4AG2A

Human chymase - fynomer complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
226
structure length
223
Chain Sequence
IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Generation, Characterization and Structural Data of Chymase Binding Proteins Based on the Human Fyn Kinase SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/de novo protein
molecule keywords CHYMASE
total genus 51
structure length 223
sequence length 226
chains with identical sequence B
ec nomenclature ec 3.4.21.39: Chymase.
pdb deposition date 2012-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ag2A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ag2A02
1BCUH 1L4ZA 2DE9A 4O97A 2C4FH 2C8ZB 2Z9JA 3RXBA 1PYTD 1BRCE 3R0FA 1FV9A 2PSXA 5TCAA 1TNJA 5A09A 1JWTA 1B0FA 1QBNA 1SOTA 1MKXK 2H1UA 2WYGA 3ODDA 4E05H 4ZXXH 1SGDE 2BOHB 3H5CB 2GZ9A 1O2GH 1JIRA 3SJOA 1GGDB 1CU1A 1P2MA 4WXIA 5ESTE 3SORA 2I6QA 1Y3YA 4AG1A 1NRSH 4X8SH 2PKAA 4Y6DA 1T8OA 4ISLA 2Q6DA 3RMNH 2J94A 3A81A 2UUFB 2ZU1A 1SGTA 1CQQA 1ZPBA 2XC4A 1GBFA 4JZ1A 4CREA 5LPRA 4TWWA 1VCQA 4CHAC 3RP2A 1A0JA 1GMDG 1VITF 3LC5A 3S9AA 2XC5A 1ZPCA 3LGYA 4AN7A 1Y3UA 1U6QA 3I78A 3GDSA 5EODA 3FP8E 1KXFA 5JB8S 2ILNA 3M3TA 2W7SA 4MNWA 2ZCKP 1SGNE 1O5FH 4B71A 1ZJKA 3K2UA 1TNLA 2BX4A 3P95A 3V13A 2F91A 3QTVH 4QT8C 3U8TH 1C4Y2 1G2LA 1UVUH 2AIQA 2VIDA 1BTYA 1DX5M 1O3EA 2V3OH 3BIUH 3P6ZB 4YOGA 4B75A 1RRKA 1JMOH 2XNIA 3HGPA 3RXCA 1IAUA 1O5EH 4NSVA 1GI1A 2FTLE 1FPHH 2VGCC 1BRAA 2KAIB 1GI2A 2STBE 1ELBA 4AORA 2CXVA 2C3SA 3P17H 2R3YA 2UUKB 1LO6A 5FCRA 1WSSH 3F9FA 2NWNA 2QAAA 4CRFA 2JETC 5A8ZA 2H5DA 2V3HH 3BTFE 2SGPE 3MH5A 3E8LA 2F9NA 2ZO3H 1XUIA 2A5IA 1A61H 5DK1A 2ZP0H 5LGOA 1AZ8A 5DP9A 1W3CA 2STAE 3CS0A 1CT4E 5EU8A 1TNGA 2P3TB 5LH8A 1SGYE 2Z9KA 3SUGA 2EI7A 2H5CA 1CGHA 4Z6AH 8GCHG 1EAUA 2ZFQH 2ZU3A 4NSYA 1XMNB 1C1WH 4GLYA 1OX1A 5E2OA 3BTTE 4J1YA 2ZWLH 3SU3A 3F9GA 2ZHDA 3UOPA 4GVUA 1GBHA 1OWJA 4CRAA 4WMEA 1NN6A 1K21H 1MTNB 2WYJA 3E0PB 3NPSA 5FHTA 3TNSA 1NRPH 1MTSA 4I32A 3RXIA 1CA0B 1SQTA 1K1PA 3ESTA 2AGIX 1ANBA 3QN7A 1FAKH 2ODQA 1RTLA 3MU5A 3VB5A 1P2KA 2VGCB 3LDXH 3MH4A 4YZUA 1UTPA 1BTPA 1DITH 2G51A 1FY3A 2AFQB 2AH4X 1YCPM 4SGBE 4FUJA 2ZECA 1PPEE 4YT6H 3TJUA 4WF8A 1BQYA 1GBCA 1TGNA 5C20A 1LHCH 1XUHA 5EGMA 1C1UH 3LGWA 2P8OC 3TK5A 3ZVAA 1WAYB 3RXSA 2A7JA 3PMHB 3T2NA 3UFAA 1Y5UT 5GPIB 1GBDA 3TJOA 1Y3XA 1JIMA 1NS3A 1K2I1 2CJIA 1O35A 1SGFG 5AFYH 4ABDA 1GG6C 1OKXA 4NFEA 3SNAA 1FIWA 4H4FA 2BDHA 1GBAA 1AKSB 4FUIA 4X0WU 4GCHF 2A4GA 4B74A 4DVAU 1Z1IA 3SOSA 2SNVA 2O8UA 1Z6EA 3HK6B 3VGCB 2GP9B 3URCA 4X1SU 1O3AA 3ZZ7A 1O5BB 5BRRE 1ESTA 3ZYEA 1Y5AT 1EXFA 1XVMA 1SHHB 1TPAE 1N6XA 1B7XB 1FI8A 7ESTE 1FQ3A 3GY4A 1P04A 1YPEH 1PPBH 1W14U 2ZI2H 5DP3A 4X2XA 4ZKNU 4DGJA 3RLYH 2HNTE 1EASA 3IITA 2R0KA 1SGEE 4AX9H 1FLEE 2SGDE 2ZU4A 3AW1A 2G5VA 3TH4H 1QBOA 3RDZA 2BXUH 4J2YB 4AYVB 1O3IA 3TIUA 5E2PA 1J15A 1IQIA 1ZLRA 2ESTE 3M5MA 1AU8A 2BY6X 3NKKA 1YYY1 1ZGVA 4MPXA 3CS7A 1LKBA 3D49H 3RXQA 1HAVA 4X1NU 2K1QA 3A8BA 1GBKA 1LQDB 1RIWC 2VNTA 3S7KB 3C1KA 2P59A 3S9CA 4CRDA 1AGJA 4A1XA 4GPGA 5ESBA 2BY7X 2FOHA 4X6NA 1Z71A 2QYIA 4RKJB 4RSPA 4NWLA 1J8AA 2BQ6B 3M36A 4NZLA 1TALA 2C8XB 1J17T 2WPKS 1O3HA 3GCHB 3T26A 2Y80A 2ZDNA 2WPHS 3GY3A 1D4PB 4YOJA 3E90B 2ODYB 3RXGA 1SGFA 1MKWK 1TFXA 3HATH 1UHBB 1YCPH 1HAGE 4NCYA 5TJXA 1BHXB 1NRRH 1WTGH 2UUYA 4Y71A 1KXAA 4TWYA 1DY8A 4DG4A 1SL3A 4AFQA 1PQ7A 1DSUA 3PMJA 1TMUH 5T6FA 2FS8A 1CVWH 2WINI 1FZZA 1UTJA 2BZ6H 3EDXB 3ZZCA 1GBEA 3RXKA 3SJ8A 4THNH 1BTWA 1P12E 1Z7KA 1SGIB 3UUZA 1OPHB 2HNTF 1HAIH 2XYAA 1D3DB 2BD2A 1CBWB 4CRGA 1XUGA 3BEUA 1DANH 1ZOMA 2BD8A 1GHBF 5A0BA 1TNHA 1EOJA 8LPRA 2YNBA 1UK2A 1O2RA 1D3QB 1NM6A 1YPLH 4I33A 5F03A 6GCHF 3KN2A 3PTBA 2BY8X 4ZUHA 3QGJA 1GJ4H 1YF4A 4I8KA 2C8YB 4FUDA 4WJG2 2VWNA 1SLVB 5L30H 1SQOA 2QIQA 3SJ9A 3QLPH 2FOMB 1C2LA 4VGCB 3TJVA 1IQMA 5EPYA 1G2MA 1ID5H 1A5HA 1YPKH 5GXPA 3FP7E 3SW2B 1HLTH 3OTJE 5GCHG 3DD2H 4FU8A 1P9UA 1JRTA 3VB7A 1SHYA 1UCYK 4BAQB 2J4IA 1EQ9A 3ODFA 4CR5A 2XTTB 1BTZA 2CHAB 3AVZA 2M5TA 2ZF0H 1H1BA 4IN1A 3UY9A 3UNRA 2A7HA 1YLDA 3SUDA 1V2VT 2A5KA 1HJ9A 1N1LA 3P8NA 4LZ1H 1UMAH 4X8UH 1ZHRA 2SNWA 1KXCA 2OQ5A 1MH0A 3RU4E 1LQEA 4ZAEA 2J95A 3GYLB 1KXBA 1ESAA 1L2EA 2OCVB 1CBWC 3MO3A 3DFJA 4FUGA 2Q6GA 2P3FH 1S5SA 1TB6H 4YT7H 1TBQH 5A2MH 1HYLA 1P3CA 3MWIU 1V3XA 2QGRA 3A83A 1P2IA 4B1TA 5FPTA 2BM2A 4I8JA 1JBUH 1OWKA 1H9IE 1AFQB 2GVFA 4JMYA 1EPTA 2B8OH 1LPGB 1LHFH 1GBIA 1PPGE 4RKOB 1H8DH 3UNSA 2GGVB 1O34A 4Z0KA 1RIWB 2ASUB 1MQ5A 4XSKU 3LIWA 1XUKA 1EZQA 1TRMA 4LXBH 5FBEA 2H2ZA 5EXLA 3Q77A 2RA0A 2ZHWH 1K1OA 1W8BH 3BTME 3ZZAA 3LH3A 3S69A 2VB0A 2ZU2A 2Y7ZA 1O3NA 4BAHB 1GJ7B 5HYOA 1GBLA 3H7OA 2THFB 3SGAE 2R2MB 1S0QA 3O8RA 1LHGH 2ZDAH 1A4WH 1V2OT 3BTHE 1C1QA 1HAVB 1K1IA 1V2TT 2UWPA 1P06A 1QB6A 2A2QH 3PB1E 1P11E 1C9PA 2FWWA 1OOKB 4K1EA 3RXPA 2IN2A 4Q2KA 1BT7A 4UEHH 1LTOA 2EI6A 3GCTG 2VIQA 1SPJA 1LPKB 3RLWH 1UCYH 2UWLA 1JXPA 3NCLA 3RU4D 3TGKE 1HUTH 1UTMA 2BYAX 2FOAA 2Y81A 4XE4A 1FJSA 2B5TB 4KP0A 5DPAA 1AB9B 3TK9A 3TGJE 1HIAA 1SLXB 1OP2A 5C67A 4DCDA 3TH2H 3MO6A 4X8VH 1A0HB 4UONA 1HNEE 2ZCHP 3B23B 3ZZ4A 1GI6A 3GY7A 1A5IA 1FN8A 2W5EA 1QQ4A 1HBTH 4XBDA 1OYQA 3JZ1B 1NFXA 3RXAA 5E8EH 2OTVA 5HM2A 4BTTB 1GL0E 1NZQH 3A80A 3SV8A 1QJ6B 1GPZA 2XRCA 4AOQA 1SLUB 4BTIB 1UVOA 4CH8B 1IQLA 1SBWA 1L4DA 1GJ6A 4NGAH 1E35B 1P01A 1NRNH 4ZHMU 3BG4C 5PTPA 2GT8A 1Y8TA 1P10A 4DJZB 1ZSJA 1C2FA 1MZDA 1ZJDA 2BLVA 4CHAB 1D3TB 3RXLA 1O2NA 1TX7A 3ZVGA 1ETTH 1NY22 3M35A 3FVFB 1RTKA 1F5RA 4F4OC 2GCTB 1ELFA 4X1PU 5E0HA 4D7FA 3BF6H 2Z94A 1HFDA 1SGPE 2QY0B 1C5QA 3SV6A 4JZEH 1HB0B 2ZPSA 3V12A 2G55A 1O2WA 4Y76A 1QA0A 1C5RA 1A0LA 3ZZ9A 3H7TA 1W12U 1ANEA 1BBRK 4JZDH 1G32B 1C1SA 4UD9H 1K9OE 4IMZA 1ANDA 5EXMA 1TE0A 4BAMB 5J4SA 1MBQA 2GV6A 1V2WT 3PO1B 1KLTA 1QRWA 1S82A 2JETB 3SN8A 5JB9S 2NU2E 3L6PA 1UTKA 3UQOA 2GV7A 5F6MA 3AAVA 3T28A 2PTCE 4I31A 4Y8YA 1QA7A 2P93A 2AGEX 3EA8A 1Y3VA 2DE8A 3Q3KA 1WOFA 1V2PT 1KIGH 1J14A 1AUJA 2G5NA 2ZDMA 1QRZA 3ZVCA 1QY6A 4YTAA 1TPOA 4Q7ZA 1TGCA 1TGSZ 4ASHA 2P16A 3E1XB 4MPUA 4FUBA 5T3HA 2FI4E 1DLEA 2FYRA 1ZSLA 4JYTA 1TOCB 1CGIE 2D2DA 3MI4A 2A2XH 2CMYA 2O8MA 1BHXF 2OQUA 1HAOH 1GI0A 5C5OA 2PSYA 5AF9H 1YPHC 2D1JA 3ATKA 4JCNA 5L6NH 2BXTH 4B76A 3UIRA 1GWAA 3AW0A 3PLBA 3UR9A 2UWOA 2AMDA 3RXVA 2Z9LA 2ZC9H 1OWDA 2VIWA 3P70B 1INCA 4WH8A 3LJOA 2Z7FE 1KXEA 2P8OB 1O5GH 1GBJA 3GY5A 1SGCA 4NA9H 3MNXA 5A8XA 2PKAB 3B9FH 3F1SB 2TGDA 2XBXA 1AZZA 2FZZA 4FU7A 4XFQA 3DUXH 5C1YA 3Q3YA 1LMWB 1ETRH 5DGJA 1C2MA 1ELEE 1TQ7B 5EPNA 1CGJE 3I29A 3RXMA 1G36A 2ZEBA 3E0NB 3OSYA 1IQJA 4ABIA 4B73A 2FDAA 3SNDA 1CT2E 1GJDB 3SJIA 2C8WB 2NU1E 2Z6BD 2QF3A 1K1JA 3ZV8A 1A46H 4WY3A 1LDTT 2DUCA 1W11U 3PMBB 1MD7A 2G8TA 1NTPA 4BANB 2TGAA 3MHWU 1SR5C 2PKSC 1FMGA 2AS9A 2P95A 4UFFH 1Z8IB 3LOXA 2PUQH 1ARCA 3TJNA 1AVXA 2FLBH 3TK6A 4A7IB 1D6RA 5CHAB 1OXGA 4BOHA 1T32A 2TBSA 1QL7A 4GSOA 1MTNC 3PM3A 1YBWA 1MD8A 1GHBG 1RS0A 1XXFA 3K6ZA 2F3CE 1EAIA 3E91A 3P8OA 4K8BA 1IQEA 3CP7A 1V2ST 1Z8JB 3LJJA 2FEQH 4FVBA 1P03A 3FZZA 1RXPA 4JK5A 5E0JA 1DT2A 3D23A 3EGKH 5GWZA 1AWHB 1V2KT 4ZHLU 1WQSA 2TGTA 1EP5A 1HJAC 5K7RA 1CHGA 4NA8A 3RUOA 1V2JT 2QV1A 3KIDU 2H9TH 5EW1H 1O3KA 2FIRH 5GJ4B 1QGFA 4XBBA 1W7GH 3RM0H 1BZXE 1OWEA 1C2EA 5FPYA 4K1TA 3ENSB 1EP6A 1ZYOA 1F5KU 5CMXH 1KDQB 1W7XH 3OY5U 1C1OA 1F2SE 1C5UA 1HDTH 4XBCA 2FX6A 4AFUA 1GG6B 1QURH 3M3SA 3NWUA 3HK3B 3ZZ5A 1SGQE 3BN9A 2FX4A 3RC5A 1LPZB 1TPPA 4MNVA 3SQHE 3RXFA 1VJ9U 2A7CA 2BD5A 1BRUP 4PROA 2ZGHA 3M5LA 1HAZB 1LVYA 3GCHC 2RDLA 2Y5FA 4ZH8A 1NESE 1P09A 3O8BA 3MH7A 1QJ7B 3PWCA 5EG4A 1V2RT 2R2WU 1GHVH 1P2JA 3KL6A 3TH3H 1OS8A 1EZSC 2PGBB 3V7TA 2ULLA 2XC0A 2ANMH 2Y6TA 1P8VC 3OU0A 1GMHF 1S84A 2BQ7B 4ISNA 1GBBA 4JYUH 1O2LA 1TGTA 1FDPA 4A5TS 1C5YB 2BY5X 2BD3A 4ZROA 2TRMA 2SGFE 4SGAE 1FUJA 2AGGX 1PPFE 5F8ZA 1O31A 4OGXA 1CSOE 2ZZUH 3K65B 2OUAA 1Y3WA 1E38B 5IYTA 1HV7A 1VZQH 1AO5A 2G4UA 2HPQH 3GCOA 1W0YH 4KGAA 2FO9A 2VIVA 1HGTH 4RN6A 1ELAA 1FY4A 2ZG0H 1UJ1A 2BD4A 2ZHQH 4WMDA 5GDSH 1SFQB 4XDEA 1BBRE 1XXDA 4XOJA 4UE7H 5B6OA 1Z8RA 4IBLH 3U9AH 4WMFA 3LGIA 4TY6A 1EJAA 3MU4A 1A5GH 3I77A 3RXRA 2AIPA 5JBCS 1KXDA 1G3DA 2JH5D 3HGNA 3BEFB 2BVXH 3SNBA 2EI8A 1C5LH 2XW9A 3QZRA 1W10U 2QC2A 1TA6A 1MU6B 1EZUC 2G00A 5FX5A 3QGNB 3VB6A 2PKSB 2ALVA 2Z9IA 1F5LA 3NUMA 1TNKA 1FPCH 4DOQA 1MAYA 1K28D 4R0IA 3MU0A 4D76A 1IQNA 3QTOH 1DWCH 2ZNKH 2PLXA 3RMMH 1YCPK 1BB0B 1C5PA 1ZSKA 3VB4A 3E6PH 3STIA 1DUAA 2ZIQH 2FS9A 1VITG 3L3TA 1SB1H 2R9PA 4KTUA 1BJUA 3MFJA 4R8TB 2QN5T 1HAYB 1F7ZA 8KME2 3FANA 1TA2A 2H9EH 5H4IB 1ESBA 4E7RG 3KCGH 1ARBA 1DWBH 1TLDA 3A7XA 1S0RA 2Z3DA 1O2KA 4DT7B 1OSSA 1ABJH 3NXPA 2D8WA 4I7YH 5JBTA 1GJCB 1DWEH 1NFWA 2AMPA 4ABFA 1AFQC 5DP5A 1C4V2 1V6DA 3ZZBA 1C2GA 2NU4E 2QCYA 1P05A 4UFEH 3M7TA 2BDBA 2EA3A 3JZ2B 1C5SA 1GI3A 4OS4A 2XWBI 2WPMS 2GMTB 1O3GA 1O2VA 4Q80A 5DP7A 1L0ZA 4B2AA 2O8LA 3BG8A 2BD7A 4U30A 2Y5GA 2ALPA 3SV2H 1NU9A 3BV9B 3E16B 1W0ZU 1TIOA 3PLPA 1IQKA 2WV5A 2OBOA 5C5NA 8GCHF 1IHSH 1SG8B 1SVPA 1Z1JA 2Z3EA 3P8FA 1C5WB 2PV9B 5FX6A 2VH0A 1MZAA 4IC5A 1F0SA 2CHAC 2FOFA 3GY6A 3U1JB 1KSNA 1SGRE 4H6SB 2HPPH 4KELA 1Y59T 1UVPA 1S83A 1FIZA 2ZFSA 5F8TA 2OXSA 4X6MA 3SUEA 2GD4B 3QZQA 3S7HB 3M7UA 2HGTH 1QL9A 3S9BA 5EQSA 5HMAA 1LVMA 2VVVA 3P92A 4A1VA 1EX3A 1N8OC 5FAHA 1HXEH 2ZKSA 1PJPA 3PLKA 3F9EA 1F0RA 1O32A 1EJMA 3KNXA 5FBIA 2HRVA 1GJAB 4AZ2B 4WH6A 1O3FA 2ZDKA 2C90B 3DFLA 1V2QT 3A7VA 1XUFA 4H42U 1P2QA 2VVCA 3V3MA 1CA8B 1IOEA 1O5CB 4D8NA 1UTOA 2WPLS 3ATMA 1G30B 2ZFRH 5ABWA 2R3UA 4YM9A 1ELCA 2ZHEH 1AUTC 4B2BA 1ACBE 3UWIA 3BTQE 1A1RA 3GY2A 1AE5A 1UVSH 2CF9H 3U8OH 1C5OH 2A5AA 2TPIZ 4HI3A 1MQ6A 3RXHA 3EYDA 2SFAA 3SU6A 1O2JA 4D7GA 1T4UH 4OS6A 5L2YH 1V2UT 5EW2H 1YPMH 2AERH 4JZIA 1QRXA 2PUXB 2ZTXA 2ZPRA 3DT0H 2HOBA 1ZTLA 2VWLA 1KTTB 3HPTB 3CENA 4HGCA 1C5VA 4GUXA 1GVKB 2BOKA 1AY6H 4JZFH 4U32A 1GI7B 4O3TA 3A85A 3BTGE 4KTCA 4U01A 1RD3B 2BVRH 3A87A 3ATLA 1NFYA 1DXWA 1DSTA 1H4WA 3F68H 1ELGA 3RMLH 3SV9A 4NWKA 1YPGH 2PW8H 3SZNA 2Y7XA 5DKMA 3SBKA 4OS5A 3MTYA 4DIHH 3OYPA 1BMAA 3ZVEA 4FXGH 2G81E 3LH1A 4YO9A 7LPRA 1WU1A 3LGTA 1G3EA 2QXJA 4CR9A 3EA9A 2BMGB 2GTBA 1A7SA 1OYTH 2SGQE 4ISIH 2FI5E 4JK6A 3T29A 4CRCA 4NIWA 2ZFFH 1C1RA 4ZMAH 1QL8A 2VVUA 4WWYA 1C5MD 1XKAC 4AB8A 1ZHPA 1NC6A 3A8DA 3LKWA 4HTCH 4AG2A 2FMJA 1MUEB 1P3EA 3MH6A 4DIIH 3LONA 4BNRA 1S6HA 3V0XA 2G52A 3EE0B 1DPOA 4FUCA 1GDNA 1C1MA 1UCYE 1Q3XA 1DICA 1TBRH 2OINA 2B9LA 1T31A 4YOIA 4Y11E 1YPJH 4O3UA 3LPRA 5HXFA 1TMTH 3K6YA 1TNIA 4DW2U 1GHAG 1BIOA 1O3MA 4UFDH 1XUJA 3FP6E 1P57B 1G3BA 1TOMH 4X2WA 4MLFB 3SJKA 4INKA 5TCCA 1BITA 2XBVA 1S81A 2P3UB 2Y82A 3Q76A 1ZMLA 2HALA 2OC7A 1FXYA 1IHTH 2ZQ2A 4NA7A 1OP0A 2FPZA 3AAUA 3SU5A 3MO9A 4K3JA 3SHCH 1JOUB 1Q31A 5C1UA 5I46H 2P94A 1FY1A 5LPEA 1TYNA 3VXFH 2J38A 3RMOH 4ZHAA 2ODPA 1LVOA 1MTUA 3M61U 5AFZH 4MNYA 1ZTKA 1KLJH 3VGCC 1QQUA 6CHAB 2ANKH 2CN0H 2CGAA 4ZKRU 3VFEA 2W7UA 3TNTA 1O38A 3BTWE 3E3TA 1FNIA 5EXNA 4HZHA 1GHWH 2VIOA 5EOKA 1NROH 6ESTA 1GHXH 1WYKA 1PPZA 1X7AC 1GHYH 1THPB 3STJA 5A8YA 2A4RA 1GDUA 1BMMH 1K1MA 3O8DA 2ZCLP 3OX7U 4ABEA 4BAOB 1ABIH 2FOBA 1BDAA 5IDKA 4ISHH 1QBVH 3ZZDA 1HAHH 1D6WA 4OS7A 2FODA 2G4TA 1O2ZA 3M37A 2F9OA 3OY6U 2PGQB 3PV4A 4INLA 1KYNA 4LK4A 1EB2A 5DG6A 3RC4A 1ZPZA 1IQFA 2AYWA 2GZ8A 1TX6A 1YLCA 5HM9A 4VGCC 1DM4B 2J9NA 3MNSA 4A6LA 5ETXA 3KF2A 1O2MA 1YM0A 3ZZ8A 1KLIH 1UK3A 3A7YA 4IC6A 2VJ1A 2OC1A 1XX9A 1EAXA 2J34A 1O3JA 4GHQA 1PPCE 4E06H 2ZU5A 2JKHA 1QHRB 2JH6D 3TU7H 1O36A 1E37B 2WUCA 3FFGA 1CHOG 1QNJA 7GCHG 2GKVE 3PROA 2ANWA 3M5NA 1TONA 5A0AE 2FTMA 2F9BH 5JYIA 2ZA5A 1V2LT 4TPYA 3M5OA 2BX3A 1EPTB 3BTEE 4TY7A 1S85A 3GCNA 4NFFA 5AHGH 2HNTC 1O0DH 1O2TA 1HJAB 2A0QB 2UUJB 3ZZ3A 1HJ8A 2F9VA 2HVXA 1GL1A 1BBRH 1C2DA 1DUEA 4BTUB 1OWHA 4TPIZ 1UHBA 2GDDA 1MCVA 4K1SA 1H9HE 3W95A 4YLUA 1HRTH 4ABJA 3KQCA 2FOEA 4K69A 1TBZH 1Z8GA 1THRH 4A92A 3TGIE 2J2UA 1BRBE 5HGGA 5I25A 2FP7B 1O39A 2ZTZA 1C5ZB 2PFEA 1WTHD 2HLCA 1QTFA 4WXVA 4GCHG 4BAKB 2AEIH 3GY8A 1OP8A 4X6PA 1AI8H 1GMCG 3QX5H 4CBOA 3UPEA 1SOZA 5AVDA 3T27A 1QFKH 1E0FD 1GGDC 3BTDE 1AFEH 1WCZA 3SV7A 2XBYA 1C2KA 1PPHE 1DS2E 2CV3A 5EQRA 1CE5A 1GI9B 3U69H 1DXPA 3QDZB 3KHVA 4Q7XA 2NU0E 1CA0C 1BMNH 3T62A 3MNCA 4YLQH 1GVLA 1LHDH 2B7DH 3UNQA 2FLRH 5FCKA 1YPHE 4IGDA 3ZVFA 2WPIS 3SU4A 1EAWA 1O30A 1V2MT 1PQ8A 4KKDA 1NO9H 3ZYDA 2PR3A 3LGUA 1F92A 2FOGA 4MPWA 5CHAC 4AYYB 3GDVA 1TRNA 5GIBA 4M7GA 2O9QA 3MU1A 2A1DB 4FU9A 2EEKA 1ZR0A 1L1NA 3RXTA 5SGAE 3BIVH 1QCPA 1ANCA 4CBNA 1FONA 4K5ZA 1NFUA 1ZGIA 1YKTA 1CT0E 1VITH 4TYDA 6GCHG 2D26C 3SNEA 2BHGA 2ZHFH 1MMJN 4FUFA 2ZGCA 1BTHH 2TGPZ 2VH6A 1O3LA 1HPGA 1GMHG 5JBAS 1MBMA 5T6GA 1ZRKA 3G01A 1G37A 3C27B 1THSH 2ANYA 4I8GA 4FVDA 2LPRA 2OBQA 2VU8E 1O2UA 3FZDA 1YP9A 2IPHA 2QA9E 1WUNH 1AD8H 5F8XA 4ZKOU 2BLQA 2GCHF 1Y5BT 1RFNA 3VB3A 2PWXA 1NT1A 5T6DA 1M9UA 1AE8H 3LT3A 1EPTC 1W2KH 1HAPH 3URDA 2PHBA 4Y0ZE 1TABE 4Q7YA 1HAXB 1S6FA 4KTSA 2ZFTA 3K9XB 6LPRA 4X8TH 1C5NH 1KY9A 4UFGH 2BLWA 3GYMA 2SGAA 1TMBH 2BDAA 4Y7AA 4MQAA 4NIXA 1JRSA 1F0UA 1L1JA 4NIYA 1LCYA 1NU7B 1AVWA 2EC9H 1ELDE 1K1NA 4UDWH 1WV7H 5FXLA 4Y7BA 1BUIA 2GDEH 1SQAA 2GCHG 3Q3XA 1GDQA 1E36B 1BJVA 1O2OA 1J16A 3GCTF 1O5DH 3PO1C 1YGCH 2OD3B 3A8AA 3IG6B 3T25A 3NZIA 2W3IA 3PYHA 1ETSH 1O3PB 5LPFA 1C1TA 2W3KA 3B8JA 3F6UH 1EOLA 3Q00A 1SFIA 1IQHA 1Z6JH 4K60A 1PQ5A 1O2QA 1KTSB 2HWLB 1WBGB 4Y79A 1VGCB 2ZDLA 3PTNA 1AB9C 3BEIB 5DP8A 4D9RA 1C1PA 3W94A 2AMQA 1UO6A 1UVTH 3RU4T 3VPKA 5DO4H 2BDYA 1MU8B 2ZGXH 3KEEA 4F49A 1MTVA 2OLGA 3UOUA 1TAWA 1O3OA 3MOCA 1LKAA 4OS1A 3A84A 3AASA 1XVOA 2C93B 1B0EA 3EA7A 1C2HA 1TRYA 2WPJS 1HIAB 3PMAB 3KQEA 4FUHA 2GMTC 1A2CH 4CH2B 5DP4A 3TPIZ 2RG3A 3GDUA 1O5AB 1O2YA 1TX8A 1GHZA 4IN2A 4ABGA 4IS5A 1NPMA 3R3GB 1T8LA 3QK1A 1AIXH 1PFXC 3KQBA 4MDSA 3BSQA 1TQ0B 2QXHA 1QB9A 1T7CA 2BDCA 1GJ5H 3F9HA 2KAIA 4AGKA 1GI5A 1C5XB 1ZRBA 1P2NA 2B0FA 3SU0A 1AWFH 4MNXA 3RXOA 3U8RH 2IJOB 1SI5H 2BDIA 3KQDA 4IW4E 2W26A 1GMCF 1EB1H 5EQQA 2BLOA 1BMLA 1O3DA 1DFPA 4ZKSU 1UTQA 1O2SA 1QIXB 2GCTC 1SC8U 3UR6A 2V6NA 2BVSH 1O33A 2RA3A 4ABHA 4Y8XA 5BPEA 1OWIA 2A32A 3ATWA 3L33A 4WVPE 1D3PB 1HCGA 2A45B 2QF0A 4O9VA 4X1QU 1MKXH 1N8OB 3A86A 3ZVDA 1K1LA 1HXFH 1N6YA 3BTKE 1ZMNA 1K22H 2BY9X 2LNCA 1IQGA 1UTLM 1O37A 1ZHMA 3ZZ6A 1TWXB 1TPSA 3SU2A 5GCHF 1EKBB 2YOLA 3RXUA 4MPVA 1GJ8B 3UTUH 4X2YA 2A4OA 3D62A 1ELVA 4I8HA 2WUBA 3SNCA 1UTNA 1BTXA 3IWMA 3MU8A 1FN6A 1P0SH 3UQVA 1PYTC 1P2OA 1VJAU 4O03A 2OC8A 5C1XA 2BB4A 1C1NA 5G4BA 3MYWA 2VIPA 3SUFA 5JBBS 1AQ7A 1P02A 2RCEA 2ZGJA 3GISB 4ABBA 1DOJA 2WV4A 3SGBE 1MAXA 4A1TA 1C5TA 1GBMA 4BXWA 2BD9A 4OGYA 3D65E 1T8NA 4HFPB 5DP6A 1FY8E 1TGBA 1XM1A 1A3EH 3LC3A 4IMQA 4DY7B 2FM2A 3A7ZA 1P9SA 3A8CA 3TITA 4AFZA 1Q2WA 2NU3E 2BTCE 1ZTJA 1QR3E 2R0LA 5JDUB 1ORFA 3GICB 1KDQA 3M7QA 3O8CA 1DE7H 4Y10E 1O2XA 1V2NT 2ZGBH 4E7NA 1DWDH 1AKSA 9ESTA 4Y8ZA 5CE1A 1QB1A 4NIVA 2XBWA 4JYVH 1VGCC 5E0GA 4D9QA 2H6MA 2JH0D 2VWMA 4LOYH 2O8TA 2Z9GA 2GX4A 1D9IA 2J92A 1BA8B 3A82A 1BOQA 3ITIA 1T4VH 1T8MA 4FUEA 3ATIA 2O8WA 2F9UA 3N7OA 3P8GA 1B5GH 4MTBA 3TVJB 4MVNA 3PWBA 5DJ7A 1AMHA 1EUFA 3ELAH 2SGEE 5J4QA 2ZFPH 3WY8A 1GCDA 3QO6A 2A4QA 2YNAA 4K8YA 1BTUA 2XXLA 3U98H 1CHOF 7GCHF 2Q1JA 1O2HA 1C9TA 5C2ZA 2F9PA 3SO3A 5K0HA 3DHKH 1L1GA 3SI4H 1FY5A 1MKWH 2IOTA 3SQEE 3UWJH 1O3CA 1RTFB 4K2YA 1G3CA 4ESTE 4H6TA 6CHAC 2Q6FA 3GOVB 4OS2A 2XCNA 4U2WA 2OC0A 1ELTA 2FESH 2OP9A 4X6OA 1GJ9B 3LGVA 1RJXB 8ESTE 2H9HA 1E34B 2ZDVH 1GVZA 1UK4A 3MNBA 1H8IH 4ABAA 1VR1H 4I8LA 2FI3E 3KGPA 3SGQE 3VEQB 1O2PA 2V0BA 1NRQH 3ZVBA 4YESB 3RC6A 3S0NA 1DVAH 5C3NA 3U1IB 1ZMJA 2BDGA 1GCTC 3LU9B 3VXEH 1O2IA 1AHTH 1MCTA 2ZPQA 1EZXC 3SI3H 4ISOA 3SU1A 1J9CH 1LHEH 1EJNA 1C2IA 3DA9B 4X1RU 4INHA 1ZZZA 2FXRA 2XWAA 1PQAA 2VWOA 3RXEA 3QWCH 4B2CA 1FAXA 1DLKB 3RM2H 3BG4B 3FAOA 1XKBC 1CO7E 3EQ0H 3NK8A 2I6SA 1LVBA 3A89A 1GBTA 3MMGA 1VCWA 2V35A 1SMFE 1GMDF 5FPSA 2GZ7A 1AVGH 2GT7A 4ZXYH 3A7TA 1H9LB 4MG3A 4Y0YE 3TLOA 1G9IE 5A0CA 2Y5HA 1VCPA 4AFSA 3EAJA 1RGQA 9LPRA 3HKIB 2QXIA 1C2JA 1YC0A 2F83A 4X2VA 1GI8B 1C4U2 2PTNA 2QXGA 4LZ4B 1EATA 1GHAF 1GJBB 2A31A 3QUMP 3M3VA 2BZAA 1A3BH 3RXJA 4CRBA 3T5FH 1F0TA 2TIOA 4GAWA 2ZTYA 4NG9H 3A7WA 3ZV9A 1GI4A 1SSXA 3RXDA 4AGJA 1WQVH 2FOCA 4GHTA 3HKJB 7KMEH 1O3BA 1DY9A 2ZQ1A 1AN1E 2Z3CA 1C1VH 1GCTB 3UREA 5JPMH 4DURA 2XCFA 1QJ1B 1SLWB 2VINA 2BQWB 4AB9A 4BXSA 5L2ZH 2FYQA 3SHAH 1DDJA 2CF8H 3A88A 1W13U 1MTWA 4NZQA
chains in the Genus database with same CATH superfamily
1BCUH 1L4ZA 2DE9A 4O97A 2C4FH 2C8ZB 2Z9JA 3RXBA 1PYTD 1BRCE 3R0FA 1FV9A 2PSXA 5TCAA 1TNJA 5A09A 1JWTA 1B0FA 1QBNA 1SOTA 1MKXK 2H1UA 2WYGA 3ODDA 4E05H 4ZXXH 1SGDE 2BOHB 3H5CB 2GZ9A 3UB0A 1O2GH 1JIRA 3SJOA 1GGDB 1CU1A 1P2MA 4WXIA 5ESTE 3SORA 2I6QA 1Y3YA 4AG1A 1NRSH 4X8SH 3SZEA 2PKAA 4Y6DA 1T8OA 4ISLA 2Q6DA 3RMNH 2J94A 3A81A 2UUFB 2ZU1A 1SGTA 1CQQA 1ZPBA 2XC4A 1GBFA 4JZ1A 3PV2A 4CREA 5LPRA 4TWWA 1VCQA 4CHAC 3RP2A 1A0JA 1GMDG 1VITF 3LC5A 3S9AA 2XC5A 1ZPCA 3LGYA 2LELA 4AN7A 1Y3UA 1U6QA 3I78A 3GDSA 5EODA 1OHHD 3FP8E 1KXFA 5JB8S 2ILNA 3M3TA 2W7SA 4MNWA 2ZCKP 1SGNE 1O5FH 4B71A 1ZJKA 1H8ED 3K2UA 1TNLA 2BX4A 3P95A 3V13A 2F91A 3QTVH 4QT8C 3U8TH 1C4Y2 1G2LA 3PRBA 1UVUH 2AIQA 2V3OH 1BTYA 1DX5M 1O3EA 2VIDA 3BIUH 3P6ZB 4YOGA 4B75A 1RRKA 1JMOH 2XNIA 3HGPA 3RXCA 1IAUA 1O5EH 4NSVA 1GI1A 2FTLE 1FPHH 2VGCC 1BRAA 2KAIB 1GI2A 2STBE 1ELBA 4AORA 2CXVA 2C3SA 3P17H 2R3YA 2UUKB 1LO6A 5FCRA 1WSSH 4FOUC 3F9FA 2NWNA 2QAAA 4CRFA 2JETC 5A8ZA 2H5DA 2V3HH 3BTFE 3N99A 2SGPE 3MH5A 3E8LA 2F9NA 2ZO3H 1XUIA 2A5IA 5C0UA 1A61H 5DK1A 2ZP0H 5LGOA 1AZ8A 5DP9A 1W3CA 2STAE 3CS0A 1CT4E 5EU8A 2V3MA 1TNGA 2P3TB 5LH8A 1SGYE 2Z9KA 3SUGA 2EI7A 2H5CA 1CGHA 4Z6AH 8GCHG 1EAUA 2ZFQH 2ZU3A 4NSYA 1XMNB 4XD7D 1C1WH 4GLYA 1OX1A 5E2OA 3BTTE 4J1YA 2ZWLH 3SU3A 3DCLA 3F9GA 2ZHDA 3UOPA 4GVUA 1GBHA 1OWJA 4CRAA 4WMEA 1NN6A 1COWD 1K21H 1MTNB 2WYJA 3E0PB 3NPSA 5FHTA 3TNSA 1NRPH 1MTSA 4I32A 3RXIA 1CA0B 1SQTA 1K1PA 3ESTA 2AGIX 1ANBA 3QN7A 1FAKH 2ODQA 1RTLA 3MU5A 3VB5A 1P2KA 2VGCB 3LDXH 3MH4A 4YZUA 1UTPA 4F48B 1BTPA 1DITH 2G51A 1FY3A 2AFQB 2AH4X 1YCPM 4SGBE 4FUJA 2ZECA 1PPEE 4YT6H 3TJUA 4WF8A 1BQYA 1GBCA 1TGNA 5C20A 1LHCH 1XUHA 4OM9A 5EGMA 1C1UH 3LGWA 2P8OC 2KM0A 3TK5A 3ZVAA 1WAYB 3GS9A 3RXSA 2A7JA 3PMHB 3T2NA 3UFAA 1Y5UT 5GPIB 1GBDA 3TJOA 1Y3XA 1JIMA 1NS3A 1K2I1 2CJIA 1O35A 1SGFG 5AFYH 4ABDA 1GG6C 1OKXA 4NFEA 3SNAA 1FIWA 4H4FA 2BDHA 1GBAA 1AKSB 4FUIA 4X0WU 4GCHF 2A4GA 4B74A 4DVAU 1Z1IA 3SOSA 2SNVA 2O8UA 1Z6EA 3HK6B 3VGCB 2GP9B 3URCA 3W1EA 4X1SU 1O3AA 3ZZ7A 1O5BB 5KGOA 5BRRE 1ESTA 3ZYEA 1Y5AT 1EXFA 1XVMA 1SHHB 1TPAE 1N6XA 1B7XB 1FI8A 7ESTE 1FQ3A 3GY4A 1P04A 1YPEH 1PPBH 1W14U 2ZI2H 5DP3A 4X2XA 4ZKNU 4DGJA 3RLYH 2HNTE 1EASA 3IITA 5DSFA 2KX4A 2R0KA 1SGEE 4AX9H 1FLEE 2SGDE 2ZU4A 3AW1A 2G5VA 3TH4H 1QBOA 3RDZA 4RT1A 2BXUH 4J2YB 1H8HD 4AYVB 1O3IA 3TIUA 5E2PA 1J15A 1IQIA 1ZLRA 2ESTE 3M5MA 1AU8A 2BY6X 3NKKA 1YYY1 1ZGVA 4MPXA 3CS7A 1LKBA 3D49H 3RXQA 1HAVA 4X1NU 2K1QA 3A8BA 1GBKA 1LQDB 1RIWC 2VNTA 3S7KB 3C1KA 2P59A 3S9CA 4CRDA 1AGJA 4A1XA 4GPGA 5ESBA 2BY7X 2FOHA 4X6NA 1Z71A 4ACAA 2QYIA 4RKJB 4RSPA 4NWLA 1J8AA 2BQ6B 3M36A 4NZLA 1TALA 2C8XB 1J17T 2WPKS 1O3HA 3GCHB 3T26A 2Y80A 2ZDNA 2WPHS 3GY3A 1D4PB 2J5UA 4YOJA 3E90B 2ODYB 3RXGA 1SGFA 1MKWK 1TFXA 3HATH 1UHBB 1YCPH 1HAGE 4NCYA 5TJXA 1BHXB 1NRRH 1WTGH 2UUYA 4Y71A 2L6OA 1KXAA 4TWYA 1DY8A 4DG4A 1SL3A 4AFQA 1PQ7A 2JIZD 1DSUA 3PMJA 1TMUH 5T6FA 2FS8A 1CVWH 2JDID 1FZZA 2WINI 1UTJA 2BZ6H 3EDXB 3ZZCA 1GBEA 3RXKA 3SJ8A 4THNH 1BTWA 1P12E 1Z7KA 1SGIB 2RFKC 3UUZA 1OPHB 2HNTF 1HAIH 2XYAA 1D3DB 2BD2A 1CBWB 4CRGA 1XUGA 3BEUA 1DANH 1ZOMA 2BD8A 1GHBF 5A0BA 1TNHA 1EOJA 8LPRA 2YNBA 1UK2A 1O2RA 2LP6A 1D3QB 1NM6A 1YPLH 4I33A 5F03A 6GCHF 3KN2A 3PTBA 2BY8X 4ZUHA 3QGJA 1GJ4H 1YF4A 4I8KA 2C8YB 4FUDA 4WJG2 2VWNA 1SLVB 5L30H 1SQOA 2QIQA 3SJ9A 3QLPH 2FOMB 1C2LA 4VGCB 3TJVA 1IQMA 5EPYA 1G2MA 1ID5H 1A5HA 1YPKH 5GXPA 3FP7E 3SW2B 1HLTH 2HLDD 3OTJE 5GCHG 3DD2H 4FU8A 1P9UA 1JRTA 3VB7A 1SHYA 1UCYK 4BAQB 2J4IA 1EQ9A 3ODFA 4CR5A 2XTTB 1BTZA 2CHAB 3AVZA 2M5TA 2ZF0H 1H1BA 4IN1A 3UY9A 3UNRA 2A7HA 1YLDA 3SUDA 1V2VT 2A5KA 1HJ9A 1N1LA 1W0JD 3P8NA 4LZ1H 1UMAH 4X8UH 1ZHRA 2SNWA 1KXCA 2OQ5A 1MH0A 3RU4E 1LQEA 4ZAEA 2J95A 3GYLB 1KXBA 1ESAA 1L2EA 2OCVB 1CBWC 3MO3A 3DFJA 4FUGA 2Q6GA 2P3FH 2AHME 1S5SA 1TB6H 4YT7H 1TBQH 5A2MH 1HYLA 5FL7D 1P3CA 3MWIU 1V3XA 2QGRA 3A83A 1P2IA 4B1TA 5FPTA 2BM2A 4I8JA 1JBUH 1OWKA 1H9IE 1AFQB 2GVFA 4JMYA 1EPTA 2B8OH 3MQKC 1LPGB 2HVYB 1LHFH 1GBIA 1PPGE 4RKOB 1H8DH 3UNSA 2GGVB 1O34A 2L74A 4Z0KA 1RIWB 2ASUB 1MQ5A 4XSKU 3LIWA 1XUKA 1EZQA 1TRMA 4LXBH 5FBEA 2H2ZA 5EXLA 3Q77A 2XOKD 2RA0A 2J98B 2ZHWH 1K1OA 1W8BH 3BTME 3ZZAA 3LH3A 3S69A 2J97A 2VB0A 3OAAD 2ZU2A 2Y7ZA 1O3NA 5CHBA 4BAHB 1GJ7B 2VBCA 2JJ1D 5HYOA 1GBLA 3H7OA 2THFB 4M9FA 3SGAE 2R2MB 1S0QA 3O8RA 1LHGH 2ZDAH 1A4WH 1V2OT 3BTHE 1C1QA 1HAVB 1K1IA 1V2TT 2UWPA 4ACBA 1P06A 4I86A 1QB6A 2A2QH 3PB1E 1P11E 1C9PA 2FWWA 1OOKB 4K1EA 3RXPA 2IN2A 4Q2KA 1BT7A 4UEHH 1LTOA 2EI6A 3GCTG 2VIQA 1SPJA 1LPKB 3RLWH 1UCYH 2UWLA 1JXPA 3NCLA 3RU4D 3TGKE 1HUTH 1UTMA 2BYAX 2FOAA 2Y81A 4XE4A 1FJSA 2B5TB 4KP0A 5DPAA 1AB9B 3TK9A 3TGJE 1HIAA 1SLXB 1OP2A 5C67A 4DCDA 3TH2H 3MO6A 4X8VH 1A0HB 4UONA 1HNEE 2ZCHP 3B23B 3ZZ4A 1GI6A 3GY7A 1A5IA 1FN8A 2W5EA 1QQ4A 1HBTH 4XBDA 1OYQA 3JZ1B 1NFXA 3RXAA 5E8EH 2OTVA 5HM2A 4BTTB 1GL0E 1NZQH 3A80A 3SV8A 1QJ6B 1GPZA 2XRCA 4AOQA 1SLUB 4BTIB 1UVOA 4CH8B 1IQLA 1SBWA 1L4DA 1GJ6A 4NGAH 1E35B 1P01A 1NRNH 4ZHMU 3BG4C 5PTPA 2GT8A 1Y8TA 1P10A 4DJZB 1ZSJA 1C2FA 1MZDA 1ZJDA 2BLVA 4CHAB 1D3TB 3RXLA 1O2NA 1TX7A 3ZVGA 1ETTH 1NBMD 1NY22 3M35A 3FVFB 1RTKA 1F5RA 4F4OC 2GCTB 1ELFA 4X1PU 5E0HA 4D7FA 3BF6H 2Z94A 1QZ8A 1HFDA 1SGPE 2QY0B 1C5QA 3SV6A 4JZEH 1HB0B 2ZPSA 3V12A 2G55A 1O2WA 4Y76A 1QA0A 1C5RA 5CDFE 1A0LA 3ZZ9A 4Z1MD 3H7TA 1W12U 1ANEA 1BBRK 4JZDH 1G32B 1C1SA 4UD9H 1K9OE 4IMZA 1ANDA 5EXMA 1TE0A 4BAMB 5J4SA 1MBQA 2GV6A 1V2WT 3PO1B 1KLTA 1QRWA 1S82A 2JETB 5B6LA 3SN8A 4Q4LA 5JB9S 2NU2E 3L6PA 1UTKA 3UQOA 2GV7A 5F6MA 3AAVA 3T28A 2PTCE 4I31A 4Y8YA 1QA7A 2P93A 2AGEX 3EA8A 1Y3VA 2DE8A 3Q3KA 2GJGA 1WOFA 1V2PT 1KIGH 1J14A 1AUJA 2G5NA 2ZDMA 1QRZA 3ZVCA 1QY6A 4YTAA 1TPOA 4Q7ZA 1TGCA 1TGSZ 2PP6A 4ASHA 2P16A 3E1XB 4MPUA 4FUBA 5T3HA 1EFRD 1DLEA 2FI4E 2FYRA 1ZSLA 4JYTA 1TOCB 1CGIE 1SKYE 2D2DA 3MI4A 2A2XH 1WDIA 2CMYA 2O8MA 1BHXF 2OQUA 1HAOH 1GI0A 5C5OA 2PSYA 5AF9H 1YPHC 2D1JA 3ATKA 4JCNA 5L6NH 2BXTH 4B76A 3UIRA 2J98A 1GWAA 3AW0A 3PLBA 3UR9A 3PRDA 2UWOA 2AMDA 3RXVA 2Z9LA 2ZC9H 1OWDA 2VIWA 4HG6A 3P70B 1INCA 4WH8A 3LJOA 2Z7FE 1KXEA 2P8OB 1O5GH 1GBJA 3GY5A 1SGCA 4NA9H 3MNXA 5A8XA 2PKAB 3B9FH 3F1SB 2TGDA 2XBXA 1AZZA 4RT0A 2FZZA 4FU7A 4XFQA 3DUXH 5C1YA 1MABB 3Q3YA 1LMWB 1ETRH 5DGJA 1C2MA 1ELEE 1TQ7B 5EPNA 1CGJE 3I29A 3RXMA 1G36A 2ZEBA 3E0NB 3OSYA 1IQJA 2KCAA 4ABIA 4B73A 5IK2D 3OE7D 2FDAA 3SNDA 1CT2E 1GJDB 3SJIA 2C8WB 2NU1E 2Z6BD 2QF3A 1K1JA 3ZV8A 1A46H 4WY3A 1LDTT 2DUCA 1W11U 3PMBB 1MD7A 2G8TA 1NTPA 4BANB 2TGAA 3MHWU 1SR5C 2PKSC 1FMGA 2AS9A 2P95A 4UFFH 1Z8IB 3LOXA 2PUQH 1ARCA 3TJNA 1AVXA 2FLBH 3TK6A 4A7IB 1D6RA 3OEED 5CHAB 1OXGA 4BOHA 1T32A 2TBSA 1QL7A 4GSOA 1MTNC 3PM3A 1YBWA 1MD8A 1GHBG 1RS0A 2EQNA 1XXFA 3K6ZA 2F3CE 1EAIA 3E91A 3P8OA 4K8BA 1IQEA 5EIYA 3CP7A 1V2ST 1Z8JB 3LJJA 2W6ID 2FEQH 5HIZA 4FVBA 1P03A 3FZZA 1RXPA 4JK5A 5E0JA 1DT2A 3D23A 2WSSD 3EGKH 1AWHB 1V2KT 5GWZA 4ZHLU 1WQSA 2TGTA 1EP5A 1HJAC 5K7RA 1CHGA 4NA8A 3RUOA 1V2JT 2QV1A 3KIDU 2H9TH 5EW1H 1O3KA 2FIRH 5GJ4B 1QGFA 4XBBA 1W7GH 3RM0H 1BZXE 1OWEA 1C2EA 5FPYA 4K1TA 5HKKD 3ENSB 1EP6A 1ZYOA 1F5KU 3FKSD 5CMXH 1KDQB 1W7XH 1E79D 3OY5U 1C1OA 1F2SE 1C5UA 1HDTH 4XBCA 2FX6A 4AFUA 1KMHB 1GG6B 1QURH 3M3SA 3NWUA 3HK3B 3ZZ5A 1SGQE 3BN9A 2FX4A 3RC5A 1LPZB 1TPPA 4MNVA 3SQHE 3RXFA 1VJ9U 2A7CA 2BD5A 1BRUP 4PROA 2ZGHA 3M5LA 1HAZB 1LVYA 3GCHC 2RDLA 2Y5FA 4ZH8A 1NESE 1P09A 3O8BA 3MH7A 1QJ7B 3PWCA 5EG4A 1V2RT 2R2WU 1GHVH 1P2JA 3KL6A 3TH3H 1OS8A 1EZSC 2PGBB 3V7TA 2ULLA 2XC0A 2ANMH 2Y6TA 1P8VC 3OU0A 1GMHF 1S84A 2BQ7B 4ISNA 1GBBA 4JYUH 1O2LA 1TGTA 1FDPA 4A5TS 1C5YB 2BY5X 2BD3A 4ZROA 2TRMA 2SGFE 4SGAE 1FUJA 2AGGX 1PPFE 5F8ZA 1O31A 4OGXA 1CSOE 2ZZUH 3K65B 2OUAA 1Y3WA 1E38B 5IYTA 1HV7A 1VZQH 1AO5A 2G4UA 2HPQH 3GCOA 1W0YH 4KGAA 2FO9A 2VIVA 1HGTH 4RN6A 2W6JD 1ELAA 1FY4A 2ZG0H 1UJ1A 2BD4A 2ZHQH 4WMDA 5GDSH 1SFQB 5T1VA 4XDEA 1BBRE 1XXDA 4XOJA 4UE7H 5B6OA 1Z8RA 4IBLH 3U9AH 4WMFA 3LGIA 4TY6A 1EJAA 3MU4A 1A5GH 3I77A 3RXRA 2AIPA 5JBCS 1KXDA 1G3DA 2JH5D 3HGNA 3BEFB 3WWFA 2BVXH 3SNBA 2EI8A 1C5LH 2XW9A 3QZRA 1W10U 2QC2A 1TA6A 1MU6B 1EZUC 2K8IA 2G00A 5FX5A 3QGNB 3VB6A 2PKSB 2ALVA 2Z9IA 1F5LA 3NUMA 1TNKA 1FPCH 4DOQA 1MAYA 1K28D 4R0IA 3MU0A 4D76A 1IQNA 3QTOH 1DWCH 2ZNKH 2PLXA 3RMMH 1YCPK 1BB0B 1C5PA 1ZSKA 3VB4A 3E6PH 3STIA 1DUAA 2ZIQH 2FS9A 1VITG 3L3TA 1SB1H 2R9PA 4KTUA 3DSPA 1BJUA 3MFJA 4R8TB 2QN5T 1HAYB 1F7ZA 8KME2 3FANA 1TA2A 2H9EH 5H4IB 1ESBA 4E7RG 3KCGH 1ARBA 1DWBH 1TLDA 3A7XA 1S0RA 2Z3DA 1O2KA 4DT7B 1OSSA 1ABJH 5C0TA 3NXPA 2D8WA 4I7YH 5JBTA 2YMSC 1GJCB 1DWEH 1NFWA 2AMPA 4ABFA 1AFQC 5DP5A 1C4V2 4P00A 1V6DA 3ZZBA 1C2GA 2NU4E 2QCYA 1P05A 4UFEH 3M7TA 2BDBA 2EA3A 3JZ2B 1C5SA 1GI3A 4FETA 4OS4A 2XWBI 2WPMS 2GMTB 1O3GA 1O2VA 4Q80A 2M2AA 5DP7A 1L0ZA 4B2AA 2O8LA 3BG8A 4XRNA 2BD7A 4U30A 2Y5GA 2WHXA 2ALPA 3SV2H 1NU9A 3BV9B 3E16B 1W0ZU 5EJLA 1TIOA 3PLPA 1IQKA 2WV5A 2OBOA 5C5NA 4ASUD 8GCHF 1IHSH 1SG8B 1SVPA 1Z1JA 2Z3EA 5DN6D 3P8FA 1C5WB 2PV9B 5FX6A 2VH0A 1MZAA 4IC5A 1F0SA 2CHAC 2FOFA 3GY6A 3U1JB 1KSNA 1SGRE 4H6SB 1WXRA 2HPPH 4KELA 1Y59T 1UVPA 1S83A 3F2GA 1FIZA 2ZFSA 5F8TA 2OXSA 4X6MA 3SUEA 2GD4B 3QZQA 3S7HB 3M7UA 2HGTH 1QL9A 3S9BA 5EQSA 5HMAA 3EE7A 1LVMA 2VVVA 2WPDD 3P92A 4Q63A 1EX3A 1N8OC 4A1VA 5FAHA 1HXEH 2ZKSA 1PJPA 3PLKA 3F9EA 1F0RA 1O32A 1EJMA 3KNXA 5FBIA 2HRVA 1GJAB 2YMSB 4AZ2B 4WH6A 1O3FA 2ZDKA 2C90B 3DFLA 1V2QT 3A7VA 1XUFA 3OFND 4H42U 1P2QA 2VVCA 4YXWD 3V3MA 1CA8B 1IOEA 1O5CB 4D8NA 1UTOA 2WPLS 3ATMA 1G30B 2ZFRH 3N7EA 5ABWA 2R3UA 2IPQX 4YM9A 1ELCA 2ZHEH 1AUTC 4B2BA 1ACBE 3UWIA 3BTQE 1A1RA 3GY2A 1AE5A 1UVSH 2CF9H 3U8OH 1C5OH 2A5AA 2TPIZ 2KR7A 4HI3A 1MQ6A 3RXHA 3EYDA 2SFAA 3SU6A 1O2JA 4D7GA 1T4UH 4OS6A 5L2YH 1V2UT 5EW2H 1YPMH 2AERH 4JZIA 1QRXA 2PUXB 2ZTXA 2ZPRA 3DT0H 2HOBA 1ZTLA 2VWLA 1KTTB 3HPTB 3CENA 4HGCA 1C5VA 4GUXA 5EJ1A 1GVKB 2BOKA 1AY6H 4JZFH 5GNDA 4U32A 3FN8A 1GI7B 4O3TA 3A85A 3BTGE 4KTCA 4U01A 1RD3B 2BVRH 1VKYA 3A87A 3ATLA 1NFYA 4ZCNA 3CNRA 1DXWA 1DSTA 1H4WA 3F68H 1ELGA 3RMLH 3SV9A 4NWKA 1YPGH 2PW8H 3SZNA 2Y7XA 5DKMA 3SBKA 4OS5A 3MTYA 4DIHH 3OYPA 1BMAA 3ZVEA 1NBME 4FXGH 2G81E 3LH1A 4YO9A 7LPRA 1WU1A 3LGTA 1G3EA 2QXJA 4CR9A 3EA9A 2BMGB 4TT3D 2GTBA 1A7SA 1OYTH 2SGQE 4ISIH 2FI5E 4JK6A 3T29A 4CRCA 1YLNA 4NIWA 2F4LA 2ZFFH 1C1RA 4ZMAH 1QL8A 5C17A 2VVUA 4WWYA 1C5MD 1XKAC 4AB8A 1ZHPA 1NC6A 3A8DA 3LKWA 4HTCH 4AG2A 2FMJA 1MUEB 1P3EA 3MH6A 4DIIH 3LONA 4BNRA 1S6HA 4P02A 3V0XA 2G52A 3EE0B 1DPOA 4FUCA 1GDNA 1C1MA 3H09A 1UCYE 1Q3XA 1DICA 1TBRH 2OINA 2B9LA 1T31A 4YOIA 4Y11E 1K0HA 1YPJH 4O3UA 3LPRA 5HXFA 1TMTH 3K6YA 1TNIA 4DW2U 1GHAG 1BIOA 1O3MA 2V7QD 4UFDH 1XUJA 3FP6E 2QF5A 1P57B 1G3BA 1TOMH 4X2WA 4MLFB 3SJKA 5KECA 4INKA 5TCCA 1BITA 1S81A 2P3UB 2XBVA 2Y82A 3Q76A 1ZMLA 2HALA 2OC7A 1FXYA 1IHTH 2ZQ2A 4NA7A 3NRLA 1OP0A 2FPZA 3AAUA 3SU5A 3MO9A 4K3JA 3FOAA 3SHCH 1FX0B 1JOUB 1Q31A 5C1UA 5I46H 2P94A 1FY1A 5LPEA 1TYNA 3VXFH 2J38A 3RMOH 4ZHAA 2ODPA 1LVOA 1MTUA 3M61U 5KEDA 1YWUA 5AFZH 4MNYA 1ZTKA 1KLJH 3SYJA 1QQUA 3VGCC 6CHAB 2ANKH 2CN0H 2CGAA 4ZKRU 3VFEA 2W7UA 3TNTA 1O38A 3BTWE 3E3TA 1FNIA 5EXNA 4HZHA 1GHWH 2VIOA 5EOKA 1NROH 6ESTA 1GHXH 1WYKA 1PPZA 1X7AC 1GHYH 1THPB 3STJA 5A8YA 2A4RA 1GDUA 1BMMH 1K1MA 3PV5A 3O8DA 2ZCLP 3OX7U 4ABEA 4BAOB 1S6LA 1ABIH 2FOBA 1BDAA 5IDKA 4ISHH 1QBVH 3ZZDA 1HAHH 1D6WA 5EJZA 4OS7A 2FODA 2G4TA 1O2ZA 3M37A 2F9OA 3OY6U 2PGQB 3PV4A 4INLA 1KYNA 4LK4A 1EB2A 5DG6A 3RC4A 1ZPZA 1IQFA 2AYWA 2GZ8A 1TX6A 1YLCA 5HM9A 4VGCC 1DM4B 2J9NA 3MNSA 2K0QA 4A6LA 3F0PA 5ETXA 3KF2A 1O2MA 1YM0A 2WZQA 3ZZ8A 1KLIH 1UK3A 3A7YA 4IC6A 2VJ1A 2OC1A 1XX9A 1EAXA 2J34A 1O3JA 4GHQA 1PPCE 4E06H 2ZU5A 2JKHA 1QHRB 2JH6D 3KYGA 3TU7H 5C94A 1O36A 1E37B 2WUCA 3FFGA 1CHOG 1QNJA 7GCHG 2GKVE 3F0OA 3PROA 2ANWA 3M5NA 1TONA 5A0AE 2FTMA 2F9BH 5JYIA 2ZA5A 1E1QD 1V2LT 4TPYA 3M5OA 2BX3A 1EPTB 3BTEE 4TY7A 1S85A 3GCNA 4NFFA 3VG8A 5AHGH 2HNTC 1O0DH 1O2TA 1HJAB 2A0QB 2UUJB 3ZZ3A 1HJ8A 2F9VA 2HVXA 1GL1A 1BBRH 1C2DA 1DUEA 4BTUB 1OWHA 4TPIZ 1UHBA 2GDDA 2KZ4A 1MCVA 4K1SA 1H9HE 3W95A 4YLUA 1HRTH 4ABJA 3KQCA 2FOEA 4K69A 1TBZH 1Z8GA 1THRH 4A92A 3TGIE 2J2UA 1BMFD 1BRBE 5HGGA 5I25A 2FP7B 3F3BA 1O39A 2ZTZA 1C5ZB 2PFEA 1WTHD 2HLCA 1QTFA 4WXVA 4GCHG 4BAKB 2AEIH 3GY8A 1OP8A 4X6PA 1AI8H 1GMCG 3QX5H 4CBOA 3UPEA 1SOZA 5AVDA 3T27A 1QFKH 1E0FD 1GGDC 3BTDE 1AFEH 1WCZA 3SV7A 2XBYA 1C2KA 1PPHE 1DS2E 2CV3A 5EQRA 1CE5A 1GI9B 3U69H 1DXPA 3QDZB 3KHVA 4Q7XA 3ZIAD 2NU0E 1CA0C 1BMNH 3T62A 3MNCA 4YLQH 1GVLA 3FO8D 2KCYA 1LHDH 2B7DH 3UNQA 2FLRH 5FCKA 1YPHE 4IGDA 3ZVFA 2WPIS 3SU4A 1EAWA 1O30A 1V2MT 1PQ8A 4KKDA 1NO9H 3ZYDA 2QF4A 2PR3A 1F92A 2FOGA 3LGUA 4MPWA 5CHAC 4AYYB 2KCOA 3GDVA 1TRNA 5GIBA 4M7GA 2O9QA 3MU1A 2A1DB 4FU9A 2EEKA 1ZR0A 3F2HA 1L1NA 3RXTA 5SGAE 3BIVH 1QCPA 1ANCA 4CBNA 3DSGA 1FONA 1W0KD 1NFUA 4K5ZA 1ZGIA 1YKTA 1CT0E 1VITH 4TYDA 6GCHG 2D26C 3SNEA 2BHGA 2ZHFH 1MMJN 4FUFA 2ZGCA 1BTHH 2TGPZ 2VH6A 1O3LA 1HPGA 1GMHG 1SQRA 5JBAS 1MBMA 5T6GA 1ZRKA 3G01A 1G37A 3C27B 1THSH 2ANYA 4I8GA 4FVDA 2LPRA 2OBQA 2VU8E 1O2UA 3FZDA 3KYFA 1YP9A 2IPHA 2QA9E 4F55A 1WUNH 1AD8H 5F8XA 4ZKOU 2BLQA 2GCHF 1Y5BT 1RFNA 3VB3A 2PWXA 1NT1A 5T6DA 5F53A 1M9UA 1AE8H 3LT3A 1EPTC 1W2KH 1HAPH 3URDA 2PHBA 4Y0ZE 1TABE 4Q7YA 1HAXB 1S6FA 4KTSA 2ZFTA 3K9XB 6LPRA 4X8TH 1C5NH 1KY9A 4UFGH 2BLWA 3GYMA 2SGAA 3UAIC 1TMBH 2BDAA 4Y7AA 4MQAA 4NIXA 3WWBA 1JRSA 2OK5A 1F0UA 2KFWA 1L1JA 4NIYA 1LCYA 1NU7B 1AVWA 2EC9H 2KCPA 1ELDE 1K1NA 3OTPA 4UDWH 1WV7H 5FXLA 4Y7BA 1BUIA 2GDEH 1SQAA 2GCHG 3Q3XA 1GDQA 1E36B 1BJVA 1O2OA 1J16A 3GCTF 1O5DH 3PO1C 1YGCH 2OD3B 3A8AA 3IG6B 3T25A 3NZIA 2W3IA 3PYHA 1ETSH 1O3PB 5LPFA 1C1TA 2W3KA 3B8JA 2EY4C 3F6UH 1EOLA 3Q00A 1SFIA 1IQHA 1Z6JH 4K60A 1PQ5A 1O2QA 1KTSB 2HWLB 1WBGB 4Y79A 1VGCB 2ZDLA 3PTNA 1AB9C 3BEIB 5DP8A 4D9RA 1C1PA 3W94A 2AMQA 1UO6A 1UVTH 3KQ5A 3RU4T 3VPKA 5DO4H 2BDYA 1MU8B 2ZGXH 3KEEA 4F49A 1MTVA 2OLGA 3UOUA 1TAWA 1O3OA 3MOCA 1LKAA 3N7DA 4OS1A 3A84A 4B6EA 3AASA 1XVOA 2C93B 1B0EA 3EA7A 1C2HA 1TRYA 2WPJS 1HIAB 3PMAB 3KQEA 4FUHA 2GMTC 1A2CH 4CH2B 5DP4A 3TPIZ 2RG3A 3GDUA 1O5AB 1O2YA 1TX8A 1GHZA 4IN2A 4ABGA 4IS5A 1NPMA 3R3GB 1T8LA 3QK1A 1AIXH 1PFXC 3KQBA 4MDSA 3BSQA 1TQ0B 2QXHA 1QB9A 1T7CA 2BDCA 1GJ5H 1E1RD 3F9HA 2KAIA 4AGKA 1GI5A 1C5XB 1ZRBA 1P2NA 2B0FA 3SU0A 1AWFH 4MNXA 3RXOA 2CK3D 3U8RH 2IJOB 1SI5H 2BDIA 3KQDA 4IW4E 4DT4A 2W26A 1GMCF 1EB1H 5EQQA 2BLOA 1BMLA 1O3DA 1DFPA 4ZKSU 1UTQA 1O2SA 1QIXB 2GCTC 1SC8U 3UR6A 2V6NA 2BVSH 1O33A 2RA3A 4ABHA 4Y8XA 5BPEA 1OWIA 2A32A 3ATWA 3L33A 4WVPE 1D3PB 1HCGA 2A45B 2QF0A 3F2FA 4O9VA 4X1QU 1MKXH 1N8OB 3A86A 3ZVDA 1K1LA 1HXFH 1N6YA 3BTKE 1ZMNA 1K22H 2BY9X 2LNCA 1IQGA 1UTLM 1O37A 1ZHMA 3ZZ6A 3U28C 1TWXB 1TPSA 3SU2A 5GCHF 1EKBB 2YOLA 3RXUA 4MPVA 1GJ8B 2RDEA 3UTUH 4X2YA 2A4OA 3D62A 1ELVA 4I8HA 2WUBA 2JJ2D 3SNCA 1UTNA 1YY3A 1BTXA 3IWMA 3MU8A 1FN6A 1P0SH 3UQVA 1PYTC 1P2OA 1VJAU 4O03A 2OC8A 5C1XA 2BB4A 1C1NA 5G4BA 3MYWA 2VIPA 3SUFA 5JBBS 4RI0A 1UW7A 1AQ7A 1P02A 2RCEA 2ZGJA 3GISB 4ABBA 1DOJA 2WV4A 3SGBE 1MAXA 4A1TA 1C5TA 1GBMA 4BXWA 2BD9A 4OGYA 3D65E 1T8NA 4HFPB 5DP6A 1FY8E 1TGBA 1XM1A 1A3EH 3LC3A 4IMQA 4DY7B 2FM2A 3WW7A 3A7ZA 1P9SA 2QE7D 3A8CA 3TITA 4AFZA 4TSFD 1Q2WA 2NU3E 2BTCE 1ZTJA 1QR3E 2R0LA 5JDUB 1ORFA 3GICB 1KDQA 3M7QA 4B6FA 3O8CA 1DE7H 2F43B 4Y10E 1O2XA 1V2NT 2ZGBH 4E7NA 1DWDH 1AKSA 9ESTA 4Y8ZA 5CE1A 1QB1A 4NIVA 4AC9A 2XBWA 4JYVH 1VGCC 5E0GA 4D9QA 2H6MA 2JH0D 2VWMA 4LOYH 2O8TA 2Z9GA 2GX4A 1D9IA 2J92A 1BA8B 3A82A 1BOQA 3ITIA 1T4VH 1T8MA 2YMSD 4FUEA 3ATIA 2O8WA 2F9UA 3N7OA 3P8GA 1B5GH 4MTBA 3TVJB 4MVNA 3PWBA 5DJ7A 1AMHA 1EUFA 3ELAH 2SGEE 5J4QA 2ZFPH 3WY8A 1GCDA 3QO6A 2A4QA 2YNAA 4K8YA 1BTUA 2XXLA 3U98H 1CHOF 7GCHF 2Q1JA 3OEHD 1O2HA 1C9TA 5C2ZA 2F9PA 3SO3A 5K0HA 3DHKH 1L1GA 3SI4H 1FY5A 1MKWH 2IOTA 3SQEE 3UWJH 1O3CA 1RTFB 4K2YA 1G3CA 4ESTE 4H6TA 6CHAC 2Q6FA 3GOVB 4OS2A 2XCNA 4U2WA 2OC0A 1ELTA 2FESH 5HIYA 2OP9A 4X6OA 1GJ9B 3LGVA 1RJXB 8ESTE 2H9HA 1E34B 2ZDVH 1GVZA 1UK4A 3MNBA 1H8IH 4ABAA 1VR1H 4I8LA 2FI3E 3KGPA 3SGQE 3VEQB 1O2PA 2V0BA 1NRQH 3ZVBA 4YESB 3RC6A 3S0NA 1DVAH 5C3NA 3U1IB 1ZMJA 2BDGA 1GCTC 3LU9B 3VXEH 1O2IA 1AHTH 1MCTA 2ZPQA 1EZXC 3SI3H 4ISOA 3SU1A 1J9CH 1LHEH 1EJNA 1C2IA 3DA9B 4X1RU 4INHA 1ZZZA 2FXRA 2XWAA 1PQAA 2VWOA 3RXEA 3QWCH 4B2CA 1FAXA 1DLKB 3RM2H 3BG4B 3FAOA 1XKBC 1CO7E 3EQ0H 3NK8A 2I6SA 1LVBA 3A89A 1GBTA 3MMGA 1VCWA 2V35A 1SMFE 1GMDF 5FPSA 2GZ7A 1AVGH 2GT7A 4ZXYH 3A7TA 1H9LB 4MG3A 4Y0YE 3TLOA 1G9IE 5A0CA 3DSOA 2Y5HA 1VCPA 4AFSA 3EAJA 1RGQA 9LPRA 3HKIB 2QXIA 1C2JA 1YC0A 2F83A 4X2VA 1GI8B 1C4U2 2PTNA 2QXGA 4LZ4B 1EATA 1GHAF 1GJBB 2A31A 3QUMP 3M3VA 2BZAA 1A3BH 3AK5A 3RXJA 4CRBA 3T5FH 1F0TA 2TIOA 4GAWA 2ZTYA 4NG9H 3A7WA 3ZV9A 1GI4A 1SSXA 3RXDA 2IJD1 4AGJA 1WQVH 2FOCA 4GHTA 3HKJB 7KMEH 1O3BA 1DY9A 2ZQ1A 1AN1E 2Z3CA 2XNDD 1C1VH 1GCTB 3UREA 5JPMH 4DURA 2XCFA 1QJ1B 1SLWB 2VINA 2BQWB 4AB9A 4BXSA 5L2ZH 2FYQA 3SHAH 1DDJA 2CF8H 2WV9A 3A88A 1W13U 1MTWA 4NZQA
chains in the Genus database with same CATH topology
1BCUH 1L4ZA 2DE9A 4O97A 2C4FH 2C8ZB 2Z9JA 3RXBA 1PYTD 1BRCE 3R0FA 1FV9A 2PSXA 5TCAA 1TNJA 5A09A 1JWTA 1B0FA 1QBNA 1SOTA 1MKXK 2H1UA 2WYGA 3ODDA 4E05H 4ZXXH 1SGDE 2BOHB 3H5CB 2GZ9A 1O2GH 1JIRA 3SJOA 1GGDB 1CU1A 1P2MA 4WXIA 5ESTE 3SORA 2I6QA 1Y3YA 4AG1A 1NRSH 4X8SH 2PKAA 4Y6DA 1T8OA 4ISLA 2Q6DA 3RMNH 2J94A 3A81A 2UUFB 2ZU1A 1SGTA 1CQQA 1ZPBA 2XC4A 1GBFA 4JZ1A 4CREA 5LPRA 4TWWA 1VCQA 4CHAC 3RP2A 1A0JA 1GMDG 1VITF 3LC5A 3S9AA 2XC5A 1ZPCA 3LGYA 4AN7A 1Y3UA 1U6QA 3I78A 3GDSA 5EODA 3FP8E 1KXFA 5JB8S 2ILNA 3M3TA 2W7SA 4MNWA 2ZCKP 1SGNE 1O5FH 4B71A 1ZJKA 3K2UA 1TNLA 2BX4A 3P95A 3V13A 2F91A 3QTVH 4QT8C 3U8TH 1C4Y2 1G2LA 1UVUH 2AIQA 2VIDA 1BTYA 1DX5M 1O3EA 2V3OH 3BIUH 3P6ZB 4YOGA 4B75A 1RRKA 1JMOH 2XNIA 3HGPA 3RXCA 1IAUA 1O5EH 4NSVA 1GI1A 2FTLE 1FPHH 2VGCC 1BRAA 2KAIB 1GI2A 2STBE 1ELBA 4AORA 2CXVA 2C3SA 3P17H 2R3YA 2UUKB 1LO6A 5FCRA 1WSSH 3F9FA 2NWNA 2QAAA 4CRFA 2JETC 5A8ZA 2H5DA 2V3HH 3BTFE 2SGPE 3MH5A 3E8LA 2F9NA 2ZO3H 1XUIA 2A5IA 1A61H 5DK1A 2ZP0H 5LGOA 1AZ8A 5DP9A 1W3CA 2STAE 3CS0A 1CT4E 5EU8A 1TNGA 2P3TB 5LH8A 1SGYE 2Z9KA 3SUGA 2EI7A 2H5CA 1CGHA 4Z6AH 8GCHG 1EAUA 2ZFQH 2ZU3A 4NSYA 1XMNB 1C1WH 4GLYA 1OX1A 5E2OA 3BTTE 4J1YA 2ZWLH 3SU3A 3F9GA 2ZHDA 3UOPA 4GVUA 1GBHA 1OWJA 4CRAA 4WMEA 1NN6A 1K21H 1MTNB 2WYJA 3E0PB 3NPSA 5FHTA 3TNSA 1NRPH 1MTSA 4I32A 3RXIA 1CA0B 1SQTA 1K1PA 3ESTA 2AGIX 1ANBA 3QN7A 1FAKH 2ODQA 1RTLA 3MU5A 3VB5A 1P2KA 2VGCB 3LDXH 3MH4A 4YZUA 1UTPA 1BTPA 1DITH 2G51A 1FY3A 2AFQB 2AH4X 1YCPM 4SGBE 4FUJA 2ZECA 1PPEE 4YT6H 3TJUA 4WF8A 1BQYA 1GBCA 1TGNA 5C20A 1LHCH 1XUHA 5EGMA 1C1UH 3LGWA 2P8OC 3TK5A 3ZVAA 1WAYB 3RXSA 2A7JA 3PMHB 3T2NA 3UFAA 1Y5UT 5GPIB 1GBDA 3TJOA 1Y3XA 1JIMA 1NS3A 1K2I1 2CJIA 1O35A 1SGFG 5AFYH 4ABDA 1GG6C 1OKXA 4NFEA 3SNAA 1FIWA 4H4FA 2BDHA 1GBAA 1AKSB 4FUIA 4X0WU 4GCHF 2A4GA 4B74A 4DVAU 1Z1IA 3SOSA 2SNVA 2O8UA 1Z6EA 3HK6B 3VGCB 2GP9B 3URCA 4X1SU 1O3AA 3ZZ7A 1O5BB 5BRRE 1ESTA 3ZYEA 1Y5AT 1EXFA 1XVMA 1SHHB 1TPAE 1N6XA 1B7XB 1FI8A 7ESTE 1FQ3A 3GY4A 1P04A 1YPEH 1PPBH 1W14U 2ZI2H 5DP3A 4X2XA 4ZKNU 4DGJA 3RLYH 2HNTE 1EASA 3IITA 2R0KA 1SGEE 4AX9H 1FLEE 2SGDE 2ZU4A 3AW1A 2G5VA 3TH4H 1QBOA 3RDZA 2BXUH 4J2YB 4AYVB 1O3IA 3TIUA 5E2PA 1J15A 1IQIA 1ZLRA 2ESTE 3M5MA 1AU8A 2BY6X 3NKKA 1YYY1 1ZGVA 4MPXA 3CS7A 1LKBA 3D49H 3RXQA 1HAVA 4X1NU 2K1QA 3A8BA 1GBKA 1LQDB 1RIWC 2VNTA 3S7KB 3C1KA 2P59A 3S9CA 4CRDA 1AGJA 4A1XA 4GPGA 5ESBA 2BY7X 2FOHA 4X6NA 1Z71A 2QYIA 4RKJB 4RSPA 4NWLA 1J8AA 2BQ6B 3M36A 4NZLA 1TALA 2C8XB 1J17T 2WPKS 1O3HA 3GCHB 3T26A 2Y80A 2ZDNA 2WPHS 3GY3A 1D4PB 4YOJA 3E90B 2ODYB 3RXGA 1SGFA 1MKWK 1TFXA 3HATH 1UHBB 1YCPH 1HAGE 4NCYA 5TJXA 1BHXB 1NRRH 1WTGH 2UUYA 4Y71A 1KXAA 4TWYA 1DY8A 4DG4A 1SL3A 4AFQA 1PQ7A 1DSUA 3PMJA 1TMUH 5T6FA 2FS8A 1CVWH 2WINI 1FZZA 1UTJA 2BZ6H 3EDXB 3ZZCA 1GBEA 3RXKA 3SJ8A 4THNH 1BTWA 1P12E 1Z7KA 1SGIB 3UUZA 1OPHB 2HNTF 1HAIH 2XYAA 1D3DB 2BD2A 1CBWB 4CRGA 1XUGA 3BEUA 1DANH 1ZOMA 2BD8A 1GHBF 5A0BA 1TNHA 1EOJA 8LPRA 2YNBA 1UK2A 1O2RA 1D3QB 1NM6A 1YPLH 4I33A 5F03A 6GCHF 3KN2A 3PTBA 2BY8X 4ZUHA 3QGJA 1GJ4H 1YF4A 4I8KA 2C8YB 4FUDA 4WJG2 2VWNA 1SLVB 5L30H 1SQOA 2QIQA 3SJ9A 3QLPH 2FOMB 1C2LA 4VGCB 3TJVA 1IQMA 5EPYA 1G2MA 1ID5H 1A5HA 1YPKH 5GXPA 3FP7E 3SW2B 1HLTH 3OTJE 5GCHG 3DD2H 4FU8A 1P9UA 1JRTA 3VB7A 1SHYA 1UCYK 4BAQB 2J4IA 1EQ9A 3ODFA 4CR5A 2XTTB 1BTZA 2CHAB 3AVZA 2M5TA 2ZF0H 1H1BA 4IN1A 3UY9A 3UNRA 2A7HA 1YLDA 3SUDA 1V2VT 2A5KA 1HJ9A 1N1LA 3P8NA 4LZ1H 1UMAH 4X8UH 1ZHRA 2SNWA 1KXCA 2OQ5A 1MH0A 3RU4E 1LQEA 4ZAEA 2J95A 3GYLB 1KXBA 1ESAA 1L2EA 2OCVB 1CBWC 3MO3A 3DFJA 4FUGA 2Q6GA 2P3FH 1S5SA 1TB6H 4YT7H 1TBQH 5A2MH 1HYLA 1P3CA 3MWIU 1V3XA 2QGRA 3A83A 1P2IA 4B1TA 5FPTA 2BM2A 4I8JA 1JBUH 1OWKA 1H9IE 1AFQB 2GVFA 4JMYA 1EPTA 2B8OH 1LPGB 1LHFH 1GBIA 1PPGE 4RKOB 1H8DH 3UNSA 2GGVB 1O34A 4Z0KA 1RIWB 2ASUB 1MQ5A 4XSKU 3LIWA 1XUKA 1EZQA 1TRMA 4LXBH 5FBEA 2H2ZA 5EXLA 3Q77A 2RA0A 2ZHWH 1K1OA 1W8BH 3BTME 3ZZAA 3LH3A 3S69A 2VB0A 2ZU2A 2Y7ZA 1O3NA 4BAHB 1GJ7B 5HYOA 1GBLA 3H7OA 2THFB 3SGAE 2R2MB 1S0QA 3O8RA 1LHGH 2ZDAH 1A4WH 1V2OT 3BTHE 1C1QA 1HAVB 1K1IA 1V2TT 2UWPA 1P06A 1QB6A 2A2QH 3PB1E 1P11E 1C9PA 2FWWA 1OOKB 4K1EA 3RXPA 2IN2A 4Q2KA 1BT7A 4UEHH 1LTOA 2EI6A 3GCTG 2VIQA 1SPJA 1LPKB 3RLWH 1UCYH 2UWLA 1JXPA 3NCLA 3RU4D 3TGKE 1HUTH 1UTMA 2BYAX 2FOAA 2Y81A 4XE4A 1FJSA 2B5TB 4KP0A 5DPAA 1AB9B 3TK9A 3TGJE 1HIAA 1SLXB 1OP2A 5C67A 4DCDA 3TH2H 3MO6A 4X8VH 1A0HB 4UONA 1HNEE 2ZCHP 3B23B 3ZZ4A 1GI6A 3GY7A 1A5IA 1FN8A 2W5EA 1QQ4A 1HBTH 4XBDA 1OYQA 3JZ1B 1NFXA 3RXAA 5E8EH 2OTVA 5HM2A 4BTTB 1GL0E 1NZQH 3A80A 3SV8A 1QJ6B 1GPZA 2XRCA 4AOQA 1SLUB 4BTIB 1UVOA 4CH8B 1IQLA 1SBWA 1L4DA 1GJ6A 4NGAH 1E35B 1P01A 1NRNH 4ZHMU 3BG4C 5PTPA 2GT8A 1Y8TA 1P10A 4DJZB 1ZSJA 1C2FA 1MZDA 1ZJDA 2BLVA 4CHAB 1D3TB 3RXLA 1O2NA 1TX7A 3ZVGA 1ETTH 1NY22 3M35A 3FVFB 1RTKA 1F5RA 4F4OC 2GCTB 1ELFA 4X1PU 5E0HA 4D7FA 3BF6H 2Z94A 1HFDA 1SGPE 2QY0B 1C5QA 3SV6A 4JZEH 1HB0B 2ZPSA 3V12A 2G55A 1O2WA 4Y76A 1QA0A 1C5RA 1A0LA 3ZZ9A 3H7TA 1W12U 1ANEA 1BBRK 4JZDH 1G32B 1C1SA 4UD9H 1K9OE 4IMZA 1ANDA 5EXMA 1TE0A 4BAMB 5J4SA 1MBQA 2GV6A 1V2WT 3PO1B 1KLTA 1QRWA 1S82A 2JETB 3SN8A 5JB9S 2NU2E 3L6PA 1UTKA 3UQOA 2GV7A 5F6MA 3AAVA 3T28A 2PTCE 4I31A 4Y8YA 1QA7A 2P93A 2AGEX 3EA8A 1Y3VA 2DE8A 3Q3KA 1WOFA 1V2PT 1KIGH 1J14A 1AUJA 2G5NA 2ZDMA 1QRZA 3ZVCA 1QY6A 4YTAA 1TPOA 4Q7ZA 1TGCA 1TGSZ 4ASHA 2P16A 3E1XB 4MPUA 4FUBA 5T3HA 2FI4E 1DLEA 2FYRA 1ZSLA 4JYTA 1TOCB 1CGIE 2D2DA 3MI4A 2A2XH 2CMYA 2O8MA 1BHXF 2OQUA 1HAOH 1GI0A 5C5OA 2PSYA 5AF9H 1YPHC 2D1JA 3ATKA 4JCNA 5L6NH 2BXTH 4B76A 3UIRA 1GWAA 3AW0A 3PLBA 3UR9A 2UWOA 2AMDA 3RXVA 2Z9LA 2ZC9H 1OWDA 2VIWA 3P70B 1INCA 4WH8A 3LJOA 2Z7FE 1KXEA 2P8OB 1O5GH 1GBJA 3GY5A 1SGCA 4NA9H 3MNXA 5A8XA 2PKAB 3B9FH 3F1SB 2TGDA 2XBXA 1AZZA 2FZZA 4FU7A 4XFQA 3DUXH 5C1YA 3Q3YA 1LMWB 1ETRH 5DGJA 1C2MA 1ELEE 1TQ7B 5EPNA 1CGJE 3I29A 3RXMA 1G36A 2ZEBA 3E0NB 3OSYA 1IQJA 4ABIA 4B73A 2FDAA 3SNDA 1CT2E 1GJDB 3SJIA 2C8WB 2NU1E 2Z6BD 2QF3A 1K1JA 3ZV8A 1A46H 4WY3A 1LDTT 2DUCA 1W11U 3PMBB 1MD7A 2G8TA 1NTPA 4BANB 2TGAA 3MHWU 1SR5C 2PKSC 1FMGA 2AS9A 2P95A 4UFFH 1Z8IB 3LOXA 2PUQH 1ARCA 3TJNA 1AVXA 2FLBH 3TK6A 4A7IB 1D6RA 5CHAB 1OXGA 4BOHA 1T32A 2TBSA 1QL7A 4GSOA 1MTNC 3PM3A 1YBWA 1MD8A 1GHBG 1RS0A 1XXFA 3K6ZA 2F3CE 1EAIA 3E91A 3P8OA 4K8BA 1IQEA 3CP7A 1V2ST 1Z8JB 3LJJA 2FEQH 4FVBA 1P03A 3FZZA 1RXPA 4JK5A 5E0JA 1DT2A 3D23A 3EGKH 5GWZA 1AWHB 1V2KT 4ZHLU 1WQSA 2TGTA 1EP5A 1HJAC 5K7RA 1CHGA 4NA8A 3RUOA 1V2JT 2QV1A 3KIDU 2H9TH 5EW1H 1O3KA 2FIRH 5GJ4B 1QGFA 4XBBA 1W7GH 3RM0H 1BZXE 1OWEA 1C2EA 5FPYA 4K1TA 3ENSB 1EP6A 1ZYOA 1F5KU 5CMXH 1KDQB 1W7XH 3OY5U 1C1OA 1F2SE 1C5UA 1HDTH 4XBCA 2FX6A 4AFUA 1GG6B 1QURH 3M3SA 3NWUA 3HK3B 3ZZ5A 1SGQE 3BN9A 2FX4A 3RC5A 1LPZB 1TPPA 4MNVA 3SQHE 3RXFA 1VJ9U 2A7CA 2BD5A 1BRUP 4PROA 2ZGHA 3M5LA 1HAZB 1LVYA 3GCHC 2RDLA 2Y5FA 4ZH8A 1NESE 1P09A 3O8BA 3MH7A 1QJ7B 3PWCA 5EG4A 1V2RT 2R2WU 1GHVH 1P2JA 3KL6A 3TH3H 1OS8A 1EZSC 2PGBB 3V7TA 2ULLA 2XC0A 2ANMH 2Y6TA 1P8VC 3OU0A 1GMHF 1S84A 2BQ7B 4ISNA 1GBBA 4JYUH 1O2LA 1TGTA 1FDPA 4A5TS 1C5YB 2BY5X 2BD3A 4ZROA 2TRMA 2SGFE 4SGAE 1FUJA 2AGGX 1PPFE 5F8ZA 1O31A 4OGXA 1CSOE 2ZZUH 3K65B 2OUAA 1Y3WA 1E38B 5IYTA 1HV7A 1VZQH 1AO5A 2G4UA 2HPQH 3GCOA 1W0YH 4KGAA 2FO9A 2VIVA 1HGTH 4RN6A 1ELAA 1FY4A 2ZG0H 1UJ1A 2BD4A 2ZHQH 4WMDA 5GDSH 1SFQB 4XDEA 1BBRE 1XXDA 4XOJA 4UE7H 5B6OA 1Z8RA 4IBLH 3U9AH 4WMFA 3LGIA 4TY6A 1EJAA 3MU4A 1A5GH 3I77A 3RXRA 2AIPA 5JBCS 1KXDA 1G3DA 2JH5D 3HGNA 3BEFB 2BVXH 3SNBA 2EI8A 1C5LH 2XW9A 3QZRA 1W10U 2QC2A 1TA6A 1MU6B 1EZUC 2G00A 5FX5A 3QGNB 3VB6A 2PKSB 2ALVA 2Z9IA 1F5LA 3NUMA 1TNKA 1FPCH 4DOQA 1MAYA 1K28D 4R0IA 3MU0A 4D76A 1IQNA 3QTOH 1DWCH 2ZNKH 2PLXA 3RMMH 1YCPK 1BB0B 1C5PA 1ZSKA 3VB4A 3E6PH 3STIA 1DUAA 2ZIQH 2FS9A 1VITG 3L3TA 1SB1H 2R9PA 4KTUA 1BJUA 3MFJA 4R8TB 2QN5T 1HAYB 1F7ZA 8KME2 3FANA 1TA2A 2H9EH 5H4IB 1ESBA 4E7RG 3KCGH 1ARBA 1DWBH 1TLDA 3A7XA 1S0RA 2Z3DA 1O2KA 4DT7B 1OSSA 1ABJH 3NXPA 2D8WA 4I7YH 5JBTA 1GJCB