4AG2A

Human chymase - fynomer complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
226
structure length
223
Chain Sequence
IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHYMASE
publication title Generation, Characterization and Structural Data of Chymase Binding Proteins Based on the Human Fyn Kinase SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/de novo protein
total genus 51
structure length 223
sequence length 226
chains with identical sequence B
ec nomenclature ec 3.4.21.39: Chymase.
pdb deposition date 2012-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ag2A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ag2A02
3KEEA 2P95A 3SHCH 2AGEX 1GMDG 1WYKA 3SU4A 4VGCC 1HJAB 3RMMH 2V0BA 4Q2KA 2ZDKA 1NESE 2ASUB 3QN7A 4NZQA 4WWYA 3SV2H 3GY8A 2BDHA 1LVOA 2G4TA 2JH0D 1AWFH 1YF4A 4GVUA 4FXGH 1CT0E 1P2JA 1TB6H 1W7XH 3ODDA 1Y3UA 4INHA 3K2UA 4NFEA 4X6NA 1BBRK 1C1TA 2PKAA 3EA8A 5EODA 3SUFA 1IQIA 1F0SA 2GZ8A 1F0RA 3LGWA 1LVYA 2BY5X 4D9QA 3STIA 4BAHB 1EZSC 1C4Y2 3A7WA 3VB4A 3ZZ8A 4IS5A 2G00A 1C2KA 2FOGA 2ZPRA 2BYAX 2F9UA 1OPHB 1AI8H 3SU6A 4CH2B 2W26A 4TPIZ 1IQKA 1BRBE 4RSPA 3K9XB 1OP0A 2VIWA 4JZFH 1BRCE 1C5XB 5L6NH 3NCLA 4DVAU 2FODA 2G81E 1V2PT 5EXNA 3SQEE 1Y3WA 1NN6A 2BD5A 1F2SE 1GHBG 1LQDB 1RIWC 1O2XA 2XBXA 2FDAA 3ATMA 1VJAU 5A2MH 1LKAA 1GBEA 7LPRA 1MTNB 2FS8A 5AFZH 1NY22 1UTOA 1C1QA 1ZGIA 4X8UH 3NXPA 4WH8A 2GCTC 1TX6A 2BD7A 2GKVE 1GL0E 4AB9A 2Y80A 4Y8ZA 1DUAA 1MKWH 1DANH 1F0UA 2W5EA 1P06A 4WF8A 2ZP0H 2QXIA 1CVWH 5EU8A 3MNSA 1KXEA 1J15A 2BDCA 4DY7B 1UTMA 3A86A 1SGIB 2GT8A 4KTUA 3RXUA 4D76A 1MTWA 1Z8IB 3OTJE 3L6PA 4OS7A 3PLBA 4GCHF 2GD4B 4ABAA 1FY4A 1N6XA 4JYTA 2SGFE 1UCYE 1QJ7B 2BY8X 1GDNA 4PROA 1EAIA 3DT0H 3BEFB 3JZ1B 4FU7A 1KXBA 2Z9IA 4CRGA 1WAYB 5F8TA 1OS8A 3RXFA 4ABFA 5DGJA 2AIQA 1N1LA 2IOTA 5DPAA 3GYLB 1CGJE 1E36B 2OBQA 5FPTA 1GI9B 1A61H 4AN7A 2CGAA 1ZGVA 1H9HE 2TRMA 2Z94A 4X2XA 3C27B 2VB0A 1HCGA 1D6RA 3M3VA 1P04A 4MG3A 3P8FA 1C5UA 5T3HA 5K0HA 1ID5H 1C5QA 1SB1H 4YZUA 2H1UA 5K7RA 1F92A 1TMTH 4J1YA 1S6FA 4WMEA 4B71A 2W7SA 5GXPA 2H5CA 1VGCC 1CBWC 3GDUA 4Z6AH 1ANCA 4MNWA 3Q76A 2BX3A 3TGJE 3URCA 1YBWA 3DD2H 2BHGA 1TQ0B 3SZNA 1KXDA 1RXPA 5E0GA 1DICA 1RS0A 2QYIA 2A4OA 1GBAA 1G2LA 4OS5A 2LPRA 2TGTA 1ZHMA 2GDEH 1Y5BT 1N8OC 3R0FA 2BX4A 4ZAEA 3MNBA 5LPRA 3F1SB 1OOKB 2TGPZ 1O0DH 1V2MT 4LXBH 1XXFA 4JZ1A 1MBMA 3TVJB 3BIUH 1FZZA 4NA8A 1HAZB 2WUCA 2ZFSA 3KL6A 2EI6A 2FYRA 5FPYA 5IDKA 1VITG 1SGFA 1E34B 1V2VT 1JXPA 3BSQA 1UTQA 1WU1A 4HZHA 1Y3VA 2BDBA 1GBKA 4QT8C 1O2QA 3ZVGA 2D2DA 1QBOA 2THFB 7KMEH 5DP6A 4JZIA 2GZ9A 1C9TA 1W10U 1EP6A 5JBCS 1SLUB 1D3DB 1P2NA 4LOYH 1TAWA 3ZVDA 2A4QA 1SOZA 2CN0H 3BIVH 2P59A 2VIPA 2Y5GA 3GCHB 1KTTB 1CGHA 4FUEA 3EA7A 2ZO3H 1TNJA 1GBLA 1ZSJA 1ZR0A 1PJPA 1AVGH 3Q3KA 1T8OA 3RU4D 2VVVA 4ZXYH 3S7KB 4UFEH 2FMJA 1ZRBA 1VCPA 3MU4A 1GDQA 3NUMA 2ZU5A 2OC0A 4U2WA 1BTUA 4CREA 1SQOA 4ZHAA 4UFGH 4Y79A 1GI1A 1HJ8A 1C1VH 1ZJDA 1EX3A 2XC0A 1C9PA 2PTCE 2R3YA 1MZDA 1C2FA 2V3OH 4IBLH 5DP3A 5J4SA 1SGFG 1NTPA 1HV7A 2ZWLH 3NK8A 1QQ4A 1QA0A 4AYVB 1C2LA 2PLXA 3O8RA 4ABEA 3MH6A 1UCYK 5E2OA 1E0FD 2SFAA 3PLKA 4ABBA 2C8ZB 4CHAC 2ZKSA 3Q77A 1A0LA 1OSSA 5CHAC 1GI2A 3FZDA 5ESBA 3ZZ6A 2P16A 1OP8A 2A4GA 1A1RA 1GG6C 4ASHA 2ZGCA 5EW2H 2BM2A 3QDZB 2ZC9H 4B1TA 1HDTH 4UFDH 1EPTC 4FUGA 2A7JA 4NWLA 1E35B 3MI4A 1ZTKA 3FAOA 1T31A 5I46H 5JB9S 2Z3EA 5HM9A 1J17T 1SL3A 1YLCA 1YGCH 2ZCHP 1XVOA 3UUZA 1ARBA 5TCAA 3AW0A 2R0KA 4D8NA 1ESTA 1A4WH 4JK5A 2CF9H 4AFUA 3SW2B 1TOCB 1C2DA 3TITA 4DURA 1UHBB 1VJ9U 1GHAG 4I8HA 1HAPH 2H9TH 1GI4A 2A31A 3A8CA 4K5ZA 4JZEH 1SGDE 4YOIA 2HRVA 3UREA 3A7VA 3OY5U 1LVBA 2HPPH 1ELDE 1OWKA 1MD8A 2FLRH 3OY6U 2ZZUH 2ZHQH 4IC5A 5G4BA 2ZTXA 2STBE 2GV7A 1TMBH 2ZIQH 5DO4H 4Y0YE 3QZRA 1T7CA 4MDSA 1O2MA 1W3CA 1ZRKA 1TWXB 2BOKA 2IPHA 4I33A 1W13U 5EG4A 3VGCB 1GCTC 2ODQA 4NWKA 3DUXH 2VGCC 1L0ZA 3F9GA 5FPSA 2P3FH 1DSTA 3KN2A 3V0XA 4X1RU 1QTFA 5DP4A 5FCRA 1HFDA 4YOJA 1PPZA 3SJ9A 2A4RA 3F9HA 5F8ZA 2GZ7A 1WSSH 2VWLA 2VU8E 1UTNA 2ZQ1A 4HGCA 2ULLA 3QLPH 2F83A 2ZI2H 3SBKA 3BF6H 1G30B 1BMNH 1C2MA 2FOHA 1DY8A 2CHAB 2F91A 2BD2A 1SSXA 3P70B 2B8OH 3SGQE 1BIOA 4LK4A 1FUJA 1PYTC 1GJ6A 1SFQB 5GPIB 4UD9H 4RKOB 3M37A 5A0AE 4ISHH 2ZGBH 3RXTA 1HAOH 4CBNA 1RTLA 1XKBC 2GV6A 1W14U 1WUNH 2QF0A 2GGVB 1HJ9A 1JRSA 1H1BA 4DOQA 1W7GH 1PYTD 1GVLA 1O3LA 1W12U 1Z6EA 5EXLA 1TNKA 2QXHA 3MO3A 1XVMA 2SGEE 1Y3YA 4MPXA 3MNXA 3RC6A 2A2QH 2AH4X 2GP9B 1YCPH 1AN1E 1TPSA 1YPJH 2FOFA 3SV7A 1DS2E 1DWDH 5DK1A 2Y5HA 4K2YA 1V2UT 1DXPA 1BRAA 1V2LT 3V7TA 3BTKE 1DITH 1EP5A 3RM2H 4B73A 1MMJN 1N6YA 1ZOMA 5SGAE 2GMTB 3MHWU 3RXIA 1UVPA 1NU7B 2PFEA 1BJUA 4A1TA 1O2VA 1CHGA 2ALVA 2P93A 1CSOE 2B5TB 2UUFB 1FIZA 4GUXA 4K69A 5AVDA 1G32B 3E16B 1EQ9A 1IQEA 1NRSH 1GI0A 2QXJA 2R9PA 3P8OA 1GBCA 2Q6GA 1WBGB 4KTCA 1EKBB 5C5OA 3ZVBA 2H2ZA 3SV9A 2QF3A 1IAUA 3KQBA 1GHZA 1AVWA 3P8NA 1EB2A 1BOQA 4X8TH 1C5LH 3GY5A 1AO5A 1Y5AT 1C5OH 1L1GA 4K8YA 1U6QA 3VXEH 4BTUB 3V12A 4ABDA 1SGTA 1BB0B 3RXDA 2FX6A 1O3DA 1MQ5A 2OP9A 2EC9H 1K21H 2WPKS 3ZZCA 2BMGB 5GIBA 3PTNA 2FO9A 5EPYA 3S69A 3DFJA 4MNVA 1GHYH 1AFQB 2OLGA 3M3SA 3SJOA 2YOLA 1VR1H 3Q3XA 1TFXA 4OGYA 4FUCA 1P2KA 3UNSA 3M3TA 1BMLA 3M5NA 4XBDA 2AGGX 1G3EA 1EOJA 2PR3A 1L2EA 3NWUA 1GI7B 1T4UH 1YPMH 2G8TA 1SC8U 3ZZ3A 1CQQA 3VB3A 2BQWB 3ATKA 3DFLA 4SGBE 4MPUA 1FNIA 1Z8GA 3TH2H 1KLTA 2O8WA 3QZQA 1A5IA 2BDIA 4ISLA 3G01A 4ABHA 2A7HA 3RXVA 3DHKH 5HMAA 6ESTA 1GI8B 1O31A 1RTKA 1RGQA 2ZFTA 4I32A 4B2AA 5E8EH 1CE5A 2AFQB 3TNTA 1A0JA 1B0FA 1C1SA 4XBBA 4X6MA 3LGTA 1MD7A 9ESTA 3KQCA 1MCVA 1BDAA 2WV4A 1GJ8B 3AASA 4ZMAH 1V2TT 1O3MA 1TX8A 2PSXA 1W11U 3SUEA 1UTPA 2F9OA 3PV4A 3RXRA 1NZQH 3U1JB 1O5DH 1YCPM 1A0HB 4D7FA 4NA7A 1Z71A 3KQEA 4A1VA 5A09A 3QX5H 2VIDA 2VVCA 3LH1A 3E0NB 1C1WH 1MKXK 1Z1IA 2FZZA 2QGRA 1HIAA 1D3QB 3HKJB 2XXLA 3I77A 1GGDB 4NG9H 3M5LA 3RXQA 1B7XB 1YC0A 1YM0A 3BTEE 5TCCA 1CGIE 2Y82A 5BRRE 1SVPA 1NRNH 1BUIA 4THNH 3CENA 2BLWA 2VJ1A 1HBTH 1SGYE 4WY3A 5TJXA 1LHEH 2PTNA 1GMDF 4NSVA 4KELA 4ESTE 1DLEA 3ZVEA 4Y10E 4H6SB 7GCHG 3M5OA 4XOJA 5E0HA 2P8OB 2Y7ZA 2ZG0H 4CRCA 5EXMA 1O39A 2ZTZA 3TNSA 1P2IA 3RXMA 2XC5A 2QV1A 2CXVA 1AB9C 1UK4A 3RXEA 4H4FA 1O5EH 1Y3XA 2FOAA 4LZ1H 2VH0A 1TGSZ 3RXHA 3ZZ4A 3O8BA 3LGIA 1THRH 2BY6X 1X7AC 2ESTE 2BQ7B 3IWMA 2UWOA 3ITIA 3KQDA 4NFFA 1WTGH 3HPTB 4K1SA 4DGJA 2JETC 4JCNA 1O3KA 4WMFA 3BTME 1O34A 3A8DA 5E0JA 1TPOA 2NU1E 4MPVA 5AFYH 1F0TA 1G37A 1LHFH 1TRNA 2Z6BD 2ZHDA 3LJOA 3I29A 1O32A 1DY9A 3D49H 1DWCH 4AG2A 1ORFA 3ZYEA 4ZKRU 1AGJA 3KCGH 4GCHG 4YLQH 4RKJB 2OQUA 2Z3CA 1FXYA 2BLQA 4CRBA 2CV3A 1HAIH 1XUHA 3TJUA 2QA9E 2ZDAH 4AZ2B 3W95A 3O8DA 3MWIU 3VB5A 1GI5A 3BEUA 3P17H 3UY9A 1DSUA 2ZU3A 3E8LA 3RM0H 2O8UA 4B2BA 1NT1A 3SN8A 1GHBF 1AY6H 2FI3E 1WTHD 2O8MA 2TGAA 2VWMA 3PTBA 1G36A 3E90B 4AX9H 3KF2A 2ZHFH 3BTFE 4F49A 1PPBH 5J4QA 2WPHS 1LO6A 1E38B 1V2JT 1EJNA 3TJNA 1THSH 1Z8RA 1V6DA 3A8BA 2G5NA 3JZ2B 1C5TA 3BN9A 5L2YH 3GCTF 2BVRH 3UWJH 4AYYB 1BA8B 3RC5A 2UUYA 1TNGA 8LPRA 2V3HH 1C4V2 3SU3A 1BHXF 3SUDA 1QHRB 2Y81A 4Y76A 3GDVA 4I8KA 3GY3A 2K1QA 4WJG2 1LPKB 1P57B 3PO1C 1P02A 1P12E 1AWHB 5EQQA 3A80A 1C5MD 2AYWA 5LPEA 3S9BA 2WV5A 2GT7A 1SGRE 2J92A 4JMYA 1JOUB 4ZKOU 1TGBA 1YPKH 1WCZA 1C2JA 1MBQA 4ZUHA 2ZU4A 1IQJA 2ZDMA 4X2WA 1GMHF 1C5ZB 1ZLRA 2C8YB 1QB9A 1VITH 2DE8A 1GBFA 2WYJA 4NIYA 1BMAA 1EAXA 1V2WT 1D6WA 2BOHB 2O8TA 3MFJA 3F6UH 4FUHA 3K6YA 2BZ6H 3GY7A 3PYHA 3BG4C 1CHOG 1NROH 1OKXA 3MYWA 1SI5H 3RLWH 1NFUA 1CA0C 1O3AA 4MVNA 1FDPA 1P05A 1UTLM 2QY0B 1ZTLA 5FX6A 2QXGA 3RC4A 1BTXA 3MO6A 1QL9A 4MPWA 4OS2A 1FLEE 3ZZAA 2NU3E 1WQSA 4KGAA 1D3TB 2ZPQA 4X1SU 1FY8E 1AKSB 2H5DA 1S82A 2FXRA 1C1OA 1HUTH 2H9EH 1S6HA 3A89A 4X6OA 4MNYA 1BBRH 2IJOB 3UQOA 2XTTB 1TBZH 5DP7A 3RMOH 7ESTE 1ZTJA 1XM1A 1H8IH 2PGBB 2VNTA 2XC4A 1UTJA 4XFQA 2GTBA 2W3KA 2Z9LA 1P9SA 3TIUA 1P8VC 2Z9JA 1IQNA 3UOUA 2C8XB 4BTTB 4DCDA 1PQ5A 3RXBA 1GBTA 1C5SA 2ZCKP 5GCHG 3A81A 3U8RH 1G3CA 4I8LA 2GCHG 1UVUH 2PSYA 1LKBA 1OXGA 1UK3A 1O2NA 3S7HB 1O36A 2PKSB 4NA9H 2FTLE 2OUAA 1H9IE 1TMUH 1GL1A 3RXSA 5C20A 4KKDA 3S9CA 3SJKA 3RMNH 3M7UA 3A87A 4NGAH 1SFIA 5ETXA 1SQTA 4RN6A 2VINA 1IHSH 3GY4A 3HGNA 4CRAA 8ESTE 2FOEA 4U32A 6CHAC 1GHWH 5B6OA 3TU7H 1J16A 2WPLS 2XBWA 2Y7XA 5L30H 1Y59T 3H5CB 1JBUH 1O2LA 2FESH 2G4UA 3P95A 3VFEA 1PPGE 1WV7H 1IQLA 4X1PU 1Z8JB 1OWHA 1JIMA 1EXFA 4KTSA 1EZQA 1HJAC 2F9BH 3LC5A 3U98H 1TX7A 3BEIB 4Y11E 2ZFFH 1VCWA 1LHCH 1ZYOA 2BVSH 1GCDA 3MOCA 4WXIA 5FAHA 1PPCE 4CRFA 3PROA 1J9CH 3A7TA 3PB1E 4FUJA 1DPOA 2HWLB 1IQFA 3MH5A 1DOJA 4I8GA 5EQRA 3RXAA 2UUJB 1T8LA 3LC3A 1GBIA 1O2SA 1Q2WA 1VZQH 1XKAC 3UR6A 1LHDH 4ZKSU 4MNXA 3A7XA 1O3NA 3RUOA 2BY7X 2J9NA 1BJVA 5EGMA 3H7OA 4CH8B 4FUFA 3LONA 3RLYH 3B8JA 4AFSA 1ELEE 1MUEB 1IQMA 4B76A 5FBEA 1FPCH 5HM2A 3ZV8A 4B74A 3L33A 3SNDA 3T5FH 1C1NA 2ZDLA 1MAYA 4GHQA 1XXDA 4CR9A 2CMYA 1GBBA 1C4U2 4E06H 3UPEA 2BTCE 4VGCB 1OWEA 5HYOA 3SI3H 6GCHG 2A5AA 4TYDA 3MO9A 1O3GA 2Q6FA 1CT4E 1P10A 1MTNC 1T8NA 4NIVA 4BAKB 4Q7YA 5LGOA 1P0SH 2BZAA 1LVMA 3UR9A 1KIGH 1K1NA 2J34A 3STJA 3T26A 1O3PB 1O3FA 2GVFA 3RMLH 1YPEH 3URDA 1KSNA 1P9UA 4F4OC 2A5IA 1ESAA 2QCYA 4WXVA 1HNEE 1ZMNA 1DFPA 1O3IA 4OS6A 4MLFB 4FUDA 5FX5A 1FMGA 5F8XA 1FY5A 1O2TA 1GI3A 3FP6E 4AFQA 1EATA 1NO9H 1AKSA 2AGIX 4X2VA 2XWBI 3KHVA 1K1PA 1UO6A 1OWJA 1WQVH 1ANDA 3FP8E 3M35A 1DUEA 1ETRH 3QO6A 1LPZB 2QIQA 2FYQA 3BTHE 3TK6A 2FTMA 1K22H 1UVTH 1TOMH 3A7ZA 2HGTH 1LHGH 1ZHRA 1RIWB 4I7YH 1OWDA 1RRKA 4AORA 3PMBB 1V2KT 2J95A 2C93B 4Y7BA 5LH8A 1S0QA 2GCTB 1YP9A 3GYMA 2OTVA 5I25A 1YPGH 3K65B 1TGTA 1ZPZA 3M61U 5DJ7A 2P3UB 1V2RT 5JB8S 3U8TH 4K8BA 1ELGA 1GJDB 1AU8A 1AFEH 4AB8A 2DE9A 3IG6B 1QR3E 1SOTA 4TWYA 4K1TA 2G52A 1HIAB 3R3GB 1IOEA 3GCOA 1DDJA 2TPIZ 3UNRA 1LDTT 1SGPE 1UTKA 1TALA 2SNVA 3TH4H 1L4DA 2XCNA 1QY6A 2V6NA 4GAWA 2EI8A 1B0EA 4X2YA 1MTVA 1NS3A 2C4FH 1UK2A 4X6PA 1P2QA 1C2EA 4AOQA 4BAMB 2BDGA 1SQAA 3C1KA 3ZZDA 3E1XB 1A5HA 1BRUP 3UIRA 3M7QA 2R2MB 2XNIA 4TY7A 4YESB 4D9RA 1HYLA 2WPJS 1ZPCA 1QB6A 1HAVB 3VEQB 3FVFB 2D26C 4J2YB 3PMAB 3ZZ9A 1ELVA 1S84A 3T27A 3FANA 2EEKA 3Q00A 3TGIE 3RXJA 3BTWE 2ZGHA 1GVZA 1GHVH 3O8CA 3E3TA 3A84A 4NSYA 4I8JA 4E7RG 2RG3A 5FCKA 1ESBA 1UCYH 2J38A 1MTUA 1EOLA 2YNBA 3VB7A 2OCVB 3A83A 3QGJA 1KLJH 4A5TS 1C5PA 4ISNA 3ZVAA 2PWXA 3GY6A 1FAKH 1MKWK 1PFXC 1Q31A 2PV9B 5A8ZA 1VGCB 1CBWB 3A88A 3EDXB 4GHTA 1OWIA 1IQHA 4AGJA 1PPHE 1TGNA 1P09A 3QGNB 3T62A 3SV8A 1GBJA 2R3UA 5DKMA 1S85A 2FS9A 2P3TB 2F9NA 4K1EA 1KYNA 1O5FH 1H4WA 1QRZA 3F9FA 4ISIH 1SLXB 1K9OE 4FVDA 2QN5T 3GCHC 1MQ6A 4YT7H 1O2PA 1N8OB 4NIXA 1FY1A 1UVSH 3BTGE 3SGAE 1KTSB 1P03A 3SUGA 3NPSA 3RXKA 2Z3DA 4IN2A 4ZROA 1SGCA 1C5VA 3NKKA 4U01A 4Y7AA 1HXEH 4Q80A 4DG4A 1O2HA 1O2WA 1Q3XA 1G3BA 1O5GH 1PQ8A 4O9VA 1QNJA 3E91A 4FU8A 4YT6H 4A92A 1IQGA 2XYAA 5GWZA 2WPMS 1TPPA 1NFYA 8GCHG 3TLOA 1H8DH 3EAJA 1FY3A 3PWBA 4O03A 3EGKH 3RXPA 2XBYA 4FUIA 1ELAA 1T32A 3I78A 4AFZA 1NPMA 3ZZ7A 1XX9A 9LPRA 1GMCF 1MH0A 1SBWA 5EPNA 1J8AA 2QC2A 1AUTC 1SG8B 1TIOA 2PUQH 2CJIA 1Y5UT 1TA2A 4ZH8A 1G3DA 2UWLA 3RU4T 5ABWA 3LGVA 1LMWB 1TBRH 4NIWA 1O33A 1RD3B 2FP7B 2HALA 3RXLA 3SQHE 4O3TA 2A45B 3TJVA 2IN2A 2YNAA 4YO9A 2SGQE 1K2I1 1ETSH 3B23B 1SPJA 4NCYA 3LU9B 4R0IA 4DIHH 1MU6B 1K1JA 3SOSA 2V35A 5C1UA 2J4IA 4BXWA 3SHAH 1QBVH 3A82A 1CT2E 1P01A 3ZYDA 2VH6A 1C2HA 3EE0B 2F9VA 2PHBA 1H9LB 2BXTH 1DWEH 3HK3B 2ANYA 1GBDA 3EA9A 1XUIA 3VPKA 3ATWA 2O8LA 1O2YA 2VIOA 1K1IA 1NRQH 4GSOA 1TRMA 2ZPSA 2Q1JA 1W2KH 4JYUH 4Q7XA 2PW8H 1A2CH 3ZVCA 1KXFA 4CHAB 2LNCA 1BTYA 1C1RA 2ZDVH 5CHAB 1KLIH 1O30A 4YOGA 3QK1A 2HLCA 3MU0A 2SNWA 1C5NH 2OC1A 5AF9H 1GG6B 3VGCC 1HAVA 1NFXA 4WMDA 3H7TA 2Y5FA 1EPTB 3M5MA 4HI3A 2I6SA 1XMNB 2FOCA 5GJ4B 3T25A 4JK6A 1NU9A 1GVKB 2RCEA 8KME2 5LPFA 1D3PB 4YM9A 2RDLA 1YKTA 4ZHLU 5JBTA 1SMFE 1QFKH 1EASA 5C2ZA 2GX4A 2WINI 3RDZA 5CE1A 2FPZA 1Z6JH 2WYGA 3L3TA 2CHAC 1ACBE 4Q7ZA 1QBNA 2AERH 7GCHF 1TYNA 3U9AH 1FQ3A 1TONA 1KXCA 3ESTA 1ZSLA 3N7OA 3OSYA 3SNAA 4DJZB 2A7CA 4XE4A 3QTVH 3PMHB 3E0PB 4XSKU 1BQYA 1S5SA 1ZZZA 3GCTG 2ZTYA 3Q3YA 3DA9B 1RJXB 3LDXH 1OYTH 2SGPE 1O2RA 3RXCA 1O2GH 1EZXC 1GCTB 1A5GH 1HAXB 1SGEE 2VGCB 1EAWA 1O5CB 2ZFPH 2DUCA 2PUXB 4D7GA 1ELTA 1NC6A 3TJOA 1NRPH 1AQ7A 4X0WU 1DVAH 3UOPA 2FIRH 1UJ1A 1GMHG 1GHXH 1C2IA 2G5VA 4GPGA 2GMTC 1O2KA 5PTPA 2ZQ2A 4FUBA 2I6QA 2VWNA 1W8BH 1TLDA 3SORA 2ZU1A 2D8WA 2OQ5A 3S0NA 1QIXB 3MU1A 4B2CA 3PMJA 3T29A 2W3IA 4A7IB 3D23A 1V2QT 1BTWA 1PQAA 1ZMJA 3NZIA 4IMZA 4BAQB 4ISOA 3SI4H 1C5WB 4E05H 3KGPA 1IHTH 4TY6A 4X8SH 1ETTH 1AZZA 1JRTA 4CRDA 5FXLA 3W94A 1OX1A 2NWNA 3UWIA 1SLVB 1ABIH 3GDSA 4M7GA 3E6PH 1O2IA 1TE0A 5FHTA 2R0LA 2WUBA 3U69H 4UFFH 1D9IA 1TNHA 1C1UH 1L4ZA 5HXFA 2B0FA 3ELAH 1XUFA 5H4IB 5C5NA 1LPGB 2BD3A 3LOXA 3LIWA 2BLOA 2A0QB 2FWWA 4ABIA 1MU8B 3EQ0H 2KAIB 3ODFA 1A46H 3F68H 1GJ5H 2ZA5A 4UONA 2TIOA 1S83A 1TPAE 1L1NA 1HRTH 1MTSA 2P94A 3SGBE 1TQ7B 1AFQC 1GPZA 3T28A 3SU5A 1MKXH 2ALPA 1DT2A 1A7SA 3UQVA 1QURH 5DP8A 1ANBA 3BTTE 3PM3A 5AHGH 1Y8TA 4BAOB 1K1OA 1CHOF 3QTOH 1C2GA 4MQAA 1O2JA 2Q6DA 3OX7U 3FFGA 3SU1A 3ZV9A 4IC6A 2W7UA 2ZCLP 2ZFQH 1PQ7A 2B9LA 2R2WU 1SR5C 4OS4A 2BXUH 2BDAA 2B7DH 3BG8A 4XDEA 1LTOA 3UNQA 2HOBA 1O3JA 1EPTA 1GJBB 1W0ZU 1W0YH 5T6GA 3KIDU 4AG1A 3OU0A 3B9FH 2SGDE 4BNRA 1EZUC 1F5KU 1P2OA 2A1DB 2VIQA 3BTQE 3K6ZA 1SHYA 1HLTH 1VITF 2ZNKH 5EOKA 3D65E 3AAVA 1O5BB 4H42U 1AD8H 3V13A 3ENSB 1BT7A 4FU9A 1JWTA 1BTZA 1YLDA 1ELFA 1YCPK 4UE7H 2G55A 4UDWH 4MTBA 1FN8A 1GJ7B 3VB6A 4Y0ZE 4WH6A 5GCHF 1HPGA 1V2NT 2Z9GA 1XUKA 2ODPA 4NZLA 2GCHF 2XW9A 3QWCH 3IITA 2ZEBA 4Y71A 1YYY1 3OYPA 1O3EA 2FEQH 2HNTC 1VCQA 4INKA 1F5RA 2C8WB 3M36A 2JH5D 2BD8A 4CBOA 1O37A 4XBCA 2QAAA 2AIPA 4K60A 3TPIZ 1BMMH 4OGXA 4JZDH 1GGDC 1SGNE 4BANB 1BTHH 3RXOA 3QUMP 2OC8A 3M7TA 1WOFA 2HNTF 1A3EH 2A2XH 2F9PA 1P3CA 3MNCA 2AMQA 4YTAA 3U1IB 2XBVA 4LZ4B 4AGKA 2FLBH 4FVBA 3BTDE 1C1PA 4ABGA 1T8MA 1ELCA 2TGDA 1O2ZA 2UUKB 2Z9KA 1YPHC 1FV9A 3LJJA 2XRCA 1O35A 2P8OC 1ANEA 3GOVB 1S81A 1SGQE 3KNXA 1AZ8A 4Y8XA 3SJ8A 2J2UA 5C1XA 3CP7A 1GBMA 3ATLA 1C5YB 1F7ZA 2HVXA 1OP2A 2VIVA 5CMXH 1BITA 1NRRH 1O3HA 3TK5A 1AMHA 1DX5M 1DE7H 3MH7A 2A5KA 5C67A 4B75A 3D62A 5DG6A 1QRXA 1FONA 1MCTA 1K28D 2AS9A 3TGKE 2J94A 1JMOH 2BVXH 1QCPA 1TNLA 1PPEE 4TPYA 2M5TA 2STAE 3HKIB 3LT3A 3SNEA 2JH6D 4H6TA 1B5GH 1P3EA 1HAYB 5JPMH 4Y6DA 2FX4A 1ZJKA 1GDUA 1GJAB 2ZHEH 3HGPA 3ZZBA 3PWCA 1E37B 2XCFA 1QA7A 5T6FA 1C5RA 2A32A 4INLA 3V3MA 1OYQA 1KDQB 4A1XA 3MMGA 5JYIA 3SJIA 2KAIA 1GHAF 4JYVH 2FI4E 6GCHF 3MH4A 3SO3A 1GJCB 5IYTA 3MTYA 5L2ZH 4ABJA 1T4VH 3SNBA 3P6ZB 3ZZ5A 1BZXE 1DXWA 3ATIA 5GDSH 5EW1H 3CS0A 2FOBA 1FAXA 1AB9B 1MZAA 1EUFA 1BCUH 1S0RA 2OBOA 4UEHH 1SLWB 1FN6A 1GJ4H 1K1MA 4IW4E 5BPEA 3A85A 1NFWA 1G2MA 1FIWA 2OINA 2OD3B 1QJ1B 2D1JA 4KP0A 2NU0E 3LPRA 1CU1A 4HTCH 5F03A 3VXFH 2ZDNA 3MU8A 1O38A 2JETB 2Z7FE 2AMDA 2ILNA 1KXAA 6LPRA 3EYDA 4ZKNU 4IN1A 1QL8A 1F5LA 3CS7A 1TABE 1MAXA 1C1MA 1O2UA 1PPFE 1XUGA 2NU4E 1NM6A 5EQSA 5T6DA 4ZHMU 2GDDA 3RP2A 3LGYA 2OC7A 1LQEA 1G9IE 5A8XA 5F6MA 2Y6TA 1ZPBA 2XWAA 4X8VH 1AIXH 3S9AA 2BD9A 3TH3H 3RU4E 3AVZA 5E2PA 2OXSA 4A6LA 2ANWA 5HGGA 1EJMA 1BBRE 1BHXB 2PKAB 3WY8A 1CO7E 4X1NU 1ZHPA 2ZGJA 4GLYA 3A7YA 4U30A 2HNTE 1DM4B 1V3XA 1UMAH 2ZU2A 1TA6A 4OS1A 4ZXXH 1A3BH 1TBQH 1J14A 5FBIA 1AE8H 1UVOA 2JKHA 5DP5A 5A0BA 2ODYB 1YPLH 4DW2U 2AEIH 2UWPA 1O5AB 3UFAA 1SHHB 1L1JA 1XUJA 1V2ST 1P2MA 1RTFB 4K3JA 2HPQH 3PO1B 5A0CA 1O3CA 3MU5A 4WVPE 4E7NA 1QB1A 2CF8H 1AHTH 4R8TB 5C1YA 2NU2E 1THPB 3FZZA 1KY9A 3SV6A 3PLPA 4SGAE 1YPHE 1K1LA 1QRWA 1Z1JA 2C3SA 2C90B 3A8AA 1QL7A 1QGFA 5JDUB 3ZVFA 3GCNA 1LCYA 1DWBH 1O3OA 1P11E 2PKSC 3RXGA 4BTIB 4HFPB 4DT7B 1FPHH 1GBHA 4O97A 3BG4B 2WPIS 4Z0KA 2H6MA 3HATH 3GISB 1CA0B 3BV9B 1FI8A 1ARCA 4YLUA 4X1QU 2RA3A 2AMPA 1EJAA 2BB4A 2EI7A 1HXFH 4IMQA 5JBAS 2ANMH 2ZECA 3UTUH 3LH3A 1EB1H 2VVUA 2SGAA 1UHBA 4TWWA 1TRYA 4CR5A 3P8GA 3GICB 1ABJH 1ZSKA 3FP7E 3AAUA 1EAUA 2FI5E 1JIRA 2BDYA 1GWAA 1GI6A 1FJSA 2ZFRH 3GY2A 1GMCG 1HAHH 1QQUA 5ESTE 2BY9X 5JBBS 1HAGE 2G51A 5DP9A 3P92A 5A8YA 1Z7KA 2ANKH 1KDQA 2PGQB 3SNCA 3SU0A 2ZGXH 1D4PB 1ZMLA 4DIIH 4BXSA 1V2OT 1O3BA 2RA0A 1INCA 2ZF0H 1TGCA 1RFNA 1QJ6B 1M9UA 2EA3A 2ZHWH 3SU2A 1AVXA 3TK9A 3AW1A 4I31A 1CA8B 2FOMB 1DLKB 1AUJA 3U8OH 1HB0B 2BLVA 4IGDA 2O9QA 1AE5A 3LGUA 1ELBA 2BD4A 2F3CE 3F9EA 4O3UA 5C3NA 1GJ9B 6CHAB 3LKWA 1O2OA 1BTPA 2VWOA 2H9HA 3HK6B 2TBSA 3T2NA 1TNIA 4BOHA 8GCHF 2BQ6B 4Y8YA 2FM2A 1HGTH
chains in the Genus database with same CATH superfamily
3KEEA 2P95A 5HIYA 3SHCH 2AGEX 1GMDG 1WYKA 3SU4A 4VGCC 1HJAB 3RMMH 2V0BA 4DT4A 4Q2KA 2F4LA 2ZDKA 1NESE 2ASUB 3QN7A 4NZQA 4WWYA 3SV2H 3GY8A 2BDHA 1LVOA 2G4TA 2JH0D 1AWFH 1YF4A 4GVUA 4FXGH 1CT0E 1P2JA 1TB6H 1W7XH 3ODDA 1Y3UA 4INHA 3WWBA 3K2UA 4NFEA 4X6NA 1BBRK 5EJ1A 1C1TA 2PKAA 3EA8A 5EODA 3SUFA 1IQIA 1F0SA 2GZ8A 1F0RA 3LGWA 1YY3A 1LVYA 2BY5X 4D9QA 3STIA 4BAHB 1EZSC 1C4Y2 3A7WA 3VB4A 3ZZ8A 4IS5A 2G00A 1C2KA 2FOGA 2ZPRA 2BYAX 2F9UA 4ZCNA 1OPHB 3SYJA 1AI8H 3SU6A 4CH2B 2W26A 3F2GA 4TPIZ 1IQKA 1BRBE 4RSPA 3K9XB 1OP0A 2VIWA 4JZFH 1BRCE 1C5XB 5L6NH 3NCLA 4DVAU 2FODA 2G81E 1V2PT 5EXNA 3SQEE 1Y3WA 1NN6A 2BD5A 1F2SE 1GHBG 1LQDB 1RIWC 1O2XA 2XBXA 2FDAA 3ATMA 1VJAU 5A2MH 1LKAA 1GBEA 7LPRA 1MTNB 2FS8A 5AFZH 1NY22 1UTOA 1C1QA 1ZGIA 4AC9A 4X8UH 3NXPA 4WH8A 2GCTC 1TX6A 2BD7A 2GKVE 1GL0E 4AB9A 2Y80A 4Y8ZA 1DUAA 1MKWH 1DANH 1F0UA 2W5EA 1P06A 4WF8A 2ZP0H 2QXIA 1CVWH 5EU8A 4I86A 3MNSA 1KXEA 1J15A 2BDCA 4DY7B 1UTMA 3A86A 1SGIB 2GT8A 4KTUA 3RXUA 4D76A 1MTWA 1Z8IB 3OTJE 3L6PA 4OS7A 3PLBA 4GCHF 2GD4B 4ABAA 1FY4A 1N6XA 4JYTA 2SGFE 1UCYE 1QJ7B 2BY8X 1GDNA 2J5UA 4PROA 1EAIA 3DT0H 3BEFB 3JZ1B 4FU7A 1KXBA 2Z9IA 4CRGA 1WAYB 5F8TA 1OS8A 3RXFA 4ABFA 5DGJA 2AIQA 1N1LA 2IOTA 5DPAA 3GYLB 1CGJE 1E36B 2OBQA 5FPTA 1GI9B 1BMFD 1A61H 4AN7A 2CGAA 1ZGVA 1H9HE 2TRMA 2Z94A 4X2XA 3C27B 2VB0A 1HCGA 1D6RA 3M3VA 1P04A 4MG3A 3P8FA 1C5UA 5T3HA 5K0HA 1ID5H 1C5QA 1SB1H 4YZUA 2H1UA 3FO8D 5K7RA 1F92A 1TMTH 4J1YA 1S6FA 5B6LA 4WMEA 4B71A 2W7SA 5GXPA 2H5CA 3F3BA 1VGCC 1CBWC 3GDUA 4Z6AH 1ANCA 4MNWA 3Q76A 2BX3A 3TGJE 4M9FA 3URCA 1YBWA 3DD2H 2BHGA 1TQ0B 2K8IA 3SZNA 1KXDA 1RXPA 5E0GA 1DICA 1RS0A 2QYIA 4XRNA 2A4OA 1GBAA 1G2LA 4OS5A 2LPRA 2TGTA 1ZHMA 2GDEH 1Y5BT 1N8OC 3R0FA 2BX4A 4ZAEA 3MNBA 5LPRA 3F1SB 1OOKB 2TGPZ 1O0DH 1V2MT 4LXBH 1XXFA 4JZ1A 1MBMA 3TVJB 3BIUH 1FZZA 4NA8A 1HAZB 2WUCA 2ZFSA 3KL6A 2EI6A 2FYRA 5FPYA 5IDKA 1VITG 1SGFA 1E34B 1V2VT 1JXPA 3BSQA 1UTQA 1WU1A 4HZHA 1Y3VA 2BDBA 1GBKA 4QT8C 1O2QA 3ZVGA 2D2DA 1QBOA 2THFB 1W0KD 7KMEH 5DP6A 4JZIA 2GZ9A 1C9TA 1W10U 1EP6A 5JBCS 1SLUB 1D3DB 1P2NA 4LOYH 1TAWA 3ZVDA 2A4QA 1SOZA 2V7QD 2CN0H 3BIVH 2P59A 2VIPA 2Y5GA 3GCHB 1KTTB 1CGHA 4FUEA 3EA7A 2ZO3H 1TNJA 2KCOA 1GBLA 1ZSJA 1ZR0A 1PJPA 1AVGH 3Q3KA 1T8OA 3RU4D 2VVVA 4ZXYH 3S7KB 4UFEH 2FMJA 1ZRBA 1VCPA 3MU4A 1GDQA 4P00A 3NUMA 2ZU5A 2OC0A 4U2WA 1BTUA 4CREA 1SQOA 4ZHAA 4UFGH 4Y79A 1GI1A 1HJ8A 1C1VH 1ZJDA 1EX3A 2XC0A 1C9PA 2CK3D 2PTCE 1MZDA 1C2FA 2R3YA 2V3OH 4IBLH 5DP3A 5J4SA 1SGFG 1NTPA 1HV7A 2KCAA 2ZWLH 1QQ4A 3NK8A 1QA0A 4AYVB 1C2LA 2PLXA 3O8RA 4ABEA 3MH6A 1UCYK 5E2OA 1E0FD 2SFAA 3PLKA 4ABBA 2C8ZB 4CHAC 2ZKSA 3Q77A 1A0LA 1OSSA 5CHAC 4Z1MD 1GI2A 3FZDA 5ESBA 3ZZ6A 2P16A 1OP8A 2A4GA 1A1RA 1GG6C 4ASHA 2ZGCA 5EW2H 2BM2A 3QDZB 2ZC9H 4B1TA 1HDTH 4UFDH 1EPTC 4FUGA 2A7JA 4NWLA 1E35B 3MI4A 1ZTKA 3FAOA 1T31A 5I46H 5JB9S 2Z3EA 5HM9A 1J17T 1SL3A 1YLCA 1YGCH 2ZCHP 1XVOA 3UUZA 1ARBA 5TCAA 1NBMD 4TSFD 3AW0A 2R0KA 4D8NA 1ESTA 1A4WH 4JK5A 2CF9H 4AFUA 3SW2B 1TOCB 1C2DA 3TITA 4DURA 1UHBB 1VJ9U 1GHAG 4I8HA 1HAPH 2H9TH 1GI4A 2A31A 3A8CA 4K5ZA 4JZEH 1SGDE 4YOIA 2HRVA 3UREA 3A7VA 3OY5U 1LVBA 2HPPH 1ELDE 1OWKA 1MD8A 2FLRH 3OY6U 2ZZUH 2ZHQH 4IC5A 5G4BA 2ZTXA 2STBE 2GV7A 1TMBH 2ZIQH 5DO4H 4Y0YE 3VG8A 3QZRA 1T7CA 4MDSA 1O2MA 1W3CA 1ZRKA 1TWXB 2BOKA 2IPHA 4I33A 1W13U 5EG4A 3VGCB 1GCTC 2ODQA 4NWKA 3DUXH 2VGCC 1L0ZA 3F9GA 5FPSA 2P3FH 1DSTA 3KN2A 3V0XA 4X1RU 1QTFA 5DP4A 5FCRA 1HFDA 4YOJA 1PPZA 3SJ9A 2A4RA 3F9HA 5F8ZA 2GZ7A 1WSSH 2VWLA 2VU8E 1UTNA 2ZQ1A 4HGCA 2ULLA 3QLPH 2F83A 2ZI2H 3SBKA 3BF6H 1G30B 1BMNH 1C2MA 2FOHA 1DY8A 2CHAB 2F91A 2BD2A 1SSXA 3P70B 2B8OH 3SGQE 1BIOA 4LK4A 1FUJA 1PYTC 1GJ6A 1SFQB 5GPIB 4UD9H 4RKOB 3M37A 5A0AE 4ISHH 2ZGBH 3RXTA 1HAOH 4CBNA 1RTLA 1XKBC 2GV6A 1W14U 1WUNH 2QF0A 2GGVB 1HJ9A 1JRSA 1H1BA 4DOQA 1W7GH 1PYTD 1GVLA 1O3LA 1W12U 1Z6EA 5EXLA 1TNKA 2QXHA 3MO3A 1XVMA 1QZ8A 2SGEE 1Y3YA 4MPXA 3MNXA 3RC6A 2A2QH 2AH4X 2GP9B 1YCPH 1AN1E 1TPSA 1YPJH 2FOFA 3SV7A 1DS2E 1DWDH 5DK1A 1E1RD 2Y5HA 5EJZA 4K2YA 1V2UT 1DXPA 1BRAA 1V2LT 3V7TA 3BTKE 1DITH 1EP5A 3RM2H 4B73A 1MMJN 1N6YA 1ZOMA 2J97A 5SGAE 2GMTB 3MHWU 3RXIA 1UVPA 1NU7B 2PFEA 1BJUA 4A1TA 1O2VA 1CHGA 2ALVA 2P93A 1EFRD 1CSOE 2B5TB 2UUFB 1FIZA 4GUXA 4K69A 5AVDA 1G32B 4ASUD 3E16B 1EQ9A 1IQEA 1NRSH 4RI0A 1GI0A 2QXJA 2R9PA 3P8OA 1GBCA 1NBME 2Q6GA 1WBGB 4KTCA 1EKBB 5C5OA 3ZVBA 2H2ZA 3SV9A 2QF3A 1IAUA 3KQBA 1GHZA 1AVWA 3P8NA 1EB2A 1BOQA 4X8TH 1C5LH 3GY5A 1AO5A 1Y5AT 1C5OH 1L1GA 4K8YA 1U6QA 3VXEH 4BTUB 3V12A 4ABDA 1SGTA 1BB0B 3RXDA 2FX6A 1O3DA 1MQ5A 2OP9A 2EC9H 1K21H 2WPKS 3ZZCA 2BMGB 5CDFE 5GIBA 3PTNA 2FO9A 5EPYA 3S69A 3DFJA 4MNVA 1GHYH 1AFQB 2OLGA 3M3SA 3SJOA 2YOLA 1VR1H 3Q3XA 1TFXA 4OGYA 4FUCA 1P2KA 3UNSA 3M3TA 1BMLA 3M5NA 4XBDA 2AGGX 1G3EA 1EOJA 2PR3A 1L2EA 1SQRA 3NWUA 1GI7B 4RT0A 1T4UH 1YPMH 2G8TA 1SC8U 3ZZ3A 1CQQA 3VB3A 2BQWB 3ATKA 3DFLA 4SGBE 4MPUA 1FNIA 1Z8GA 3TH2H 1KLTA 2O8WA 3QZQA 3WW7A 1A5IA 2BDIA 4ISLA 3G01A 4ABHA 2A7HA 4FETA 5CHBA 3RXVA 3DHKH 3FN8A 5HMAA 2KFWA 6ESTA 1GI8B 1O31A 1RTKA 1RGQA 2ZFTA 4I32A 4B2AA 5E8EH 1CE5A 2AFQB 3TNTA 1A0JA 1B0FA 1C1SA 4XBBA 4X6MA 3LGTA 1MD7A 9ESTA 3KQCA 1MCVA 1BDAA 2WV4A 1GJ8B 3AASA 4ZMAH 1V2TT 1O3MA 1TX8A 2PSXA 3DSGA 1W11U 3SUEA 1UTPA 2F9OA 3PV4A 2KX4A 1NZQH 3RXRA 3U1JB 5EJLA 1O5DH 1YCPM 1A0HB 4D7FA 4NA7A 1Z71A 3KQEA 4A1VA 5A09A 3QX5H 2VIDA 2VVCA 3LH1A 1H8HD 1C1WH 3E0NB 1MKXK 1Z1IA 2FZZA 2QGRA 1HIAA 1D3QB 3HKJB 2XXLA 3I77A 3GS9A 1GGDB 4NG9H 3M5LA 3RXQA 1B7XB 1YC0A 1YM0A 5DN6D 3BTEE 1E1QD 5TCCA 1CGIE 2Y82A 5BRRE 1SVPA 1NRNH 1BUIA 4THNH 3CENA 2BLWA 2VJ1A 1HBTH 1SGYE 4WY3A 5TJXA 1LHEH 2PTNA 1GMDF 4NSVA 4KELA 4ESTE 1DLEA 2V3MA 3ZVEA 4Y10E 4H6SB 7GCHG 3M5OA 4XOJA 2WZQA 5E0HA 2P8OB 2Y7ZA 2ZG0H 4CRCA 5EXMA 1O39A 2ZTZA 3TNSA 1P2IA 3RXMA 2XC5A 2QV1A 2CXVA 1AB9C 1UK4A 3OEHD 4H4FA 1O5EH 3RXEA 5KECA 1Y3XA 2FOAA 4LZ1H 2VH0A 1TGSZ 3RXHA 2LP6A 3ZZ4A 3O8BA 3LGIA 1THRH 2BY6X 1X7AC 2ESTE 2BQ7B 3IWMA 2UWOA 3ITIA 3KQDA 4NFFA 1WTGH 3HPTB 5F53A 4K1SA 4DGJA 2JETC 4JCNA 1O3KA 4WMFA 3BTME 1MABB 1O34A 3A8DA 5E0JA 1TPOA 1YWUA 2NU1E 4MPVA 5AFYH 1F0TA 1G37A 1LHFH 1TRNA 2Z6BD 2ZHDA 3LJOA 3I29A 1O32A 1DY9A 3D49H 1DWCH 4AG2A 1ORFA 3ZYEA 4ZKRU 1AGJA 3KCGH 4GCHG 4YLQH 4RKJB 2OQUA 2Z3CA 3SZEA 1FXYA 2BLQA 4CRBA 2CV3A 1HAIH 1XUHA 3TJUA 2QA9E 2ZDAH 4AZ2B 3W95A 3O8DA 3MWIU 3VB5A 1GI5A 3BEUA 3P17H 3UY9A 1DSUA 2HLDD 2ZU3A 3E8LA 3RM0H 2O8UA 4B2BA 1NT1A 3SN8A 1GHBF 1AY6H 2FI3E 1WTHD 2O8MA 2TGAA 2VWMA 3PTBA 1G36A 3E90B 4AX9H 3KF2A 2ZHFH 3BTFE 4F49A 1PPBH 2J98B 5J4QA 2WPHS 3PRBA 1LO6A 1E38B 2EY4C 1V2JT 1EJNA 3TJNA 1THSH 1Z8RA 3AK5A 1V6DA 2XOKD 3A8BA 2G5NA 3JZ2B 1C5TA 2WHXA 3BN9A 3GCTF 5L2YH 2BVRH 3UWJH 4AYYB 1BA8B 3RC5A 2UUYA 1TNGA 8LPRA 2V3HH 1C4V2 3SU3A 1BHXF 3SUDA 1QHRB 2Y81A 4Y76A 3GDVA 4I8KA 3GY3A 2K1QA 4WJG2 1LPKB 1P57B 3PO1C 1P02A 1WXRA 1P12E 1AWHB 5EQQA 3A80A 1C5MD 2AYWA 5LPEA 3S9BA 2WV5A 2GT7A 1SGRE 2J92A 4JMYA 1JOUB 4ZKOU 1TGBA 1YPKH 1WCZA 1C2JA 1MBQA 4ZUHA 2ZU4A 3NRLA 1IQJA 2ZDMA 4X2WA 4Q63A 1GMHF 1C5ZB 1ZLRA 2C8YB 1QB9A 1VITH 2DE8A 1GBFA 2WYJA 4NIYA 1BMAA 1EAXA 1V2WT 1D6WA 2BOHB 2O8TA 3MFJA 3F6UH 4FUHA 3K6YA 2BZ6H 3GY7A 3PYHA 3BG4C 1CHOG 1NROH 1OKXA 3KYFA 3MYWA 1SI5H 3RLWH 1NFUA 1CA0C 2KZ4A 1O3AA 3N99A 4MVNA 1FDPA 1P05A 1UTLM 2QY0B 1ZTLA 5FL7D 2QXGA 5FX6A 3RC4A 1BTXA 3MO6A 1QL9A 4MPWA 4OS2A 1FLEE 1WDIA 3ZZAA 2NU3E 1WQSA 4KGAA 1D3TB 2ZPQA 4X1SU 1FY8E 1AKSB 2H5DA 1S82A 2FXRA 1C1OA 3F0PA 1HUTH 2H9EH 1S6HA 3A89A 4X6OA 4MNYA 1BBRH 2IJOB 3UQOA 2XTTB 1TBZH 5DP7A 3RMOH 7ESTE 1ZTJA 1XM1A 1H8IH 2PGBB 2VNTA 2XC4A 1UTJA 4XFQA 2GTBA 2W3KA 2Z9LA 1P9SA 3TIUA 1P8VC 2Z9JA 2YMSC 1IQNA 3UOUA 2C8XB 2PP6A 4BTTB 2L74A 4DCDA 1PQ5A 3RXBA 1GBTA 1C5SA 2ZCKP 5GCHG 3A81A 3U8RH 1G3CA 4I8LA 2GCHG 1UVUH 2PSYA 1LKBA 1OXGA 1UK3A 1O2NA 3S7HB 1O36A 2PKSB 4NA9H 2FTLE 2OUAA 1H9IE 1TMUH 1GL1A 2YMSD 3RXSA 3KQ5A 5C20A 1UW7A 4KKDA 3S9CA 3SJKA 3RMNH 3M7UA 3A87A 4NGAH 1SFIA 3F0OA 5ETXA 1SQTA 4RN6A 2VINA 1IHSH 3GY4A 3HGNA 4CRAA 8ESTE 2FOEA 4U32A 6CHAC 1GHWH 5B6OA 2AHME 3TU7H 1J16A 2WPLS 2XBWA 2Y7XA 4ACAA 5L30H 1Y59T 3H5CB 1JBUH 1O2LA 2FESH 2G4UA 3P95A 3VFEA 1PPGE 1WV7H 1IQLA 4X1PU 1Z8JB 1OWHA 1JIMA 1EXFA 4KTSA 1EZQA 1HJAC 3U28C 2F9BH 3LC5A 3U98H 1TX7A 3BEIB 4Y11E 2ZFFH 1VCWA 1LHCH 1ZYOA 2BVSH 1GCDA 3MOCA 4WXIA 5FAHA 1PPCE 4CRFA 2JDID 3PROA 1J9CH 3A7TA 3PB1E 4FUJA 1DPOA 2HWLB 1IQFA 3MH5A 1DOJA 3KYGA 4I8GA 5EQRA 3RXAA 2UUJB 1T8LA 3LC3A 1GBIA 1O2SA 1Q2WA 1VZQH 1XKAC 3UR6A 1LHDH 2J98A 4ZKSU 2XNDD 4MNXA 1OHHD 3A7XA 1O3NA 3RUOA 2BY7X 2J9NA 3OEED 1BJVA 5EGMA 3H7OA 4CH8B 4FUFA 3LONA 3RLYH 3B8JA 4AFSA 1ELEE 1MUEB 1IQMA 4B76A 5FBEA 1FPCH 5HM2A 3W1EA 3DSOA 3ZV8A 4B74A 3L33A 3SNDA 3T5FH 1C1NA 2ZDLA 1MAYA 4GHQA 1XXDA 4CR9A 2CMYA 1GBBA 1C4U2 4E06H 3UPEA 2BTCE 4VGCB 1OWEA 5HYOA 3SI3H 6GCHG 2A5AA 4TYDA 3MO9A 1O3GA 2Q6FA 1CT4E 1P10A 1MTNC 1T8NA 4NIVA 4BAKB 4Q7YA 5LGOA 1P0SH 1S6LA 2BZAA 3EE7A 1LVMA 3UR9A 1KIGH 1K1NA 2IJD1 2J34A 3STJA 3T26A 1O3PB 1O3FA 2GVFA 3RMLH 1YPEH 3URDA 1KSNA 1P9UA 4F4OC 2A5IA 1ESAA 2QCYA 4WXVA 1HNEE 1ZMNA 1DFPA 1O3IA 4OS6A 4MLFB 4FUDA 5FX5A 1FMGA 5F8XA 1FY5A 1O2TA 1GI3A 3FP6E 4AFQA 5C94A 1EATA 1NO9H 1AKSA 2AGIX 4X2VA 3PV2A 2XWBI 3KHVA 1K1PA 1UO6A 1OWJA 1WQVH 1ANDA 3FP8E 3M35A 1DUEA 1ETRH 3QO6A 1LPZB 2QIQA 2FYQA 3BTHE 3TK6A 2FTMA 1K22H 1UVTH 1TOMH 3A7ZA 2HGTH 2WSSD 1LHGH 1ZHRA 1RIWB 4I7YH 1OWDA 1RRKA 4AORA 3PMBB 1V2KT 2J95A 3CNRA 2C93B 4Y7BA 5LH8A 1S0QA 2GCTB 1YP9A 3GYMA 2OTVA 5I25A 1YPGH 3K65B 1TGTA 1ZPZA 3M61U 5DJ7A 1H8ED 2P3UB 1V2RT 4B6FA 5JB8S 3U8TH 4K8BA 1ELGA 1GJDB 1AU8A 5DSFA 1AFEH 4AB8A 2DE9A 3IG6B 1QR3E 1SOTA 4TWYA 4K1TA 2G52A 1HIAB 3R3GB 1IOEA 3GCOA 1DDJA 2TPIZ 3UNRA 1LDTT 1SGPE 1UTKA 1TALA 2SNVA 2KR7A 3TH4H 1L4DA 2XCNA 1QY6A 2V6NA 4GAWA 2EI8A 3ZIAD 1B0EA 4X2YA 1MTVA 1NS3A 2C4FH 1UK2A 4X6PA 1P2QA 1C2EA 4AOQA 4BAMB 2BDGA 1SQAA 3C1KA 3ZZDA 3E1XB 1A5HA 1BRUP 3UIRA 3M7QA 2R2MB 2XNIA 4TY7A 4YESB 4D9RA 1HYLA 2WPJS 1ZPCA 1QB6A 4HG6A 1HAVB 2F43B 3FVFB 2D26C 3OAAD 4J2YB 3VEQB 3PMAB 3ZZ9A 1ELVA 1S84A 3T27A 3FANA 2EEKA 3Q00A 3TGIE 3RXJA 3BTWE 2ZGHA 1GVZA 1GHVH 3O8CA 3E3TA 3A84A 4NSYA 4I8JA 4E7RG 2RG3A 5FCKA 1ESBA 1UCYH 2J38A 2W6JD 1MTUA 1EOLA 2YNBA 3VB7A 2OCVB 3A83A 3QGJA 4ACBA 1KLJH 4A5TS 1C5PA 4ISNA 3ZVAA 2PWXA 2K0QA 3PV5A 3GY6A 1FAKH 1MKWK 1PFXC 1Q31A 2PV9B 5A8ZA 1VGCB 1CBWB 3A88A 3EDXB 4GHTA 1OWIA 1IQHA 4AGJA 1PPHE 1TGNA 1P09A 3QGNB 3T62A 3SV8A 1GBJA 2R3UA 5DKMA 1S85A 2FS9A 2P3TB 2F9NA 4K1EA 1KYNA 1O5FH 1H4WA 1QRZA 3F9FA 4ISIH 1SLXB 1K9OE 4FVDA 2QN5T 3GCHC 1MQ6A 4YT7H 1O2PA 1N8OB 4NIXA 1FY1A 1UVSH 3BTGE 3SGAE 1KTSB 1P03A 3SUGA 3NPSA 3RXKA 2Z3DA 4IN2A 4ZROA 1SGCA 1C5VA 3NKKA 4U01A 4Y7AA 1HXEH 4Q80A 4DG4A 1O2HA 1O2WA 1Q3XA 1G3BA 1O5GH 1PQ8A 4O9VA 1QNJA 3E91A 4FU8A 4YT6H 4A92A 1IQGA 2XYAA 5GWZA 2WPMS 1TPPA 1NFYA 8GCHG 3TLOA 1H8DH 3EAJA 2L6OA 1FY3A 3PWBA 4O03A 3EGKH 3FOAA 3RXPA 2XBYA 4FUIA 1ELAA 1T32A 3I78A 4AFZA 1NPMA 3ZZ7A 1XX9A 9LPRA 1GMCF 1MH0A 1SBWA 5EPNA 1J8AA 2QC2A 1AUTC 1SG8B 1TIOA 2PUQH 2CJIA 1Y5UT 1TA2A 2IPQX 4ZH8A 1G3DA 2UWLA 3RU4T 5ABWA 3LGVA 1LMWB 1TBRH 4NIWA 1O33A 1RD3B 2FP7B 2HALA 3RXLA 3SQHE 4O3TA 2A45B 3TJVA 2IN2A 2YNAA 4YO9A 2SGQE 1K2I1 1ETSH 3B23B 1SPJA 4NCYA 3LU9B 4R0IA 4DIHH 1MU6B 1K1JA 3SOSA 2V35A 5C1UA 2J4IA 4BXWA 3SHAH 1QBVH 3A82A 1CT2E 1P01A 3ZYDA 2VH6A 5HKKD 1C2HA 3EE0B 2F9VA 2PHBA 1H9LB 2BXTH 1DWEH 3HK3B 2ANYA 1GBDA 3EA9A 1XUIA 3VPKA 3ATWA 4TT3D 2O8LA 2HVYB 1O2YA 2VIOA 1K1IA 5GNDA 1NRQH 1E79D 4GSOA 1TRMA 2ZPSA 2Q1JA 1W2KH 2RDEA 4JYUH 4Q7XA 2PW8H 1A2CH 3ZVCA 1KXFA 4CHAB 2LNCA 1BTYA 1C1RA 2ZDVH 5CHAB 1KLIH 1O30A 4YOGA 3QK1A 2HLCA 3MU0A 2SNWA 1C5NH 2OC1A 5AF9H 1GG6B 3VGCC 1HAVA 1NFXA 4WMDA 3H7TA 2Y5FA 1EPTB 3M5MA 4HI3A 2I6SA 1XMNB 2FOCA 5GJ4B 3T25A 4JK6A 1NU9A 1GVKB 2RCEA 8KME2 5LPFA 1D3PB 2WPDD 4YM9A 2RDLA 1YKTA 4ZHLU 5JBTA 1SMFE 1QFKH 1EASA 5C2ZA 2GX4A 3FKSD 2WINI 3RDZA 5CE1A 2FPZA 1Z6JH 2WYGA 3L3TA 2CHAC 1ACBE 4Q7ZA 1QBNA 2AERH 3H09A 7GCHF 1TYNA 2JIZD 3U9AH 4OM9A 1FQ3A 1TONA 1KXCA 3ESTA 1ZSLA 3N7OA 4FOUC 3OSYA 3DCLA 3SNAA 4DJZB 2A7CA 4XE4A 3QTVH 3PMHB 3E0PB 4XSKU 1BQYA 3MQKC 1S5SA 1ZZZA 3GCTG 2ZTYA 3Q3YA 3DA9B 1RJXB 3LDXH 1OYTH 2SGPE 1O2RA 3RXCA 1O2GH 1EZXC 1GCTB 1A5GH 1HAXB 1SGEE 2WV9A 2VGCB 1EAWA 1O5CB 2ZFPH 2DUCA 2PUXB 4D7GA 1ELTA 1NC6A 3TJOA 1NRPH 1AQ7A 4X0WU 1DVAH 3UOPA 2FIRH 1UJ1A 1GMHG 1GHXH 1C2IA 2G5VA 4GPGA 2GMTC 1O2KA 5PTPA 5HIZA 1SKYE 2KCPA 2ZQ2A 4FUBA 2I6QA 2VWNA 1W8BH 1TLDA 3SORA 2ZU1A 2D8WA 2OQ5A 3S0NA 1QIXB 3MU1A 4B2CA 3PMJA 3OTPA 3T29A 2W3IA 4A7IB 3D23A 1V2QT 1BTWA 1PQAA 1ZMJA 3NZIA 4IMZA 4BAQB 4ISOA 3SI4H 1C5WB 4E05H 3KGPA 1IHTH 4TY6A 4X8SH 1ETTH 1AZZA 1JRTA 4CRDA 5FXLA 3W94A 1OX1A 2NWNA 3UWIA 1SLVB 1ABIH 3GDSA 4M7GA 3E6PH 1O2IA 1TE0A 5FHTA 2R0LA 2WUBA 3U69H 1COWD 4UFFH 1D9IA 1TNHA 1W0JD 1C1UH 1L4ZA 5HXFA 2B0FA 3ELAH 1XUFA 5H4IB 5C5NA 1LPGB 2BD3A 3LOXA 3LIWA 2BLOA 2A0QB 2FWWA 4ABIA 1MU8B 3EQ0H 2KAIB 3ODFA 1A46H 3F68H 1GJ5H 2ZA5A 4UONA 2TIOA 1S83A 1TPAE 1L1NA 1HRTH 1MTSA 2P94A 3SGBE 4XD7D 1TQ7B 2KCYA 1AFQC 1GPZA 3T28A 3SU5A 1MKXH 2ALPA 1DT2A 1A7SA 3UQVA 1QURH 5DP8A 1ANBA 3BTTE 3PM3A 5AHGH 1Y8TA 4BAOB 1K1OA 1CHOF 3QTOH 1C2GA 4MQAA 1O2JA 2Q6DA 3OX7U 3FFGA 3SU1A 3ZV9A 4IC6A 2W7UA 2ZCLP 2ZFQH 1PQ7A 3OFND 2B9LA 2R2WU 2LELA 1SR5C 4OS4A 2BXUH 2BDAA 2B7DH 3BG8A 4XDEA 1LTOA 3UNQA 2HOBA 1O3JA 1EPTA 1GJBB 1W0ZU 1W0YH 5T6GA 3KIDU 4AG1A 3OU0A 3B9FH 2SGDE 4BNRA 1EZUC 2GJGA 1F5KU 1P2OA 2A1DB 2VIQA 3BTQE 3K6ZA 1SHYA 1HLTH 1VITF 2ZNKH 5EOKA 3D65E 3AAVA 1O5BB 4H42U 1AD8H 3UAIC 3V13A 3ENSB 1BT7A 4FU9A 1JWTA 2JJ1D 1BTZA 1YLDA 1ELFA 1YCPK 4UE7H 2G55A 4UDWH 4MTBA 1FN8A 1GJ7B 3VB6A 4Y0ZE 4WH6A 5GCHF 1HPGA 1V2NT 2Z9GA 1XUKA 2ODPA 4NZLA 2GCHF 2XW9A 3QWCH 3IITA 2ZEBA 4Y71A 1YYY1 3OYPA 1O3EA 2FEQH 2HNTC 1VCQA 4INKA 1F5RA 2C8WB 3M36A 2JH5D 2BD8A 4CBOA 2M2AA 1O37A 4XBCA 2QAAA 2AIPA 4K60A 1VKYA 3TPIZ 1BMMH 4OGXA 4JZDH 1GGDC 1SGNE 4BANB 1BTHH 3RXOA 3QUMP 2OC8A 2JJ2D 3M7TA 2QF4A 1WOFA 2HNTF 1A3EH 2A2XH 2F9PA 1P3CA 3MNCA 2AMQA 4YTAA 3U1IB 2XBVA 4LZ4B 4AGKA 2FLBH 4FVBA 3BTDE 1C1PA 4ABGA 1T8MA 1ELCA 2TGDA 1O2ZA 2UUKB 2Z9KA 1YPHC 1FV9A 3LJJA 2XRCA 1O35A 2P8OC 1ANEA 3GOVB 1S81A 1SGQE 3KNXA 1AZ8A 4Y8XA 4P02A 3SJ8A 2J2UA 5C1XA 3CP7A 1GBMA 3ATLA 1C5YB 1F7ZA 2HVXA 1OP2A 2VIVA 5CMXH 1BITA 1NRRH 1O3HA 3TK5A 1AMHA 1DX5M 2VBCA 1DE7H 3MH7A 2A5KA 5C67A 2QE7D 4B75A 3D62A 5DG6A 1QRXA 1FONA 1MCTA 1K28D 2AS9A 3TGKE 2J94A 5KGOA 1JMOH 2BVXH 1QCPA 1TNLA 1PPEE 3UB0A 4TPYA 2M5TA 2STAE 3HKIB 3LT3A 3SNEA 2JH6D 4H6TA 1B5GH 1P3EA 1HAYB 5JPMH 4Y6DA 2FX4A 1ZJKA 1GDUA 1GJAB 2ZHEH 3HGPA 3ZZBA 3PWCA 1E37B 2XCFA 1QA7A 5T6FA 1C5RA 2A32A 4INLA 1KMHB 3V3MA 1OYQA 1KDQB 4A1XA 3MMGA 5JYIA 3SJIA 2KAIA 1GHAF 4JYVH 2FI4E 6GCHF 3MH4A 3SO3A 1GJCB 5IYTA 3MTYA 5L2ZH 4ABJA 1T4VH 3SNBA 3P6ZB 3ZZ5A 1BZXE 5T1VA 1DXWA 3ATIA 5GDSH 5EW1H 2W6ID 3CS0A 2FOBA 1FAXA 3PRDA 1AB9B 1MZAA 1EUFA 1BCUH 1S0RA 2OBOA 4UEHH 1SLWB 1FN6A 1GJ4H 1K1MA 4IW4E 5BPEA 3A85A 1NFWA 1G2MA 1FIWA 2OINA 2OD3B 1QJ1B 2D1JA 4KP0A 2NU0E 3LPRA 1CU1A 3F2HA 4HTCH 5F03A 3VXFH 2ZDNA 3MU8A 1O38A 2JETB 2Z7FE 2AMDA 2ILNA 1KXAA 6LPRA 3EYDA 4ZKNU 4IN1A 1QL8A 1F5LA 3CS7A 1TABE 1MAXA 1C1MA 1O2UA 1PPFE 5IK2D 1XUGA 2NU4E 1NM6A 5EQSA 5T6DA 4ZHMU 2GDDA 3RP2A 3LGYA 2OC7A 1LQEA 1G9IE 5A8XA 5F6MA 2Y6TA 1ZPBA 3F2FA 2XWAA 4X8VH 1AIXH 3S9AA 2BD9A 3TH3H 3RU4E 3AVZA 5E2PA 2OXSA 4A6LA 2ANWA 5HGGA 3N7DA 1EJMA 1BBRE 1BHXB 2PKAB 3WY8A 1CO7E 4X1NU 1ZHPA 2ZGJA 4GLYA 3A7YA 4U30A 2HNTE 1DM4B 1V3XA 1UMAH 2ZU2A 1TA6A 4OS1A 4ZXXH 1A3BH 1TBQH 1J14A 5FBIA 1AE8H 1UVOA 2JKHA 5DP5A 5A0BA 2ODYB 1YPLH 4DW2U 2OK5A 2AEIH 2UWPA 1O5AB 4F48B 3UFAA 1SHHB 1K0HA 1L1JA 1XUJA 4Q4LA 1V2ST 1P2MA 1RTFB 4K3JA 5EIYA 2HPQH 3PO1B 5A0CA 1O3CA 3MU5A 4WVPE 4E7NA 1QB1A 2CF8H 1AHTH 4R8TB 5C1YA 2NU2E 1THPB 2RFKC 3FZZA 1KY9A 3SV6A 3PLPA 4SGAE 1YPHE 1K1LA 1QRWA 1Z1JA 2C3SA 3OE7D 2C90B 3A8AA 1QL7A 1QGFA 5JDUB 3ZVFA 5C17A 3GCNA 1YLNA 1LCYA 1DWBH 1O3OA 2EQNA 1P11E 2PKSC 3RXGA 4BTIB 4HFPB 4DT7B 1FPHH 4B6EA 1GBHA 4O97A 3BG4B 2WPIS 4Z0KA 2H6MA 3HATH 3GISB 1CA0B 3BV9B 1FI8A 1ARCA 4YLUA 4X1QU 2RA3A 5C0TA 2AMPA 1EJAA 2BB4A 1FX0B 2EI7A 1HXFH 4IMQA 5JBAS 2ANMH 2ZECA 3UTUH 3LH3A 1EB1H 2VVUA 2SGAA 4YXWD 1UHBA 4TWWA 1TRYA 4CR5A 3P8GA 3GICB 1ABJH 1ZSKA 3FP7E 3AAUA 1EAUA 2FI5E 1JIRA 2BDYA 5C0UA 1GWAA 1GI6A 1FJSA 2ZFRH 3GY2A 1GMCG 1HAHH 1QQUA 5ESTE 2BY9X 5JBBS 1HAGE 2G51A 2QF5A 5DP9A 3P92A 5A8YA 1Z7KA 2ANKH 1KDQA 2PGQB 3SNCA 2YMSB 3SU0A 2ZGXH 1D4PB 1ZMLA 3DSPA 4DIIH 4RT1A 2KM0A 4BXSA 1V2OT 1O3BA 2RA0A 1INCA 4F55A 2ZF0H 1TGCA 1RFNA 1QJ6B 1M9UA 2EA3A 2ZHWH 3SU2A 5KEDA 1AVXA 3TK9A 3AW1A 4I31A 1CA8B 2FOMB 1DLKB 1AUJA 3N7EA 3U8OH 3WWFA 1HB0B 2BLVA 4IGDA 2O9QA 1AE5A 3LGUA 1ELBA 2BD4A 2F3CE 3F9EA 4O3UA 5C3NA 1GJ9B 6CHAB 3LKWA 1O2OA 1BTPA 2VWOA 2H9HA 3HK6B 2TBSA 3T2NA 1TNIA 4BOHA 8GCHF 2BQ6B 4Y8YA 2FM2A 1HGTH
chains in the Genus database with same CATH topology
3KEEA 2P95A 3SHCH 2AGEX 1GMDG 1WYKA 3SU4A 4VGCC 1HJAB 3RMMH 2V0BA 4Q2KA 2ZDKA 1NESE 2ASUB 3QN7A 4NZQA 4WWYA 3SV2H 3GY8A 2BDHA 1LVOA 2G4TA 2JH0D 1AWFH 1YF4A 4GVUA 4FXGH 1CT0E 1P2JA 1TB6H 1W7XH 3ODDA 1Y3UA 4INHA 3K2UA 4NFEA 4X6NA 1BBRK 1C1TA 2PKAA 3EA8A 5EODA 3SUFA 1IQIA 1F0SA 2GZ8A 1F0RA 3LGWA 1LVYA 2BY5X 4D9QA 3STIA 4BAHB 1EZSC 1C4Y2 3A7WA 3VB4A 3ZZ8A 4IS5A 2G00A 1C2KA 2FOGA 2ZPRA 2BYAX 2F9UA 1OPHB 1AI8H 3SU6A 4CH2B 2W26A 4TPIZ 1IQKA 1BRBE 4RSPA 3K9XB 1OP0A 2VIWA 4JZFH 1BRCE 1C5XB 5L6NH 3NCLA 4DVAU 2FODA 2G81E 1V2PT 5EXNA 3SQEE 1Y3WA 1NN6A 2BD5A 1F2SE 1GHBG 1LQDB 1RIWC 1O2XA 2XBXA 2FDAA 3ATMA 1VJAU 5A2MH 1LKAA 1GBEA 7LPRA 1MTNB 2FS8A 5AFZH 1NY22 1UTOA 1C1QA 1ZGIA 4X8UH 3NXPA 4WH8A 2GCTC 1TX6A 2BD7A 2GKVE 1GL0E 4AB9A 2Y80A 4Y8ZA 1DUAA 1MKWH 1DANH 1F0UA 2W5EA 1P06A 4WF8A 2ZP0H 2QXIA 1CVWH 5EU8A 3MNSA 1KXEA 1J15A 2BDCA 4DY7B 1UTMA 3A86A 1SGIB 2GT8A 4KTUA 3RXUA 4D76A 1MTWA 1Z8IB 3OTJE 3L6PA 4OS7A 3PLBA 4GCHF 2GD4B 4ABAA 1FY4A 1N6XA 4JYTA 2SGFE 1UCYE 1QJ7B 2BY8X 1GDNA 4PROA 1EAIA 3DT0H 3BEFB 3JZ1B 4FU7A 1KXBA 2Z9IA 4CRGA 1WAYB 5F8TA 1OS8A 3RXFA 4ABFA 5DGJA 2AIQA 1N1LA 2IOTA 5DPAA 3GYLB 1CGJE 1E36B 2OBQA 5FPTA 1GI9B 1A61H 4AN7A 2CGAA 1ZGVA 1H9HE 2TRMA 2Z94A 4X2XA 3C27B 2VB0A 1HCGA 1D6RA 3M3VA 1P04A 4MG3A 3P8FA 1C5UA 5T3HA 5K0HA 1ID5H 1C5QA 1SB1H 4YZUA 2H1UA 5K7RA 1F92A 1TMTH 4J1YA 1S6FA 4WMEA 4B71A 2W7SA 5GXPA 2H5CA 1VGCC 1CBWC 3GDUA 4Z6AH 1ANCA 4MNWA 3Q76A 2BX3A 3TGJE 3URCA 1YBWA 3DD2H 2BHGA 1TQ0B 3SZNA 1KXDA 1RXPA 5E0GA 1DICA 1RS0A 2QYIA 2A4OA 1GBAA 1G2LA 4OS5A 2LPRA 2TGTA 1ZHMA 2GDEH 1Y5BT 1N8OC 3R0FA 2BX4A 4ZAEA 3MNBA 5LPRA 3F1SB 1OOKB 2TGPZ 1O0DH 1V2MT 4LXBH 1XXFA 4JZ1A 1MBMA 3TVJB 3BIUH 1FZZA 4NA8A 1HAZB 2WUCA 2ZFSA 3KL6A 2EI6A 2FYRA 5FPYA 5IDKA 1VITG 1SGFA 1E34B 1V2VT 1JXPA 3BSQA 1UTQA 1WU1A 4HZHA 1Y3VA 2BDBA 1GBKA 4QT8C 1O2QA 3ZVGA 2D2DA 1QBOA 2THFB 7KMEH 5DP6A 4JZIA 2GZ9A 1C9TA 1W10U 1EP6A 5JBCS 1SLUB 1D3DB 1P2NA 4LOYH 1TAWA 3ZVDA 2A4QA 1SOZA 2CN0H 3BIVH 2P59A 2VIPA 2Y5GA 3GCHB 1KTTB 1CGHA 4FUEA 3EA7A 2ZO3H 1TNJA 1GBLA 1ZSJA 1ZR0A 1PJPA 1AVGH 3Q3KA 1T8OA 3RU4D 2VVVA 4ZXYH 3S7KB 4UFEH 2FMJA 1ZRBA 1VCPA 3MU4A 1GDQA 3NUMA 2ZU5A 2OC0A 4U2WA 1BTUA 4CREA 1SQOA 4ZHAA 4UFGH 4Y79A 1GI1A 1HJ8A 1C1VH 1ZJDA 1EX3A 2XC0A 1C9PA 2PTCE 2R3YA 1MZDA 1C2FA 2V3OH 4IBLH 5DP3A 5J4SA 1SGFG 1NTPA 1HV7A 2ZWLH 3NK8A 1QQ4A 1QA0A 4AYVB 1C2LA 2PLXA 3O8RA 4ABEA 3MH6A 1UCYK 5E2OA 1E0FD 2SFAA 3PLKA 4ABBA 2C8ZB 4CHAC 2ZKSA 3Q77A 1A0LA 1OSSA 5CHAC 1GI2A 3FZDA 5ESBA 3ZZ6A 2P16A 1OP8A 2A4GA 1A1RA 1GG6C 4ASHA 2ZGCA 5EW2H 2BM2A 3QDZB 2ZC9H 4B1TA 1HDTH 4UFDH 1EPTC 4FUGA 2A7JA 4NWLA 1E35B 3MI4A 1ZTKA 3FAOA 1T31A 5I46H 5JB9S 2Z3EA 5HM9A 1J17T 1SL3A 1YLCA 1YGCH 2ZCHP 1XVOA 3UUZA 1ARBA 5TCAA 3AW0A 2R0KA 4D8NA 1ESTA 1A4WH 4JK5A 2CF9H 4AFUA 3SW2B 1TOCB 1C2DA 3TITA 4DURA 1UHBB 1VJ9U 1GHAG 4I8HA 1HAPH 2H9TH 1GI4A 2A31A 3A8CA 4K5ZA 4JZEH 1SGDE 4YOIA 2HRVA 3UREA 3A7VA 3OY5U 1LVBA 2HPPH 1ELDE 1OWKA 1MD8A 2FLRH 3OY6U 2ZZUH 2ZHQH 4IC5A 5G4BA 2ZTXA 2STBE 2GV7A 1TMBH 2ZIQH 5DO4H 4Y0YE 3QZRA 1T7CA 4MDSA 1O2MA 1W3CA 1ZRKA 1TWXB 2BOKA 2IPHA 4I33A 1W13U 5EG4A 3VGCB 1GCTC 2ODQA 4NWKA 3DUXH 2VGCC 1L0ZA 3F9GA 5FPSA 2P3FH 1DSTA 3KN2A 3V0XA 4X1RU 1QTFA 5DP4A 5FCRA 1HFDA 4YOJA 1PPZA 3SJ9A 2A4RA 3F9HA 5F8ZA 2GZ7A 1WSSH 2VWLA 2VU8E 1UTNA 2ZQ1A 4HGCA 2ULLA 3QLPH 2F83A 2ZI2H 3SBKA 3BF6H 1G30B 1BMNH 1C2MA 2FOHA 1DY8A 2CHAB 2F91A 2BD2A 1SSXA 3P70B 2B8OH 3SGQE 1BIOA 4LK4A 1FUJA 1PYTC 1GJ6A 1SFQB 5GPIB 4UD9H 4RKOB 3M37A 5A0AE 4ISHH 2ZGBH 3RXTA 1HAOH 4CBNA 1RTLA 1XKBC 2GV6A 1W14U 1WUNH 2QF0A 2GGVB 1HJ9A 1JRSA 1H1BA 4DOQA 1W7GH 1PYTD 1GVLA 1O3LA 1W12U 1Z6EA 5EXLA 1TNKA 2QXHA 3MO3A 1XVMA 2SGEE 1Y3YA 4MPXA 3MNXA 3RC6A 2A2QH 2AH4X 2GP9B 1YCPH 1AN1E 1TPSA 1YPJH 2FOFA 3SV7A 1DS2E 1DWDH 5DK1A 2Y5HA 4K2YA 1V2UT 1DXPA 1BRAA 1V2LT 3V7TA 3BTKE 1DITH 1EP5A 3RM2H 4B73A 1MMJN 1N6YA 1ZOMA 5SGAE 2GMTB 3MHWU 3RXIA 1UVPA 1NU7B 2PFEA 1BJUA 4A1TA 1O2VA 1CHGA 2ALVA 2P93A 1CSOE 2B5TB 2UUFB 1FIZA 4GUXA 4K69A 5AVDA 1G32B 3E16B 1EQ9A 1IQEA 1NRSH 1GI0A 2QXJA 2R9PA 3P8OA 1GBCA 2Q6GA 1WBGB 4KTCA 1EKBB 5C5OA 3ZVBA 2H2ZA 3SV9A 2QF3A 1IAUA 3KQBA 1GHZA 1AVWA 3P8NA 1EB2A 1BOQA 4X8TH 1C5LH 3GY5A 1AO5A 1Y5AT 1C5OH 1L1GA 4K8YA 1U6QA 3VXEH 4BTUB 3V12A 4ABDA 1SGTA 1BB0B 3RXDA 2FX6A 1O3DA 1MQ5A 2OP9A 2EC9H 1K21H 2WPKS 3ZZCA 2BMGB 5GIBA 3PTNA 2FO9A 5EPYA 3S69A 3DFJA 4MNVA 1GHYH 1AFQB 2OLGA 3M3SA 3SJOA 2YOLA 1VR1H 3Q3XA 1TFXA 4OGYA 4FUCA 1P2KA 3UNSA 3M3TA 1BMLA 3M5NA 4XBDA 2AGGX 1G3EA 1EOJA 2PR3A 1L2EA 3NWUA 1GI7B 1T4UH 1YPMH 2G8TA 1SC8U 3ZZ3A 1CQQA 3VB3A 2BQWB 3ATKA 3DFLA 4SGBE 4MPUA 1FNIA 1Z8GA 3TH2H 1KLTA 2O8WA 3QZQA 1A5IA 2BDIA 4ISLA 3G01A 4ABHA 2A7HA 3RXVA 3DHKH 5HMAA 6ESTA 1GI8B 1O31A 1RTKA 1RGQA 2ZFTA 4I32A 4B2AA 5E8EH 1CE5A 2AFQB 3TNTA 1A0JA 1B0FA 1C1SA 4XBBA 4X6MA 3LGTA 1MD7A 9ESTA 3KQCA 1MCVA 1BDAA 2WV4A 1GJ8B 3AASA 4ZMAH 1V2TT 1O3MA 1TX8A 2PSXA 1W11U 3SUEA 1UTPA 2F9OA 3PV4A 3RXRA 1NZQH 3U1JB 1O5DH 1YCPM 1A0HB 4D7FA 4NA7A 1Z71A 3KQEA 4A1VA 5A09A 3QX5H 2VIDA 2VVCA 3LH1A 3E0NB 1C1WH 1MKXK 1Z1IA 2FZZA 2QGRA 1HIAA 1D3QB 3HKJB 2XXLA 3I77A 1GGDB 4NG9H 3M5LA 3RXQA 1B7XB 1YC0A 1YM0A 3BTEE 5TCCA 1CGIE 2Y82A 5BRRE 1SVPA 1NRNH 1BUIA 4THNH 3CENA 2BLWA 2VJ1A 1HBTH 1SGYE 4WY3A 5TJXA 1LHEH 2PTNA 1GMDF 4NSVA 4KELA 4ESTE 1DLEA 3ZVEA 4Y10E 4H6SB 7GCHG 3M5OA 4XOJA 5E0HA 2P8OB 2Y7ZA 2ZG0H 4CRCA 5EXMA 1O39A 2ZTZA 3TNSA 1P2IA 3RXMA 2XC5A 2QV1A 2CXVA 1AB9C 1UK4A 3RXEA 4H4FA 1O5EH 1Y3XA 2FOAA 4LZ1H 2VH0A 1TGSZ 3RXHA 3ZZ4A 3O8BA 3LGIA 1THRH 2BY6X 1X7AC 2ESTE 2BQ7B 3IWMA 2UWOA 3ITIA 3KQDA 4NFFA 1WTGH 3HPTB 4K1SA 4DGJA 2JETC 4JCNA 1O3KA 4WMFA 3BTME 1O34A 3A8DA 5E0JA 1TPOA 2NU1E 4MPVA 5AFYH 1F0TA 1G37A 1LHFH 1TRNA 2Z6BD 2ZHDA 3LJOA 3I29A 1O32A 1DY9A 3D49H 1DWCH 4AG2A 1ORFA 3ZYEA 4ZKRU 1AGJA 3KCGH 4GCHG 4YLQH 4RKJB 2OQUA 2Z3CA 1FXYA 2BLQA 4CRBA 2CV3A 1HAIH 1XUHA 3TJUA 2QA9E 2ZDAH 4AZ2B 3W95A 3O8DA 3MWIU 3VB5A 1GI5A 3BEUA 3P17H 3UY9A 1DSUA 2ZU3A 3E8LA 3RM0H 2O8UA 4B2BA 1NT1A 3SN8A 1GHBF 1AY6H 2FI3E 1WTHD 2O8MA 2TGAA 2VWMA 3PTBA 1G36A 3E90B 4AX9H 3KF2A 2ZHFH 3BTFE 4F49A 1PPBH 5J4QA 2WPHS 1LO6A 1E38B 1V2JT 1EJNA 3TJNA 1THSH 1Z8RA 1V6DA 3A8BA 2G5NA 3JZ2B 1C5TA 3BN9A 5L2YH 3GCTF 2BVRH 3UWJH 4AYYB 1BA8B 3RC5A 2UUYA 1TNGA 8LPRA 2V3HH 1C4V2 3SU3A 1BHXF 3SUDA 1QHRB 2Y81A 4Y76A 3GDVA 4I8KA 3GY3A 2K1QA 4WJG2 1LPKB 1P57B 3PO1C 1P02A 1P12E 1AWHB 5EQQA 3A80A 1C5MD 2AYWA 5LPEA 3S9BA 2WV5A 2GT7A 1SGRE 2J92A 4JMYA 1JOUB 4ZKOU 1TGBA 1YPKH 1WCZA 1C2JA 1MBQA 4ZUHA 2ZU4A 1IQJA 2ZDMA 4X2WA 1GMHF 1C5ZB 1ZLRA 2C8YB 1QB9A 1VITH 2DE8A 1GBFA 2WYJA 4NIYA 1BMAA 1EAXA 1V2WT 1D6WA 2BOHB 2O8TA 3MFJA 3F6UH 4FUHA 3K6YA 2BZ6H 3GY7A 3PYHA 3BG4C 1CHOG 1NROH 1OKXA 3MYWA 1SI5H 3RLWH 1NFUA 1CA0C 1O3AA 4MVNA 1FDPA 1P05A 1UTLM 2QY0B 1ZTLA 5FX6A 2QXGA 3RC4A 1BTXA 3MO6A 1QL9A 4MPWA 4OS2A 1FLEE 3ZZAA 2NU3E 1WQSA 4KGAA 1D3TB 2ZPQA 4X1SU 1FY8E 1AKSB 2H5DA 1S82A 2FXRA 1C1OA 1HUTH 2H9EH 1S6HA 3A89A 4X6OA 4MNYA 1BBRH 2IJOB 3UQOA 2XTTB 1TBZH 5DP7A 3RMOH 7ESTE 1ZTJA 1XM1A 1H8IH 2PGBB 2VNTA 2XC4A 1UTJA 4XFQA 2GTBA 2W3KA 2Z9LA 1P9SA 3TIUA 1P8VC 2Z9JA 1IQNA 3UOUA 2C8XB 4BTTB 4DCDA 1PQ5A 3RXBA 1GBTA 1C5SA 2ZCKP 5GCHG 3A81A 3U8RH 1G3CA 4I8LA 2GCHG 1UVUH 2PSYA 1LKBA 1OXGA 1UK3A 1O2NA 3S7HB 1O36A 2PKSB 4NA9H 2FTLE 2OUAA 1H9IE 1TMUH 1GL1A 3RXSA 5C20A 4KKDA 3S9CA 3SJKA 3RMNH 3M7UA 3A87A 4NGAH 1SFIA 5ETXA 1SQTA 4RN6A 2VINA 1IHSH 3GY4A 3HGNA 4CRAA 8ESTE 2FOEA 4U32A 6CHAC 1GHWH 5B6OA 3TU7H 1J16A 2WPLS 2XBWA 2Y7XA 5L30H 1Y59T 3H5CB 1JBUH 1O2LA 2FESH 2G4UA 3P95A 3VFEA 1PPGE 1WV7H 1IQLA 4X1PU 1Z8JB 1OWHA 1JIMA 1EXFA 4KTSA 1EZQA 1HJAC 2F9BH 3LC5A 3U98H 1TX7A 3BEIB 4Y11E 2ZFFH 1VCWA 1LHCH 1ZYOA 2BVSH 1GCDA 3MOCA 4WXIA 5FAHA 1PPCE 4CRFA 3PROA 1J9CH 3A7TA 3PB1E 4FUJA 1DPOA 2HWLB 1IQFA 3MH5A 1DOJA 4I8GA 5EQRA 3RXAA 2UUJB 1T8LA 3LC3A 1GBIA 1O2SA 1Q2WA 1VZQH 1XKAC 3UR6A 1LHDH 4ZKSU 4MNXA 3A7XA 1O3NA 3RUOA 2BY7X 2J9NA 1BJVA 5EGMA 3H7OA