G9IE 1OP8A 1ELEE 2ZFQH 1C1WH 3M35A 3GDUA 4OGYA 1CHOG 1NM6A 3NCLA 1IQFA 1E38B 1TONA 3MU5A 1GJDB 1FIWA 1O2GH 1TX7A 4XBDA 4HFPB 4D9QA 1W0ZU 1DWEH 1GHZA 1QIXB 2QAAA 5JYIA 1QURH 2G8TA 4NFEA 2F9BH 1T8NA 3RP2A 5EQQA 4K1SA 3S7KB 1LVMA 1VCWA 3HKJB 3M3VA 4K8YA 2ZGHA 4UFEH 3V0XA 4J2YB 3E0PB 4UDWH 1OOKB 2C8XB 2CHAC 1O5CB 3A88A 3EYDA 3TH3H 1SGIB 1TRNA 4CRAA 1PYTD 2Y6TA 4ISHH 2B0FA 4ISNA 3SU6A 5GIBA 1MTSA 3MOCA 1DT2A 1GJ7B 1HAZB 3CENA 1O5BB 3KCGH 3SJOA 1K22H 4KKDA 1O35A 1PQ8A 3AASA 5FPTA 1K1JA 2ZCKP 3LGIA 3TH2H 4IGDA 4NZLA 1T31A 1GI8B 2GX4A 2A0QB 4KTUA 1KXDA 4MQAA 4CR5A 5IDKA 3PB1E 1GJ6A 1SOTA 1OWHA 4ABFA 1ZHMA 2BX4A 1MD7A 1K1LA 4I33A 3U8OH 3GCOA 1BRCE 1FY5A 4NFFA 3GCNA 2PUXB 1SQOA 3BTFE 3VFEA 2AIQA 1C1NA 1LPKB 1EJMA 1GMDF 2ODYB 1E34B 3PLBA 5FXLA 4LZ1H 5E0HA 3UOUA 2EA3A 2XWBI 3QK1A 3ZZ5A 1CHOF 7ESTE 2ZA5A 1HAVB 2BZ6H 4X2YA 3P8NA 1FAKH 3ZYDA 2JH5D 2VIPA 1GCDA 4DVAU 2CN0H 5ESTE 4XE4A 2FP7B 3KN2A 1CSOE 1C4V2 2JETB 3LPRA 4ABJA 1O2HA 2D2DA 2ZDKA 2TGTA 1C5TA 3SGBE 2NU2E 3KQEA 1BTHH 1F0RA 1AHTH 1VCQA 1IQKA 2XYAA 1KLTA 4X8TH 3VB6A 4AFSA 3T26A 1BJUA 3BEFB 1C2GA 2BB4A 3P8FA 1TNJA 1PPBH 1XKAC 3SI4H 3UOPA 1G30B 2SNWA 4E7RG 5C67A 4MNWA 1V2QT 5J4QA 3GY6A 4MTBA 3C1KA 4NA7A 2H5CA 4BAKB 3ATIA 2FOMB 2Z9IA 1SL3A 3Q3YA 2R0LA 2FIRH 1XVOA 3RXMA 3A7WA 2H5DA 1GBDA 4IC6A 1EPTA 2GDEH 3PYHA 3SN8A 1C5UA 2PV9B 1SGCA 4GHQA 1O3JA 2VWOA 1OYQA 5JBTA 3CP7A 4B71A 3ZZ6A 1H9LB 2G5VA 3A87A 3MNSA 4JMYA 1O3CA 1HAXB 3ZV8A 1THSH 3MO6A 3M3SA 5CHAC 3JZ2B 2XWAA 2PW8H 2BDAA 3F9FA 2THFB 3VB7A 1NFWA 1ARBA 1EUFA 1O2IA 5EPNA 3FP7E 2PFEA 2FDAA 4JZFH 4MPVA 2FXRA 3NUMA 1P10A 1B5GH 1C2HA 4H6SB 2QF0A 4TY6A 1GMHG 1JRTA 4INLA 1RJXB 5EODA 3BG4C 1LHFH 3MO9A 2UUYA 1HXFH 3MTYA 1QJ1B 1QA0A 3EAJA 3RXBA 3BTHE 3SU3A 2F91A 1SHHB 2K1QA 4X6NA 1FIZA 5A09A 3BTWE 1ESAA 2VVVA 2J2UA 1IQIA 2ZIQH 3NZIA 1UTMA 1C1MA 1MZDA 3SU0A 4CBNA 3ZZ8A 3RU4D 2HNTF 4ISOA 1NFYA 1OWJA 3LONA 4ZKSU 1C5ZB 2G4TA 1WTGH 1O2YA 1SGFG 5EGMA 1S81A 4B74A 3EA8A 1YCPH 3ENSB 1BHXB 2FO9A 2O8WA 8LPRA 4X6PA 1O2JA 1C2EA 2Y7ZA 1NS3A 4OS5A 1O2UA 1AB9B 1P0SH 2OXSA 1ANCA 3RXUA 2GMTB 3HATH 2BD2A 1J17T 4A92A 5E0GA 1PPEE 1Y3WA 1F0SA 2FOBA 4I8GA 3V7TA 1AFQB 3M5LA 5AFYH 4K69A 1QBVH 2TBSA 2J4IA 1ZGVA 1EOJA 5DP3A 1GGDB 3TPIZ 4GUXA 1AI8H 2BY8X 2J94A 3O8CA 1THRH 4CHAC 2ZDAH 1IQLA 1SLWB 3AW0A 4X2VA 4AG1A 1GHBG 1QNJA 1SOZA 2RDLA 1ZMLA 1NC6A 1JOUB 2R3UA 3A7XA 1L4ZA 3ODDA 3RXQA 3TITA 1P2IA 1GBEA 9ESTA 1GMHF 1EP5A 3T2NA 3MYWA 5LH8A 1C5XB 3QZQA 1XUHA 2FEQH 3ZVAA 2BY5X 1ELAA 1MD8A 1W8BH 1BTYA 1GG6B 1NTPA 2WUCA 4WXVA 5C3NA 4NIVA 2P59A 1YYY1 3VEQB 5F8ZA 1GJ4H 2ZQ2A 1THPB 2EI6A 4U30A 1QBOA 4FU7A 3SNEA 4ZKRU 3NXPA 1XUFA 1ID5H 2LNCA 4B2BA 1VZQH 5AFZH 4MNVA 1HJ8A 4FUBA 4CH8B 3L6PA 4JZIA 5DP5A 3BG8A 5BPEA 2ZFFH 2BY7X 3K9XB 3MFJA 4WMFA 1O3MA 1SGRE 1DVAH 4PROA 4CRDA 3ATLA 1PQ5A 1C5SA 2LPRA 5JB9S 1O2PA 2ZF0H 1ZOMA 1O2MA 1UO6A 2Z9LA 4QT8C 1OP0A 3I29A 3ZZ9A 1TRMA 4HI3A 2V6NA 4J1YA 3DT0H 2VIQA 5C2ZA 1CT0E 1V2MT 1MKXH 5I46H 3QGNB 2XC4A 4A1XA 3T62A 1RIWC 2GV6A 2VB0A 3I77A 3E16B 3FANA 1AVWA 1GJ9B 1MMJN 2XC0A 4WWYA 1AD8H 1NROH 1C5VA 1W12U 2C93B 1EKBB 4MNXA 1P05A 2GMTC 2QA9E 3E3TA 1HAIH 1RD3B 4MG3A 4F4OC 1ELFA 1QRZA 1F92A 2SFAA 8GCHG 1AFQC 3F68H 1SC8U 3ATKA 1GI6A 2PR3A 2TPIZ 4NA9H 1SLUB 1GGDC 3PMHB 3Q3XA 3LGTA 3PLKA 1HGTH 3U1IB 1Y3YA 1YPKH 2PWXA 2W7SA 3SW2B 1SR5C 3A85A 1CA8B 2O8TA 3RXRA 1C2DA 1QB9A 2F9VA 1ETSH 1AWFH 3P95A 1O3NA 1O30A 1ABIH 1YCPM 1IAUA 3M7UA 1V2JT 3HGPA 1O3KA 1TYNA 4A1TA 2J92A 2ANWA 3SNAA 1KYNA 1PFXC 3O8DA 4NIWA 1GG6C 4DT7B 4ISLA 1G3BA 1P01A 5ABWA 3A7TA 1KXAA 1DICA 1LKAA 1CO7E 1E35B 2NU3E 3BTGE 1T8OA 3M5MA 3PWBA 3DUXH 4Y7AA 2RCEA 2XW9A 1P8VC 2BYAX 1QQUA 2ZDMA
chains in the Genus database with same CATH superfamily
5C20A 2OCVB 3T28A 1M9UA 1XX9A 1B0FA 2BLWA 1EAUA 1O39A 1CQQA 2SGDE 4TYDA 1GBMA 3UWIA 3JZ1B 3M5NA 3FZZA 3UQOA 3PMAB 2J9NA 5F53A 2QN5T 4XBBA 3T29A 3M5OA 4IMZA 5GWZA 1BTPA 3RXVA 5JBBS 5DP6A 3UFAA 4E05H 4FXGH 3RXEA 3AAUA 3S9AA 3ZIAD 1GI4A 3RXAA 3SU4A 4AFUA 4CRBA 4I86A 4Q7YA 1IHSH 1YF4A 5DSFA 1FMGA 1MU6B 4CH2B 5CDFE 1W0KD 8GCHF 1S5SA 1O2VA 4Y0ZE 5C94A 4ZMAH 1K1IA 2OC8A 1T32A 2DE8A 4Y8YA 1WAYB 1O3BA 2A32A 2Q6GA 2FOFA 2AHME 1ZRBA 1GBIA 2FI5E 1FONA 1HDTH 4F49A 3MU8A 1BIOA 3M7TA 1MH0A 4GPGA 3A8CA 3RMOH 2PUQH 3QZRA 2Z6BD 3ZVEA 4AYYB 1W0YH 5A8XA 1XKBC 3CS0A 1YLDA 1YP9A 4YZUA 1O3FA 1J14A 2BY9X 2Y82A 1O3IA 2B8OH 2NWNA 5EPYA 5EW2H 3G01A 1EPTB 1P11E 2OLGA 4LK4A 3F9HA 2A5IA 3BF6H 4RKJB 1G32B 4FUCA 2ZG0H 4AX9H 1LO6A 1GL1A 6LPRA 3N99A 2YMSB 1EAIA 5DGJA 2ZFPH 3RC5A 1YPHC 3DA9B 2GT8A 2SGEE 3D49H 5FX6A 3N7OA 1P06A 1TA6A 5FBIA 3STJA 2OK5A 1CE5A 2W7UA 2BDCA 5L6NH 2Q6DA 1Q3XA 2B7DH 4VGCC 4XDEA 2D26C 2FOCA 1IQJA 3RMLH 1BQYA 1NRPH 2GVFA 3DFLA 1LPZB 4OS2A 1KTTB 2PKAB 3UWJH 1C1VH 2XBYA 1LHDH 1C2FA 1GHXH 1P9UA 3MI4A 2FM2A 3EE0B 5C0TA 1AZ8A 1AUJA 2BQ6B 3OYPA 3SV8A 5EJZA 3KGPA 4HGCA 5L30H 5HYOA 2HLCA 1CU1A 1J9CH 3A8AA 1TNIA 1JRSA 1NY22 5SGAE 2ESTE 1NRRH 1HAYB 1LVOA 5EQRA 2ANYA 4OM9A 1DXWA 4YT6H 1A0JA 4ABEA 2ZU3A 3NRLA 5AF9H 2Y81A 2A2XH 5C5NA 1BA8B 3RU4E 1TX8A 5FPYA 2R0KA 5C1UA 2A4OA 1ELBA 2A7CA 4INKA 3E6PH 1FLEE 1TQ7B 4NWKA 1H8HD 2BVXH 1U6QA 1O2NA 2XCNA 4I8LA 4R8TB 1QL8A 1V2OT 2A5AA 3SZEA 3RM0H 3SU5A 2VNTA 3SU2A 1V2LT 2A7JA 3B9FH 2Z94A 1EPTC 2PGBB 3TU7H 4X1SU 4UE7H 3S0NA 1JXPA 4BAMB 1BMMH 3SUEA 1UTNA 2XNDD 5JB8S 3DFJA 1ARCA 1BZXE 4MLFB 4BANB 1EB1H 1L1GA 2YMSC 5F6MA 3QTOH 1T4UH 4CBOA 4ZHAA 1EATA 3QGJA 5T6GA 1XUIA 2ZGXH 2QCYA 1YGCH 1UJ1A 5JPMH 1ZR0A 2HALA 5LGOA 1RFNA 2ZU1A 3TVJB 1SGEE 4Q7ZA 1TLDA 2AGEX 4YOIA 4KTSA 1TB6H 1O2TA 5KECA 2VJ1A 2XBWA 3U8TH 4ASUD 2BDIA 1XM1A 2C8WB 1IQEA 1D3QB 2ZTZA 4CREA 2C4FH 2NU1E 1CHGA 1NBME 2O8LA 2Q6FA 1H8ED 1K9OE 5L2ZH 1L4DA 5A8ZA 2FOGA 1DANH 3TGKE 2CMYA 2ZCLP 1Y5AT 2QF4A 1QB6A 3TH4H 1NU9A 2K8IA 2OC1A 4TPYA 1V2WT 1ZTLA 3RMMH 5CHAB 3PV4A 3RXJA 3SZNA 4A7IB 2BD3A 3A82A 3GDSA 3MNBA 4BAOB 4D9RA 1DDJA 3H09A 2G55A 1MBQA 3RXSA 1D9IA 1MAYA 2WPJS 4K5ZA 4GCHG 8KME2 4WMDA 4FUIA 2ODQA 2OTVA 1HIAB 1E0FD 4INHA 1O5AB 1O37A 1KIGH 5TJXA 4ZROA 1ETTH 1EZSC 1Z71A 2AGGX 3BG4B 5HGGA 1BDAA 1ETRH 5DK1A 2YMSD 2ZKSA 3UB0A 1ZMJA 5A8YA 4X6MA 2FODA 3ZVDA 1ZGIA 1E37B 1HPGA 2R3YA 1DY8A 1W0JD 3L33A 2ZEBA 1BRAA 1O36A 1BJVA 1Q2WA 5FL7D 2VIOA 2BD5A 3GY5A 4FU8A 4AFQA 3TJUA 1TMUH 2BMGB 2KZ4A 1H8IH 1KLIH 3BTME 1DLKB 2AH4X 2KCOA 5FBEA 1FI8A 1SGTA 1GMCG 3LJJA 2ANMH 5KGOA 2TRMA 1SB1H 2P95A 4NZQA 1DFPA 4Z6AH 4I8JA 2VH0A 3VB4A 4BXWA 1S84A 1YPJH 1G3CA 4IN1A 2R2MB 1MTNC 1V2KT 1TPAE 4B73A 1Z8IB 3GY7A 1NFXA 1D6RA 1Y3UA 2J38A 4D7FA 2QC2A 3BEIB 1C5WB 4WMEA 5HM2A 1NRNH 3P17H 3W94A 2ALVA 2FESH 5E0JA 2WV4A 1DE7H 1GVZA 5EW1H 1KLJH 1A5IA 2AFQB 1V3XA 3EQ0H 4ABIA 1TA2A 2PSYA 3ZZ4A 1CVWH 4UEHH 4ABBA 1UTLM 2L74A 4CHAB 2BD9A 3F2HA 4WH6A 4GCHF 1C5NH 2XBXA 3H5CB 4FOUC 5E8EH 1GI7B 3EA7A 5FX5A 3U1JB 2UWPA 2VWLA 2LP6A 2Q1JA 4XBCA 4Y11E 2ILNA 1XXFA 2ZTXA 1RRKA 7KMEH 1CBWB 4JYUH 1P3EA 3T5FH 1Y8TA 1ESTA 1C2LA 2OQ5A 2RFKC 2WHXA 1S6FA 3ZVCA 1DWCH 2ZQ1A 1VR1H 2BHGA 1VJAU 1GCTC 4WJG2 4M7GA 3SUFA 1BMAA 3PRBA 1MTUA 2PP6A 2FI4E 4IW4E 2GCHG 1QL9A 1IQHA 1TOCB 3E91A 1GMCF 1HJAC 1EP6A 3RXTA 4X6OA 4Y79A 3FP8E 4ACBA 2Z9KA 1TGNA 1UHBB 3LH3A 1IQNA 2V3HH 1QA7A 1TE0A 2GT7A 2FOAA 3M7QA 1G3DA 1HJ9A 1L0ZA 2ZCHP 2ZHEH 2IJOB 2TGPZ 3A80A 2GD4B 4NSYA 1ZTKA 1EXFA 3RXFA 4DG4A 1MBMA 3SV7A 1S0RA 4FUGA 3L3TA 1UVSH 1O32A 2BD8A 3B8JA 3ZV9A 1MU8B 1KDQA 1D6WA 1C5OH 3A89A 2HPPH 2OBOA 2C3SA 4ABAA 1RIWB 2FPZA 2EEKA 4Q63A 2WV5A 3RUOA 1Z8RA 2G5NA 1A46H 2J98B 3KQDA 4YESB 1LQEA 1P3CA 3NWUA 1AKSA 3TGJE 3TNTA 3R3GB 1BMFD 3EGKH 3KEEA 1GBBA 5LPEA 1ZPZA 3HK6B 3F6UH 5F03A 1UTPA 1UVOA 3SV9A 2A7HA 3QTVH 2WPMS 5IK2D 4NSVA 1XUJA 3FVFB 3ZZDA 1FY4A 2IOTA 2VVUA 4MPWA 3SO3A 3UREA 3MHWU 3N7DA 2KM0A 4Q4LA 1C5PA 2FWWA 4JK5A 1E36B 3EE7A 1EZXC 2SGAA 1DOJA 3UIRA 3TGIE 2GCHF 1NFUA 3BIUH 1CBWC 1K1OA 3EA9A 3ZZCA 4X2WA 2JJ2D 1DSUA 2LELA 4ZHLU 4HTCH 3SOSA 1O2KA 3DCLA 4SGAE 1FN6A 3PRDA 4ZKNU 1CGHA 1TPOA 3LC5A 4X8SH 2H6MA 3KL6A 3RM2H 3TLOA 1UTOA 3UAIC 2F9PA 1ZZZA 1A3BH 1AE8H 3SUDA 1O3PB 1HAPH 4UFGH 1HLTH 1PPGE 1TX6A 2VH6A 3LGUA 4BAHB 2CF9H 2SGPE 4I7YH 1V2VT 1TNHA 2JH6D 1UVPA 4O3UA 1OWEA 2ZP0H 4Z0KA 1P2NA 3PO1B 1L2EA 1SKYE 1GJ5H 2QXJA 1DX5M 1FDPA 1Y5UT 4Y0YE 1T4VH 3F9GA 5CE1A 5A2MH 1TPSA 1B0EA 2FOHA 2F4LA 1KXCA 2PLXA 4AOQA 1RTKA 1SGNE 3F3BA 3LC3A 3LOXA 4UFFH 1YPLH 4OS6A 4UD9H 3SGQE 4AFZA 1YKTA 5TCAA 4DGJA 3FFGA 1A61H 3ELAH 5F8XA 1LHEH 1O2XA 1P03A 3LT3A 1O2QA 2C90B 2ZDVH 4ZH8A 1WXRA 2ZI2H 3UR9A 2AS9A 2PSXA 3BTTE 3RMNH 4YM9A 1OWDA 3UNQA 5EJ1A 4D8NA 4B75A 3E0NB 1UTJA 1RTLA 4YO9A 1GHBF 1QR3E 3HGNA 1Q31A 2HWLB 3P70B 2I6SA 1DY9A 1BRBE 2W6ID 2ZECA 2UWOA 3WWBA 5DP4A 2WPHS 1TNKA 1EJAA 1ZRKA 1F5RA 1HUTH 1HAOH 2VU8E 5GPIB 3C27B 2YOLA 5PTPA 4B2CA 1YLCA 3FP6E 4ABHA 2EY4C 1GPZA 3SHCH 1GHVH 3KF2A 4I31A 3TK5A 2ZNKH 1O5GH 1GI3A 1UTKA 2GZ9A 7LPRA 4AB8A 3TJNA 1DM4B 1SGFA 4ISIH 1QJ6B 4IMQA 1SSXA 1FAXA 3Q77A 3TIUA 2BM2A 1HAVA 1OWKA 2ZHFH 1NU7B 3SV2H 1QQ4A 2GZ8A 1DITH 5A0AE 3GCTG 1V2TT 3GCHB 2P8OB 5E2OA 2SGFE 2IN2A 1FN8A 2UUFB 2ZFSA 2EQNA 1J8AA 4VGCB 2Y80A 2ASUB 3BV9B 2ZO3H 1DXPA 4JZDH 4OGXA 1WV7H 1ZPCA 3PTBA 1QHRB 1AFEH 3URDA 5F8TA 1LQDB 1GI0A 2WYGA 1W7XH 1IOEA 1GVLA 2WUBA 1Z6EA 3SQEE 3VXEH 4XOJA 1F5KU 2A1DB 3M37A 1D4PB 1SLXB 1ZHRA 2PTNA 3RC6A 1WCZA 1IQGA 2HOBA 2TGDA 2VGCB 1QRWA 1RS0A 2XBVA 3PMJA 1ZSKA 3OAAD 3PO1C 4I32A 1C9PA 5EXNA 4NIXA 4YLUA 1AE5A 3UNRA 1EX3A 3W1EA 1C5MD 4ZXYH 4IC5A 1PPFE 1RGQA 1XXDA 1XUGA 2IJD1 2PHBA 1HV7A 1F0TA 1UTQA 3RXOA 1SGPE 1UK3A 3Q76A 1QB1A 1GDQA 1C1QA 1ZSJA 4ZHMU 2ZWLH 3UY9A 1VGCB 1BHXF 3OY6U 1QTFA 3LJOA 1GHWH 1UCYK 3P6ZB 3ZYEA 2ZTYA 1A1RA 1IQMA 4YOGA 2B9LA 4FUDA 2ANKH 1C2MA 1C2JA 1TMBH 1CA0C 1TNGA 4AYVB 1ORFA 1DLEA 2AMPA 1UMAH 2G51A 1AWHB 2AMQA 5DJ7A 1COWD 2F43B 1SVPA 4Y7BA 1YPEH 3SYJA 1C1SA 3O8BA 3GCTF 1FUJA 6CHAC 2V0BA 5HKKD 2PKSB 1S0QA 2AGIX 2FS9A 2SGQE 1WYKA 1Z1IA 2M2AA 1EQ9A 1C1UH 1A0LA 2ZDLA 4FU9A 1ZLRA 1ANBA 1D3DB 3SJ8A 1N6YA 1WUNH 4MPXA 3M61U 2QIQA 1TOMH 1Z1JA 1SGDE 3VGCB 1LHGH 3F1SB 3S9CA 1GJBB 3GCHC 5EU8A 2P8OC 3OU0A 4H42U 4P02A 1XVMA 3NPSA 6GCHG 3GYLB 1EZQA 2FMJA 3ZZ7A 2H9HA 1GWAA 3URCA 4FVBA 2WZQA 5KEDA 3T27A 2STAE 2CK3D 4BXSA 4AORA 3TJVA 3VPKA 3SNDA 3ESTA 2G81E 1C2KA 2VGCC 3V3MA 3UR6A 2F9NA 1PQ7A 1K0HA 2FTMA 1O3GA 1OXGA 3ZVBA 4WH8A 3LKWA 4RKOB 1W10U 3V13A 5EOKA 4U2WA 4ESTE 1V2UT 1LVYA 2BVRH 2C8ZB 5EXMA 1SQRA 3BEUA 1A4WH 1AY6H 1CT2E 5FCRA 5DG6A 5CMXH 1K1PA 5C1YA 2Z3CA 4FVDA 1F7ZA 1O31A 3KNXA 2H2ZA 2GDDA 2P3TB 3LGWA 2VIWA 1VGCC 1C4U2 2W3IA 1V2NT 2AYWA 1SQTA 2V7QD 2QV1A 4DT4A 3F0PA 4KGAA 1J15A 3OX7U 1JBUH 2Z9GA 1C1PA 2AMDA 2QF5A 2ZPQA 4FETA 3AAVA 4HZHA 4A1VA 1HYLA 1E1QD 1FZZA 1W3CA 3RXHA 2XC5A 2QYIA 5TCCA 3GDVA 3BTDE 4OS4A 1O38A 4X1QU 1TBQH 2PKSC 2FOEA 1EAXA 2XCFA 1NRSH 1TABE 2O9QA 3DD2H 2Y5FA 3A7ZA 3PMBB 2CGAA 1D3TB 1MTNB 1SPJA 1TAWA 3ODFA 3W95A 3VGCC 1SHYA 2PGQB 3MU4A 1DUAA 3GS9A 1GJ8B 1P2KA 4K3JA 1C5LH 4MNYA 4TWWA 1L1NA 1A3EH 3MMGA 2JDID 4RI0A 1W2KH 3OTJE 2W5EA 2DUCA 1TGBA 1YPGH 7GCHG 2P93A 4TY7A 5DKMA 1DS2E 2BDGA 2NU0E 4AGJA 1GBKA 1FNIA 1KSNA 3ZVGA 3F0OA 3QUMP 3DSPA 1H9IE 2F9UA 1N6XA 4XD7D 1MAXA 2BQWB 1ZJKA 3SUGA 3A7VA 1ANDA 2A4RA 3Q3KA 9LPRA 1MABB 4JK6A 4OS1A 2WINI 5AHGH 4Y71A 1AGJA 4ZKOU 1BT7A 1G37A 1MTWA 1T8LA 4Z1MD 2P3UB 5EJLA 3BSQA 2ZHQH 5EQSA 1PPCE 1OKXA 1MKWK 3FZDA 1J16A 1O5FH 4ZAEA 1AMHA 2QXIA 4CR9A 2QXGA 2ZDNA 2FYRA 2K0QA 1H8DH 2Z3EA 3E90B 1GCTB 1JWTA 2G00A 4K2YA 3LU9B 4ABGA 3PWCA 1N8OB 3BTEE 1BOQA 2ZGJA 3OTPA 1QRXA 1S6LA 4DURA 2A4GA 4GHTA 1HJAB 1QL7A 1ELDE 4DY7B 2BDYA 1F2SE 1BB0B 2FI3E 3RLWH 1DPOA 5BRRE 2V3OH 4BOHA 5HXFA 5I25A 1YPMH 1SI5H 1Y59T 1WBGB 3D65E 2AEIH 1SLVB 2GCTB 1A2CH 3LIWA 1QCPA 1V2RT 3ATMA 3BTQE 4MDSA 1G2LA 1O3EA 3MNCA 1WTHD 1T8MA 2BOHB 2RG3A 2FTLE 3U98H 1FY8E 1FY3A 2GZ7A 3KYFA 1W14U 4LOYH 5HM9A 3A8DA 3BTKE 4I8KA 3U9AH 2DE9A 4DIHH 4AG2A 1QY6A 3ITIA 4DJZB 7GCHF 3LDXH 4DOQA 3GICB 3GY8A 1FJSA 2O8UA 1S6HA 1AN1E 2HNTC 1BBRK 1P02A 1GI2A 3PTNA 4JCNA 1MCTA 5GNDA 4P00A 4O9VA 5ETXA 1K28D 1WQVH 4JYVH 3CS7A 2D1JA 4XFQA 1QBNA 2GV7A 2QE7D 1P04A 3KIDU 2ZGBH 4X2XA 5HIZA 2ZZUH 1P09A 1GI1A 2BLOA 3KYGA 3KQCA 1ELTA 1JIRA 1ACBE 4E7NA 2R2WU 1O2WA 1O3AA 1QJ7B 5EG4A 5K0HA 1S85A 2H9EH 1BTWA 3RLYH 1LMWB 2A5KA 2QXHA 4CRGA 1BITA 1NESE 3R0FA 2YNBA 2F83A 1HRTH 1PPHE 1OYTH 1SBWA 3LGYA 5LPRA 4FUFA 2FLRH 1ESBA 3GOVB 1GBTA 2VWMA 3QX5H 1LPGB 2BXUH 1UCYE 1W11U 3MH7A 3FAOA 3UQVA 2QF3A 1OS8A 1SGQE 5GCHG 1QFKH 1BCUH 3UUZA 3MWIU 1WQSA 1SFIA 2C8YB 1KXFA 4KELA 5L2YH 1N8OC 5GDSH 2WSSD 1GJAB 2TGAA 2FZZA 1OWIA 2RA0A 2RA3A 4IBLH 2L6OA 2Z7FE 4ZXXH 4I8HA 1IHTH 1HAGE 2BQ7B 1A0HB 1SQAA 3OEED 4RT0A 2A4QA 2BX3A 2A45B 1G2MA 1GBLA 2CF8H 1Y3XA 1ZPBA 4GAWA 5A0BA 2GCTC 2WPKS 3SNCA 2BTCE 3GY2A 5E2PA 2R9PA 4KTCA 2ZC9H 3VB5A 4TSFD 2BD4A 4MPUA 2OBQA 3KQ5A 3TJOA 1ZTJA 2HLDD 3TK9A 3QWCH 1TBZH 4FUJA 1HXEH 2PKAA 3H7OA 1TWXB 4YLQH 3PM3A 2UUKB 1AU8A 1VITH 2ZU2A 3LGVA 3SV6A 1FV9A 2BLVA 3K2UA 2BLQA 1TMTH 1K1MA 4E06H 2G4UA 3M36A 2JJ1D 3A81A 1CGIE 5T6DA 1O5EH 2H1UA 3A84A 4X0WU 3SJIA 3E8LA 3EDXB 1B7XB 1DSTA 3QDZB 5HIYA 3DHKH 1V2PT 1HNEE 3D23A 2JETC 3STIA 3ZZ3A 5GXPA 4UONA 1GDNA 3RXGA 3T25A 4D7GA 3H7TA 3TK6A 1UCYH 1P2MA 1GHAG 4CRFA 3SJ9A 2WV9A 1ELCA 4IS5A 2KAIA 3O8RA 1AIXH 4DW2U 3ZZBA 3AW1A 4YOJA 5GCHF 4XRNA 4JZ1A 1TRYA 4O3TA 1DUEA 1HFDA 5T3HA 1HB0B 1MQ6A 2BDHA 1BTUA 1QZ8A 1P12E 4DIIH 1UVUH 3BIVH 2GJGA 2Y5GA 1TGSZ 1O0DH 1TALA 1YWUA 1GI5A 1MZAA 3QLPH 5FPSA 4XSKU 1K21H 4WXIA 3UNSA 5LPFA 2EI7A 4NCYA 4TPIZ 1P9SA 4NA8A 1C2IA 1ELGA 2GKVE 1WDIA 2P94A 3Q00A 4JYTA 4YTAA 3RXIA 1DWDH 1KXEA 4AZ2B 2QGRA 4U32A 1JMOH 2IPQX 3K6ZA 2ZU5A 3S9BA 3SNBA 1T7CA 1XUKA 1P2QA 8ESTE 3DSGA 1D3PB 1O2SA 1EOLA 1EAWA 2KR7A 1AVGH 4FUEA 1O3LA 1N1LA 2UWLA 4B2AA 4D76A 1GBJA 1V2ST 3S69A 2KFWA 4O03A 1C5RA 4A6LA 2CJIA 1O2OA 2SNVA 4JZEH 1NN6A 1YPHE 2V35A 2P16A 2HPQH 4K1TA 4BTIB 1H4WA 3MU1A 1P57B 3SI3H 1O2RA 1P2OA 1FY1A 3OSYA 1E1RD 3RDZA 3P8OA 4ASHA 3GYMA 5FCKA 4B76A 1VITG 2GP9B 3P8GA 1GHAF 1SFQB 1AQ7A 1K2I1 1O3HA 2P3FH 3GY4A 4RN6A 1KMHB 3DSOA 2JH0D 1FPHH 2FLBH 2GTBA 3A7YA 5T6FA 2OQUA 2XXLA 3RXPA 2A31A 3A8BA 2OC7A 2ZGCA 3WW7A 1CA0B 3A86A 3ATWA 1WU1A 5GJ4B 3MU0A 5DP8A 2OD3B 1LKBA 1ELVA 1GBHA 1F5LA 1HIAA 2NU4E 2Y7XA 6CHAB 1AB9C 3OFND 1SGYE 3HPTB 4AGKA 1ANEA 3HKIB 2Y5HA 3U28C 3NK8A 2D8WA 4TT3D 1UVTH 3MH5A 4ZCNA 1BMNH 1GL0E 1MQ5A 4GLYA 2YNAA 2XRCA 1H9HE 4MVNA 4ABDA 1O5DH 1OPHB 3VB3A 3TNSA 1QGFA 1C1TA 2ALPA 2ZPSA 4NWLA 2TIOA 1OP2A 3ZZAA 3S7HB 2AIPA 2BZAA 1F0UA 1LHCH 1MTVA 2J95A 4NGAH 2BDBA 3E1XB 1YBWA 4X1PU 1FXYA 1ZMNA 2VIDA 2BOKA 2G52A 1HBTH 2STBE 3SHAH 1O2LA 1X7AC 4ZUHA 5JDUB 1INCA 2ZFTA 5FHTA 2OP9A 1O34A 1VITF 2VIVA 5C1XA 3WY8A 4RSPA 1LVBA 3BN9A 1VKYA 2ZHDA 5C17A 4FUHA 4X8UH 1Z6JH 3OY5U 1O3OA 1BBRE 4UFDH 1MCVA 3UTUH 2PTCE 1EJNA 4R0IA 1GDUA 2OINA 1AO5A 1A5HA 1ZHPA 2W3KA 3SORA 4DCDA 4X1RU 2FX4A 3D62A 1CGJE 1SMFE 3A83A 2EC9H 1TQ0B 3KHVA 3MH6A 2AERH 1SG8B 2ULLA 1H1BA 5G4BA 1C4Y2 1MKWH 3RC4A 1Z7KA 3QO6A 1YCPK 2KCYA 2ZHWH 1WSSH 3IITA 3U69H 4BNRA 3SJKA 2O8MA 2HRVA 1UK2A 1LTOA 1G36A 3RXCA 4KP0A 3B23B 3GISB 2W26A 2HGTH 1K1NA 4IN2A 1G3EA 2F3CE 3RXDA 1W7GH 2WPIS 2FX6A 1UK4A 4GVUA 5B6OA 2M5TA 1GBAA 2XTTB 4Y10E 3U8RH 3K65B 3LH1A 4LZ4B 1BMLA 5DPAA 1WOFA 1KTSB 1ZJDA 4SGBE 1LCYA 4O97A 3ZVFA 1KY9A 2ZPRA 1C5YB 2VWNA 1GBCA 2QY0B 1EB2A 1AUTC 2WYJA 5IYTA 1GJCB 1GI9B 1NPMA 2ZFRH 3PV5A 3MH4A 1YM0A 3P92A 4OS7A 5DP7A 1KXBA 4AB9A 1O33A 1UHBA 2OUAA 4LXBH 4B1TA 1FX0B 1TNLA 1NO9H 2V3MA 4WVPE 1O2ZA 4A5TS 4K8BA 3RXKA 2J97A 1RXPA 1TFXA 2CV3A 4YT7H 4H6TA 1OX1A 1NT1A 4WY3A 2VINA 1PQAA 2HVXA 1A7SA 2EI8A 1Z8JB 1BBRH 5A0CA 1Y3VA 2UUJB 1VJ9U 5JBCS 5DO4H 3AVZA 1C1RA 2J34A 1EASA 4X1NU 5K7RA 4BTUB 1PPZA 3MNXA 4AN7A 2J98A 3PLPA 4THNH 3FN8A 2Z9JA 4Y6DA 4Y76A 1O3DA 1Y5BT 1BUIA 3M3TA 2F9OA 4Q80A 2BXTH 1CT4E 2KCPA 1TBRH 4BTTB 3F9EA 3QN7A 1P2JA 3IWMA 4NIYA 1JIMA 1BTZA 2OC0A 4NG9H 2CHAB 4WF8A 1GHYH 3SQHE 1KDQB 2HNTE 3SGAE 3V12A 1HCGA 2H9TH 1FQ3A 2BVSH 2BY6X 1DWBH 2I6QA 3RXLA 1W13U 4Q7XA 5ESBA 1OSSA 4H4FA 1MUEB 1EZUC 5J4SA 2BD7A 1HAHH 1MKXK 2VVCA 1AKSB 2A2QH 2FYQA 1NZQH 3KQBA 4K1EA 4U01A 2FS8A 1TGTA 1C9TA 5HMAA 4X8VH 6ESTA 4CRCA 2GGVB 1FPCH 3IG6B 2B5TB 2WPLS 1VCPA 5FAHA 5AVDA 3HK3B 1PYTC 2ZU4A 1AVXA 1A5GH 1S82A 3VXFH 1ZYOA 3RU4T 1V6DA 4K60A 1XMNB 5H4IB 5C5OA 1TIOA 2KAIB 1BTXA 1LDTT 1BRUP 3AK5A 1PJPA 5JBAS 1GVKB 5EXLA 4Y8XA 3SU1A 2CXVA 1C5QA 1L1JA 3SBKA 4BAQB 1C1OA 1GBFA 1TPPA 1TGCA 3UPEA 6GCHF 1UW7A 3K6YA 2IPHA 3I78A 2JKHA 1RTFB 1YC0A 1S83A 1NRQH 4Q2KA 2ODPA 1ZSLA 2XNIA 4GSOA 3GY3A 4TWYA 5DP9A 3MO3A 1Z8GA 4Y8ZA 1ABJH 2Z3DA 1GMDG 3NKKA 3PROA 1AZZA 1G9IE 1OP8A 1ELEE 2ZFQH 1C1WH 3M35A 3GDUA 4OGYA 1CHOG 1NM6A 3NCLA 1IQFA 1E38B 1TONA 3MU5A 1GJDB 1FIWA 1O2GH 1TX7A 4XBDA 4HFPB 4D9QA 1W0ZU 1DWEH 1GHZA 1QIXB 2QAAA 5JYIA 1QURH 2G8TA 4NFEA 2F9BH 1T8NA 3RP2A 5EQQA 4K1SA 3S7KB 1LVMA 1VCWA 3HKJB 3M3VA 4K8YA 2ZGHA 4UFEH 5C0UA 3V0XA 4J2YB 3E0PB 4UDWH 1OOKB 2C8XB 2CHAC 1O5CB 3A88A 3EYDA 3TH3H 1SGIB 1TRNA 4CRAA 1PYTD 2Y6TA 4ISHH 2B0FA 4ISNA 3SU6A 5GIBA 1MTSA 3MOCA 5J4QA 1E79D 1DT2A 1GJ7B 1HAZB 3CENA 1O5BB 3KCGH 3SJOA 1K22H 4KKDA 1O35A 1PQ8A 3AASA 5FPTA 1K1JA 2ZCKP 3LGIA 3TH2H 4IGDA 4NZLA 1T31A 1GI8B 1OHHD 2GX4A 2A0QB 4KTUA 1KXDA 5CHBA 4MQAA 4CR5A 5IDKA 3PB1E 1GJ6A 1SOTA 1OWHA 4ABFA 1ZHMA 2BX4A 1MD7A 1K1LA 4I33A 3U8OH 3GCOA 1BRCE 1FY5A 3PV2A 4NFFA 4YXWD 3WWFA 3GCNA 2PUXB 1SQOA 3BTFE 3VFEA 2AIQA 1C1NA 1LPKB 1EJMA 1GMDF 2ODYB 1E34B 3OE7D 1EFRD 3PLBA 5FXLA 4LZ1H 5E0HA 3UOUA 2EA3A 2XWBI 3QK1A 3ZZ5A 1CHOF 7ESTE 2ZA5A 1HAVB 2BZ6H 4X2YA 3P8NA 4RT1A 1FAKH 3ZYDA 2JH5D 2VIPA 1GCDA 4DVAU 2CN0H 5ESTE 4XE4A 2FP7B 3KN2A 1CSOE 1C4V2 2JETB 3LPRA 4ABJA 1O2HA 2D2DA 2ZDKA 2TGTA 1C5TA 3SGBE 2NU2E 4B6EA 3KQEA 3VG8A 1BTHH 1F0RA 1AHTH 1VCQA 1IQKA 2XYAA 1KLTA 4X8TH 2HVYB 3VB6A 4AFSA 3T26A 1BJUA 5B6LA 3BEFB 1C2GA 3FOAA 2BB4A 3P8FA 1TNJA 1PPBH 1XKAC 3SI4H 3UOPA 1G30B 2SNWA 4E7RG 5C67A 4MNWA 1V2QT 2KCAA 3GY6A 4MTBA 3C1KA 4NA7A 2H5CA 4BAKB 3ATIA 2FOMB 2Z9IA 1SL3A 3Q3YA 2R0LA 2FIRH 1XVOA 3RXMA 3A7WA 2H5DA 1GBDA 4IC6A 1EPTA 2GDEH 3PYHA 3SN8A 1C5UA 2PV9B 1SGCA 4GHQA 1O3JA 2VWOA 1OYQA 5JBTA 3CP7A 4B71A 1YLNA 3ZZ6A 1H9LB 2G5VA 3A87A 3MNSA 4JMYA 1O3CA 1HAXB 3ZV8A 1THSH 3MO6A 3M3SA 5CHAC 3JZ2B 2XWAA 2PW8H 2RDEA 2BDAA 3FKSD 3F9FA 2THFB 3VB7A 1NFWA 1ARBA 1EUFA 1O2IA 5EPNA 3FP7E 2PFEA 2FDAA 4JZFH 4MPVA 2FXRA 3NUMA 1P10A 1B5GH 1C2HA 4M9FA 4H6SB 2QF0A 4TY6A 1GMHG 1JRTA 4INLA 1RJXB 5EODA 3BG4C 1LHFH 3MO9A 2UUYA 1HXFH 3MTYA 1QJ1B 2W6JD 1QA0A 3EAJA 3RXBA 3BTHE 3SU3A 2F91A 1SHHB 2K1QA 4X6NA 1FIZA 4B6FA 5A09A 3BTWE 5DN6D 1ESAA 2VVVA 2J2UA 1IQIA 3FO8D 2ZIQH 3NZIA 1UTMA 1C1MA 1MZDA 3SU0A 4CBNA 3ZZ8A 3RU4D 2HNTF 4ISOA 1NFYA 1OWJA 3LONA 4ZKSU 1C5ZB 2G4TA 3OEHD 1WTGH 1O2YA 1SGFG 5EGMA 4ACAA 1S81A 4B74A 3EA8A 1YCPH 3ENSB 1BHXB 2FO9A 2O8WA 8LPRA 4X6PA 1O2JA 1C2EA 2Y7ZA 1NS3A 4OS5A 1O2UA 1AB9B 1P0SH 2OXSA 1ANCA 3RXUA 2GMTB 3HATH 2BD2A 1J17T 4A92A 5E0GA 1PPEE 1Y3WA 1F0SA 2FOBA 4I8GA 3V7TA 1AFQB 3M5LA 5AFYH 4AC9A 4K69A 1QBVH 2TBSA 2J4IA 1ZGVA 1EOJA 5DP3A 1GGDB 3TPIZ 4GUXA 3N7EA 1AI8H 2BY8X 2J94A 3O8CA 1THRH 4CHAC 2ZDAH 1IQLA 1SLWB 3AW0A 4X2VA 2WPDD 1GHBG 4AG1A 1QNJA 1SOZA 2RDLA 1ZMLA 1NC6A 1JOUB 2R3UA 3A7XA 1L4ZA 3ODDA 3RXQA 3TITA 1P2IA 1GBEA 4F55A 9ESTA 1GMHF 1EP5A 3T2NA 3MYWA 5LH8A 1C5XB 3QZQA 1XUHA 2FEQH 3ZVAA 2BY5X 1ELAA 1MD8A 1W8BH 1BTYA 1GG6B 1NTPA 2VBCA 2WUCA 4WXVA 4NIVA 5C3NA 2P59A 1YYY1 3VEQB 5F8ZA 1GJ4H 1YY3A 2ZQ2A 1NBMD 1THPB 2EI6A 4U30A 1QBOA 4FU7A 3SNEA 4ZKRU 3NXPA 1XUFA 1ID5H 2LNCA 4B2BA 1VZQH 5AFZH 4MNVA 1HJ8A 4FUBA 4CH8B 3L6PA 4JZIA 5DP5A 3BG8A 5BPEA 2ZFFH 2BY7X 3K9XB 3MFJA 4F48B 4WMFA 1O3MA 4HG6A 1SGRE 1DVAH 4PROA 4CRDA 3ATLA 3CNRA 1PQ5A 1C5SA 2LPRA 5JB9S 1O2PA 2ZF0H 1ZOMA 1O2MA 1UO6A 2Z9LA 4QT8C 2J5UA 1OP0A 3I29A 3ZZ9A 1TRMA 4HI3A 2V6NA 4J1YA 3DT0H 2VIQA 3MQKC 5C2ZA 1CT0E 1V2MT 1MKXH 5I46H 3QGNB 2XC4A 4A1XA 3T62A 1RIWC 2GV6A 2VB0A 3I77A 3E16B 3FANA 1AVWA 1GJ9B 1MMJN 2XC0A 3F2FA 4WWYA 1AD8H 1NROH 1C5VA 1W12U 2C93B 1EKBB 4MNXA 1P05A 2GMTC 2QA9E 3E3TA 1HAIH 1RD3B 4MG3A 4F4OC 1ELFA 1QRZA 1F92A 2SFAA 8GCHG 1AFQC 3F68H 1SC8U 3ATKA 1GI6A 2PR3A 2TPIZ 4NA9H 1SLUB 1GGDC 3PMHB 3Q3XA 3LGTA 3PLKA 1HGTH 2XOKD 3U1IB 1Y3YA 1YPKH 2PWXA 2W7SA 3SW2B 1SR5C 3A85A 1CA8B 2O8TA 3RXRA 1C2DA 1QB9A 2F9VA 1ETSH 1AWFH 3P95A 1O3NA 1O30A 1ABIH 1YCPM 1IAUA 3M7UA 1V2JT 3HGPA 1O3KA 1TYNA 4A1TA 5EIYA 2J92A 2ANWA 3F2GA 1KYNA 2JIZD 3SNAA 1PFXC 2KX4A 3O8DA 4NIWA 1GG6C 4DT7B 4ISLA 1G3BA 1P01A 5ABWA 3A7TA 1KXAA 1DICA 1LKAA 1CO7E 1E35B 2NU3E 3BTGE 1T8OA 3M5MA 5T1VA 3PWBA 3DUXH 4Y7AA 2RCEA 2XW9A 1P8VC 2BYAX 1QQUA 2ZDMA
chains in the Genus database with same CATH topology
5C20A 2OCVB 3T28A 1M9UA 1XX9A 1B0FA 2BLWA 1EAUA 1O39A 1CQQA 2SGDE 4TYDA 1GBMA 3UWIA 3JZ1B 3M5NA 3FZZA 3UQOA 3PMAB 2J9NA 2QN5T 4XBBA 3T29A 3M5OA 4IMZA 5GWZA 1BTPA 3RXVA 5JBBS 5DP6A 3UFAA 4E05H 4FXGH 3RXEA 3AAUA 3S9AA 1GI4A 3RXAA 3SU4A 4AFUA 4CRBA 4Q7YA 1IHSH 1YF4A 1FMGA 1MU6B 4CH2B 8GCHF 1S5SA 1O2VA 4Y0ZE 4ZMAH 1K1IA 2OC8A 1T32A 2DE8A 4Y8YA 1WAYB 1O3BA 2A32A 2Q6GA 2FOFA 1ZRBA 1GBIA 2FI5E 1FONA 1HDTH 4F49A 3MU8A 1BIOA 3M7TA 1MH0A 4GPGA 3A8CA 3RMOH 2PUQH 3QZRA 2Z6BD 3ZVEA 4AYYB 1W0YH 5A8XA 1XKBC 3CS0A 1YLDA 1YP9A 4YZUA 1O3FA 1J14A 2BY9X 2Y82A 1O3IA 2B8OH 2NWNA 5EPYA 5EW2H 3G01A 1EPTB 1P11E 2OLGA 4LK4A 3F9HA 2A5IA 3BF6H 4RKJB 1G32B 4FUCA 2ZG0H 4AX9H 1LO6A 1GL1A 6LPRA 1EAIA 5DGJA 2ZFPH 3RC5A 1YPHC 3DA9B 2GT8A 2SGEE 3D49H 5FX6A 3N7OA 1P06A 1TA6A 5FBIA 3STJA 1CE5A 2W7UA 2BDCA 5L6NH 2Q6DA 1Q3XA 2B7DH 4VGCC 4XDEA 2D26C 2FOCA 1IQJA 3RMLH 1BQYA 1NRPH 2GVFA 3DFLA 1LPZB 4OS2A 1KTTB 2PKAB 3UWJH 1C1VH 2XBYA 1LHDH 1C2FA 1GHXH 1P9UA 3MI4A 2FM2A 3EE0B 1AZ8A 1AUJA 2BQ6B 3OYPA 3SV8A 3KGPA 4HGCA 5L30H 5HYOA 2HLCA 1CU1A 1J9CH 3A8AA 1TNIA 1JRSA 1NY22 5SGAE 2ESTE 1NRRH 1HAYB 1LVOA 5EQRA 2ANYA 1DXWA 4YT6H 1A0JA 4ABEA 2ZU3A 5AF9H 2Y81A 2A2XH 5C5NA 1BA8B 3RU4E 1TX8A 5FPYA 2R0KA 5C1UA 2A4OA 1ELBA 2A7CA 4INKA 3E6PH 1FLEE 1TQ7B 4NWKA 2BVXH 1U6QA 1O2NA 2XCNA 4I8LA 4R8TB 1QL8A 1V2OT 2A5AA 3RM0H 3SU5A 2VNTA 3SU2A 1V2LT 2A7JA 3B9FH 2Z94A 1EPTC 2PGBB 3TU7H 4X1SU 4UE7H 3S0NA 1JXPA 4BAMB 1BMMH 3SUEA 1UTNA 5JB8S 3DFJA 1ARCA 1BZXE 4MLFB 4BANB 1EB1H 1L1GA 5F6MA 3QTOH 1T4UH 4CBOA 4ZHAA 1EATA 3QGJA 5T6GA 1XUIA 2ZGXH 2QCYA 1YGCH 1UJ1A 5JPMH 1ZR0A 2HALA 5LGOA 1RFNA 2ZU1A 3TVJB 1SGEE 4Q7ZA 1TLDA 2AGEX 4YOIA 4KTSA 1TB6H 1O2TA 2VJ1A 2XBWA 3U8TH 2BDIA 1XM1A 2C8WB 1IQEA 1D3QB 2ZTZA 4CREA 2C4FH 2NU1E 1CHGA 2O8LA 2Q6FA 1K9OE 5L2ZH 1L4DA 5A8ZA 2FOGA 1DANH 3TGKE 2CMYA 2ZCLP 1Y5AT 1QB6A 3TH4H 1NU9A 2OC1A 4TPYA 1V2WT 1ZTLA 3RMMH 5CHAB 3PV4A 3RXJA 3SZNA 4A7IB 2BD3A 3A82A 3GDSA 3MNBA 4BAOB 4D9RA 1DDJA 2G55A 1MBQA 3RXSA 1D9IA 1MAYA 2WPJS 4K5ZA 4GCHG 8KME2 4WMDA 4FUIA 2ODQA 2OTVA 1HIAB 1E0FD 4INHA 1O5AB 1O37A 1KIGH 5TJXA 4ZROA 1ETTH 1EZSC 1Z71A 2AGGX 3BG4B 5HGGA 1BDAA 1ETRH 5DK1A 2ZKSA 1ZMJA 5A8YA 4X6MA 2FODA 3ZVDA 1ZGIA 1E37B 1HPGA 2R3YA 1DY8A 3L33A 2ZEBA 1BRAA 1O36A 1BJVA 1Q2WA 2VIOA 2BD5A 3GY5A 4FU8A 4AFQA 3TJUA 1TMUH 2BMGB 1H8IH 1KLIH 3BTME 1DLKB 2AH4X 5FBEA 1FI8A 1SGTA 1GMCG 3LJJA 2ANMH 2TRMA 1SB1H 2P95A 4NZQA 1DFPA 4Z6AH 4I8JA 2VH0A 3VB4A 4BXWA 1S84A 1YPJH 1G3CA 4IN1A 2R2MB 1MTNC 1V2KT 1TPAE 4B73A 1Z8IB 3GY7A 1NFXA 1D6RA 1Y3UA 2J38A 4D7FA 2QC2A 3BEIB 1C5WB 4WMEA 5HM2A 1NRNH 3P17H 3W94A 2ALVA 2FESH 5E0JA 2WV4A 1DE7H 1GVZA 5EW1H 1KLJH 1A5IA 2AFQB 1V3XA 3EQ0H 4ABIA 1TA2A 2PSYA 3ZZ4A 1CVWH 4UEHH 4ABBA 1UTLM 4CHAB 2BD9A 4WH6A 4GCHF 1C5NH 2XBXA 3H5CB 5E8EH 1GI7B 3EA7A 5FX5A 3U1JB 2UWPA 2VWLA 2Q1JA 4XBCA 4Y11E 2ILNA 1XXFA 2ZTXA 1RRKA 7KMEH 1CBWB 4JYUH 1P3EA 3T5FH 1Y8TA 1ESTA 1C2LA 2OQ5A 1S6FA 3ZVCA 1DWCH 2ZQ1A 1VR1H 2BHGA 1VJAU 1GCTC 4WJG2 4M7GA 3SUFA 1BMAA 1MTUA 2FI4E 4IW4E 2GCHG 1QL9A 1IQHA 1TOCB 3E91A 1GMCF 1HJAC 1EP6A 3RXTA 4X6OA 4Y79A 3FP8E 2Z9KA 1TGNA 1UHBB 3LH3A 1IQNA 2V3HH 1QA7A 1TE0A 2GT7A 2FOAA 3M7QA 1G3DA 1HJ9A 1L0ZA 2ZCHP 2ZHEH 2IJOB 2TGPZ 3A80A 2GD4B 4NSYA 1ZTKA 1EXFA 3RXFA 4DG4A 1MBMA 3SV7A 1S0RA 4FUGA 3L3TA 1UVSH 1O32A 2BD8A 3B8JA 3ZV9A 1MU8B 1KDQA 1D6WA 1C5OH 3A89A 2HPPH 2OBOA 2C3SA 4ABAA 1RIWB 2FPZA 2EEKA 3RUOA 2WV5A 1Z8RA 2G5NA 1A46H 3KQDA 4YESB 1LQEA 1P3CA 3NWUA 1AKSA 3TGJE 3TNTA 3R3GB 3EGKH 3KEEA 1GBBA 5LPEA 1ZPZA 3HK6B 3F6UH 5F03A 1UTPA 1UVOA 3SV9A 2A7HA 3QTVH 2WPMS 4NSVA 1XUJA 3FVFB 3ZZDA 1FY4A 2IOTA 2VVUA 4MPWA 3SO3A 3UREA 3MHWU 1C5PA 2FWWA 4JK5A 1E36B 1EZXC 2SGAA 1DOJA 3UIRA 3TGIE 2GCHF 1NFUA 3BIUH 1CBWC 1K1OA 3EA9A 3ZZCA 4X2WA 1DSUA 4ZHLU 4HTCH 3SOSA 1O2KA 4SGAE 1FN6A 4ZKNU 1CGHA 1TPOA 3LC5A 4X8SH 2H6MA 3KL6A 3RM2H 3TLOA 1UTOA 2F9PA 1ZZZA 1A3BH 1AE8H 3SUDA 1O3PB 1HAPH 4UFGH 1HLTH 1PPGE 1TX6A 2VH6A 3LGUA 4BAHB 2CF9H 2SGPE 4I7YH 1V2VT 1TNHA 2JH6D 1UVPA 4O3UA 1OWEA 2ZP0H 4Z0KA 1P2NA 3PO1B 1L2EA 1GJ5H 2QXJA 1DX5M 1FDPA 1Y5UT 4Y0YE 1T4VH 3F9GA 5CE1A 5A2MH 1TPSA 1B0EA 2FOHA 1KXCA 2PLXA 4AOQA 1RTKA 1SGNE 3LC3A 3LOXA 4UFFH 1YPLH 4OS6A 4UD9H 3SGQE 4AFZA 1YKTA 5TCAA 4DGJA 3FFGA 1A61H 3ELAH 5F8XA 1LHEH 1O2XA 1P03A 3LT3A 1O2QA 2C90B 2ZDVH 4ZH8A 2ZI2H 3UR9A 2AS9A 2PSXA 3BTTE 3RMNH 4YM9A 1OWDA 3UNQA 4D8NA 4B75A 3E0NB 1UTJA 1RTLA 4YO9A 1GHBF 1QR3E 3HGNA 1Q31A 2HWLB 3P70B 2I6SA 1DY9A 1BRBE 2ZECA 2UWOA 5DP4A 2WPHS 1TNKA 1EJAA 1ZRKA 1F5RA 1HUTH 1HAOH 2VU8E 5GPIB 3C27B 2YOLA 5PTPA 4B2CA 1YLCA 3FP6E 4ABHA 1GPZA 3SHCH 1GHVH 3KF2A 4I31A 3TK5A 2ZNKH 1O5GH 1GI3A 1UTKA 2GZ9A 7LPRA 4AB8A 3TJNA 1DM4B 1SGFA 4ISIH 1QJ6B 4IMQA 1SSXA 1FAXA 3Q77A 3TIUA 2BM2A 1HAVA 1OWKA 2ZHFH 1NU7B 3SV2H 1QQ4A 2GZ8A 1DITH 5A0AE 3GCTG 1V2TT 3GCHB 2P8OB 5E2OA 2SGFE 2IN2A 1FN8A 2UUFB 2ZFSA 1J8AA 4VGCB 2Y80A 2ASUB 3BV9B 2ZO3H 1DXPA 4JZDH 4OGXA 1WV7H 1ZPCA 3PTBA 1QHRB 1AFEH 3URDA 5F8TA 1LQDB 1GI0A 2WYGA 1W7XH 1IOEA 1GVLA 2WUBA 1Z6EA 3SQEE 3VXEH 4XOJA 1F5KU 2A1DB 3M37A 1D4PB 1SLXB 1ZHRA 2PTNA 3RC6A 1WCZA 1IQGA 2HOBA 2TGDA 2VGCB 1QRWA 1RS0A 2XBVA 3PMJA 1ZSKA 3PO1C 4I32A 1C9PA 5EXNA 4NIXA 4YLUA 1AE5A 3UNRA 1EX3A 1C5MD 4ZXYH 4IC5A 1PPFE 1RGQA 1XXDA 1XUGA 2PHBA 1HV7A 1F0TA 1UTQA 3RXOA 1SGPE 1UK3A 3Q76A 1QB1A 1GDQA 1C1QA 1ZSJA 4ZHMU 2ZWLH 3UY9A 1VGCB 1BHXF 3OY6U 1QTFA 3LJOA 1GHWH 1UCYK 3P6ZB 3ZYEA 2ZTYA 1A1RA 1IQMA 4YOGA 2B9LA 4FUDA 2ANKH 1C2MA 1C2JA 1TMBH 1CA0C 1TNGA 4AYVB 1ORFA 1DLEA 2AMPA 1UMAH 2G51A 1AWHB 2AMQA 5DJ7A 1SVPA 4Y7BA 1YPEH 1C1SA 3O8BA 3GCTF 1FUJA 6CHAC 2V0BA 2PKSB 1S0QA 2AGIX 2FS9A 2SGQE 1WYKA 1Z1IA 1EQ9A 1C1UH 1A0LA 2ZDLA 4FU9A 1ZLRA 1ANBA 1D3DB 3SJ8A 1N6YA 1WUNH 4MPXA 3M61U 2QIQA 1TOMH 1Z1JA 1SGDE 3VGCB 1LHGH 3F1SB 3S9CA 1GJBB 3GCHC 5EU8A 2P8OC 3OU0A 4H42U 1XVMA 3NPSA 6GCHG 3GYLB 1EZQA 2FMJA 3ZZ7A 2H9HA 1GWAA 3URCA 4FVBA 3T27A 2STAE 4BXSA 4AORA 3TJVA 3VPKA 3SNDA 3ESTA 2G81E 1C2KA 2VGCC 3V3MA 3UR6A 2F9NA 1PQ7A 2FTMA 1O3GA 1OXGA 3ZVBA 4WH8A 3LKWA 4RKOB 1W10U 3V13A 5EOKA 4U2WA 4ESTE 1V2UT 1LVYA 2BVRH 2C8ZB 5EXMA 3BEUA 1A4WH 1AY6H 1CT2E 5FCRA 5DG6A 5CMXH 1K1PA 5C1YA 2Z3CA 4FVDA 1F7ZA 1O31A 3KNXA 2H2ZA 2GDDA 2P3TB 3LGWA 2VIWA 1VGCC 1C4U2 2W3IA 1V2NT 2AYWA 1SQTA 2QV1A 4KGAA 1J15A 3OX7U 1JBUH 2Z9GA 1C1PA 2AMDA 2ZPQA 3AAVA 4HZHA 4A1VA 1HYLA 1FZZA 1W3CA 3RXHA 2XC5A 2QYIA 5TCCA 3GDVA 3BTDE 4OS4A 1O38A 4X1QU 1TBQH 2PKSC 2FOEA 1EAXA 2XCFA 1NRSH 1TABE 2O9QA 3DD2H 2Y5FA 3A7ZA 3PMBB 2CGAA 1D3TB 1MTNB 1SPJA 1TAWA 3ODFA 3W95A 3VGCC 1SHYA 2PGQB 3MU4A 1DUAA 1GJ8B 1P2KA 4K3JA 1C5LH 4MNYA 4TWWA 1L1NA 1A3EH 3MMGA 1W2KH 3OTJE 2W5EA 2DUCA 1TGBA 1YPGH 7GCHG 2P93A 4TY7A 5DKMA 1DS2E 2BDGA 2NU0E 4AGJA 1GBKA 1FNIA 1KSNA 3ZVGA 3QUMP 1H9IE 2F9UA 1N6XA 1MAXA 2BQWB 1ZJKA 3SUGA 3A7VA 1ANDA 2A4RA 3Q3KA 9LPRA 4JK6A 4OS1A 2WINI 5AHGH 4Y71A 1AGJA 4ZKOU 1BT7A 1G37A 1MTWA 1T8LA 2P3UB 3BSQA 2ZHQH 5EQSA 1PPCE 1OKXA 1MKWK 3FZDA 1J16A 1O5FH 4ZAEA 1AMHA 2QXIA 4CR9A 2QXGA 2ZDNA 2FYRA 1H8DH 2Z3EA 3E90B 1GCTB 1JWTA 2G00A 4K2YA 3LU9B 4ABGA 3PWCA 1N8OB 3BTEE 1BOQA 2ZGJA 1QRXA 4DURA 2A4GA 4GHTA 1HJAB 1QL7A 1ELDE 4DY7B 2BDYA 1F2SE 1BB0B 2FI3E 3RLWH 1DPOA 5BRRE 2V3OH 4BOHA 5HXFA 5I25A 1YPMH 1SI5H 1Y59T 1WBGB 3D65E 2AEIH 1SLVB 2GCTB 1A2CH 3LIWA 1QCPA 1V2RT 3ATMA 3BTQE 4MDSA 1G2LA 1O3EA 3MNCA 1WTHD 1T8MA 2BOHB 2RG3A 2FTLE 3U98H 1FY8E 1FY3A 2GZ7A 1W14U 4LOYH 5HM9A 3A8DA 3BTKE 4I8KA 3U9AH 2DE9A 4DIHH 4AG2A 1QY6A 3ITIA 4DJZB 7GCHF 3LDXH 4DOQA 3GICB 3GY8A 1FJSA 2O8UA 1S6HA 1AN1E 2HNTC 1BBRK 1P02A 1GI2A 3PTNA 4JCNA 1MCTA 4O9VA 5ETXA 1K28D 1WQVH 4JYVH 3CS7A 2D1JA 4XFQA 1QBNA 2GV7A 1P04A 3KIDU 2ZGBH 4X2XA 2ZZUH 1P09A 1GI1A 2BLOA 3KQCA 1ELTA 1JIRA 1ACBE 4E7NA 2R2WU 1O2WA 1O3AA 1QJ7B 5EG4A 5K0HA 1S85A 2H9EH 1BTWA 3RLYH 1LMWB 2A5KA 2QXHA 4CRGA 1BITA 1NESE 3R0FA 2YNBA 2F83A 1HRTH 1PPHE 1OYTH 1SBWA 3LGYA 5LPRA 4FUFA 2FLRH 1ESBA 3GOVB 1GBTA 2VWMA 3QX5H 1LPGB 2BXUH 1UCYE 1W11U