4AGJA

Crystal structure of the capsid protein (110-267) from aura virus in complex with dioxane
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
152
structure length
152
Chain Sequence
DRTFAVKNEDGKIMGYAVAMEGKVIKPLHVKGTIDHPALAKLKFTKSSSYDMEFAKLPTEMKSDAFGYTTEHPEGFYNWHHGAVQFSGGRFTIPTGAGGPGDSGRPILDDSGKVVAIVLGGANEGARTALSVVTWNKKGAAIKTTHEDTVEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAPSID PROTEIN
publication title Crystal Structure of Aura Virus Capsid Protease and its Complex with Dioxane: New Insights Into Capsid-Glycoprotein Molecular Contacts.
pubmed doi rcsb
source organism Aura virus
molecule tags Hydrolase
total genus 30
structure length 152
sequence length 152
ec nomenclature ec 3.4.21.90: Togavirin.
pdb deposition date 2012-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4agjA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4agjA01
5FX5A 3NCLA 2ANMH 4FVBA 3A8AA 2TRMA 1T7CA 2AH4X 2GZ8A 5JBCS 1TNKA 5BRRE 2PTCE 1C2GA 1C5VA 3SW2B 4ABJA 1NPMA 1UTLM 3SU5A 4DW2U 2ZHFH 1NC6A 3ZZ6A 4RKJB 3QDZB 1KIGH 1DICA 1V2LT 2F9NA 2GZ7A 1C5MD 3B8JA 2PR3A 3RU4D 4GHTA 3VPKA 2BYAX 3PO1B 4K1EA 3UOUA 1GCTC 1XUGA 2OINA 4TPYA 2XC5A 3LC3A 4TWWA 1F5RA 4YTAA 1IAUA 2QAAA 1GPZA 4AG2A 1ZOMA 3BIVH 2ZHQH 4UE7H 3O8DA 1G32B 4WVPE 3K6ZA 4H4FA 3OTJE 4UFDH 1RD3B 2D26C 5FXLA 4GHQA 1UVPA 3SUEA 8ESTE 1MTUA 3K9XB 2GD4B 1G2MA 3K6YA 4TY6A 1RGQA 4K8YA 1QRZA 1FMGA 1D6WA 3BTQE 3M7UA 2ZFFH 1BRBE 3Q00A 5CMXH 2ZU2A 4OGXA 2ODPA 4TYDA 1YPGH 4XBBA 5JPMH 1BTZA 3MNBA 1SFQB 4IMQA 1LDTT 3GY8A 3STIA 1G9IE 3A84A 1TRYA 1MBQA 3A85A 3Q3KA 4Z0KA 1YPKH 2M5TA 2ZHDA 1KDQA 1WQVH 1G3CA 3BN9A 1LTOA 1LVOA 1C2EA 1P57B 2BDGA 2ANKH 2BD8A 2ZGBH 1FIWA 1K1IA 2A45B 2QIQA 5EG4A 4ABAA 4NSYA 4Q80A 4MPXA 9LPRA 1BBRH 3F6UH 2EA3A 3FP8E 5DPAA 1C2IA 1FQ3A 3BTHE 1DOJA 1NFUA 1OOKB 2ZTYA 1TB6H 3HGPA 3LGIA 3OYPA 2QV1A 1AMHA 1HAIH 1QJ6B 4UFGH 3A88A 5EU8A 2WPKS 1DSUA 3E90B 1WBGB 3ZVGA 4ABGA 3TJUA 3MH7A 1L1GA 3ODDA 1HAVA 1FY8E 5IDKA 1AZZA 1O5GH 4MG3A 1BRUP 1EZSC 1S84A 1GMHF 2BOKA 2BVRH 4X8TH 1K1OA 1FJSA 1MZDA 1GBDA 4AX9H 1THSH 1ARBA 2B9LA 1P3EA 2PKSC 4BANB 3RXJA 1W7XH 1G3BA 1GMDF 1ZRKA 2NU0E 1QQUA 4WY3A 2HPQH 1FLEE 1SPJA 1UHBA 3NZIA 4ZUHA 2ZGHA 1JWTA 3ATIA 2A5AA 1L0ZA 4XBCA 2WPLS 2Z3CA 5HM2A 5I46H 2HPPH 2GCTC 1AWFH 1WTGH 1C2KA 1LHCH 1AKSB 3DT0H 3IITA 1K2I1 2THFB 3RXEA 1TOMH 3MH6A 1GL1A 1PQ5A 2SGDE 2WV4A 1EPTC 2VWOA 4X8SH 5TCCA 1AVXA 1GBMA 2PLXA 3QK1A 3VB6A 1JIRA 1A0HB 1THRH 5F8TA 3RM2H 1HUTH 1TAWA 1QCPA 2C4FH 2XBXA 1BA8B 2GZ9A 4DY7B 3RLWH 1EAXA 2WUBA 1UCYH 4Y76A 4D7FA 3A86A 1C1UH 3PMBB 1JOUB 5C3NA 4Y10E 3RXQA 2PFEA 1NTPA 3QWCH 3NK8A 1DUAA 1BJUA 3BG8A 1J15A 4KP0A 1AE8H 1BHXB 4FUDA 2R0LA 1T31A 2FOBA 1QQ4A 2AMDA 4BAOB 2BLWA 1V2UT 1QB1A 2OTVA 5GCHG 3TH3H 1SGFG 3RXOA 1IHTH 1GI7B 3LGYA 1QJ7B 4AOQA 1HXFH 1KTTB 1Q31A 4MPVA 4CRCA 2O8UA 1SLWB 2ZQ1A 3EDXB 1GVKB 1DM4B 2ZPSA 3HK6B 2BD9A 4YLQH 2PSXA 1ZGVA 1XVOA 3ZVCA 2PV9B 5IYTA 3R3GB 2GTBA 3DFJA 4NFEA 3R0FA 2ZO3H 4A92A 2FOFA 2OP9A 3T27A 1ABJH 1Y5AT 2ZFSA 5DP4A 1A61H 3URDA 1Y3UA 4INLA 1LPKB 5ESBA 2QXHA 3V3MA 2BQ6B 3MWIU 4H6SB 1OWHA 1DLEA 1UTPA 1YKTA 3BSQA 1MCTA 1GMCF 1CSOE 3BTEE 5FBEA 1OPHB 3UIRA 2ZCKP 3PLKA 2BDBA 3KIDU 4WF8A 3MYWA 3MH5A 1QBOA 1BDAA 1G36A 2W7SA 6LPRA 3FZDA 2Q6GA 1VITH 4FUHA 1D4PB 2FI4E 1K28D 5DGJA 1FN6A 5GPIB 1JMOH 2UWOA 4UD9H 4NIWA 1RS0A 3B23B 4X6NA 2OUAA 1O3KA 1OWEA 2XWAA 4ZXYH 1D9IA 1T8NA 1TGNA 2VINA 4UDWH 2A4RA 3QO6A 1ESAA 2AGGX 1YGCH 3AW0A 2ZU4A 4IC5A 1W11U 1HCGA 1YYY1 3SHAH 3SU6A 4ZKNU 1PJPA 1CBWB 1W14U 1GBCA 5ABWA 1O37A 2ANWA 2UUJB 1VITG 2G52A 3KQDA 2ZP0H 1ZMLA 3K2UA 4KELA 1YPLH 1AFEH 1KLTA 3WY8A 2ZECA 1VJ9U 1KLJH 1V6DA 5E2OA 1K1PA 1EP5A 4PROA 2UUYA 1P09A 4BXWA 2Q1JA 1AUJA 4E7NA 3QTVH 2GX4A 5DJ7A 5DP7A 2IPHA 4MDSA 4WXVA 4BAQB 1J14A 1C1OA 3T26A 2GDEH 1A0LA 4OS6A 2CJIA 1QGFA 1EB1H 3GCHB 3P92A 2A4GA 2P94A 1KXCA 2F9PA 3S9AA 3CP7A 4OS2A 1O2XA 2BOHB 1E37B 1PPEE 1J17T 1HBTH 1TGCA 1TX8A 3FANA 4K69A 5C5NA 4D76A 1F0UA 3P8OA 3MO9A 4J2YB 3QN7A 4BTTB 5A0CA 4O03A 2R2WU 1CA0B 3P8FA 2UUFB 2JETB 1H9LB 1XM1A 4GUXA 1LHEH 4X1SU 1BITA 1HLTH 3GY4A 1AO5A 1EZQA 4WMEA 1QRXA 1A7SA 2P3UB 1ZSLA 1UTNA 1ELGA 1BIOA 3U8RH 5EXLA 1MU6B 3ATMA 1P2OA 2HRVA 1VCWA 2BM2A 2VVVA 1SVPA 5DP8A 4ABHA 5DP9A 3SGAE 2ZQ2A 1LVMA 1YCPK 1XUFA 2FWWA 4E06H 2ZNKH 1GHYH 2P59A 5EW1H 3DA9B 2VVCA 5FPYA 2BTCE 2AEIH 1YF4A 4Q7XA 5TJXA 1UK2A 3FAOA 2ZZUH 2CN0H 3TU7H 4FUGA 1AB9B 3LOXA 4IBLH 3PMJA 1PPFE 3CS7A 5A8XA 1N6YA 2QGRA 2ZF0H 2Y5HA 3TNTA 2FO9A 4D7GA 5C67A 4CHAC 1DWEH 4AORA 1EKBB 1ZJDA 3EAJA 3PV4A 2D1JA 1Z1IA 4ZHAA 4Y11E 4IGDA 4BTUB 4VGCB 1HAZB 2ZHWH 3RMLH 3ZVDA 5G4BA 1WV7H 1HAOH 2ODYB 5EXMA 3TGJE 1JIMA 1IQLA 2BLVA 1GG6C 7ESTE 5JBBS 5GWZA 1MU8B 4A1TA 3SO3A 3H7TA 1LQEA 2C3SA 5ESTE 2WPJS 3HGNA 3F9GA 2JH6D 2H5DA 1GI5A 5CHAB 1A5HA 3UOPA 4DVAU 4WMDA 3GY6A 5DP5A 4U2WA 3T62A 4H6TA 1EOLA 1QL9A 3OY6U 2BY5X 3A7VA 1SB1H 3LGVA 3PTNA 4ZAEA 1H1BA 1CT0E 3SJKA 2RA0A 3EA8A 1C9TA 3SNCA 4CH2B 3LIWA 2H2ZA 1FXYA 2GCHG 4ABFA 2ESTE 1O3JA 2GV7A 1O2MA 1ELCA 2XBVA 2J92A 3PMAB 1EJMA 2OBOA 2O8MA 1BBRK 5EQQA 1BMLA 1TPPA 4NA9H 1SGFA 1S85A 1A2CH 1SGIB 1QR3E 1ACBE 1OWDA 3RXKA 1O5FH 2WV5A 1MQ6A 1WTHD 1GBBA 3SU0A 1N8OB 1QJ1B 1TGSZ 4B2AA 5B6OA 3BEFB 3SNAA 4JK5A 1AD8H 3E91A 2R3UA 1EUFA 4D8NA 1XKAC 3PTBA 1KXAA 3UPEA 2A1DB 5FPSA 2ZFPH 1O3PB 4WXIA 1T4VH 3U8OH 1SQOA 3D65E 3F9FA 1J8AA 4LZ4B 4E7RG 1SI5H 3SUGA 1HJ9A 3KQBA 1F2SE 1ELEE 1GBEA 2UWLA 3UWIA 3QTOH 1FNIA 2VIDA 1P2QA 2ZDNA 1LPZB 1C2LA 4I8GA 5E8EH 2BZAA 3DHKH 4IN2A 3ESTA 8KME2 2Z9GA 2OQ5A 3M5NA 3GY2A 3RMOH 3STJA 3RXCA 1EJAA 2HOBA 2VGCB 1ZJKA 3U69H 1TPAE 1ZGIA 1C1TA 1EJNA 1ANDA 1WAYB 2R3YA 1GI6A 3MU5A 4F4OC 1YBWA 4JZIA 3MU4A 1O3FA 3RMNH 1HJAC 2J34A 4ESTE 4SGBE 3VGCB 3SU4A 2DE8A 2IN2A 2Z7FE 1ZHMA 3KQEA 1GBKA 1A5GH 1GHBF 2XNIA 3BEIB 3TGKE 3UWJH 2NWNA 3I78A 1W2KH 1GMHG 1LHFH 2XWBI 1SGYE 4X2YA 1O2YA 1SL3A 2XBWA 5F8XA 3NXPA 3BTME 1AY6H 1EPTA 3AW1A 2Z9JA 2XC0A 7GCHF 2OLGA 2PGQB 1NN6A 1GMDG 1JRTA 1TNLA 1FN8A 3RP2A 1Z71A 5JB8S 4BAMB 1MKWK 2ZEBA 5HMAA 2BD3A 2BZ6H 2XYAA 2BX3A 4I8JA 1L1NA 3UFAA 4Z6AH 1QURH 1EATA 1BZXE 1P2MA 1FAKH 1O30A 2W3IA 1C1RA 3BEUA 1O36A 3A87A 4B76A 2CGAA 1Y59T 1O39A 1KXFA 1EX3A 1ETSH 3LKWA 1GHAF 4ZKRU 1GDNA 1SGEE 3GDVA 1ZHRA 3LONA 2ODQA 4UFFH 2GCHF 3D23A 2CHAB 1LPGB 1OXGA 1O2RA 1FY4A 3ZVAA 1H8IH 3TK6A 3ZZ5A 4X8UH 9ESTA 1Y3VA 1LCYA 2FX6A 3M3VA 3NUMA 1DXWA 3KHVA 2HALA 2BY9X 1SGPE 2GP9B 1TE0A 4Y7AA 4MQAA 1H8DH 2P95A 4IS5A 2H9HA 5FCRA 1ELFA 1QL7A 2A7JA 1SGRE 2BD4A 3JZ2B 4BXSA 1C5ZB 3TH2H 1ZMJA 1MTNC 3W94A 1ABIH 1VGCC 2TGTA 2XC4A 1NESE 5C2ZA 1NO9H 1O31A 4FU8A 2P8OC 1DFPA 3IWMA 5DO4H 1GHXH 1O35A 1S6FA 2WUCA 3SJIA 4E05H 4DT7B 3RXIA 5SGAE 1SBWA 1SGCA 4MLFB 4NSVA 5FPTA 3RXPA 1SLUB 1Y3WA 4D9RA 2NU3E 4KGAA 1DDJA 2PW8H 4R0IA 2G5VA 5JB9S 2G81E 1C5TA 2FOMB 2CMYA 3RXBA 1DITH 1SMFE 1HAVB 2PWXA 2BQ7B 4FU9A 5DG6A 2AERH 2SGPE 1V2WT 3GCTF 1P9UA 3U98H 4MNXA 2FXRA 1BBRE 2QA9E 4FUCA 2BD2A 2ZGCA 2OC7A 3T29A 2BHGA 2UUKB 2A2XH 4IMZA 1S81A 1DUEA 1TGBA 2P93A 3SHCH 1XX9A 3A83A 1O2KA 1GCDA 1UHBB 2EI8A 2RA3A 3SJOA 1Z8IB 4AFUA 1SQAA 4Y79A 1BCUH 2XBYA 3MU8A 2JKHA 2XTTB 3V7TA 2AGEX 1ELDE 2HWLB 2HLCA 1SGTA 1FDPA 4NZLA 1GMCG 4I8HA 3U8TH 2GVFA 2SFAA 2VIWA 1B7XB 1T8LA 1RIWC 3A7XA 5BPEA 2G00A 1GJBB 2ZFRH 3RXMA 2VNTA 2ZIQH 4U01A 2BY8X 4JYVH 4IN1A 1PQAA 1E38B 2A31A 1HV7A 4M7GA 2BD7A 2SGFE 3UY9A 2FP7B 2XRCA 3OX7U 1HFDA 2FS9A 3M5LA 1P3CA 1TWXB 1UMAH 2ZGJA 2ALVA 3TJOA 1GBJA 2Z9IA 2HNTF 2XW9A 5EPNA 1BHXF 2W5EA 1TNJA 4FUIA 3ZZ3A 1C5SA 1MH0A 5DK1A 1DWBH 1LKAA 1PPHE 1ELVA 3KEEA 1OP2A 1Q3XA 3ATKA 1NZQH 2WPHS 1G3EA 1GI9B 4FUJA 3H7OA 1TA2A 1YLCA 4DG4A 3TGIE 4X6PA 1W7GH 3SU2A 5H4IB 2FESH 1KLIH 5E0HA 7KMEH 2O9QA 3V0XA 4JMYA 2BVXH 1C2JA 1ELBA 1GL0E 3GYLB 1MUEB 2EC9H 3TPIZ 3SBKA 2GT7A 4B1TA 1Z8JB 4MVNA 4Y71A 2TBSA 1V2RT 2PTNA 4YOGA 1TBZH 5FHTA 1O2JA 1P02A 2JH5D 2C8XB 2VJ1A 1YCPM 4KTSA 1A1RA 2W26A 1C9PA 4BAHB 2BDYA 3RXUA 3PMHB 4GSOA 1DT2A 3SGQE 1AFQC 4U30A 3TIUA 1O3OA 2WYGA 1C5YB 3ENSB 1GGDC 1MQ5A 3M36A 1L4ZA 4BOHA 1LHDH 2W3KA 2HVXA 3BG4C 4GVUA 1T8MA 1TQ0B 2CF8H 1O3IA 1F7ZA 1O2WA 2GMTB 1EXFA 4ISLA 4JZEH 2Y5GA 2ZDMA 1DE7H 3S7KB 3SNDA 2G8TA 1Z6EA 5EW2H 1O32A 1HB0B 1IHSH 1NY22 3ATWA 1YPEH 3MH4A 1A5IA 2AMPA 1JBUH 6CHAC 3FVFB 3GDSA 1Z7KA 4NG9H 4F49A 3SORA 2AMQA 1FZZA 2GGVB 1QA0A 1FY3A 4NWLA 1Z1JA 4AZ2B 3RUOA 2TGAA 3MTYA 3C1KA 3QX5H 2DUCA 1CQQA 1EAWA 1SFIA 2BXUH 1GBTA 3CENA 1KYNA 8LPRA 2ZU3A 1RJXB 3SUFA 2FTLE 5HXFA 3VXFH 4ASHA 5GXPA 2QXIA 2STAE 1V2KT 5HM9A 3A7WA 4UFEH 3RXHA 1GDQA 1ELAA 3RXSA 1RTFB 3TH4H 2IOTA 1NS3A 3PO1C 1GJCB 1PPBH 1TNHA 2ZWLH 5AVDA 3C27B 3ZVEA 1FI8A 1E35B 1V2JT 1L4DA 1C5QA 3M7QA 3GOVB 1O2IA 1EOJA 1FONA 2FMJA 2FDAA 1P0SH 2ALPA 4NCYA 1ZTKA 1MAYA 2C93B 4K60A 3A8BA 1HAHH 4XDEA 2A4OA 3F9EA 4JYTA 1BT7A 1F0SA 2CV3A 3P70B 2Z9KA 3SOSA 4AFSA 2FOGA 1O3DA 1TPSA 4BAKB 2BLOA 1GJ9B 3O8CA 1VCQA 3GY7A 4OS7A 2W7UA 4X1PU 3RXLA 4ISNA 2BXTH 1UTMA 4ZXXH 1BMAA 2ULLA 2VIQA 4XSKU 1O3CA 2B7DH 4TY7A 1PPCE 2ZG0H 2R0KA 1D3QB 1XMNB 2AIQA 1O2VA 1FY5A 2ZA5A 1LVBA 2NU1E 1CGIE 1P9SA 1MBMA 1TNGA 5LPRA 2I6QA 4TWYA 1IQKA 4YLUA 5I25A 1A3BH 4O3UA 2BDIA 1PFXC 2K1QA 6ESTA 4HZHA 1MKXK 3ZZ9A 4Y8YA 3U9AH 1XUHA 1CGHA 2JH0D 1SGDE 2SGAA 3EYDA 4TPIZ 1TX7A 2FOCA 2DE9A 1J9CH 5JYIA 4ZROA 2C8ZB 3ELAH 1S0RA 4B75A 4OS4A 4O3TA 1V2VT 3KGPA 4NA7A 1G3DA 4I31A 1KXEA 4K1SA 1GHZA 1PYTD 2FOEA 4LZ1H 5TCAA 1ZRBA 2QN5T 2Z94A 3TVJB 2SNVA 4JYUH 4ZKSU 4NIVA 4I7YH 1GCTB 1GBLA 4XFQA 1G30B 4ZH8A 3M37A 1MTWA 1NRRH 2HGTH 2OD3B 3M5MA 5JBTA 1P2KA 3EA7A 1O5DH 1LMWB 3MMGA 4DURA 3UUZA 1TA6A 1ID5H 5LGOA 3ZZ8A 2F91A 2Y5FA 3NKKA 5EODA 3ZZ7A 2BMGB 2EI6A 1BTHH 1AZ8A 2FTMA 1UTKA 1AVGH 2V6NA 4CRFA 4X0WU 1K1MA 2RG3A 4OS1A 3T28A 1C5XB 3Q3XA 3A8DA 4ISHH 4KTCA 3D49H 4AYVB 1UK3A 3ZZAA 1ANCA 3M5OA 1WQSA 2GT8A 3SN8A 1O5BB 2PKAA 3S9BA 2TGPZ 4K1TA 2ZTZA 1GHWH 1W3CA 1QFKH 1AN1E 1XUIA 1GHBG 5EOKA 2V3OH 2ANYA 2P3FH 1UTOA 1Y3YA 2FYQA 2YOLA 3LPRA 3SJ9A 1UVSH 1BTUA 1VJAU 1BMMH 4A1VA 1H9HE 1KXDA 4AN7A 1KXBA 1K9OE 4ZHMU 2A0QB 2XCNA 1IQIA 2BY7X 3DUXH 2KAIA 2QC2A 2QXJA 4JK6A 7GCHG 1GVLA 2BVSH 2SNWA 2QF3A 2SGEE 1QY6A 1L1JA 1ELTA 1OWKA 2FZZA 1TBQH 4Y0ZE 1QL8A 3BTTE 1QB9A 1CHOG 4X2XA 1O5CB 3RXRA 3MNXA 1KSNA 1YPJH 1EZXC 3GCNA 3Q77A 1C1PA 2PUQH 4X6OA 4YOIA 3T25A 4CR9A 1WOFA 3I29A 3E3TA 3PYHA 4I8LA 2G5NA 1QA7A 2O8TA 3FFGA 4LXBH 3BV9B 4FU7A 2HNTC 1OP0A 1SC8U 4MPWA 1E0FD 3LDXH 4FVDA 4R8TB 1GHAG 2EEKA 3SV7A 6GCHF 3SI4H 2AFQB 3LH3A 1YLDA 2IJOB 2G4UA 4X1RU 1NU9A 4J1YA 2H9TH 2H1UA 1O2OA 3S69A 2OXSA 3DFLA 3HPTB 4KTUA 1DANH 4ABDA 1HGTH 3SU1A 1W0YH 3LH1A 4INHA 2PKSB 4NFFA 2VIPA 5F6MA 3B9FH 3FZZA 1ETRH 2BD5A 3ZZDA 1JRSA 4B2CA 1O33A 1ETTH 1P03A 1C4Y2 3VB7A 1EASA 4WMFA 2VWMA 2FI3E 1EB2A 3OSYA 1ZYOA 2FX4A 4X6MA 1BMNH 2G51A 1O34A 3UR6A 1BJVA 2RDLA 1DY9A 3EE0B 7LPRA 1C1VH 2GCTB 4CRDA 4GPGA 4O97A 1HPGA 1GWAA 4IW4E 5GIBA 1GBFA 1GJAB 1IQHA 1QHRB 2LNCA 3LC5A 3GCTG 1P10A 3TJVA 4YESB 2R2MB 1NRQH 2ZKSA 5T6DA 3SV6A 4XE4A 1D3PB 1EPTB 2QXGA 1DWCH 3GY3A 3SV9A 3BIUH 1C1QA 3P17H 2A7HA 1MAXA 4BNRA 3ZZBA 1H4WA 1U6QA 1T4UH 8GCHF 3GISB 1TMBH 2Z6BD 4JZ1A 3ZVBA 2ZGXH 3NPSA 2Z3DA 1QIXB 3DD2H 1ANBA 5FAHA 2OC0A 4DCDA 2ZCHP 1A0JA 2BQWB 3F68H 1GJ8B 4GLYA 3ZV8A 1ESTA 1RTKA 4CRGA 2XCFA 1LHGH 1V2NT 4FUEA 4ZHLU 1CBWC 1NFWA 5A0BA 1HRTH 1UCYK 3GDUA 1IOEA 1NT1A 3CS0A 3SI3H 3SQHE 3BTKE 1CA8B 1DVAH 1GI4A 1HIAA 5LPEA 1C5OH 3SU3A 3PWBA 1UVUH 4H42U 1O38A 2O8LA 1CHOF 1UO6A 1YC0A 2Y7XA 4YT6H 3NWUA 1GI0A 1YM0A 1DX5M 3P6ZB 2H9EH 1RRKA 3GCHC 1W12U 1ZZZA 2FYRA 1PPZA 5DKMA 3AAVA 1CGJE 3BTGE 3M3SA 1V2MT 1ANEA 1O2TA 1O2QA 4ISOA 5ETXA 2XXLA 4A7IB 5LH8A 1KDQB 2A32A 4ZKOU 2ZI2H 1GI3A 3F9HA 3KQCA 1HJ8A 1IQJA 1TQ7B 3L3TA 2ZHEH 4WH6A 2Y7ZA 1YCPH 2FOHA 1CA0C 1GBAA 2J9NA 1UVTH 2JETC 2ZU5A 1DPOA 1OP8A 1WCZA 1SLVB 4O9VA 3SUDA 4K5ZA 4WWYA 3K65B 2NU4E 1F5KU 1N1LA 2BY6X 5A8ZA 4AB8A 3GY5A 1IQEA 1BQYA 1CVWH 1MD8A 1PQ8A 4Q2KA 5C1YA 3U1JB 5A0AE 2PUXB 1BTPA 1CE5A 2ASUB 2OC8A 2O8WA 4DJZB 2B0FA 1ARCA 2FI5E 3M7TA 2D2DA 1NRSH 4JZDH 5HYOA 1MZAA 1FAXA 1C2HA 1C1MA 5C1UA 1TALA 1XXFA 3MNSA 5T6GA 1FUJA 2VIVA 3E0NB 4X1NU 1AB9C 1ZLRA 4AFQA 1GJ5H 1TOCB 1O2ZA 3QLPH 3BTWE 1OYTH 1WSSH 3G01A 1C5LH 1C5PA 4NA8A 3JZ1B 2OQUA 1Y5BT 1O3EA 3V13A 4THNH 5F8ZA 4YM9A 2SGQE 1TRNA 1PPGE 3SNEA 4VGCC 1F5LA 1Z8RA 3A7TA 1GJ4H 2VWNA 4CRBA 1OSSA 1NFXA 1PQ7A 4UONA 1FV9A 5J4SA 1HAXB 2VH6A 1O0DH 4JCNA 3TK5A 1D6RA 3E16B 1O3AA 4Q7ZA 1ZMNA 4Y6DA 1FPHH 1SR5C 3S0NA 3HKJB 3VB5A 2F9BH 5CHAC 2GKVE 3LU9B 3O8BA 1HXEH 3PM3A 1FIZA 1E34B 2J4IA 2ZPRA 4CR5A 1XVMA 1EAIA 2Z9LA 1F0RA 4HFPB 1NROH 3FP6E 5A09A 2BB4A 3UQOA 1EZUC 2Q6FA 3PLPA 1JXPA 3VEQB 1UVOA 1H9IE 5A2MH 3T5FH 4AGJA 4MNVA 5GJ4B 1ZSJA 4GCHG 1AU8A 3P95A 1VR1H 1GDUA 1F92A 1O2GH 2ZFTA 1N8OC 4OS5A 1CT4E 1B0EA 1C1SA 1OYQA 3MHWU 4DOQA 1OWIA 1MTVA 3PB1E 4WH8A 4I33A 1CO7E 3Q76A 2GV6A 3P8NA 4X1QU 1C1WH 1C5UA 2V35A 4B73A 4SGAE 5CE1A 3PWCA 1TMTH 3HK3B 1ESBA 4LK4A 3AASA 1LKBA 3ODFA 1P01A 1K1LA 1WYKA 3VB4A 1S0QA 2BLQA 2UWPA 1NRPH 1A3EH 3SV2H 1V2TT 1UCYE 4K3JA 3RXVA 1XKBC 3RU4E 4CHAB 5C5OA 3EGKH 4AG1A 1AE5A 1Y5UT 1LQDB 1V2QT 1N6XA 5L30H 1TBRH 3D62A 1P04A 1AWHB 3LJJA 5EPYA 1K22H 1TONA 2VH0A 1TX6A 1UJ1A 1BRAA 1K1NA 5E0JA 2ZU1A 4NIXA 2VGCC 2A4QA 1SSXA 5PTPA 1P11E 2FOAA 1DSTA 1FPCH 1GG6B 1SOZA 3SJ8A 1V2ST 3KCGH 3W95A 2PHBA 1TABE 3Q3YA 1UTQA 2QY0B 3S9CA 1LO6A 4BTIB 1DLKB 3M35A 3LGUA 3VFEA 3VGCC 1OKXA 1YP9A 3SQEE 3VXEH 3QGNB 4ZMAH 1MKWH 1AKSA 3MNCA 2VWLA 3ZYDA 1RXPA 3M61U 2WPIS 1EQ9A 2A7CA 1O2HA 3RXFA 3TNSA 4CBOA 1O3MA 3GCOA 3KNXA 2F9VA 1BRCE 1TGTA 2F83A 4CREA 4DGJA 1TMUH 2H5CA 2WYJA 5L2YH 3HATH 3E0PB 3A7YA 4NIYA 1C2DA 2G55A 1V2OT 1AVWA 3QUMP 1KTSB 2FLBH 4RKOB 5AHGH 3GICB 4INKA 2C8WB 1WUNH 4X2WA 3UNRA 5L6NH 2OCVB 2C90B 4ABIA 3LT3A 4CH8B 1TYNA 3UNSA 1SQTA 2A2QH 1ZTLA 1Y3XA 1SGNE 1A4WH 1HAGE 1B0FA 5JBAS 1OS8A 3MO3A 3A80A 1O3HA 3UTUH 5EGMA 1AHTH 2AGIX 1C4V2 2VU8E 2AS9A 5E2PA 1S6HA 1UK4A 3VB3A 4DIIH 1O3GA 4GAWA 1E36B 3FP7E 4I8KA 2J2UA 1B5GH 1BTYA 1GI1A 2CF9H 2V3HH 2NU2E 5AF9H 2CHAC 4CRAA 2QYIA 1C5NH 1YPMH 2Y82A 1INCA 2TPIZ 1G37A 1SLXB 3SGBE 3RXGA 5FBIA 3RDZA 4GCHF 1QNJA 1Z6JH 4B71A 4U32A 2CXVA 4A5TS 2J95A 4Y8ZA 2ZDKA 3E1XB 4ISIH 1D3TB 2TGDA 2FS8A 1HJAB 1DS2E 4YT7H 1Q2WA 2ZTXA 1WU1A 1ORFA 6GCHG 1RTLA 4ABBA 3BF6H 4CBNA 1EP6A 4DIHH 1QBNA 4MNWA 4AGKA 2WPMS 3A8CA 1J16A 3QZRA 2D8WA 1ZR0A 4MPUA 2A5KA 3ITIA 4ABEA 3M3TA 4LOYH 3MFJA 3KF2A 3MO6A 3HKIB 2C8YB 1SHYA 1MMJN 3OU0A 3PROA 2ZCLP 2FODA 2J94A 1W13U 4HTCH 1SGQE 1SHHB 2ZDVH 1SOTA 4NZQA 2AYWA 1W10U 4KKDA 2VB0A 2ZDAH 4XBDA 5F03A 1XUJA 1MCVA 2YNBA 1V3XA 4FUBA 1O5EH 3BTFE 5EQSA 3LGWA 3SNBA 3UR9A 1HDTH 3RC6A 1DY8A 2PKAB 3RU4T 1AI8H 1O3BA 5EQRA 1GBHA 2BDCA 4FUFA 2AIPA 1W0ZU 3ZVFA 3SZNA 2H6MA 2ZFQH 3OY5U 2F9OA 2TIOA 2P3TB 1TIOA 3AVZA 1IQFA 2B5TB 4Y8XA 1OX1A 5GCHF 3UREA 2OC1A 4AB9A 3E6PH 3A89A 1P2IA 3MU0A 1XUKA 2KAIB 5HGGA 1O2NA 1P05A 1AUTC 8GCHG 3U1IB 1DXPA 1HNEE 1AIXH 5FX6A 1ZPBA 1GHVH 3N7OA 1O2PA 1TPOA 3A7ZA 3ZV9A 1MTNB 3RLYH 3L6PA 1VGCB 4XOJA 1HAPH 2V0BA 2P8OB 2YNAA 4NGAH 3S7HB 1AGJA 1C5RA 4X2VA 5FCKA 1UTJA 2STBE 1C4U2 1ZSKA 3TLOA 2ZC9H 4YOJA 1NRNH 4RN6A 3IG6B 1S5SA 2Z3EA 1GJ6A 2Q6DA 3MOCA 1MD7A 1X7AC 1Y8TA 2VIOA 3RXDA 2RCEA 4UEHH 2FIRH 1QTFA 1CT2E 1BB0B 3ATLA 5J4QA 2VVUA 3MI4A 1K21H 3RM0H 1D3DB 1V2PT 4IC6A 1HYLA 1P2NA 2EI7A 1C5WB 1G2LA 2ILNA 2P16A 1O2SA 4K2YA 4FXGH 2FLRH 1PYTC 1VCPA 3P8GA 1THPB 4B74A 1RFNA 3T2NA 3EA9A 3RC4A 4Y0YE 3I77A 1BOQA 1NFYA 3LGTA 4B2BA 1QRWA 2PGBB 1ZTJA 3UQVA 5AFYH 2GMTC 4JZFH 1C2MA 2I6SA 1GI8B 4HI3A 3GYMA 3TITA 1QB6A 2Y80A 4Q7YA 2BX4A 1O5AB 2FPZA 3TJNA 1GJDB 1RIWB 1T8OA 2PSYA 1O3NA 4WJG2 5LPFA 1ZHPA 3KN2A 1TFXA 3SV8A 1XXDA 1VITF 3TK9A 1A46H 1DWDH 2F9UA 2FM2A 1F0TA 1TRMA 3V12A 4MNYA 1GJ7B 3KL6A 3O8RA 1YPHC 2Y81A 4I32A 3E8LA 4NWKA 5A8YA 5EXNA 5T3HA 2OBQA 3MU1A 2QF0A 5JDUB 3QZQA 4HGCA 5C1XA 4YO9A 3EQ0H 5DP6A 5K0HA 2GDDA 4X8VH 1O3LA 3F1SB 3A81A 4AYYB 4OGYA 5GDSH 1QBVH 3ZZ4A 1GVZA 4K8BA 4Y7BA 2ZDLA 1L2EA 2Y6TA 3QGJA 2WINI 5L2ZH 4QT8C 2J38A 2QCYA 2FEQH 2BDHA 3RMMH 1NM6A 1P2JA 1NU7B 1LVYA 2R9PA 3L33A 1OWJA 4AFZA 3BTDE 1HIAB 1S82A 1T32A 2HNTE 4A1XA 3AAUA 1CHGA 1MTSA 1Z8GA 1GI2A 5T6FA 1IQMA 1BUIA 1AFQB 1K1JA 2ZPQA 2B8OH 1W8BH 1AQ7A 1CU1A 3PLBA 2LPRA 1KY9A 4A6LA 2BDAA 1C2FA 1GGDB 1P8VC 1SG8B 4RSPA 5DP3A 4D9QA 1S83A 3BG4B 5C20A 1BTXA 1IQNA 1MKXH 3URCA 3RC5A 1BTWA 3ZZCA 1ZPCA 3H5CB 1M9UA 3RXTA 3UNQA 1EAUA 1HAYB 1ZPZA 1O2LA 1C1NA 3LJOA 1O2UA 5K7RA 5E0GA 5AFZH 2G4TA 4MTBA 3ZYEA 1FY1A 1TNIA 6CHAB 4YZUA 1P12E 2A5IA 1YPHE 1TLDA 1VZQH 1IQGA 1P06A 3RXAA 2F3CE 1GBIA 3A82A
chains in the Genus database with same CATH superfamily
5FX5A 3NCLA 2ANMH 4FVBA 3A8AA 2TRMA 1T7CA 2AH4X 2GZ8A 5JBCS 1TNKA 5BRRE 2PTCE 1C2GA 1C5VA 3SW2B 4ABJA 1NPMA 1UTLM 3SU5A 4DW2U 2ZHFH 1NC6A 3ZZ6A 4RKJB 2KFWA 3QDZB 1KIGH 1DICA 1V2LT 2F9NA 2GZ7A 1C5MD 3B8JA 2PR3A 3RU4D 4GHTA 3VPKA 2BYAX 3PO1B 4K1EA 3UOUA 1GCTC 1XUGA 2OINA 4TPYA 2XC5A 3LC3A 4TWWA 1F5RA 4YTAA 1IAUA 4B6FA 2QAAA 1GPZA 4AG2A 1ZOMA 3BIVH 2ZHQH 4UE7H 4DT4A 3O8DA 1G32B 4WVPE 3K6ZA 4H4FA 3OTJE 4UFDH 1RD3B 2D26C 5FXLA 4GHQA 1UVPA 3SUEA 8ESTE 4YXWD 1MTUA 3K9XB 2GD4B 1G2MA 3K6YA 4TY6A 1RGQA 4K8YA 1QRZA 1FMGA 1D6WA 3BTQE 3M7UA 2ZFFH 1BRBE 3Q00A 5CMXH 2ZU2A 4OGXA 2JJ2D 2ODPA 4TYDA 1YPGH 4XBBA 5JPMH 1BTZA 3MNBA 1SFQB 4IMQA 1LDTT 3GY8A 3STIA 1G9IE 3A84A 1TRYA 1MBQA 3A85A 3Q3KA 4Z0KA 1YPKH 2M5TA 2ZHDA 1KDQA 1WQVH 1G3CA 3BN9A 1LTOA 1LVOA 4ACBA 1C2EA 1P57B 4XRNA 2BDGA 1NBMD 2ANKH 2BD8A 2ZGBH 1FIWA 1K1IA 2A45B 2QIQA 5EG4A 4ABAA 4NSYA 5EJ1A 4Q80A 4MPXA 9LPRA 1BBRH 3F6UH 3SZEA 2EA3A 3FP8E 5DPAA 3DSGA 1C2IA 1FQ3A 3BTHE 1DOJA 1NFUA 1OOKB 1YY3A 1TB6H 2ZTYA 3HGPA 3LGIA 3OAAD 3OYPA 2QV1A 1AMHA 1W0KD 1HAIH 1QJ6B 4UFGH 3A88A 5EU8A 2WPKS 1DSUA 3E90B 1WBGB 3ZVGA 4ABGA 3TJUA 3MH7A 1L1GA 3ODDA 1HAVA 1FY8E 5IDKA 1AZZA 1O5GH 1FX0B 4MG3A 1SKYE 1BRUP 1EZSC 1S84A 5KEDA 1GMHF 2BOKA 2BVRH 4X8TH 4FETA 1K1OA 1FJSA 1MZDA 5HIZA 1GBDA 4AX9H 1THSH 1ARBA 2B9LA 1P3EA 2PKSC 4BANB 3RXJA 1W7XH 1G3BA 1GMDF 1ZRKA 2NU0E 1QQUA 4WY3A 2HPQH 1FLEE 1SPJA 1UHBA 3NZIA 4ZUHA 2ZGHA 1JWTA 3ATIA 2A5AA 3SYJA 3DSOA 1L0ZA 4XBCA 2WPLS 2Z3CA 5HM2A 5I46H 2HPPH 2GCTC 1AWFH 1WTGH 1C2KA 1WXRA 1LHCH 1AKSB 3DT0H 3IITA 1K2I1 2THFB 3RXEA 1TOMH 3MH6A 1GL1A 1PQ5A 2SGDE 2WV4A 1EPTC 2VWOA 3DSPA 4X8SH 5TCCA 1AVXA 1GBMA 2PLXA 3QK1A 3VB6A 1JIRA 1A0HB 1THRH 3OEED 5F8TA 3RM2H 1HUTH 1TAWA 1QCPA 2C4FH 2XBXA 1BA8B 2GZ9A 4DY7B 3RLWH 1EAXA 2WUBA 1UCYH 4Y76A 4D7FA 3A86A 1C1UH 3PMBB 1JOUB 5C3NA 4Y10E 3RXQA 2PFEA 1NTPA 3QWCH 3NK8A 1DUAA 1BJUA 3BG8A 1J15A 4KP0A 1AE8H 1BHXB 4FUDA 2R0LA 3NRLA 1T31A 2FOBA 1QQ4A 2AMDA 4TT3D 2BLWA 4BAOB 1V2UT 1QB1A 2OTVA 5GCHG 4M9FA 3TH3H 1SGFG 3KQ5A 2EQNA 3RXOA 1IHTH 1GI7B 3LGYA 1QJ7B 4AOQA 1HXFH 1KTTB 1Q31A 2L6OA 4MPVA 4CRCA 1COWD 2O8UA 1SLWB 2ZQ1A 3EDXB 1GVKB 1DM4B 2ZPSA 3HK6B 2BD9A 4YLQH 2PSXA 2J5UA 1ZGVA 1XVOA 3ZVCA 2PV9B 5IYTA 3R3GB 2GTBA 3DFJA 4NFEA 3R0FA 2ZO3H 4A92A 2FOFA 2OP9A 3T27A 1ABJH 3F0PA 1Y5AT 2ZFSA 5DP4A 1A61H 3URDA 1Y3UA 4INLA 1LPKB 5ESBA 2QXHA 3V3MA 2BQ6B 3MWIU 4H6SB 1OWHA 1DLEA 1UTPA 2WPDD 1YKTA 3BSQA 1MCTA 4RI0A 1GMCF 1CSOE 3BTEE 5FBEA 5GNDA 1OPHB 3UIRA 2ZCKP 3PLKA 2BDBA 3KIDU 4WF8A 3MYWA 3MH5A 1QBOA 1BDAA 1G36A 3WW7A 2W7SA 6LPRA 3FZDA 2Q6GA 1VITH 4FUHA 1D4PB 2FI4E 1K28D 5DGJA 1FN6A 5GPIB 1JMOH 2UWOA 4UD9H 4NIWA 2J97A 1RS0A 3B23B 4X6NA 2KCAA 2OUAA 1O3KA 1OWEA 2XWAA 4ZXYH 1D9IA 1T8NA 1TGNA 2VINA 4UDWH 2A4RA 3QO6A 1ESAA 2AGGX 1YGCH 3MQKC 3AW0A 2ZU4A 4IC5A 1W11U 1HCGA 1YYY1 3SHAH 3SU6A 4ZKNU 4P02A 1PJPA 1CBWB 1W14U 1GBCA 5ABWA 1O37A 2ANWA 2UUJB 1VITG 2G52A 3KQDA 2ZP0H 1ZMLA 3K2UA 4KELA 1YPLH 1AFEH 1KLTA 3WY8A 2ZECA 1VJ9U 1KLJH 1V6DA 5E2OA 1K1PA 1EP5A 4PROA 2UUYA 3FKSD 1P09A 4BXWA 2Q1JA 1AUJA 4E7NA 3QTVH 2GX4A 5DJ7A 5DP7A 2IPHA 4MDSA 4WXVA 4BAQB 1J14A 1C1OA 3T26A 2GDEH 1A0LA 4OS6A 2CJIA 1QGFA 1EB1H 3GCHB 3P92A 2A4GA 2P94A 1KXCA 3N99A 2F9PA 3S9AA 3CP7A 4OS2A 2M2AA 1K0HA 1O2XA 2BOHB 1E37B 1PPEE 1J17T 1HBTH 1TGCA 1TX8A 3FANA 4K69A 5C5NA 4D76A 2QE7D 1F0UA 3P8OA 3MO9A 4J2YB 3QN7A 4BTTB 5A0CA 4O03A 5B6LA 2R2WU 1CA0B 3P8FA 2UUFB 2JETB 1H9LB 1XM1A 4GUXA 1LHEH 4X1SU 1BITA 1HLTH 3GY4A 1AO5A 1EZQA 5HIYA 4WMEA 1QRXA 1A7SA 2P3UB 1ZSLA 1UTNA 1ELGA 1BIOA 3U8RH 5EXLA 3W1EA 1MU6B 3ATMA 1P2OA 2HRVA 1VCWA 2BM2A 2VVVA 1SVPA 5DP8A 4ABHA 5DP9A 3SGAE 2ZQ2A 1LVMA 1YCPK 1XUFA 2FWWA 4E06H 2ZNKH 5CDFE 1GHYH 2P59A 5EW1H 1OHHD 3DA9B 2VVCA 5FPYA 2BTCE 2AEIH 1YF4A 4Q7XA 5TJXA 1UK2A 3FAOA 2ZZUH 2CN0H 2F43B 3TU7H 4FUGA 1AB9B 3LOXA 4IBLH 4ACAA 3PMJA 1PPFE 3CS7A 5A8XA 1N6YA 2QGRA 2ZF0H 2Y5HA 3TNTA 2FO9A 4D7GA 5C67A 4CHAC 1DWEH 4AORA 1EKBB 1ZJDA 3EAJA 3PV4A 2D1JA 1Z1IA 4ZHAA 4Y11E 4IGDA 4BTUB 4VGCB 1HAZB 2ZHWH 3F2GA 3RMLH 3ZVDA 5G4BA 1WV7H 1HAOH 2ODYB 5EXMA 3VG8A 3TGJE 1JIMA 1IQLA 2BLVA 1GG6C 7ESTE 5KECA 5JBBS 5GWZA 1MU8B 4A1TA 3SO3A 4RT0A 3H7TA 1LQEA 2C3SA 5ESTE 2WPJS 3HGNA 3F9GA 2JH6D 2H5DA 1GI5A 5CHAB 1A5HA 4ZCNA 3UOPA 4DVAU 4WMDA 3GY6A 5DP5A 4U2WA 3T62A 4H6TA 1EOLA 1QL9A 3OY6U 2BY5X 3A7VA 1SB1H 1YLNA 3LGVA 3PTNA 4ZAEA 1H1BA 1CT0E 3SJKA 2RA0A 3EA8A 1C9TA 3SNCA 4CH2B 3LIWA 2H2ZA 1FXYA 2GCHG 1H8HD 4ABFA 2ESTE 1O3JA 2GV7A 1O2MA 1ELCA 2XBVA 2J92A 3PMAB 1EJMA 5KGOA 2OBOA 2O8MA 1BBRK 5EQQA 1BMLA 1TPPA 4NA9H 3CNRA 1SGFA 1S85A 1A2CH 1SGIB 1QR3E 1ACBE 1OWDA 3RXKA 1O5FH 5IK2D 2WV5A 1MQ6A 1WTHD 1GBBA 3SU0A 1N8OB 1QJ1B 1TGSZ 4B2AA 4I86A 5B6OA 3BEFB 3SNAA 4JK5A 1AD8H 3E91A 2R3UA 1EUFA 4D8NA 1XKAC 3PTBA 1KXAA 3UPEA 2A1DB 5FPSA 2ZFPH 1O3PB 4WXIA 3AK5A 1T4VH 3U8OH 1SQOA 3D65E 3F9FA 1J8AA 4LZ4B 3F2HA 4E7RG 1SI5H 3SUGA 1HJ9A 3KQBA 1F2SE 1ELEE 1GBEA 2UWLA 3UWIA 3QTOH 1FNIA 2VIDA 1P2QA 2ZDNA 1LPZB 1C2LA 4I8GA 1H8ED 3N7DA 5E8EH 5F53A 2BZAA 3DHKH 4IN2A 3ESTA 8KME2 2Z9GA 2OQ5A 3M5NA 3GY2A 3RMOH 3STJA 3RXCA 1EJAA 2HOBA 2VGCB 1ZJKA 3U69H 1TPAE 1ZGIA 1C1TA 1EJNA 1ANDA 1WAYB 2R3YA 1GI6A 3MU5A 4F4OC 1YBWA 4JZIA 3MU4A 3F2FA 1O3FA 3RMNH 1HJAC 3EE7A 2J34A 4ESTE 4SGBE 3VGCB 3SU4A 2DE8A 2IN2A 2Z7FE 1ZHMA 3KQEA 1GBKA 1A5GH 1GHBF 2XNIA 3BEIB 3TGKE 3UWJH 2NWNA 3I78A 1W2KH 1GMHG 1LHFH 2XWBI 1SGYE 4X2YA 5DN6D 1O2YA 1SL3A 2XBWA 5F8XA 3NXPA 3BTME 1AY6H 1EPTA 3AW1A 2Z9JA 2XC0A 7GCHF 2OLGA 2PGQB 1NN6A 1GMDG 1JRTA 1TNLA 1FN8A 3RP2A 1Z71A 5JB8S 4BAMB 1MKWK 2ZEBA 5HMAA 2BD3A 2BZ6H 2XYAA 5EIYA 3PRBA 2BX3A 4I8JA 1L1NA 3UFAA 4Z6AH 2AHME 1QURH 1EATA 1BZXE 1P2MA 1MABB 1E79D 1FAKH 1O30A 2W3IA 1C1RA 3BEUA 1O36A 3A87A 4B76A 2CGAA 1S6LA 1Y59T 1O39A 1KXFA 1EX3A 1ETSH 2K8IA 3LKWA 1GHAF 4ZKRU 1GDNA 1SGEE 3GDVA 1ZHRA 4B6EA 3LONA 2ODQA 4UFFH 2GCHF 3DCLA 3D23A 2CHAB 1LPGB 1OXGA 1O2RA 1FY4A 3UB0A 1H8IH 3TK6A 3ZVAA 3ZZ5A 4X8UH 9ESTA 1Y3VA 1LCYA 2FX6A 3M3VA 3NUMA 1DXWA 3KHVA 2HALA 2BY9X 1SGPE 2GP9B 1TE0A 4Y7AA 4MQAA 1H8DH 2P95A 4IS5A 2H9HA 5FCRA 1ELFA 1QL7A 2A7JA 1SGRE 2BD4A 3JZ2B 4BXSA 1C5ZB 3TH2H 1ZMJA 1MTNC 3W94A 1ABIH 1VGCC 2TGTA 2XC4A 1NESE 5C2ZA 1NO9H 1O31A 4FU8A 2P8OC 1DFPA 3IWMA 5HKKD 5DO4H 1GHXH 1O35A 1S6FA 2WUCA 3SJIA 4E05H 4DT7B 3RXIA 5SGAE 5DSFA 1SBWA 1SGCA 4MLFB 4NSVA 5FPTA 3RXPA 1SLUB 1Y3WA 4D9RA 2NU3E 4KGAA 1DDJA 2PW8H 4R0IA 2G5VA 5JB9S 2G81E 1C5TA 2FOMB 2CMYA 3RXBA 1DITH 1SMFE 1HAVB 2PWXA 2BQ7B 2YMSB 4FU9A 5DG6A 2AERH 2SGPE 1V2WT 3GCTF 1P9UA 3U98H 4MNXA 2FXRA 1BBRE 2QA9E 4FUCA 2BD2A 2ZGCA 2OC7A 3T29A 2BHGA 2UUKB 2A2XH 4IMZA 1S81A 1DUEA 1TGBA 2P93A 2KR7A 3SHCH 1XX9A 3A83A 1O2KA 1GCDA 1UHBB 2EI8A 2RA3A 3SJOA 1Z8IB 4AFUA 1SQAA 2WHXA 4Y79A 1BCUH 2XBYA 3MU8A 2JKHA 2XTTB 3V7TA 2AGEX 1ELDE 2HWLB 2HLCA 1SGTA 1FDPA 4NZLA 1GMCG 4I8HA 3U8TH 2GVFA 2SFAA 2VIWA 3WWBA 1B7XB 1T8LA 1RIWC 3A7XA 5BPEA 2G00A 1GJBB 2ZFRH 3RXMA 5C0TA 2VNTA 2ZIQH 4U01A 2BY8X 4JYVH 4IN1A 1PQAA 1UW7A 1E38B 2A31A 1HV7A 4M7GA 2BD7A 2SGFE 3UY9A 4Q63A 2FP7B 2XRCA 3OX7U 1HFDA 2FS9A 3M5LA 1P3CA 1TWXB 1UMAH 2ZGJA 3F3BA 2ALVA 3TJOA 1GBJA 2Z9IA 2QF5A 2HNTF 2XW9A 5EPNA 1BHXF 2W5EA 1TNJA 4FUIA 3ZZ3A 1C5SA 1MH0A 5DK1A 1DWBH 1LKAA 1PPHE 1ELVA 3KEEA 1OP2A 1Q3XA 3ATKA 1NZQH 2WPHS 1G3EA 1GI9B 4FUJA 3H7OA 1TA2A 1YLCA 3KYFA 4DG4A 3TGIE 4X6PA 1W7GH 3SU2A 5H4IB 2FESH 1KLIH 5E0HA 7KMEH 2O9QA 3V0XA 4JMYA 2BVXH 1C2JA 1ELBA 1GL0E 3GYLB 1MUEB 2EC9H 3TPIZ 3SBKA 5C0UA 2GT7A 4B1TA 1Z8JB 4MVNA 4Y71A 2TBSA 1V2RT 2PTNA 4YOGA 1TBZH 5FHTA 1O2JA 2JJ1D 1P02A 2JH5D 2C8XB 2VJ1A 1YCPM 4KTSA 1A1RA 2W26A 1C9PA 2J98A 4BAHB 2BDYA 3RXUA 2PP6A 3PMHB 4GSOA 1DT2A 3SGQE 1AFQC 4U30A 3TIUA 1O3OA 2WYGA 1C5YB 3ENSB 1GGDC 1MQ5A 3M36A 1L4ZA 4BOHA 1LHDH 2W3KA 2HVXA 3BG4C 4GVUA 1T8MA 1TQ0B 2CF8H 1O3IA 1F7ZA 1O2WA 2GMTB 1EXFA 4ISLA 4JZEH 2Y5GA 2ZDMA 1DE7H 3S7KB 2KX4A 2G8TA 3SNDA 1Z6EA 2HVYB 5EW2H 1O32A 1HB0B 1IHSH 1NY22 3ATWA 1YPEH 3MH4A 1A5IA 2AMPA 1JBUH 6CHAC 3FVFB 3GDSA 1Z7KA 4NG9H 4F49A 3SORA 2AMQA 1FZZA 2GGVB 1QA0A 1FY3A 4NWLA 1Z1JA 4AZ2B 3RUOA 2TGAA 3MTYA 3C1KA 3QX5H 2DUCA 1CQQA 1EAWA 1SFIA 2BXUH 1GBTA 2YMSD 3CENA 1KYNA 2EY4C 8LPRA 2ZU3A 1RJXB 5T1VA 3SUFA 2F4LA 2FTLE 5HXFA 3VXFH 4ASHA 5GXPA 2QXIA 2STAE 1V2KT 5HM9A 3A7WA 4UFEH 3RXHA 1GDQA 1ELAA 3RXSA 1RTFB 4F55A 3TH4H 2IOTA 1NS3A 3PO1C 1GJCB 1PPBH 1TNHA 2ZWLH 5AVDA 3C27B 3ZVEA 1FI8A 1E35B 1V2JT 1L4DA 1C5QA 3M7QA 3GOVB 1O2IA 1EOJA 1FONA 2FMJA 2FDAA 1P0SH 2ALPA 4NCYA 1ZTKA 1MAYA 2C93B 4K60A 3A8BA 1HAHH 4XDEA 2A4OA 3F9EA 4JYTA 1BT7A 1F0SA 2CV3A 3P70B 2Z9KA 3SOSA 4AFSA 2FOGA 1O3DA 1TPSA 4BAKB 2BLOA 1GJ9B 3O8CA 1VCQA 3GY7A 2V3MA 4OS7A 2W7UA 1YWUA 4X1PU 3RXLA 4ISNA 2BXTH 1UTMA 4ZXXH 1BMAA 2ULLA 2VIQA 4XSKU 1O3CA 2B7DH 4TY7A 1PPCE 2ZG0H 2R0KA 1D3QB 1XMNB 2AIQA 1O2VA 1FY5A 2ZA5A 1LVBA 2NU1E 1CGIE 1P9SA 1MBMA 1TNGA 5LPRA 2I6QA 4TWYA 1IQKA 4YLUA 5I25A 1A3BH 4O3UA 2BDIA 1PFXC 2K1QA 6ESTA 4HZHA 1MKXK 3ZZ9A 4Y8YA 3U9AH 1XUHA 1CGHA 2JH0D 1SGDE 2SGAA 3EYDA 4TPIZ 1TX7A 1E1QD 2FOCA 2DE9A 1J9CH 5JYIA 4ZROA 2C8ZB 3ELAH 1WDIA 1BMFD 1S0RA 4B75A 4OS4A 4O3TA 1V2VT 3KGPA 4NA7A 1G3DA 4I31A 3F0OA 1KXEA 4ASUD 4K1SA 1GHZA 1PYTD 2FOEA 4LZ1H 5TCAA 2KCOA 1ZRBA 2QN5T 2Z94A 3TVJB 2SNVA 4JYUH 4ZKSU 4NIVA 4I7YH 1GCTB 1GBLA 3U28C 4XFQA 1G30B 4ZH8A 3M37A 1MTWA 1NRRH 2HGTH 2OD3B 3M5MA 2V7QD 5JBTA 1P2KA 3EA7A 1O5DH 1LMWB 3MMGA 4DURA 2CK3D 1QZ8A 3UUZA 2RFKC 1TA6A 1ID5H 5LGOA 3OTPA 3ZZ8A 2F91A 2Y5FA 3NKKA 5EODA 3ZZ7A 2BMGB 2EI6A 1BTHH 1AZ8A 2FTMA 1UTKA 1AVGH 2V6NA 4CRFA 4X0WU 1K1MA 2RG3A 4OS1A 3T28A 1C5XB 3Q3XA 3A8DA 4ISHH 4KTCA 3D49H 4AYVB 1UK3A 3ZZAA 1ANCA 3M5OA 1WQSA 2GT8A 3SN8A 1O5BB 2PKAA 3S9BA 2TGPZ 4K1TA 2ZTZA 1GHWH 2W6ID 1W3CA 1QFKH 1AN1E 1XUIA 1GHBG 5EOKA 2V3OH 2ANYA 2P3FH 1UTOA 1Y3YA 2FYQA 2YOLA 3LPRA 3SJ9A 1UVSH 1BTUA 1VJAU 1BMMH 4A1VA 1H9HE 1KXDA 4AN7A 1KXBA 1K9OE 4ZHMU 2A0QB 2XCNA 1IQIA 2BY7X 3DUXH 2KAIA 2QC2A 2QXJA 4JK6A 7GCHG 1GVLA 2BVSH 2SNWA 2QF3A 2SGEE 1QY6A 1L1JA 1ELTA 1OWKA 2FZZA 1TBQH 4Y0ZE 1QL8A 3BTTE 1QB9A 1CHOG 4X2XA 1O5CB 3RXRA 2WSSD 3MNXA 1KSNA 1YPJH 1EZXC 3GCNA 3Q77A 1C1PA 2PUQH 4X6OA 4YOIA 3T25A 4CR9A 1WOFA 3I29A 3E3TA 3PYHA 4I8LA 2G5NA 1QA7A 2O8TA 3FFGA 4LXBH 3BV9B 4FU7A 2HNTC 1OP0A 1SC8U 4MPWA 1E0FD 3LDXH 4FVDA 4R8TB 1GHAG 2EEKA 3SV7A 6GCHF 3SI4H 2AFQB 3LH3A 1YLDA 2IJOB 2G4UA 4X1RU 1NU9A 4J1YA 2H9TH 2H1UA 1O2OA 3S69A 2OXSA 3DFLA 3HPTB 4KTUA 1DANH 4ABDA 1HGTH 3SU1A 1W0YH 3LH1A 2K0QA 4INHA 2PKSB 4NFFA 2VIPA 5F6MA 3B9FH 3FZZA 1ETRH 2BD5A 3ZZDA 1JRSA 4B2CA 1O33A 1ETTH 1P03A 1C4Y2 3VB7A 1EASA 4WMFA 2VWMA 2FI3E 1EB2A 3OSYA 1ZYOA 2FX4A 4X6MA 1BMNH 2G51A 1O34A 3UR6A 1BJVA 2RDLA 1DY9A 3EE0B 7LPRA 1C1VH 2GCTB 4CRDA 4GPGA 4O97A 1HPGA 1GWAA 4IW4E 3OE7D 5GIBA 4HG6A 1GBFA 1GJAB 1IQHA 1QHRB 2LNCA 3LC5A 3GCTG 1P10A 3TJVA 4YESB 2R2MB 1NRQH 2ZKSA 5T6DA 3SV6A 4XE4A 1D3PB 1EPTB 2QXGA 1DWCH 3GY3A 5CHBA 3SV9A 3BIUH 1C1QA 3P17H 2A7HA 1MAXA 4BNRA 3ZZBA 1H4WA 1U6QA 1T4UH 8GCHF 3GISB 1TMBH 2Z6BD 4JZ1A 3ZVBA 2ZGXH 3NPSA 2Z3DA 1E1RD 1QIXB 3DD2H 1ANBA 5FAHA 2OC0A 4DCDA 2ZCHP 1A0JA 2BQWB 3F68H 1GJ8B 4GLYA 3ZV8A 1ESTA 1RTKA 4CRGA 2XCFA 1LHGH 1V2NT 4FUEA 4ZHLU 1CBWC 1NFWA 5A0BA 1HRTH 1UCYK 3GDUA 1IOEA 1NT1A 3CS0A 3SI3H 3SQHE 3BTKE 1CA8B 1DVAH 1GI4A 4FOUC 1HIAA 5LPEA 1C5OH 3SU3A 3PWBA 1UVUH 4H42U 1O38A 2O8LA 1CHOF 1UO6A 1YC0A 2Y7XA 2L74A 4YT6H 3NWUA 1GI0A 1YM0A 1DX5M 3P6ZB 4F48B 2H9EH 1RRKA 3GCHC 1W12U 1ZZZA 2FYRA 1PPZA 5DKMA 3AAVA 1CGJE 3BTGE 3M3SA 1V2MT 1ANEA 1O2TA 1O2QA 4ISOA 5ETXA 2XXLA 4A7IB 5LH8A 1KDQB 2A32A 2KCPA 4ZKOU 2ZI2H 1GI3A 3F9HA 3KQCA 1HJ8A 1IQJA 1TQ7B 3L3TA 2ZHEH 2KZ4A 4WH6A 2Y7ZA 1YCPH 2FOHA 1CA0C 1GBAA 2J9NA 1UVTH 2JETC 2ZU5A 1DPOA 1OP8A 1WCZA 1SLVB 4O9VA 3SUDA 4K5ZA 4WWYA 3K65B 2NU4E 1F5KU 1N1LA 2BY6X 5A8ZA 4AB8A 3GY5A 5EJZA 1IQEA 1BQYA 1CVWH 1MD8A 1PQ8A 4Q2KA 5C1YA 3U1JB 5A0AE 2PUXB 1BTPA 1CE5A 2ASUB 2OC8A 2O8WA 4DJZB 2B0FA 1ARCA 2FI5E 3M7TA 2D2DA 1NRSH 4JZDH 5HYOA 1MZAA 1FAXA 1C2HA 1C1MA 5C1UA 1TALA 1VKYA 1XXFA 3MNSA 5T6GA 1FUJA 2GJGA 4P00A 5EJLA 2VIVA 3E0NB 4X1NU 1AB9C 1ZLRA 4AFQA 1GJ5H 1TOCB 1O2ZA 3QLPH 3BTWE 1OYTH 1WSSH 3G01A 1C5LH 3H09A 3UAIC 1C5PA 4NA8A 3JZ1B 2OQUA 1Y5BT 1O3EA 3V13A 4THNH 5F8ZA 2OK5A 4YM9A 2SGQE 1TRNA 1PPGE 3SNEA 4VGCC 1F5LA 1Z8RA 3A7TA 1GJ4H 2VWNA 4CRBA 1OSSA 1NFXA 1PQ7A 4UONA 1FV9A 5J4SA 1HAXB 2VH6A 1O0DH 4JCNA 2XNDD 3TK5A 1D6RA 2WZQA 3E16B 1O3AA 4Q7ZA 1ZMNA 4Y6DA 1FPHH 1SR5C 3S0NA 3HKJB 3VB5A 2F9BH 5CHAC 2GKVE 3LU9B 3O8BA 1HXEH 2KM0A 5C17A 3PM3A 1FIZA 1E34B 2J4IA 2ZPRA 4CR5A 1XVMA 1EAIA 2Z9LA 1F0RA 4HFPB 1NROH 3FP6E 3ZIAD 5A09A 2BB4A 3UQOA 1EZUC 2Q6FA 3PLPA 1JXPA 3FO8D 3VEQB 1UVOA 1H9IE 5A2MH 3T5FH 4AGJA 2J98B 4MNVA 5GJ4B 1ZSJA 4GCHG 1AU8A 3P95A 1VR1H 1GDUA 1F92A 1O2GH 2ZFTA 1N8OC 4OS5A 2JDID 1CT4E 2IJD1 1B0EA 1C1SA 1OYQA 3MHWU 4DOQA 1OWIA 1MTVA 3PB1E 4WH8A 4I33A 1CO7E 3Q76A 2GV6A 3P8NA 1KMHB 1C1WH 1C5UA 4X1QU 2V35A 4B73A 4SGAE 5CE1A 3PWCA 1TMTH 3HK3B 4TSFD 1ESBA 2W6JD 4LK4A 3AASA 1LKBA 3ODFA 1P01A 1K1LA 1WYKA 3VB4A 1S0QA 2BLQA 2UWPA 1NRPH 1A3EH 3SV2H 1V2TT 1UCYE 4K3JA 3RXVA 1XKBC 3RU4E 4CHAB 5C5OA 3EGKH 4AG1A 1AE5A 1Y5UT 1LQDB 1V2QT 1N6XA 5L30H 1TBRH 3D62A 1P04A 1AWHB 3LJJA 5EPYA 1K22H 1TONA 2VH0A 1TX6A 1UJ1A 1BRAA 1K1NA 5E0JA 2ZU1A 4NIXA 2VGCC 2A4QA 1SSXA 2RDEA 1P11E 2FOAA 3GS9A 5PTPA 1DSTA 1FPCH 1GG6B 1SOZA 3SJ8A 1V2ST 3KCGH 3W95A 2PHBA 1TABE 3Q3YA 4Q4LA 1UTQA 2QY0B 3S9CA 1LO6A 4BTIB 2JIZD 1DLKB 3M35A 3LGUA 3VFEA 3VGCC 1OKXA 1YP9A 3SQEE 3VXEH 3QGNB 4ZMAH 1MKWH 1AKSA 3MNCA 2VWLA 2HLDD 3ZYDA 1RXPA 3M61U 2WPIS 1EQ9A 2A7CA 1O2HA 3RXFA 3TNSA 4CBOA 1O3MA 3GCOA 3KNXA 2F9VA 1BRCE 1TGTA 2F83A 4CREA 4DGJA 1TMUH 2H5CA 2WYJA 5L2YH 2QF4A 3HATH 3E0PB 3A7YA 4NIYA 1C2DA 2G55A 1V2OT 1AVWA 3QUMP 1KTSB 2FLBH 4RKOB 5AHGH 3GICB 4INKA 2C8WB 4XD7D 1WUNH 4X2WA 3UNRA 5L6NH 2OCVB 2C90B 4ABIA 1NBME 3LT3A 4CH8B 1TYNA 3UNSA 1SQTA 2A2QH 1ZTLA 1Y3XA 1SGNE 1A4WH 1HAGE 1B0FA 5JBAS 1OS8A 3MO3A 3A80A 1O3HA 3UTUH 5EGMA 1AHTH 2AGIX 1C4V2 2VU8E 2AS9A 5E2PA 1S6HA 1UK4A 3VB3A 3OFND 4DIIH 1O3GA 4GAWA 1E36B 3FP7E 4I8KA 2J2UA 1B5GH 1BTYA 1GI1A 2CF9H 2V3HH 2NU2E 4Z1MD 5AF9H 2CHAC 4CRAA 2QYIA 1C5NH 1YPMH 2Y82A 1INCA 2TPIZ 1G37A 1SLXB 3SGBE 3RXGA 5FBIA 3RDZA 2VBCA 4GCHF 1QNJA 1Z6JH 4B71A 4U32A 2CXVA 4A5TS 2J95A 4Y8ZA 2ZDKA 3E1XB 4ISIH 1D3TB 2LELA 2TGDA 2FS8A 1HJAB 1DS2E 4YT7H 1Q2WA 2ZTXA 1WU1A 1ORFA 6GCHG 1RTLA 3FN8A 3N7EA 4ABBA 3OEHD 3BF6H 4CBNA 1EP6A 4DIHH 1QBNA 4MNWA 4AGKA 2WPMS 4OM9A 3A8CA 1J16A 3QZRA 2D8WA 1ZR0A 4MPUA 2A5KA 3ITIA 4ABEA 2YMSC 3M3TA 4LOYH 4RT1A 3MFJA 3KF2A 3MO6A 3HKIB 2C8YB 1SHYA 1MMJN 3OU0A 3PROA 2ZCLP 2FODA 2J94A 1W13U 4HTCH 1SGQE 1SHHB 2ZDVH 1SOTA 4NZQA 2AYWA 1W10U 4KKDA 2VB0A 2ZDAH 4XBDA 5C94A 5F03A 1XUJA 1MCVA 2YNBA 1V3XA 4FUBA 1O5EH 3BTFE 5EQSA 3LGWA 3SNBA 3UR9A 1HDTH 3RC6A 1DY8A 2PKAB 3RU4T 1AI8H 1EFRD 1O3BA 1W0JD 5EQRA 1GBHA 2WV9A 2BDCA 4FUFA 2AIPA 1W0ZU 3ZVFA 2XOKD 3SZNA 2H6MA 2ZFQH 5FL7D 3OY5U 2F9OA 2TIOA 2P3TB 1TIOA 3AVZA 1IQFA 2B5TB 4Y8XA 1OX1A 5GCHF 3UREA 2OC1A 4AB9A 3E6PH 3A89A 1P2IA 3MU0A 1XUKA 3PRDA 3PV5A 2KAIB 5HGGA 1O2NA 1P05A 1AUTC 8GCHG 3U1IB 1DXPA 3FOAA 1HNEE 1AIXH 5FX6A 1ZPBA 1SQRA 1GHVH 3N7OA 1O2PA 1TPOA 3A7ZA 3ZV9A 1MTNB 3RLYH 3L6PA 1VGCB 4XOJA 1HAPH 2V0BA 2P8OB 2YNAA 4NGAH 3S7HB 1AGJA 1C5RA 4X2VA 5FCKA 1UTJA 2STBE 1C4U2 1ZSKA 3TLOA 2ZC9H 4YOJA 1NRNH 4RN6A 3IG6B 1S5SA 2Z3EA 1GJ6A 2Q6DA 3MOCA 1MD7A 1X7AC 1Y8TA 2VIOA 3RXDA 2IPQX 2RCEA 4UEHH 2FIRH 1QTFA 1CT2E 1BB0B 3ATLA 5J4QA 2VVUA 3MI4A 1K21H 3RM0H 1D3DB 1V2PT 4IC6A 1HYLA 1P2NA 2EI7A 1C5WB 1G2LA 2ILNA 2P16A 1O2SA 4K2YA 4FXGH 2FLRH 1PYTC 1VCPA 3P8GA 1THPB 4B74A 1RFNA 3T2NA 3EA9A 3RC4A 4Y0YE 3I77A 1BOQA 1NFYA 3LGTA 4B2BA 1QRWA 2PGBB 1ZTJA 3UQVA 5AFYH 2GMTC 4JZFH 1C2MA 2I6SA 1GI8B 4HI3A 3GYMA 3TITA 1QB6A 2Y80A 4Q7YA 2BX4A 3WWFA 1O5AB 2FPZA 3TJNA 1GJDB 1RIWB 1T8OA 2PSYA 1O3NA 4WJG2 3PV2A 5LPFA 1ZHPA 3KN2A 1TFXA 3SV8A 1XXDA 1VITF 3TK9A 1A46H 1DWDH 2F9UA 2FM2A 1F0TA 1TRMA 3V12A 4MNYA 1GJ7B 3KL6A 3O8RA 1YPHC 2Y81A 4I32A 3E8LA 4NWKA 5A8YA 5EXNA 5T3HA 2OBQA 3MU1A 2QF0A 5JDUB 3QZQA 4HGCA 5C1XA 4YO9A 3EQ0H 5DP6A 5K0HA 2GDDA 4X8VH 1O3LA 3F1SB 3A81A 4AYYB 4OGYA 5GDSH 1QBVH 3ZZ4A 1GVZA 4K8BA 4Y7BA 2ZDLA 1L2EA 2Y6TA 3QGJA 2WINI 5L2ZH 4QT8C 2J38A 2QCYA 2FEQH 2BDHA 3RMMH 1NM6A 1P2JA 1NU7B 1LVYA 2R9PA 3L33A 1OWJA 4AFZA 3BTDE 1HIAB 1S82A 1T32A 2HNTE 4A1XA 3AAUA 1CHGA 1MTSA 1Z8GA 1GI2A 5T6FA 1IQMA 1BUIA 1AFQB 1K1JA 2ZPQA 2B8OH 1W8BH 1AQ7A 1CU1A 3PLBA 2LPRA 1KY9A 4A6LA 2BDAA 1C2FA 2LP6A 1GGDB 1P8VC 1SG8B 4RSPA 3KYGA 5DP3A 1S83A 4D9QA 3BG4B 5C20A 1BTXA 1IQNA 4AC9A 1MKXH 3URCA 3RC5A 1BTWA 3ZZCA 1ZPCA 3H5CB 1M9UA 3RXTA 3UNQA 1EAUA 1HAYB 1ZPZA 1O2LA 1C1NA 3LJOA 1O2UA 5K7RA 2KCYA 5E0GA 5AFZH 2G4TA 4MTBA 3ZYEA 1FY1A 1TNIA 6CHAB 4YZUA 1P12E 2A5IA 1YPHE 1TLDA 1VZQH 1IQGA 1P06A 3RXAA 2F3CE 1GBIA 3A82A
chains in the Genus database with same CATH topology
5FX5A 3NCLA 2ANMH 4FVBA 3A8AA 2TRMA 1T7CA 2AH4X 2GZ8A 5JBCS 1TNKA 5BRRE 2PTCE 1C2GA 1C5VA 3SW2B 4ABJA 1NPMA 1UTLM 3SU5A 4DW2U 2ZHFH 1NC6A 3ZZ6A 4RKJB 3QDZB 1KIGH 1DICA 1V2LT 2F9NA 2GZ7A 1C5MD 3B8JA 2PR3A 3RU4D 4GHTA 3VPKA 2BYAX 3PO1B 4K1EA 3UOUA 1GCTC 1XUGA 2OINA 4TPYA 2XC5A 3LC3A 4TWWA 1F5RA 4YTAA 1IAUA 2QAAA 1GPZA 4AG2A 1ZOMA 3BIVH 2ZHQH 4UE7H 3O8DA 1G32B 4WVPE 3K6ZA 4H4FA 3OTJE 4UFDH 1RD3B 2D26C 5FXLA 4GHQA 1UVPA 3SUEA 8ESTE 1MTUA 3K9XB 2GD4B 1G2MA 3K6YA 4TY6A 1RGQA 4K8YA 1QRZA 1FMGA 1D6WA 3BTQE 3M7UA 2ZFFH 1BRBE 3Q00A 5CMXH 2ZU2A 4OGXA 2ODPA 4TYDA 1YPGH 4XBBA 5JPMH 1BTZA 3MNBA 1SFQB 4IMQA 1LDTT 3GY8A 3STIA 1G9IE 3A84A 1TRYA 1MBQA 3A85A 3Q3KA 4Z0KA 1YPKH 2M5TA 2ZHDA 1KDQA 1WQVH 1G3CA 3BN9A 1LTOA 1LVOA 1C2EA 1P57B 2BDGA 2ANKH 2BD8A 2ZGBH 1FIWA 1K1IA 2A45B 2QIQA 5EG4A 4ABAA 4NSYA 4Q80A 4MPXA 9LPRA 1BBRH 3F6UH 2EA3A 3FP8E 5DPAA 1C2IA 1FQ3A 3BTHE 1DOJA 1NFUA 1OOKB 2ZTYA 1TB6H 3HGPA 3LGIA 3OYPA 2QV1A 1AMHA 1HAIH 1QJ6B 4UFGH 3A88A 5EU8A 2WPKS 1DSUA 3E90B 1WBGB 3ZVGA 4ABGA 3TJUA 3MH7A 1L1GA 3ODDA 1HAVA 1FY8E 5IDKA 1AZZA 1O5GH 4MG3A 1BRUP 1EZSC 1S84A 1GMHF 2BOKA 2BVRH 4X8TH 1K1OA 1FJSA 1MZDA 1GBDA 4AX9H 1THSH 1ARBA 2B9LA 1P3EA 2PKSC 4BANB 3RXJA 1W7XH 1G3BA 1GMDF 1ZRKA 2NU0E 1QQUA 4WY3A 2HPQH 1FLEE 1SPJA 1UHBA 3NZIA 4ZUHA 2ZGHA 1JWTA 3ATIA 2A5AA 1L0ZA 4XBCA 2WPLS 2Z3CA 5HM2A 5I46H 2HPPH 2GCTC 1AWFH 1WTGH 1C2KA 1LHCH 1AKSB 3DT0H 3IITA 1K2I1 2THFB 3RXEA 1TOMH 3MH6A 1GL1A 1PQ5A 2SGDE 2WV4A 1EPTC 2VWOA 4X8SH 5TCCA 1AVXA 1GBMA 2PLXA 3QK1A 3VB6A 1JIRA 1A0HB 1THRH 5F8TA 3RM2H 1HUTH 1TAWA 1QCPA 2C4FH 2XBXA 1BA8B 2GZ9A 4DY7B 3RLWH 1EAXA 2WUBA 1UCYH 4Y76A 4D7FA 3A86A 1C1UH 3PMBB 1JOUB 5C3NA 4Y10E 3RXQA 2PFEA 1NTPA 3QWCH 3NK8A 1DUAA 1BJUA 3BG8A 1J15A 4KP0A 1AE8H 1BHXB 4FUDA 2R0LA 1T31A 2FOBA 1QQ4A 2AMDA 4BAOB 2BLWA 1V2UT 1QB1A 2OTVA 5GCHG 3TH3H 1SGFG 3RXOA 1IHTH 1GI7B 3LGYA 1QJ7B 4AOQA 1HXFH 1KTTB 1Q31A 4MPVA 4CRCA 2O8UA 1SLWB 2ZQ1A 3EDXB 1GVKB 1DM4B 2ZPSA 3HK6B 2BD9A 4YLQH 2PSXA 1ZGVA 1XVOA 3ZVCA 2PV9B 5IYTA 3R3GB 2GTBA 3DFJA 4NFEA 3R0FA 2ZO3H 4A92A 2FOFA 2OP9A 3T27A 1ABJH 1Y5AT 2ZFSA 5DP4A 1A61H 3URDA 1Y3UA 4INLA 1LPKB 5ESBA 2QXHA 3V3MA 2BQ6B 3MWIU 4H6SB 1OWHA 1DLEA 1UTPA 1YKTA 3BSQA 1MCTA 1GMCF 1CSOE 3BTEE 5FBEA 1OPHB 3UIRA 2ZCKP 3PLKA 2BDBA 3KIDU 4WF8A 3MYWA 3MH5A 1QBOA 1BDAA 1G36A 2W7SA 6LPRA 3FZDA 2Q6GA 1VITH 4FUHA 1D4PB 2FI4E 1K28D 5DGJA 1FN6A 5GPIB 1JMOH 2UWOA 4UD9H 4NIWA 1RS0A 3B23B 4X6NA 2OUAA 1O3KA 1OWEA 2XWAA 4ZXYH 1D9IA 1T8NA 1TGNA 2VINA 4UDWH 2A4RA 3QO6A 1ESAA 2AGGX 1YGCH 3AW0A 2ZU4A 4IC5A 1W11U 1HCGA 1YYY1 3SHAH 3SU6A 4ZKNU 1PJPA 1CBWB 1W14U 1GBCA 5ABWA 1O37A 2ANWA 2UUJB 1VITG 2G52A 3KQDA 2ZP0H 1ZMLA 3K2UA 4KELA 1YPLH 1AFEH 1KLTA 3WY8A 2ZECA 1VJ9U 1KLJH 1V6DA 5E2OA 1K1PA 1EP5A 4PROA 2UUYA 1P09A 4BXWA 2Q1JA 1AUJA 4E7NA 3QTVH 2GX4A 5DJ7A 5DP7A 2IPHA 4MDSA 4WXVA 4BAQB 1J14A 1C1OA 3T26A 2GDEH 1A0LA 4OS6A 2CJIA 1QGFA 1EB1H 3GCHB 3P92A 2A4GA 2P94A 1KXCA 2F9PA 3S9AA 3CP7A 4OS2A 1O2XA 2BOHB 1E37B 1PPEE 1J17T 1HBTH 1TGCA 1TX8A 3FANA 4K69A 5C5NA 4D76A 1F0UA 3P8OA 3MO9A 4J2YB 3QN7A 4BTTB 5A0CA 4O03A 2R2WU 1CA0B 3P8FA 2UUFB 2JETB 1H9LB 1XM1A 4GUXA 1LHEH 4X1SU 1BITA 1HLTH 3GY4A 1AO5A 1EZQA 4WMEA 1QRXA 1A7SA 2P3UB 1ZSLA 1UTNA 1ELGA 1BIOA 3U8RH 5EXLA 1MU6B 3ATMA 1P2OA 2HRVA 1VCWA 2BM2A 2VVVA 1SVPA 5DP8A 4ABHA 5DP9A 3SGAE 2ZQ2A 1LVMA 1YCPK 1XUFA 2FWWA 4E06H 2ZNKH 1GHYH 2P59A 5EW1H 3DA9B 2VVCA 5FPYA 2BTCE 2AEIH 1YF4A 4Q7XA 5TJXA 1UK2A 3FAOA 2ZZUH 2CN0H 3TU7H 4FUGA 1AB9B 3LOXA 4IBLH 3PMJA 1PPFE 3CS7A 5A8XA 1N6YA 2QGRA 2ZF0H 2Y5HA 3TNTA 2FO9A 4D7GA 5C67A 4CHAC 1DWEH 4AORA 1EKBB 1ZJDA 3EAJA 3PV4A 2D1JA 1Z1IA 4ZHAA 4Y11E 4IGDA 4BTUB 4VGCB 1HAZB 2ZHWH 3RMLH 3ZVDA 5G4BA 1WV7H 1HAOH 2ODYB 5EXMA 3TGJE 1JIMA 1IQLA 2BLVA 1GG6C 7ESTE 5JBBS 5GWZA 1MU8B 4A1TA 3SO3A 3H7TA 1LQEA 2C3SA 5ESTE 2WPJS 3HGNA 3F9GA 2JH6D 2H5DA 1GI5A 5CHAB 1A5HA 3UOPA 4DVAU 4WMDA 3GY6A 5DP5A 4U2WA 3T62A 4H6TA 1EOLA 1QL9A 3OY6U 2BY5X 3A7VA 1SB1H 3LGVA 3PTNA 4ZAEA 1H1BA 1CT0E 3SJKA 2RA0A 3EA8A 1C9TA 3SNCA 4CH2B 3LIWA 2H2ZA 1FXYA 2GCHG 4ABFA 2ESTE 1O3JA 2GV7A 1O2MA 1ELCA 2XBVA 2J92A 3PMAB 1EJMA 2OBOA 2O8MA 1BBRK 5EQQA 1BMLA 1TPPA 4NA9H 1SGFA 1S85A 1A2CH 1SGIB 1QR3E 1ACBE 1OWDA 3RXKA 1O5FH 2WV5A 1MQ6A 1WTHD 1GBBA 3SU0A 1N8OB 1QJ1B 1TGSZ 4B2AA 5B6OA 3BEFB 3SNAA 4JK5A 1AD8H 3E91A 2R3UA 1EUFA 4D8NA 1XKAC 3PTBA 1KXAA 3UPEA 2A1DB 5FPSA 2ZFPH 1O3PB 4WXIA 1T4VH 3U8OH 1SQOA 3D65E 3F9FA 1J8AA 4LZ4B 4E7RG 1SI5H 3SUGA 1HJ9A 3KQBA 1F2SE 1ELEE 1GBEA 2UWLA 3UWIA 3QTOH 1FNIA 2VIDA 1P2QA 2ZDNA 1LPZB 1C2LA 4I8GA 5E8EH 2BZAA 3DHKH 4IN2A 3ESTA 8KME2 2Z9GA 2OQ5A 3M5NA 3GY2A 3RMOH 3STJA 3RXCA 1EJAA 2HOBA 2VGCB 1ZJKA 3U69H 1TPAE 1ZGIA 1C1TA 1EJNA 1ANDA 1WAYB 2R3YA 1GI6A 3MU5A 4F4OC 1YBWA 4JZIA 3MU4A 1O3FA 3RMNH 1HJAC 2J34A 4ESTE 4SGBE 3VGCB 3SU4A 2DE8A 2IN2A 2Z7FE 1ZHMA 3KQEA 1GBKA 1A5GH 1GHBF 2XNIA 3BEIB 3TGKE 3UWJH 2NWNA 3I78A 1W2KH 1GMHG 1LHFH 2XWBI 1SGYE 4X2YA 1O2YA 1SL3A 2XBWA 5F8XA 3NXPA 3BTME 1AY6H 1EPTA 3AW1A 2Z9JA 2XC0A 7GCHF 2OLGA 2PGQB 1NN6A 1GMDG 1JRTA 1TNLA 1FN8A 3RP2A 1Z71A 5JB8S 4BAMB 1MKWK 2ZEBA 5HMAA 2BD3A 2BZ6H 2XYAA 2BX3A 4I8JA 1L1NA 3UFAA 4Z6AH 1QURH 1EATA 1BZXE 1P2MA 1FAKH 1O30A 2W3IA 1C1RA 3BEUA 1O36A 3A87A 4B76A 2CGAA 1Y59T 1O39A 1KXFA 1EX3A 1ETSH 3LKWA 1GHAF 4ZKRU 1GDNA 1SGEE 3GDVA 1ZHRA 3LONA 2ODQA 4UFFH 2GCHF 3D23A 2CHAB 1LPGB 1OXGA 1O2RA 1FY4A 3ZVAA 1H8IH 3TK6A 3ZZ5A 4X8UH 9ESTA 1Y3VA 1LCYA 2FX6A 3M3VA 3NUMA 1DXWA 3KHVA 2HALA 2BY9X 1SGPE 2GP9B 1TE0A 4Y7AA 4MQAA 1H8DH 2P95A 4IS5A 2H9HA 5FCRA 1ELFA 1QL7A 2A7JA 1SGRE 2BD4A 3JZ2B 4BXSA 1C5ZB 3TH2H 1ZMJA 1MTNC 3W94A 1ABIH 1VGCC 2TGTA 2XC4A 1NESE 5C2ZA 1NO9H 1O31A 4FU8A 2P8OC 1DFPA 3IWMA 5DO4H 1GHXH 1O35A 1S6FA 2WUCA 3SJIA 4E05H 4DT7B 3RXIA 5SGAE 1SBWA 1SGCA 4MLFB 4NSVA 5FPTA 3RXPA 1SLUB 1Y3WA 4D9RA 2NU3E 4KGAA 1DDJA 2PW8H 4R0IA 2G5VA 5JB9S 2G81E 1C5TA 2FOMB 2CMYA 3RXBA 1DITH 1SMFE 1HAVB 2PWXA 2BQ7B 4FU9A 5DG6A 2AERH 2SGPE 1V2WT 3GCTF 1P9UA 3U98H 4MNXA 2FXRA 1BBRE 2QA9E 4FUCA 2BD2A 2ZGCA 2OC7A 3T29A 2BHGA 2UUKB 2A2XH 4IMZA 1S81A 1DUEA 1TGBA 2P93A 3SHCH 1XX9A 3A83A 1O2KA 1GCDA 1UHBB 2EI8A 2RA3A 3SJOA 1Z8IB 4AFUA 1SQAA 4Y79A 1BCUH 2XBYA 3MU8A 2JKHA 2XTTB 3V7TA 2AGEX 1ELDE 2HWLB 2HLCA 1SGTA 1FDPA 4NZLA 1GMCG 4I8HA 3U8TH 2GVFA 2SFAA 2VIWA 1B7XB 1T8LA 1RIWC 3A7XA 5BPEA 2G00A 1GJBB 2ZFRH 3RXMA 2VNTA 2ZIQH 4U01A 2BY8X 4JYVH 4IN1A 1PQAA 1E38B 2A31A 1HV7A 4M7GA 2BD7A 2SGFE 3UY9A 2FP7B 2XRCA 3OX7U 1HFDA 2FS9A 3M5LA 1P3CA 1TWXB 1UMAH 2ZGJA 2ALVA 3TJOA 1GBJA 2Z9IA 2HNTF 2XW9A 5EPNA 1BHXF 2W5EA 1TNJA 4FUIA 3ZZ3A 1C5SA 1MH0A 5DK1A 1DWBH 1LKAA 1PPHE 1ELVA 3KEEA 1OP2A 1Q3XA 3ATKA 1NZQH 2WPHS 1G3EA 1GI9B 4FUJA 3H7OA 1TA2A 1YLCA 4DG4A 3TGIE 4X6PA 1W7GH 3SU2A 5H4IB 2FESH 1KLIH 5E0HA 7KMEH 2O9QA 3V0XA 4JMYA 2BVXH 1C2JA 1ELBA 1GL0E 3GYLB 1MUEB 2EC9H 3TPIZ 3SBKA 2GT7A 4B1TA 1Z8JB 4MVNA 4Y71A 2TBSA 1V2RT 2PTNA 4YOGA 1TBZH 5FHTA 1O2JA 1P02A 2JH5D 2C8XB 2VJ1A 1YCPM 4KTSA 1A1RA 2W26A 1C9PA 4BAHB 2BDYA 3RXUA 3PMHB 4GSOA 1DT2A 3SGQE 1AFQC 4U30A 3TIUA 1O3OA 2WYGA 1C5YB 3ENSB 1GGDC 1MQ5A 3M36A 1L4ZA 4BOHA 1LHDH 2W3KA 2HVXA 3BG4C 4GVUA 1T8MA 1TQ0B 2CF8H 1O3IA 1F7ZA 1O2WA 2GMTB 1EXFA 4ISLA 4JZEH 2Y5GA 2ZDMA 1DE7H 3S7KB 3SNDA 2G8TA 1Z6EA 5EW2H 1O32A 1HB0B 1IHSH 1NY22 3ATWA 1YPEH 3MH4A 1A5IA 2AMPA 1JBUH 6CHAC 3FVFB 3GDSA 1Z7KA 4NG9H 4F49A 3SORA 2AMQA 1FZZA 2GGVB 1QA0A 1FY3A 4NWLA 1Z1JA 4AZ2B 3RUOA 2TGAA 3MTYA 3C1KA 3QX5H 2DUCA 1CQQA 1EAWA 1SFIA 2BXUH 1GBTA 3CENA 1KYNA 8LPRA 2ZU3A 1RJXB 3SUFA 2FTLE 5HXFA 3VXFH 4ASHA 5GXPA 2QXIA 2STAE 1V2KT 5HM9A 3A7WA 4UFEH 3RXHA 1GDQA 1ELAA 3RXSA 1RTFB 3TH4H 2IOTA 1NS3A 3PO1C 1GJCB 1PPBH 1TNHA 2ZWLH 5AVDA 3C27B 3ZVEA 1FI8A 1E35B 1V2JT 1L4DA 1C5QA 3M7QA 3GOVB 1O2IA 1EOJA 1FONA 2FMJA 2FDAA 1P0SH 2ALPA 4NCYA 1ZTKA 1MAYA 2C93B 4K60A 3A8BA 1HAHH 4XDEA 2A4OA 3F9EA 4JYTA 1BT7A 1F0SA 2CV3A 3P70B 2Z9KA 3SOSA 4AFSA 2FOGA 1O3DA 1TPSA 4BAKB 2BLOA 1GJ9B 3O8CA 1VCQA 3GY7A 4OS7A 2W7UA 4X1PU 3RXLA 4ISNA