4AGJA

Crystal structure of the capsid protein (110-267) from aura virus in complex with dioxane
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
152
structure length
152
Chain Sequence
DRTFAVKNEDGKIMGYAVAMEGKVIKPLHVKGTIDHPALAKLKFTKSSSYDMEFAKLPTEMKSDAFGYTTEHPEGFYNWHHGAVQFSGGRFTIPTGAGGPGDSGRPILDDSGKVVAIVLGGANEGARTALSVVTWNKKGAAIKTTHEDTVEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CAPSID PROTEIN
publication title Crystal Structure of Aura Virus Capsid Protease and its Complex with Dioxane: New Insights Into Capsid-Glycoprotein Molecular Contacts.
pubmed doi rcsb
source organism Aura virus
total genus 30
structure length 152
sequence length 152
ec nomenclature ec 3.4.21.90: Togavirin.
pdb deposition date 2012-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4agjA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4agjA01
1L4ZA 1XUKA 3E3TA 1LPZB 2A5KA 1Y8TA 3OY6U 4D8NA 4E7RG 1GCTB 1NFYA 4D7FA 1P03A 2A7JA 3BG4C 2PW8H 2ZQ1A 1D6WA 1BRAA 1TPOA 1N8OB 3L6PA 2ZGXH 4XOJA 3CS7A 4KTUA 2ZDLA 2G5VA 4DY7B 2TGDA 1GMDF 3ESTA 5F8TA 5C1UA 2STBE 4YT6H 1YCPM 1GHXH 2XXLA 2B9LA 4A92A 5EOKA 2WV5A 1YC0A 3SI4H 3A8BA 4KKDA 3ATIA 4DGJA 3SJOA 2C90B 4AFUA 1HAZB 1O32A 1HXFH 3SGQE 1D3QB 3MNXA 3NPSA 2BVSH 4Y0ZE 1SPJA 1TAWA 5C1XA 2A0QB 2ZTYA 2D26C 2GP9B 4X2VA 1G3EA 2Y82A 1JWTA 1QB1A 2VWNA 1PPGE 1HBTH 3D65E 4Y0YE 2A4QA 1RIWC 3KIDU 4D9QA 3H7TA 2THFB 1DWDH 3SU0A 1SMFE 1NC6A 2XTTB 2ZGCA 3P92A 3IITA 3M7QA 2QF3A 2PWXA 4BAOB 2OP9A 4FUHA 3UREA 2FP7B 1O5DH 4JK5A 1MMJN 1ELVA 3E90B 1GHAF 4DOQA 3URCA 2QY0B 3PWBA 4XBDA 2ZU4A 4THNH 2NU2E 1BRCE 4GHTA 1TONA 4IN1A 1O2IA 2BQWB 1GHAG 1O2KA 1QURH 3LGTA 1MTUA 1DY8A 2J94A 2UUKB 1GL0E 4DJZB 3KNXA 1LHEH 3ZZ6A 4ISHH 4IS5A 1FN6A 2G00A 5L2ZH 1TOCB 3FZZA 2V0BA 1SGCA 3TPIZ 5JYIA 4ABGA 4ZUHA 1SQAA 2G55A 2FI3E 1EZUC 3RXCA 3SNEA 1HAOH 4X8SH 1XMNB 2Y5FA 1LCYA 1EQ9A 1O2YA 3BEIB 1GDQA 3BEFB 1G37A 1WQVH 3LH1A 3TIUA 1YPLH 2VIWA 5CE1A 5SGAE 3RXBA 3GY8A 1MTWA 2OQUA 2W26A 4OS7A 1YKTA 2PKAA 1TYNA 2VGCC 2FTLE 3SNDA 3ZZ5A 3NCLA 1QHRB 4I33A 1ZJDA 2A45B 1O3FA 3RXIA 2VVCA 4INKA 4IN2A 3SU6A 3QWCH 4DIHH 1DX5M 1Z8JB 1C5SA 1GJCB 5DPAA 5FX6A 2ESTE 1CVWH 2OC0A 8ESTE 2FOAA 1S6HA 3OSYA 1GHBF 1LVOA 3EA9A 1ZHPA 1VR1H 3BV9B 2AEIH 2OC8A 4KGAA 5JPMH 4K2YA 5CMXH 1GHBG 1KSNA 1TGBA 3GY3A 3QO6A 2QYIA 3AVZA 3KQEA 4TYDA 2ZIQH 2V35A 3GY5A 3RMLH 1DT2A 4AX9H 2FWWA 5HGGA 4CHAC 1KTTB 2K1QA 2Z7FE 4MNVA 1C5WB 2FM2A 3SV7A 3L3TA 2PSYA 4GPGA 1B7XB 3KQDA 4GAWA 2F9BH 2VU8E 3BTWE 3A82A 1FQ3A 4WJG2 6GCHF 1GI6A 1QQ4A 1W7XH 1QA7A 4MTBA 1QRXA 3PYHA 1KLJH 1SQTA 2RA3A 1BCUH 1F7ZA 3HKIB 3GY7A 2BZAA 4U32A 1RJXB 4NIVA 2ALVA 2JH6D 1HDTH 1E36B 5JDUB 1G2MA 3FP6E 2BD9A 3LC5A 1WTHD 4FUFA 2VINA 3CP7A 3ZV9A 2ZF0H 1HUTH 1C9PA 3RM2H 4B71A 1BMNH 2TPIZ 3QTOH 4Y79A 1HAVB 4WH8A 1UMAH 1N1LA 1SGDE 2FS9A 5L30H 1GCDA 1TB6H 3GCNA 4NA8A 1C1OA 4MLFB 4UFDH 2ZFQH 5FPTA 2XCNA 3F68H 3V12A 2H9EH 4MDSA 3P8GA 4H6SB 2Y5HA 3GY4A 3LGYA 1YYY1 1EZSC 1XUGA 1D3DB 2FPZA 2ANWA 2P3TB 4CBOA 2O8UA 1PPCE 1K1LA 5LH8A 1SGRE 1O3JA 1TGNA 4DW2U 1ZHMA 5G4BA 3MU0A 4K1TA 1NN6A 4B2AA 1C5UA 4A5TS 1DFPA 1FIWA 3UOPA 2IOTA 1EUFA 1UTQA 1FPHH 4VGCB 1CGHA 2PUXB 5DK1A 3SQHE 3W95A 4WMEA 3E0PB 2XBYA 5F8XA 1GI4A 2RDLA 3UNSA 5I46H 2XC5A 4O9VA 1MD7A 2Q1JA 1LPKB 1LQDB 3JZ1B 2VIPA 3PTNA 1UTLM 4OGXA 5K7RA 5FX5A 1FONA 1RXPA 3BN9A 2ODYB 4Y71A 2OUAA 3A81A 4DVAU 1MCVA 1OXGA 3R0FA 1AVWA 1C2HA 1UVTH 1P2JA 3SGBE 4TWWA 3PM3A 4GSOA 1DWBH 1QQUA 1GJ9B 3M5LA 1SB1H 1V6DA 1JXPA 1W7GH 4IGDA 4JYUH 3EQ0H 3VEQB 1SFQB 1EPTB 1K1JA 5EGMA 3SV8A 1UJ1A 1O3IA 1DM4B 1NRNH 5JBAS 1SBWA 1K9OE 2ZPQA 1VZQH 3RXEA 1KDQB 5EQRA 1F2SE 1C2LA 1FMGA 1TNGA 2A4GA 4BXSA 1C5LH 3VB6A 3UIRA 3LGWA 1U6QA 2WPJS 2DE9A 5F03A 2BDCA 4X6OA 1TBQH 1O3OA 2OXSA 4DURA 1GBHA 1DSTA 3RC6A 3HATH 2BDGA 1V2WT 2G5NA 2QIQA 1EJAA 3E16B 5H4IB 3QDZB 3AAVA 2GCHF 2Q6GA 1VJ9U 1DE7H 4A1TA 2OBQA 3DD2H 1TBZH 1ZLRA 1BDAA 2M5TA 4GUXA 1C4U2 1QJ6B 2GZ8A 1TLDA 3M37A 2GCHG 1BBRH 3I29A 3TGIE 3PO1B 6LPRA 1GPZA 4MPWA 1PPZA 4ABHA 1GHYH 1VCPA 1DXWA 2P93A 5C2ZA 3ZZDA 5LPEA 3KQBA 1F0TA 4WVPE 1ZJKA 4NA9H 4UE7H 3LJJA 1YCPK 2CV3A 5LGOA 1P2KA 2OC7A 2XWBI 3F9FA 1VITF 3SUGA 5A0AE 3P8NA 1MU8B 2Z9IA 4D7GA 4AFSA 2PKSB 3UFAA 2AGIX 1AB9C 1AZ8A 1UTJA 3SJKA 1O30A 2R2WU 1CBWB 1OWKA 2HVXA 1J8AA 1OPHB 1HAIH 4AYVB 1ID5H 3BTDE 4AGKA 1SLUB 4NWKA 4ABDA 1O3NA 4YLQH 4X1PU 4D76A 4JZ1A 1ZYOA 1QL9A 5L6NH 1V2UT 2GV7A 2ZHDA 4Y8XA 1VCQA 4I7YH 1EOLA 3DHKH 3BTHE 4ABJA 2ZPRA 1LMWB 2NU0E 8KME2 2FI5E 2GTBA 5TCCA 1YPEH 1IAUA 1ZGVA 2BQ7B 2LNCA 4NWLA 5E0HA 1TQ7B 1CSOE 1TRYA 3S9AA 1SI5H 2GKVE 1TX8A 1CA8B 1QBNA 4B73A 5CHAB 3O8RA 5C67A 4I8KA 2ZDAH 4AZ2B 2BDBA 1FAKH 1PJPA 1QTFA 3TU7H 2PTCE 1C5PA 3PO1C 5DP7A 1HNEE 1GMHF 1P3CA 4K1EA 1L1JA 1C5RA 1E37B 2FMJA 2ZI2H 1F5RA 1GMHG 3M5NA 4K1SA 3PMJA 2FIRH 3MHWU 1P01A 3EA7A 1GBEA 3T2NA 2IJOB 2Y7XA 3A83A 1UCYH 2AMPA 4OS1A 1BHXF 1K22H 3RP2A 1JBUH 1IQMA 1FLEE 2BDHA 3A87A 1AE8H 1GBCA 3PROA 1RFNA 1G2LA 1AFEH 1GJ8B 1CA0C 1CBWC 6ESTA 2ZDVH 1GBIA 4JZFH 4ZH8A 3UPEA 3RXKA 1P04A 3U98H 3QZRA 4H42U 5FPYA 6CHAC 2PLXA 3SZNA 2D8WA 2HALA 3O8CA 4XE4A 3PLKA 3A7XA 3SHCH 1O34A 3LGUA 3TITA 4JZIA 1T8LA 5JB8S 1QIXB 1LO6A 4YT7H 1E34B 2BLQA 5AVDA 1UK3A 3H7OA 3B23B 3OTJE 3MYWA 4DG4A 3TGJE 2R0KA 3KF2A 2BM2A 2HNTE 2P95A 4HFPB 3M35A 2ZHEH 1WOFA 3ZV8A 2D1JA 5C5NA 3SQEE 1AD8H 4IBLH 2PHBA 3UQOA 2VH0A 3ZZCA 2FZZA 5EQSA 1TX6A 1JIMA 3URDA 4ZAEA 3SBKA 2OCVB 2SGAA 1ZSLA 3ZYDA 3ZZ8A 1SGQE 1A3BH 4CRFA 4OS4A 3A7VA 3NXPA 2CHAC 5FXLA 4XFQA 1LHFH 2J95A 5JBCS 1WYKA 2CXVA 1XVOA 1BA8B 1OYQA 1YGCH 3A7TA 2A2QH 3S9BA 1SGNE 4LZ1H 1GMCF 3UTUH 1YLDA 1C1TA 4LK4A 1DXPA 5A0CA 2W7UA 3RXPA 3VB4A 4ZMAH 1GMCG 1AFQB 1IHTH 2FLRH 1AIXH 3BTEE 1C5VA 4Z6AH 2BX3A 3F9HA 2ILNA 3EGKH 2B7DH 2GX4A 1C1VH 1K2I1 2XW9A 1CGJE 1SLWB 3GDSA 1Z71A 5EPYA 2BD5A 1RTLA 1NU9A 2QXGA 2GVFA 1O2SA 3A8AA 1GI2A 5DJ7A 4TPIZ 3ITIA 2B0FA 3RXRA 2O8TA 4MVNA 1TNHA 1AN1E 5T6DA 4K60A 2PSXA 5FCKA 1VGCC 2GMTB 1LVYA 3ZZAA 1GL1A 1O5CB 1Y5UT 3RLWH 3U1IB 2H6MA 1HIAB 1FI8A 2F9UA 3SU5A 3BG8A 1ORFA 1W3CA 4FUGA 1MAYA 2ZP0H 2PGQB 1AKSB 1SLXB 3HK6B 2WPIS 2ZU1A 2GT7A 2VWLA 2PUQH 2ZGJA 3GICB 2P59A 1GMDG 2FOGA 1T4VH 2EEKA 4XSKU 3MMGA 3K9XB 3FZDA 3P70B 3U8TH 4X1QU 3ODFA 1OP2A 3T62A 2VNTA 3VXFH 1V3XA 5FAHA 3VB3A 4KP0A 1O0DH 3QX5H 1IQKA 1UVPA 2C8XB 3STIA 1L0ZA 4I8LA 8LPRA 4BAQB 2YNAA 1SGTA 1THPB 2H9HA 1O38A 5L2YH 1CGIE 2ZGHA 3I78A 1C5OH 1ZPBA 1Y59T 4MG3A 3A7YA 3RU4D 1ANEA 1F0SA 2JKHA 4K8YA 2QXHA 4FUDA 3T29A 1ZTLA 5DP5A 1O35A 1A0HB 2VWMA 2PR3A 2FDAA 4AFQA 2ZFFH 1SGFG 1GHZA 5HM2A 3SOSA 1MBQA 1GVLA 1C2GA 2TBSA 2A31A 2A7HA 1YP9A 1O3CA 2H9TH 2SGEE 3ZVAA 1UTMA 2I6QA 4FVBA 2VVVA 4X2XA 2HOBA 1ZTJA 1C2JA 4YOIA 5PTPA 4SGAE 1O33A 1GCTC 3QK1A 1NT1A 1ZZZA 3DA9B 1GI7B 1E0FD 3K65B 2GMTC 4X1SU 3V13A 1G3DA 1SGPE 2A1DB 1N8OC 2EI7A 1K21H 3KQCA 2KAIB 1DPOA 1QRZA 1C2MA 3ZZBA 4CRGA 1YPHE 1KXDA 1C2KA 1UHBB 1A5GH 1O3PB 2AGGX 2Y7ZA 1FJSA 2XBXA 2FEQH 4AG1A 3HGPA 1K28D 1AY6H 1GBTA 1O2UA 2D2DA 4UD9H 1ELFA 5A8XA 1PQ8A 3MFJA 2O8LA 4SGBE 1CT4E 2OQ5A 3JZ2B 2GZ7A 2NWNA 2G52A 2QGRA 1TGTA 2VIOA 4B2CA 2HRVA 3RC4A 3SNBA 1MZAA 2XBWA 1BUIA 3RXLA 2F9VA 4NFFA 1NS3A 2BYAX 4X6PA 3A89A 1ETSH 4BTTB 1A0LA 1GG6B 2J34A 3KGPA 3IG6B 1TWXB 2RCEA 1BRUP 4WMFA 1P05A 1O3LA 2BTCE 3BTQE 3VB5A 1BTPA 3F1SB 1G32B 1WAYB 1GBDA 3A84A 3PMBB 2ZPSA 5FCRA 4KTSA 1ZTKA 1V2OT 1Q3XA 1Y5BT 1P9SA 1OWIA 2Y5GA 1QCPA 1Z8RA 3FANA 1QL8A 3RXOA 1MZDA 1EP5A 4AOQA 3L33A 1LQEA 1YCPH 2ZTXA 4O03A 1EJMA 3MU4A 2ZEBA 1C4Y2 1SSXA 1DS2E 1GI9B 1EAUA 1VJAU 2ZG0H 3P17H 3ZYEA 4IMQA 1OS8A 5EW2H 5I25A 1L4DA 2LPRA 1P06A 5HYOA 4A6LA 1RTFB 4PROA 1B0EA 1FNIA 6GCHG 3M3VA 5DP4A 4DCDA 1C1WH 1B0FA 1HAXB 2WYJA 2FYQA 2V3OH 4UFGH 3RMOH 2ZC9H 2VIQA 4LZ4B 1O2GH 3NK8A 5A8ZA 3RXUA 5DKMA 2FOCA 2J2UA 3A85A 2BX4A 5J4SA 1HAVA 2FLBH 4GHQA 1FY8E 2O9QA 3K2UA 1Z7KA 2XCFA 2ALPA 1S5SA 1TQ0B 1GJDB 2VB0A 4CRCA 5ABWA 1N6XA 1G36A 1C5QA 1TRMA 2NU3E 3PMHB 2QA9E 2WPHS 2ZFTA 1J9CH 3SV9A 2PGBB 1F92A 1HJ8A 1RTKA 3M3TA 2BY7X 2NU4E 2EC9H 5IDKA 2HGTH 3FP7E 1WTGH 3BTFE 2AFQB 1DDJA 2XRCA 1GHWH 1SOZA 3A86A 1XKAC 3LT3A 1QA0A 3TGKE 3MI4A 4Y6DA 1P9UA 3M61U 1YLCA 1KTSB 3GY2A 1EXFA 4X2WA 2EI8A 1A61H 2ZU3A 3QTVH 1GJ7B 2A5IA 3P95A 3A8DA 2CF8H 1AUTC 1EP6A 3PWCA 1NRSH 1O3EA 2R3YA 2ODPA 4I31A 1HAGE 3C27B 1HAPH 3BEUA 5DGJA 1W14U 1O2RA 2SFAA 4CH2B 4O3UA 1WQSA 1ABJH 1ELAA 1GJBB 3RMMH 3E91A 1C4V2 1JIRA 4TY7A 4YM9A 3P8FA 2ZU5A 1BTYA 2C8YB 1T4UH 2F83A 1EPTA 1MKXK 1O2OA 1FY3A 1SG8B 4E06H 1BHXB 1H4WA 2ZHFH 2BOKA 3TJVA 2OTVA 3A7ZA 2ANKH 1D6RA 1MH0A 4RSPA 1OX1A 1KDQA 1FY5A 3U9AH 1MTNB 1T8MA 1Z6EA 3T26A 4Y10E 3O8BA 1KXFA 1QY6A 4IC6A 1XUHA 1QFKH 4E05H 3A8CA 1O3KA 3EYDA 4NSYA 3N7OA 2UWLA 1S0RA 2TGPZ 5LPFA 1FN8A 1CQQA 1GBLA 1W0YH 1A4WH 2CJIA 4NIXA 2Z9JA 2WPMS 4CREA 2B5TB 2C4FH 4Y76A 3SJ8A 1O37A 1AO5A 2WPKS 4FUBA 4MQAA 5TCAA 4BAKB 4MPVA 3ZZ7A 2SGQE 1QRWA 1O39A 1QB6A 1ZRBA 4ZXYH 3Q3XA 5C1YA 4FVDA 1XX9A 3ZZ9A 1GBAA 1ETTH 1C2FA 1BMMH 1O3DA 2EI6A 5E8EH 2AS9A 2JETB 4KELA 4VGCC 4YOJA 2ZKSA 7ESTE 1PPHE 4WY3A 1UVOA 5DP6A 1TFXA 1RD3B 5C20A 2J92A 1AE5A 3DUXH 1BTWA 1SC8U 1TPSA 3DFLA 1NESE 1IQJA 1FPCH 1JOUB 1T8OA 2ZWLH 3HKJB 1UK2A 1C1SA 1P2IA 3QZQA 4ESTE 2VJ1A 1T32A 3BIVH 4X8VH 4ZXXH 5GCHF 2ZFPH 2Y80A 3G01A 3VFEA 3UR6A 4X0WU 1NROH 1O2ZA 1Q31A 4MNXA 2BD8A 2A4RA 2JH0D 2ZQ2A 4XDEA 3SUEA 2FI4E 1UTKA 1IQNA 5T6FA 1EB1H 3S69A 3LKWA 1OKXA 3WY8A 1VITG 1EPTC 2Z3EA 5JB9S 1A7SA 1MTNC 1IHSH 2BD7A 5EG4A 2TGAA 2SGPE 2OC1A 1J15A 2R2MB 1P12E 3O8DA 1CT2E 1TOMH 4XBCA 2BD3A 3Q00A 1SR5C 1M9UA 1FV9A 3QLPH 2P8OB 2WV4A 2XNIA 1T7CA 3Q76A 3RXMA 1P11E 2G81E 2R9PA 1NZQH 1DITH 1QGFA 3SNAA 3SU4A 1BTUA 1C1UH 1P8VC 1ZRKA 2QXJA 4FU7A 2CN0H 5HMAA 2FESH 5FHTA 3EDXB 1MBMA 1OYTH 1XUJA 2V3HH 2GCTB 1GGDB 2ZECA 1O5EH 5EODA 2FXRA 2JETC 3SUFA 4HZHA 1EOJA 4JZEH 8GCHF 3BTGE 4ISOA 1MU6B 3S9CA 2R3UA 4CR5A 3D49H 2BY8X 2OD3B 8GCHG 3MH5A 1SOTA 3B8JA 2TIOA 2NU1E 3S7HB 2BD2A 4YOGA 2BHGA 2AYWA 3GDUA 1SGFA 3VGCB 5F6MA 1S85A 3SO3A 2ODQA 3Q3KA 2F9NA 2A32A 2BQ6B 2W5EA 4ZKOU 1HJ9A 5GDSH 4X8TH 2F9PA 4F49A 4GLYA 1MKWK 1W2KH 3RMNH 2PKSC 2JH5D 3GOVB 2XBVA 1QR3E 2BLOA 4WXVA 2FOFA 2A2XH 1HJAB 1V2MT 1BT7A 3ZZ3A 1O2JA 3TK6A 1ACBE 3PMAB 4BNRA 3M5OA 3U1JB 1GBFA 2WINI 1O36A 3RXQA 3F9GA 2PV9B 2GDDA 1O2VA 1LHGH 1C2DA 3MH6A 4RKOB 2SNWA 5FPSA 2HNTF 2P8OC 1PQ5A 1C5TA 1LTOA 2P3UB 4OS2A 3ZVDA 1O3HA 4ZHMU 1K1OA 2BMGB 3D62A 4NA7A 1GJ4H 2J9NA 1AVGH 4AFZA 3AAUA 3UY9A 3RXAA 2BB4A 1NFXA 2ZZUH 1BQYA 3BG4B 2H2ZA 5JBTA 1NRQH 1IOEA 1ZMJA 1TALA 3SU1A 5CHAC 3GISB 1V2VT 1P2NA 1O2QA 1ZPZA 3F9EA 1WV7H 2ASUB 1HAYB 2AERH 2ZCKP 3SNCA 1Y3WA 1FUJA 2FX4A 4INLA 3CS0A 1ANBA 1BRBE 4FUCA 1L2EA 1X7AC 1DVAH 4BXWA 3GCHB 4TPYA 4ABIA 2ZDKA 1CHOF 1ZSKA 2BVXH 1ZPCA 4NGAH 3SJ9A 4GCHF 1FY4A 3RU4E 1EASA 1WSSH 1GBJA 2XC4A 1AVXA 3V7TA 1P0SH 1RIWB 1CHOG 3NKKA 7GCHF 4A1VA 1GJAB 1NY22 1TMBH 1D4PB 1IQEA 4MNWA 1S83A 2VIVA 3CENA 4AB8A 1ETRH 3Q77A 1EKBB 4B1TA 1GJ6A 1XKBC 1GVKB 5DP9A 3EA8A 1OWDA 1BBRK 4ISLA 2J38A 2Q6FA 5A09A 1L1NA 1ARCA 1VITH 4GVUA 3TVJB 1HV7A 2FYRA 2W3KA 1C9TA 1HIAA 4IW4E 2ZU2A 1KY9A 2IPHA 4AG2A 2BY6X 2TGTA 3LONA 2I6SA 4YESB 1AKSA 1TMUH 1QJ1B 5IYTA 3PTBA 5EXLA 1EAXA 1YPHC 2SNVA 2GGVB 3DFJA 2ZNKH 1KIGH 3SHAH 4ZKRU 5GPIB 2SGFE 5BPEA 2P94A 1XM1A 4X6NA 1HFDA 1NPMA 1O3BA 1O5FH 1GVZA 3T28A 4ABFA 1O2PA 1O2HA 2PFEA 3UWIA 1HRTH 4JCNA 3KCGH 3KL6A 2YNBA 2G4UA 2WUCA 2VGCB 1ZMLA 4Q7XA 5T3HA 3Q3YA 1IQIA 1P10A 1C5XB 1V2TT 1GDUA 2Y81A 1V2RT 4RN6A 1K1PA 1O2TA 1YPMH 2Y6TA 3HK3B 1RGQA 2FS8A 3GCOA 1AI8H 1TNLA 3GCHC 1SGIB 1ELTA 1OWEA 1ZOMA 4K5ZA 3T27A 1J17T 2ZDMA 1TNKA 3LJOA 3U8OH 1ABIH 1P09A 1RRKA 1TPPA 1AFQC 1NM6A 1NO9H 1TE0A 3ATKA 4O97A 4UDWH 3UR9A 1CT0E 4U30A 1F5LA 5AFYH 1T31A 3BTKE 3MU1A 3TNSA 4JYTA 2TRMA 1DLEA 1Z1JA 1P02A 3A80A 2A5AA 4BAHB 2J4IA 1LHCH 1BTXA 1W13U 3LIWA 1W12U 3ENSB 2FOHA 1O2NA 1BITA 1O31A 1SVPA 1GBKA 3AW0A 3E6PH 1YPKH 2ZDNA 4YTAA 1PQAA 1MTSA 1TX7A 5A8YA 4JZDH 2BXTH 3FP8E 1A5HA 1UVSH 5AHGH 1GJ5H 1XXFA 2HLCA 1MKXH 4CHAB 3NZIA 2KAIA 1THRH 2ZGBH 3LOXA 3MO6A 4ABAA 1Z1IA 2FOBA 3IWMA 1Z6JH 2F3CE 1UHBA 3ODDA 1KXEA 2CMYA 4FUIA 3ZVFA 1H9HE 5BRRE 2ULLA 5LPRA 1UCYK 3GYMA 4JK6A 2FOEA 1GBMA 4ISNA 3TK5A 3ATLA 3F6UH 4NIYA 3RXDA 1NTPA 3R3GB 1G30B 3MNSA 1Y5AT 5DO4H 4AGJA 1BTZA 3K6ZA 1BB0B 2UUFB 1DUEA 4BANB 1MUEB 1O3GA 1TA6A 5A2MH 2PTNA 4Y7AA 3RLYH 1ZSJA 2CGAA 3BSQA 4B76A 4AB9A 1ZHRA 3MU5A 1PPEE 3TH3H 2GDEH 4OS5A 5HM9A 1NRPH 1BJUA 1UO6A 3BIUH 3RXTA 1T8NA 2ZFSA 1SHHB 1GI1A 3UUZA 1SQOA 1H9LB 4K8BA 4JMYA 1AU8A 1BMAA 2Z3DA 2FX6A 3TH2H 3QUMP 3I77A 2PKAB 2VVUA 3M36A 1BTHH 1Z8GA 3V0XA 1C1NA 1Z8IB 5E2OA 5F8ZA 2Q6DA 3A7WA 4FU9A 3VB7A 1C5NH 1O2XA 3MH4A 4LOYH 1F0UA 1J16A 3QGNB 1ZGIA 4H6TA 4NZLA 1THSH 5C5OA 1G3BA 3SW2B 3PV4A 3TNTA 1XUIA 4KTCA 3MO3A 1IQFA 4MPUA 4AN7A 1KXAA 4I8HA 2BOHB 4B2BA 1TPAE 1ESTA 1TIOA 3PLPA 2C8ZB 4YZUA 3SUDA 5J4QA 1A2CH 3E0NB 7LPRA 3RXFA 1PFXC 1MCTA 2DUCA 2STAE 4AYYB 4U01A 1FAXA 4CR9A 3UOUA 1KLTA 3AASA 5EXNA 1BBRE 4X1RU 3FAOA 3K6YA 1DY9A 3QN7A 1OP8A 1YPJH 1TGSZ 3ATMA 4Q7ZA 3RM0H 1F0RA 1FIZA 1HAHH 4NZQA 1NU7B 2QXIA 4WH6A 1H1BA 5EXMA 3BTME 4DIIH 1WCZA 2HPQH 5E2PA 2P16A 2RG3A 3SI3H 1QBVH 1DSUA 3H5CB 4TY6A 4OGYA 2QN5T 2Z3CA 3UWJH 2F91A 1J14A 1QL7A 2BDAA 4LXBH 1TMTH 1LKAA 5DP3A 3RXVA 1H9IE 3U69H 3ELAH 3RUOA 2H5DA 1BZXE 2BZ6H 3SORA 4Y8YA 1TA2A 4F4OC 5DP8A 4B75A 5C3NA 2WUBA 4OS6A 3VXEH 2HWLB 2ZCLP 3E8LA 2XWAA 1MD8A 2YOLA 1GG6C 2WYGA 4TWYA 2QAAA 2ZO3H 4I32A 1O5BB 4I8JA 2ZCHP 1AHTH 1Y3VA 1QNJA 2R0LA 1PYTC 1BMLA 2GD4B 1TNJA 2CF9H 1KYNA 3BF6H 4Q2KA 1EATA 3TLOA 4Y7BA 1S82A 2ANYA 3RXJA 4NSVA 3MU8A 3LC3A 3MTYA 1O3MA 1C5YB 3E1XB 3RC5A 1UVUH 1KXCA 2QCYA 1G9IE 1MKWH 2BD4A 4FXGH 1MQ6A 3BTTE 2AMDA 5AFZH 2IN2A 1W10U 4BTIB 1IQLA 3LDXH 2W3IA 4INHA 3GY6A 1Y3YA 4X1NU 1ANCA 3TJUA 1XXDA 3TJOA 1RS0A 1OWJA 1GWAA 1A46H 1JRSA 1GI5A 1UTNA 1XVMA 1V2KT 4U2WA 5B6OA 3M7UA 1GI3A 1H8DH 3NWUA 1OWHA 1TNIA 1EX3A 3U8RH 5JBBS 3STJA 1DOJA 1MAXA 1YF4A 2G51A 2Z94A 1UCYE 2XYAA 5EPNA 4WMDA 1O5GH 4X2YA 1F5KU 1UK4A 1EAIA 1A5IA 1N6YA 2Z9KA 5E0GA 1E35B 1TRNA 1L1GA 1ESBA 4MNYA 1WU1A 4HTCH 3SU3A 1AB9B 1FZZA 5A0BA 1SHYA 2Z9LA 1BIOA 1NFUA 4K3JA 3P8OA 1S84A 4FUJA 5FBEA 1P2MA 1A0JA 1O2MA 4WF8A 1P3EA 3SGAE 2GZ9A 1C2IA 3PLBA 2UWPA 4DT7B 1GI8B 1C2EA 4X8UH 3TK9A 1ELCA 3LU9B 4Z0KA 2V6NA 2BLWA 1PPFE 1AWHB 1V2ST 2C93B 3OX7U 2EA3A 1OSSA 1Y3XA 4B74A 1WBGB 1ELGA 1HLTH 3DT0H 3TJNA 3UQVA 2AIPA 3KHVA 1SL3A 5K0HA 3HPTB 3UNQA 1ANDA 1MTVA 1EJNA 1V2LT 1FDPA 1V2QT 3SV2H 1GHVH 4CH8B 3ZVEA 1EZXC 1A3EH 1E38B 4I8GA 5EQQA 4YO9A 1P57B 1INCA 1W11U 5GCHG 3LPRA 1JMOH 4CBNA 4HI3A 1VCWA 2HPPH 1MQ5A 2SGDE 4UFFH 5EW1H 4M7GA 4D9RA 1HYLA 1SLVB 1ELEE 1AMHA 1UTOA 2BDIA 1S81A 2GV6A 4ABEA 2QC2A 1UTPA 1DUAA 1OOKB 1S0QA 1O2LA 1AWFH 2O8MA 4Y11E 3W94A 3B9FH 2FO9A 2ZHQH 4A7IB 1C5MD 2WPLS 4CRBA 1LDTT 1JRTA 4IC5A 4Q7YA 2FOMB 1SGYE 3T25A 4NCYA 3P6ZB 2UWOA 1LHDH 3S0NA 2OINA 1D3PB 3EE0B 2OBOA 1TABE 2H1UA 2HNTC 1CA0B 5ESTE 4ASHA 2F9OA 4WWYA 2BY5X 2ZA5A 1DANH 4UFEH 1WUNH 6CHAB 1KXBA 1QB9A 2AGEX 1Q2WA 5ETXA 1H8IH 1K1NA 1DICA 5DG6A 2BVRH 1C5ZB 1PPBH 2QF0A 4Y8ZA 2Z6BD 4J2YB 1HXEH 3QGJA 1DWEH 2AH4X 1V2PT 4WXIA 3LGIA 2VH6A 3EAJA 4K69A 2G8TA 1YM0A 1ZR0A 7KMEH 2BXUH 3OYPA 2UUJB 3KEEA 1Y3UA 2FTMA 2P3FH 4XBBA 3T5FH 1C1RA 4X6MA 1HGTH 4HGCA 1EZQA 1HB0B 3FVFB 1GDNA 4MPXA 2AIQA 1LVMA 3A88A 2GT8A 4BOHA 3C1KA 1PYTD 1CU1A 3SV6A 3GYLB 3MOCA 4FU8A 1QJ7B 3LGVA 2A4OA 3RXSA 2CHAB 3S7KB 1KLIH 4ZHLU 1CO7E 4H4FA 4NIWA 3M7TA 1BJVA 2BLVA 2G4TA 5EU8A 4BAMB 3ZVBA 1YPGH 4ZKNU 5E0JA 4R8TB 1QBOA 1C1MA 1O3AA 3UNRA 3MNBA 2H5CA 1ARBA 4O3TA 4QT8C 1AZZA 1W8BH 5GXPA 1CHGA 1HCGA 1D3TB 3MWIU 3PB1E 5FBIA 4NFEA 1BOQA 9ESTA 1C1QA 5GIBA 1YBWA 3VPKA 3ZVGA 1TBRH 2W7SA 4E7NA 1IQHA 1LPGB 3D23A 4NG9H 4AORA 1O2WA 1NFWA 4IMZA 4ZKSU 3RDZA 1XUFA 5TJXA 1AGJA 3RU4T 2B8OH 1VGCB 1K1MA 1EB2A 1O5AB 1B5GH 3LH3A 5GJ4B 3TH4H 3AW1A 2ZHWH 1W0ZU 4R0IA 1TGCA 2GCTC 1LVBA 1GGDC 3KN2A 3SU2A 2C3SA 2QV1A 2UUYA 5GWZA 2DE8A 3MNCA 1ESAA 1FXYA 3M5MA 3FFGA 3SJIA 1HPGA 1V2NT 1V2JT 4UEHH 4A1XA 2ANMH 4ZHAA 2BY9X 1K1IA 1P2QA 1GBBA 1D9IA 2XC0A 2AMQA 2FODA 1EAWA 3ATWA 1FY1A 4CRDA 4ISIH 2VWOA 3VGCC 3RXGA 3GDVA 1A1RA 1SGEE 2ZFRH 1LKBA 2ZTZA 4YLUA 3ZVCA 4BTUB 3HGNA 3MH7A 1C1PA 2BDYA 4ZROA 3ZZ4A 1AUJA 1IQGA 3M3SA 1ELDE 4GCHG 1DLKB 1AQ7A 5ESBA 1HJAC 3GCTF 4UONA 4ABBA 7GCHG 3NUMA 3MO9A 1CE5A 2OLGA 3GCTG 1ELBA 4CRAA 4RKJB 5AF9H 4FUEA 3OU0A 1PQ7A 1S6FA 1ZMNA 2O8WA 1NRRH 4Q80A 1GI0A 2VIDA 3V3MA 5T6GA 4JYVH 2A7CA 3RXHA 1G3CA 2RA0A 5HXFA 9LPRA 3SN8A 2Z9GA 1OP0A 3OY5U 2C8WB 1DWCH 1SFIA 1P2OA 4J1YA
chains in the Genus database with same CATH superfamily
1L4ZA 1XUKA 3E3TA 1LPZB 2A5KA 1Y8TA 3OY6U 4D8NA 4E7RG 1GCTB 1NFYA 4D7FA 4Z1MD 1P03A 2A7JA 3BG4C 1H8ED 5C17A 2PW8H 2ZQ1A 1D6WA 1BRAA 1TPOA 1N8OB 3L6PA 3VG8A 2ZGXH 4XOJA 3CS7A 4KTUA 2ZDLA 2G5VA 4DY7B 2TGDA 2KCAA 1GMDF 3ESTA 5F8TA 5C1UA 2STBE 4YT6H 1YCPM 1GHXH 2XXLA 2B9LA 4A92A 5EOKA 2WV5A 1YC0A 3SI4H 3A8BA 4KKDA 3ATIA 4DGJA 3SJOA 2C90B 4AFUA 1HAZB 1O32A 1HXFH 3SGQE 1D3QB 3MNXA 3NPSA 2BVSH 4Y0ZE 1SPJA 1TAWA 1UW7A 5C1XA 2A0QB 2ZTYA 2D26C 2GP9B 4X2VA 1G3EA 2Y82A 1JWTA 1QB1A 2VWNA 1PPGE 1HBTH 3D65E 4Y0YE 2A4QA 3U28C 1RIWC 3KIDU 4D9QA 3H7TA 2THFB 1DWDH 3SU0A 1SMFE 1NC6A 2XTTB 2ZGCA 3P92A 3IITA 3M7QA 2QF3A 2PWXA 4BAOB 2OP9A 4FUHA 4Q4LA 3UREA 2FP7B 1O5DH 4JK5A 1MMJN 1ELVA 3E90B 4DT4A 1GHAF 4HG6A 4DOQA 3URCA 2QY0B 3PWBA 4XBDA 2ZU4A 4THNH 2NU2E 1BRCE 4GHTA 1TONA 4IN1A 1O2IA 2BQWB 1GHAG 1O2KA 1QURH 3LGTA 1MTUA 1DY8A 2J94A 2UUKB 1GL0E 4DJZB 3KNXA 1LHEH 3ZZ6A 5EIYA 4ISHH 4IS5A 1FN6A 2G00A 5L2ZH 1TOCB 3FZZA 2V0BA 1SGCA 3TPIZ 5JYIA 4ABGA 4FOUC 4ZUHA 1SQAA 2G55A 2FI3E 1EZUC 3RXCA 2J5UA 3SNEA 2YMSD 1XMNB 2Y5FA 1LCYA 4X8SH 1HAOH 1EQ9A 1O2YA 1S6LA 1GDQA 3BEIB 1G37A 3BEFB 3EE7A 1WQVH 3LH1A 3TIUA 1YPLH 2VIWA 5CE1A 5SGAE 3RXBA 3GY8A 1MTWA 2OQUA 1OHHD 2WPDD 2W26A 4OS7A 1YKTA 2PKAA 1TYNA 2VGCC 2FTLE 3SNDA 3ZZ5A 3NCLA 1QHRB 3UAIC 4I33A 1ZJDA 2A45B 1O3FA 3RXIA 2VVCA 4INKA 4IN2A 3SU6A 3QWCH 4DIHH 1DX5M 1Z8JB 1C5SA 1GJCB 5DPAA 1WDIA 5FX6A 2ESTE 1CVWH 2OC0A 8ESTE 2FOAA 1S6HA 3OSYA 1GHBF 1LVOA 3EA9A 1ZHPA 1VR1H 3BV9B 2AEIH 2OC8A 4KGAA 5JPMH 4K2YA 5CMXH 1GHBG 1KSNA 1TGBA 3GY3A 3QO6A 2QYIA 3AVZA 3KQEA 4TYDA 2ZIQH 2V35A 3GY5A 3RMLH 1DT2A 4AX9H 2FWWA 5HGGA 4CHAC 1KTTB 2K1QA 2Z7FE 4MNVA 3N7DA 1C5WB 2FM2A 5EJLA 3SV7A 3L3TA 2PSYA 4GPGA 1B7XB 3KQDA 4GAWA 2F9BH 2VU8E 3BTWE 3A82A 1FQ3A 4WJG2 6GCHF 1GI6A 1QQ4A 1W7XH 1QA7A 2K0QA 4MTBA 1QRXA 3PYHA 1KLJH 1SQTA 2RA3A 1BCUH 1F7ZA 3HKIB 3GY7A 2BZAA 4U32A 1RJXB 4NIVA 2ALVA 2JH6D 1HDTH 1E36B 5JDUB 1G2MA 3FP6E 2BD9A 3LC5A 1WTHD 4FUFA 2VINA 3CP7A 3ZV9A 2ZF0H 1HUTH 1C9PA 3RM2H 4B71A 1BMNH 2TPIZ 3QTOH 2KZ4A 4Y79A 1HAVB 4WH8A 1UMAH 1N1LA 1K0HA 1SGDE 2FS9A 5L30H 1GCDA 1TB6H 3GCNA 4NA8A 1C1OA 4MLFB 4UFDH 2ZFQH 5FPTA 2XCNA 4OM9A 3F68H 3N99A 3V12A 2H9EH 4MDSA 3P8GA 4H6SB 2Y5HA 3GY4A 3LGYA 1YYY1 1EZSC 1XUGA 1D3DB 2FPZA 2ANWA 2P3TB 4B6EA 4CBOA 2O8UA 1PPCE 1K1LA 5LH8A 1SGRE 1O3JA 1TGNA 4DW2U 1ZHMA 5G4BA 3MU0A 4K1TA 1NN6A 4B2AA 1C5UA 4A5TS 1DFPA 1FIWA 3UOPA 2IOTA 1EUFA 1UTQA 1FPHH 4VGCB 1CGHA 2PUXB 3UB0A 5DK1A 3SQHE 3W95A 4WMEA 3E0PB 2XBYA 5F8XA 1GI4A 2WV9A 2RDLA 3UNSA 5I46H 2XC5A 2JJ1D 4O9VA 1MD7A 4I86A 2Q1JA 4P00A 1LPKB 1LQDB 3JZ1B 2VIPA 3PTNA 1UTLM 4OGXA 5K7RA 5FX5A 1FONA 1RXPA 3BN9A 2ODYB 4Y71A 2OUAA 3A81A 4DVAU 1MCVA 1OXGA 3R0FA 1AVWA 1C2HA 1UVTH 1P2JA 3SGBE 4TWWA 3PM3A 4GSOA 1DWBH 1QQUA 1GJ9B 5C0TA 3M5LA 1SB1H 1V6DA 1JXPA 1W7GH 4IGDA 4JYUH 3EQ0H 3VEQB 3FKSD 1SFQB 1EPTB 1K1JA 5EGMA 3SV8A 1UJ1A 2QF4A 1O3IA 3FOAA 1DM4B 1NRNH 5JBAS 1SBWA 1K9OE 2ZPQA 1VZQH 3RXEA 1KDQB 5EQRA 1F2SE 1C2LA 1FMGA 2LELA 1TNGA 2A4GA 4BXSA 1C5LH 3VB6A 3UIRA 3LGWA 1U6QA 2WPJS 2DE9A 4Q63A 5F03A 2BDCA 4X6OA 1E1QD 1TBQH 1O3OA 2OXSA 4DURA 1GBHA 1DSTA 3RC6A 3HATH 2BDGA 1V2WT 2G5NA 3OAAD 2QIQA 1EJAA 3E16B 5H4IB 3QDZB 3AAVA 2GCHF 3F3BA 2Q6GA 2QF5A 1VJ9U 1DE7H 4A1TA 2WZQA 2OBQA 3DD2H 1TBZH 1ZLRA 1BDAA 2M5TA 4GUXA 1C4U2 1QJ6B 2GZ8A 3F0PA 1TLDA 3M37A 2GCHG 1BBRH 3I29A 3TGIE 3PO1B 6LPRA 2F4LA 1GPZA 4MPWA 1PPZA 4ABHA 1GHYH 1VCPA 1DXWA 2P93A 5C2ZA 3ZZDA 5LPEA 3KQBA 1F0TA 4WVPE 1ZJKA 4NA9H 4UE7H 3LJJA 1YCPK 2CV3A 5T1VA 5LGOA 1P2KA 2OC7A 2XWBI 3F9FA 1VITF 3SUGA 5A0AE 3P8NA 1MU8B 2Z9IA 4D7GA 3OFND 4AFSA 2L6OA 2PKSB 3UFAA 2AGIX 1AB9C 1AZ8A 1UTJA 3SJKA 1O30A 2R2WU 1CBWB 1OWKA 2KCYA 2HVXA 1J8AA 1OPHB 1HAIH 2W6JD 4AYVB 1ID5H 3BTDE 4AGKA 1SLUB 4NWKA 4ABDA 1O3NA 4YLQH 4X1PU 4D76A 4JZ1A 1ZYOA 1QL9A 5L6NH 1V2UT 2GV7A 2ZHDA 4Y8XA 1VCQA 4I7YH 1EOLA 3DHKH 3BTHE 4ABJA 2ZPRA 1LMWB 2NU0E 2V7QD 8KME2 2FI5E 2GTBA 5TCCA 1YPEH 1IAUA 1ZGVA 2BQ7B 3WWBA 2LNCA 4NWLA 5E0HA 1TQ7B 1CSOE 1TRYA 3S9AA 1SI5H 3OEHD 2GKVE 1TX8A 1CA8B 1QBNA 4B73A 5CHAB 3O8RA 5C67A 4I8KA 2ZDAH 4AZ2B 2BDBA 1FAKH 1PJPA 1QTFA 5DSFA 3TU7H 2PTCE 1C5PA 3PO1C 5DP7A 1HNEE 1GMHF 1P3CA 4K1EA 1L1JA 1C5RA 1E37B 2FMJA 2ZI2H 1F5RA 1GMHG 3M5NA 4K1SA 3PMJA 2FIRH 3MHWU 1P01A 3EA7A 1GBEA 3T2NA 2IJOB 2Y7XA 3A83A 1UCYH 5C0UA 2AMPA 4OS1A 1BHXF 1K22H 3RP2A 1JBUH 1IQMA 1FLEE 2BDHA 3A87A 1AE8H 1GBCA 3PROA 1RFNA 3F2HA 2JDID 1G2LA 1AFEH 1GJ8B 2VBCA 2KFWA 1CA0C 1CBWC 6ESTA 2ZDVH 1GBIA 4JZFH 4ZH8A 3UPEA 3RXKA 1P04A 3U98H 1E1RD 3DSGA 3F0OA 3QZRA 4H42U 5FPYA 6CHAC 2JIZD 2PLXA 3SZNA 2D8WA 2HALA 3O8CA 4XE4A 3PLKA 3A7XA 3SHCH 1O34A 3LGUA 3TITA 4JZIA 1T8LA 5JB8S 1QIXB 1LO6A 4YT7H 1E34B 2BLQA 5AVDA 1UK3A 3H7OA 3B23B 3OTJE 3MYWA 4DG4A 3TGJE 2R0KA 3KF2A 2BM2A 2HNTE 2P95A 2IPQX 4HFPB 3M35A 2ZHEH 1WOFA 3ZV8A 2D1JA 5C5NA 3SQEE 1AD8H 4IBLH 2PHBA 3UQOA 2VH0A 3ZZCA 2FZZA 5EQSA 1TX6A 1JIMA 3URDA 5HKKD 4ZAEA 3SBKA 2OCVB 2SGAA 1ZSLA 3ZYDA 3ZZ8A 1SGQE 1A3BH 4CRFA 4OS4A 3A7VA 3NXPA 2CHAC 5FXLA 4XFQA 1LHFH 2J95A 5JBCS 1WYKA 2CXVA 1XVOA 1BA8B 1OYQA 1YGCH 3A7TA 2A2QH 3S9BA 1SGNE 4LZ1H 1GMCF 3UTUH 1YLDA 1C1TA 4LK4A 1DXPA 5A0CA 2W7UA 3RXPA 3VB4A 4ZMAH 1GMCG 1AFQB 1IHTH 2FLRH 1AIXH 3BTEE 1C5VA 4Z6AH 2BX3A 3F9HA 2ILNA 3EGKH 2B7DH 2GX4A 1C1VH 1K2I1 2XW9A 1CGJE 3OTPA 1SLWB 3GDSA 4ASUD 1Z71A 5EPYA 2BD5A 1RTLA 1NU9A 2QXGA 2GVFA 1O2SA 5DN6D 3A8AA 1GI2A 5DJ7A 4TPIZ 3ITIA 2B0FA 3RXRA 2O8TA 4MVNA 1TNHA 2KCPA 1AN1E 5T6DA 4K60A 2PSXA 5FCKA 1VGCC 4AC9A 2GMTB 1LVYA 3ZZAA 1GL1A 1O5CB 1Y5UT 3RLWH 3U1IB 2H6MA 1HIAB 1FI8A 2F9UA 3SU5A 3BG8A 1ORFA 1W3CA 4FUGA 1MAYA 2ZP0H 2PGQB 1AKSB 1SLXB 3HK6B 2WPIS 2ZU1A 2GT7A 2VWLA 2PUQH 2ZGJA 3GICB 2P59A 1GMDG 2FOGA 1T4VH 2EEKA 4XSKU 3MMGA 3K9XB 3FZDA 3P70B 3U8TH 4X1QU 3ODFA 1OP2A 3T62A 2VNTA 3F2FA 3VXFH 1V3XA 5FAHA 3VB3A 4KP0A 1O0DH 3QX5H 1IQKA 1UVPA 2C8XB 3STIA 1L0ZA 4I8LA 8LPRA 4BAQB 4F48B 2YNAA 1SGTA 1THPB 2H9HA 1O38A 5L2YH 1CGIE 2ZGHA 3I78A 1C5OH 1ZPBA 1Y59T 4MG3A 3A7YA 3RU4D 1ANEA 1F0SA 2JKHA 4K8YA 2QXHA 4FUDA 3T29A 1ZTLA 5DP5A 1O35A 1A0HB 2VWMA 2PR3A 2FDAA 4AFQA 2ZFFH 1SGFG 1GHZA 5HM2A 3SOSA 1MBQA 1GVLA 1C2GA 2TBSA 2A31A 2A7HA 1YP9A 1O3CA 2H9TH 2SGEE 2V3MA 3ZVAA 1UTMA 2I6QA 4FVBA 2VVVA 4X2XA 4TSFD 2HOBA 1ZTJA 1C2JA 4YOIA 5PTPA 4SGAE 1O33A 1GCTC 3QK1A 1NT1A 1ZZZA 3DA9B 1GI7B 1E0FD 3K65B 2GMTC 4X1SU 3V13A 1G3DA 1SGPE 2A1DB 1N8OC 2EI7A 1K21H 3KQCA 2KAIB 1DPOA 1QRZA 1C2MA 3ZZBA 4CRGA 1YPHE 1KXDA 1C2KA 1UHBB 1A5GH 1O3PB 2AGGX 2Y7ZA 1FJSA 2XBXA 2FEQH 4AG1A 3HGPA 1K28D 1AY6H 1GBTA 1O2UA 2D2DA 4UD9H 1ELFA 5A8XA 1PQ8A 3MFJA 2O8LA 4SGBE 1CT4E 2OQ5A 3JZ2B 2GZ7A 2NWNA 3SYJA 2G52A 2QGRA 1TGTA 2VIOA 4B2CA 2HRVA 3RC4A 3SNBA 1MZAA 2XBWA 1BUIA 3RXLA 2F9VA 4NFFA 1NS3A 2BYAX 4X6PA 3A89A 1ETSH 4BTTB 2J34A 1A0LA 1GG6B 2EQNA 3KGPA 3IG6B 1TWXB 2RCEA 1BRUP 4WMFA 1P05A 1O3LA 2BTCE 3BTQE 3VB5A 1BTPA 3F1SB 1G32B 1WAYB 1GBDA 3A84A 3PMBB 2ZPSA 5FCRA 4KTSA 1ZTKA 1V2OT 1Q3XA 1Y5BT 1P9SA 1MABB 1OWIA 2Y5GA 1QCPA 1Z8RA 3FANA 1QL8A 3RXOA 1MZDA 1EP5A 4AOQA 3L33A 1LQEA 1YCPH 2ZTXA 4O03A 1EJMA 3MU4A 2ZEBA 1C4Y2 1SSXA 1DS2E 1GI9B 1EAUA 1W0KD 1VJAU 2ZG0H 3P17H 3ZYEA 4IMQA 1OS8A 5EW2H 5I25A 1L4DA 2LPRA 1P06A 5HYOA 4A6LA 1RTFB 5F53A 4PROA 1B0EA 1FNIA 6GCHG 3M3VA 5DP4A 4DCDA 3KYGA 1C1WH 1B0FA 1HAXB 2WYJA 2FYQA 2V3OH 4UFGH 3RMOH 2ZC9H 2VIQA 4LZ4B 1O2GH 3NK8A 5A8ZA 3RXUA 5DKMA 2FOCA 2J2UA 3H09A 3A85A 2BX4A 5J4SA 1HAVA 2FLBH 4GHQA 1FY8E 2O9QA 3K2UA 1Z7KA 2XCFA 2ALPA 1S5SA 1TQ0B 1GJDB 2VB0A 2RFKC 4CRCA 5ABWA 1N6XA 1G36A 1C5QA 1TRMA 2NU3E 3PMHB 2QA9E 5C94A 2WPHS 2ZFTA 1J9CH 3SV9A 2PGBB 1F92A 2OK5A 1HJ8A 1RTKA 3M3TA 2BY7X 2NU4E 2EC9H 5IDKA 2HGTH 3FP7E 1WTGH 3NRLA 3BTFE 2AFQB 1DDJA 4B6FA 2XRCA 4M9FA 1GHWH 1SOZA 3A86A 1XKAC 3LT3A 1QA0A 3TGKE 3MI4A 4Y6DA 1P9UA 3M61U 1YLCA 1KTSB 3GY2A 1EXFA 4X2WA 2EI8A 1A61H 2ZU3A 3QTVH 1GJ7B 2A5IA 3P95A 3A8DA 2CF8H 1AUTC 1EP6A 3PWCA 1NRSH 1O3EA 2R3YA 2ODPA 4I31A 1HAGE 3C27B 1HAPH 3BEUA 5DGJA 1W14U 1O2RA 2SFAA 1WXRA 4CH2B 4O3UA 1WQSA 4RT1A 1ABJH 1ELAA 1GJBB 3RMMH 3E91A 1C4V2 1JIRA 4TY7A 4YM9A 3P8FA 2ZU5A 1BTYA 2C8YB 1T4UH 2F83A 1EPTA 1MKXK 1O2OA 1FY3A 1SG8B 4E06H 1BHXB 1H4WA 2ZHFH 2BOKA 3TJVA 2OTVA 3A7ZA 2ANKH 1D6RA 1MH0A 4RSPA 1OX1A 1KDQA 1FY5A 3U9AH 1MTNB 1T8MA 1Z6EA 3T26A 4Y10E 3O8BA 1KXFA 1QY6A 4IC6A 1XUHA 1QFKH 4E05H 3A8CA 1O3KA 3EYDA 4NSYA 3N7OA 3WW7A 2UWLA 1S0RA 2TGPZ 5LPFA 1FN8A 1CQQA 1GBLA 1W0YH 1A4WH 2CJIA 4NIXA 2Z9JA 2WPMS 4CREA 2B5TB 2C4FH 4Y76A 3SJ8A 1O37A 1AO5A 2WPKS 3DSOA 4FUBA 2AHME 3GS9A 4MQAA 2LP6A 5TCAA 4BAKB 4MPVA 3ZZ7A 2SGQE 1QRWA 1O39A 1QB6A 1ZRBA 4ZXYH 3Q3XA 5C1YA 4FVDA 1XX9A 3ZZ9A 1GBAA 1ETTH 1C2FA 1BMMH 1O3DA 2EI6A 5E8EH 2KM0A 2AS9A 2JETB 4KELA 4VGCC 4YOJA 2ZKSA 7ESTE 1PPHE 4WY3A 1UVOA 5DP6A 1TFXA 1RD3B 2PP6A 2J92A 5C20A 1AE5A 3DUXH 1BTWA 1SC8U 3OEED 1TPSA 3DFLA 1NESE 1IQJA 1FPCH 1JOUB 1T8OA 2ZWLH 3HKJB 1UK2A 1C1SA 1P2IA 3QZQA 4ESTE 2VJ1A 1T32A 3BIVH 4X8VH 4ZXXH 5GCHF 2ZFPH 2Y80A 3G01A 3VFEA 3UR6A 4X0WU 1NROH 1O2ZA 1Q31A 4MNXA 2BD8A 2A4RA 2JH0D 2ZQ2A 4XDEA 3SUEA 2FI4E 1UTKA 1IQNA 5T6FA 3PRBA 1EB1H 3S69A 3LKWA 1OKXA 3WY8A 1VITG 1EPTC 2Z3EA 5JB9S 1A7SA 2J98B 1MTNC 1IHSH 2BD7A 5EG4A 2XNDD 2TGAA 2SGPE 2L74A 2OC1A 2YMSB 1J15A 2R2MB 1P12E 3O8DA 1CT2E 1TOMH 4XBCA 2BD3A 3Q00A 1SR5C 1M9UA 1FV9A 2HVYB 3QLPH 2P8OB 2WV4A 2XNIA 1T7CA 3Q76A 5HIZA 3RXMA 1P11E 2G81E 2R9PA 1YWUA 1NZQH 1DITH 1QGFA 3SNAA 3SU4A 1BTUA 1C1UH 1P8VC 1ZRKA 2QXJA 4FU7A 2CN0H 5HMAA 2FESH 5FHTA 3EDXB 1MBMA 1OYTH 1XUJA 2V3HH 2GCTB 1GGDB 2ZECA 1O5EH 5EODA 2FXRA 2JETC 3SUFA 4HZHA 1EOJA 4JZEH 8GCHF 1W0JD 3BTGE 4ISOA 1MU6B 2J97A 3S9CA 2R3UA 4CR5A 3D49H 2BY8X 2OD3B 8GCHG 3MH5A 1SOTA 3B8JA 2TIOA 2NU1E 3S7HB 2BD2A 4YOGA 2BHGA 2AYWA 3GDUA 1SGFA 3VGCB 5F6MA 1S85A 3SO3A 2ODQA 3Q3KA 2F9NA 2A32A 2BQ6B 2W5EA 4ZKOU 1HJ9A 5GDSH 4X8TH 2F9PA 4F49A 4GLYA 1MKWK 1BMFD 1W2KH 3RMNH 3KYFA 2PKSC 2JH5D 3GOVB 2XBVA 1QR3E 2BLOA 4XD7D 4WXVA 2FOFA 2A2XH 1HJAB 1V2MT 1BT7A 3ZZ3A 1O2JA 3TK6A 1ACBE 3PMAB 4BNRA 4ACBA 3M5OA 3U1JB 1GBFA 2YMSC 2WINI 1O36A 3RXQA 3F9GA 2PV9B 2GDDA 1O2VA 1LHGH 1C2DA 3MH6A 4RKOB 5B6LA 2SNWA 5FPSA 3SZEA 2HNTF 2P8OC 1E79D 1PQ5A 1C5TA 1LTOA 2P3UB 4OS2A 3ZVDA 1O3HA 4ZHMU 1K1OA 2BMGB 3D62A 4NA7A 1GJ4H 2J9NA 1AVGH 4AFZA 3AAUA 3UY9A 3RXAA 2BB4A 1NFXA 2ZZUH 1BQYA 3BG4B 2H2ZA 5JBTA 1NRQH 1IOEA 1ZMJA 1TALA 3SU1A 5CHAC 3GISB 1V2VT 1P2NA 1O2QA 1ZPZA 3F9EA 1WV7H 2ASUB 1HAYB 2AERH 2ZCKP 3SNCA 1Y3WA 1FUJA 2FX4A 4INLA 3CS0A 1ANBA 1BRBE 4FUCA 1L2EA 1X7AC 1DVAH 4BXWA 3GCHB 4TPYA 4ABIA 2ZDKA 1CHOF 1ZSKA 2BVXH 1ZPCA 4NGAH 3SJ9A 4GCHF 1FY4A 3OE7D 2K8IA 1EASA 3RU4E 1WSSH 1GBJA 2XC4A 5KEDA 1AVXA 3V7TA 1P0SH 1RIWB 1CHOG 3NKKA 7GCHF 4A1VA 1GJAB 1NY22 1TMBH 1D4PB 1IQEA 4MNWA 1S83A 1YLNA 2VIVA 3CENA 4AB8A 1ETRH 3Q77A 1EKBB 4B1TA 1GJ6A 1XKBC 1GVKB 5DP9A 3EA8A 1OWDA 1BBRK 4ISLA 5CHBA 2J38A 2Q6FA 5A09A 1L1NA 1ARCA 1VITH 4GVUA 3TVJB 1HV7A 2FYRA 2W3KA 1C9TA 1HIAA 4IW4E 2ZU2A 1KY9A 2IPHA 1H8HD 4AG2A 2BY6X 2TGTA 2F43B 3LONA 2I6SA 4YESB 1AKSA 1TMUH 1QJ1B 5IYTA 3PTBA 5EXLA 1EAXA 1YPHC 2SNVA 2GGVB 3DFJA 2ZNKH 1KIGH 1COWD 3SHAH 4ZKRU 5GPIB 2SGFE 5BPEA 2P94A 1XM1A 4X6NA 1HFDA 3DSPA 1NPMA 1O3BA 1O5FH 1GVZA 2GJGA 3T28A 4ABFA 1O2PA 1O2HA 2IJD1 2PFEA 3UWIA 1HRTH 4JCNA 3KCGH 3KL6A 2YNBA 2G4UA 2WUCA 2VGCB 1ZMLA 4Q7XA 5T3HA 3Q3YA 1IQIA 1P10A 1C5XB 1V2TT 1GDUA 2Y81A 1V2RT 4RN6A 1K1PA 1O2TA 2XOKD 1YPMH 2Y6TA 3HK3B 3N7EA 1RGQA 2FS8A 3GCOA 1AI8H 1TNLA 3GCHC 1SGIB 1ELTA 1OWEA 1ZOMA 4K5ZA 3T27A 1J17T 2ZDMA 1TNKA 3LJOA 3U8OH 1ABIH 1P09A 4YXWD 1RRKA 1TPPA 1AFQC 1NM6A 2WSSD 1NO9H 1TE0A 3ATKA 4O97A 4UDWH 3UR9A 1CT0E 4U30A 1F5LA 2JJ2D 5AFYH 1T31A 3BTKE 3MU1A 3TNSA 4JYTA 2TRMA 1DLEA 1Z1JA 1VKYA 1P02A 3WWFA 3A80A 2A5AA 4BAHB 2J4IA 1LHCH 1BTXA 1W13U 3LIWA 5HIYA 1W12U 3ENSB 2FOHA 1O2NA 3CNRA 1BITA 1O31A 1SVPA 1GBKA 3AW0A 3E6PH 1YPKH 2ZDNA 4YTAA 1PQAA 1MTSA 1TX7A 4ACAA 5A8YA 4XRNA 4JZDH 2BXTH 3FP8E 1A5HA 1UVSH 5AHGH 1GJ5H 1XXFA 2HLCA 1MKXH 4CHAB 3NZIA 2KAIA 1THRH 2ZGBH 3LOXA 3MO6A 4ABAA 1Z1IA 2FOBA 3IWMA 1Z6JH 2F3CE 1UHBA 3ODDA 1KXEA 2CMYA 4FUIA 3ZVFA 1H9HE 5EJ1A 5BRRE 2ULLA 5LPRA 1UCYK 3GYMA 4JK6A 2FOEA 1GBMA 4ISNA 3TK5A 3ATLA 3F6UH 4NIYA 3RXDA 1NTPA 3R3GB 1G30B 3MNSA 1Y5AT 5DO4H 4AGJA 1BTZA 3K6ZA 1BB0B 2UUFB 1DUEA 4BANB 1MUEB 1O3GA 1TA6A 5A2MH 2PTNA 4Y7AA 3RLYH 1ZSJA 2CGAA 3BSQA 4B76A 4AB9A 1ZHRA 3MU5A 1PPEE 3TH3H 2GDEH 4OS5A 5HM9A 1NRPH 1BJUA 1UO6A 3BIUH 3RXTA 1T8NA 2ZFSA 1SHHB 1GI1A 3UUZA 1SQOA 1H9LB 4K8BA 4JMYA 1AU8A 1BMAA 2Z3DA 2FX6A 3TH2H 3QUMP 3I77A 2PKAB 2VVUA 3M36A 1BTHH 1Z8GA 3V0XA 1C1NA 1Z8IB 5E2OA 5F8ZA 2Q6DA 3A7WA 4FU9A 3VB7A 1C5NH 1O2XA 3MH4A 4LOYH 1F0UA 1J16A 3QGNB 1ZGIA 4H6TA 4NZLA 1THSH 5C5OA 1G3BA 3SW2B 3PV4A 3TNTA 1XUIA 4KTCA 3MO3A 1IQFA 4MPUA 4AN7A 1KXAA 4I8HA 2BOHB 4B2BA 1TPAE 1ESTA 1TIOA 3PLPA 2C8ZB 4YZUA 3SUDA 5J4QA 1A2CH 3E0NB 7LPRA 3RXFA 1PFXC 1MCTA 2DUCA 2STAE 4AYYB 4U01A 1FAXA 4CR9A 3UOUA 1KLTA 3AASA 5EXNA 1BBRE 4X1RU 3FAOA 3K6YA 3AK5A 1DY9A 3QN7A 3W1EA 1OP8A 1YPJH 1TGSZ 3ATMA 4Q7ZA 3RM0H 2RDEA 1F0RA 1FIZA 1HAHH 4NZQA 1NU7B 2QXIA 4WH6A 1H1BA 1YY3A 3BTME 5EXMA 4DIIH 5IK2D 1WCZA 2HPQH 5E2PA 2P16A 2RG3A 3SI3H 3F2GA 1QBVH 1DSUA 3H5CB 4TY6A 4OGYA 2QN5T 2Z3CA 3UWJH 2F91A 1J14A 1QL7A 2BDAA 4LXBH 1TMTH 1LKAA 5DP3A 3RXVA 1H9IE 3U69H 3ELAH 3RUOA 2H5DA 1BZXE 3ZIAD 2BZ6H 3SORA 4Y8YA 1TA2A 4F4OC 5DP8A 4B75A 5C3NA 2WUBA 4OS6A 3VXEH 2HWLB 2ZCLP 3E8LA 2XWAA 1MD8A 2YOLA 1GG6C 2WYGA 4TWYA 2QAAA 2ZO3H 4I32A 1O5BB 5KGOA 4I8JA 2ZCHP 1AHTH 1Y3VA 1QNJA 2R0LA 1PYTC 1BMLA 2GD4B 1TNJA 3PV2A 2CF9H 1KYNA 3BF6H 4Q2KA 1EATA 3TLOA 4Y7BA 1S82A 2KX4A 2ANYA 3RXJA 4NSVA 3MU8A 3LC3A 3MTYA 1O3MA 3FO8D 1C5YB 3E1XB 3RC5A 1UVUH 1KXCA 2QCYA 1G9IE 1MKWH 2BD4A 4FXGH 1MQ6A 3BTTE 2AMDA 3PRDA 5AFZH 2IN2A 1W10U 4BTIB 1IQLA 3LDXH 2W3IA 4INHA 2HLDD 1FX0B 1Y3YA 3GY6A 4X1NU 1ANCA 3TJUA 1XXDA 3TJOA 1RS0A 1OWJA 1GWAA 1A46H 1JRSA 1GI5A 1UTNA 1XVMA 1V2KT 4U2WA 5B6OA 3M7UA 1GI3A 1H8DH 3NWUA 1OWHA 1TNIA 1EX3A 3U8RH 5JBBS 3STJA 1DOJA 1MAXA 1YF4A 2G51A 2Z94A 1SQRA 1UCYE 2XYAA 2EY4C 3KQ5A 5EPNA 4WMDA 1O5GH 4X2YA 1F5KU 1UK4A 1EAIA 1A5IA 1N6YA 2Z9KA 5E0GA 1E35B 1TRNA 5GNDA 1QZ8A 1L1GA 2QE7D 1ESBA 4MNYA 1WU1A 4HTCH 3SU3A 1AB9B 1FZZA 5A0BA 1SHYA 2Z9LA 1BIOA 1NFUA 4K3JA 3P8OA 1S84A 4FUJA 5FBEA 1P2MA 1A0JA 1O2MA 4WF8A 4P02A 1P3EA 3SGAE 2GZ9A 1C2IA 3PLBA 2UWPA 4DT7B 1GI8B 1C2EA 4X8UH 3TK9A 1ELCA 3LU9B 4Z0KA 2V6NA 2BLWA 1PPFE 1AWHB 1V2ST 2C93B 3OX7U 2EA3A 1OSSA 1Y3XA 4B74A 1WBGB 1ELGA 1HLTH 3DT0H 3TJNA 3UQVA 1SKYE 2AIPA 3KHVA 1SL3A 5K0HA 3HPTB 3UNQA 1ANDA 1MTVA 1EJNA 1V2LT 1FDPA 1V2QT 4ZCNA 3SV2H 1GHVH 3MQKC 4CH8B 3ZVEA 1EZXC 2J98A 1A3EH 5FL7D 1E38B 4I8GA 5EQQA 4YO9A 1P57B 1INCA 1W11U 5GCHG 3LPRA 1JMOH 4CBNA 4HI3A 1VCWA 2HPPH 1MQ5A 2SGDE 4UFFH 5EW1H 4M7GA 4D9RA 1HYLA 1SLVB 1ELEE 1AMHA 1UTOA 2BDIA 1S81A 2GV6A 4ABEA 2QC2A 1UTPA 1DUAA 1OOKB 1S0QA 1O2LA 1AWFH 2O8MA 4Y11E 3W94A 3B9FH 2FO9A 2ZHQH 4A7IB 1C5MD 2WPLS 4CRBA 1LDTT 1JRTA 4IC5A 4Q7YA 2FOMB 1SGYE 3T25A 4NCYA 3P6ZB 2UWOA 1LHDH 3S0NA 2OINA 1D3PB 3EE0B 1TABE 2H1UA 2HNTC 2OBOA 1CA0B 5ESTE 4ASHA 2F9OA 4WWYA 2BY5X 2ZA5A 1DANH 4UFEH 1WUNH 6CHAB 1KXBA 5KECA 1QB9A 2AGEX 1Q2WA 5ETXA 1H8IH 1K1NA 1DICA 5DG6A 2BVRH 1C5ZB 1PPBH 2QF0A 4Y8ZA 2Z6BD 4J2YB 1HXEH 3QGJA 1DWEH 2AH4X 1V2PT 4WXIA 3LGIA 2VH6A 3EAJA 4K69A 2G8TA 1YM0A 1ZR0A 7KMEH 2BXUH 3OYPA 2UUJB 3KEEA 1Y3UA 2FTMA 2P3FH 4XBBA 3T5FH 1C1RA 4X6MA 1HGTH 4HGCA 1EZQA 1HB0B 3FVFB 1GDNA 4MPXA 2AIQA 1LVMA 3A88A 2GT8A 4F55A 4BOHA 3C1KA 1PYTD 1CU1A 3SV6A 3FN8A 3GYLB 3MOCA 4FU8A 1QJ7B 3LGVA 2A4OA 3RXSA 2CHAB 3S7KB 1KLIH 4ZHLU 1CO7E 4H4FA 4NIWA 3M7TA 1BJVA 2BLVA 2G4TA 5EU8A 4BAMB 2M2AA 3ZVBA 1YPGH 2KCOA 4ZKNU 5E0JA 4R8TB 1QBOA 1C1MA 3DCLA 1O3AA 1NBME 3UNRA 3MNBA 2H5CA 1ARBA 4O3TA 4QT8C 1AZZA 2KR7A 1W8BH 5GXPA 1CHGA 1HCGA 1D3TB 3MWIU 4RI0A 3PB1E 5FBIA 4NFEA 5EJZA 1BOQA 4TT3D 9ESTA 1C1QA 5GIBA 4FETA 1YBWA 3VPKA 3ZVGA 1TBRH 2W7SA 4E7NA 1IQHA 1LPGB 3D23A 4NG9H 4AORA 1O2WA 1NFWA 4IMZA 4ZKSU 3RDZA 1XUFA 5TJXA 1AGJA 2WHXA 3RU4T 2B8OH 1VGCB 1K1MA 1EB2A 1O5AB 1B5GH 3LH3A 5GJ4B 3TH4H 3AW1A 2ZHWH 1W0ZU 4R0IA 1TGCA 2GCTC 1LVBA 1GGDC 3KN2A 3SU2A 2C3SA 2QV1A 2UUYA 5GWZA 3PV5A 2DE8A 3MNCA 1ESAA 1FXYA 3M5MA 3FFGA 3SJIA 1HPGA 1V2NT 1V2JT 4UEHH 4A1XA 2ANMH 4ZHAA 2BY9X 1K1IA 1P2QA 1GBBA 1D9IA 2XC0A 2AMQA 2FODA 1EAWA 3ATWA 1FY1A 4CRDA 4ISIH 2VWOA 3VGCC 3RXGA 3GDVA 1A1RA 1SGEE 2ZFRH 1LKBA 2ZTZA 4YLUA 3ZVCA 4BTUB 3HGNA 3MH7A 1KMHB 1C1PA 2W6ID 1EFRD 2BDYA 4ZROA 3ZZ4A 1AUJA 1IQGA 3M3SA 1ELDE 4GCHG 1DLKB 1AQ7A 5ESBA 1NBMD 1HJAC 3GCTF 4UONA 4ABBA 7GCHG 3NUMA 3MO9A 2CK3D 1CE5A 2OLGA 3GCTG 1ELBA 4CRAA 4RKJB 5AF9H 4FUEA 3OU0A 5CDFE 1PQ7A 1S6FA 1ZMNA 2O8WA 1NRRH 4Q80A 1GI0A 2VIDA 3V3MA 5T6GA 4JYVH 2A7CA 3RXHA 1G3CA 2RA0A 5HXFA 9LPRA 3SN8A 2Z9GA 1OP0A 3OY5U 4RT0A 2C8WB 1DWCH 1SFIA 1P2OA 4J1YA
chains in the Genus database with same CATH topology
1L4ZA 1XUKA 3E3TA 1LPZB 2A5KA 1Y8TA 3OY6U 4D8NA 4E7RG 1GCTB 1NFYA 4D7FA 1P03A 2A7JA 3BG4C 2PW8H 2ZQ1A 1D6WA 1BRAA 1TPOA 1N8OB 3L6PA 2ZGXH 4XOJA 3CS7A 4KTUA 2ZDLA 2G5VA 4DY7B 2TGDA 1GMDF 3ESTA 5F8TA 5C1UA 2STBE 4YT6H 1YCPM 1GHXH 2XXLA 2B9LA 4A92A 5EOKA 2WV5A 1YC0A 3SI4H 3A8BA 4KKDA 3ATIA 4DGJA 3SJOA 2C90B 4AFUA 1HAZB 1O32A 1HXFH 3SGQE 1D3QB 3MNXA 3NPSA 2BVSH 4Y0ZE 1SPJA 1TAWA 5C1XA 2A0QB 2ZTYA 2D26C 2GP9B 4X2VA 1G3EA 2Y82A 1JWTA 1QB1A 2VWNA 1PPGE 1HBTH 3D65E 4Y0YE 2A4QA 1RIWC 3KIDU 4D9QA 3H7TA 2THFB 1DWDH 3SU0A 1SMFE 1NC6A 2XTTB 2ZGCA 3P92A 3IITA 3M7QA 2QF3A 2PWXA 4BAOB 2OP9A 4FUHA 3UREA 2FP7B 1O5DH 4JK5A 1MMJN 1ELVA 3E90B 1GHAF 4DOQA 3URCA 2QY0B 3PWBA 4XBDA 2ZU4A 4THNH 2NU2E 1BRCE 4GHTA 1TONA 4IN1A 1O2IA 2BQWB 1GHAG 1O2KA 1QURH 3LGTA 1MTUA 1DY8A 2J94A 2UUKB 1GL0E 4DJZB 3KNXA 1LHEH 3ZZ6A 4ISHH 4IS5A 1FN6A 2G00A 5L2ZH 1TOCB 3FZZA 2V0BA 1SGCA 3TPIZ 5JYIA 4ABGA 4ZUHA 1SQAA 2G55A 2FI3E 1EZUC 3RXCA 3SNEA 1HAOH 4X8SH 1XMNB 2Y5FA 1LCYA 1EQ9A 1O2YA 3BEIB 1GDQA 3BEFB 1G37A 1WQVH 3LH1A 3TIUA 1YPLH 2VIWA 5CE1A 5SGAE 3RXBA 3GY8A 1MTWA 2OQUA 2W26A 4OS7A 1YKTA 2PKAA 1TYNA 2VGCC 2FTLE 3SNDA 3ZZ5A 3NCLA 1QHRB 4I33A 1ZJDA 2A45B 1O3FA 3RXIA 2VVCA 4INKA 4IN2A 3SU6A 3QWCH 4DIHH 1DX5M 1Z8JB 1C5SA 1GJCB 5DPAA 5FX6A 2ESTE 1CVWH 2OC0A 8ESTE 2FOAA 1S6HA 3OSYA 1GHBF 1LVOA 3EA9A 1ZHPA 1VR1H 3BV9B 2AEIH 2OC8A 4KGAA 5JPMH 4K2YA 5CMXH 1GHBG 1KSNA 1TGBA 3GY3A 3QO6A 2QYIA 3AVZA 3KQEA 4TYDA 2ZIQH 2V35A 3GY5A 3RMLH 1DT2A 4AX9H 2FWWA 5HGGA 4CHAC 1KTTB 2K1QA 2Z7FE 4MNVA 1C5WB 2FM2A 3SV7A 3L3TA 2PSYA 4GPGA 1B7XB 3KQDA 4GAWA 2F9BH 2VU8E 3BTWE 3A82A 1FQ3A 4WJG2 6GCHF 1GI6A 1QQ4A 1W7XH 1QA7A 4MTBA 1QRXA 3PYHA 1KLJH 1SQTA 2RA3A 1BCUH 1F7ZA 3HKIB 3GY7A 2BZAA 4U32A 1RJXB 4NIVA 2ALVA 2JH6D 1HDTH 1E36B 5JDUB 1G2MA 3FP6E 2BD9A 3LC5A 1WTHD 4FUFA 2VINA 3CP7A 3ZV9A 2ZF0H 1HUTH 1C9PA 3RM2H 4B71A 1BMNH 2TPIZ 3QTOH 4Y79A 1HAVB 4WH8A 1UMAH 1N1LA 1SGDE 2FS9A 5L30H 1GCDA 1TB6H 3GCNA 4NA8A 1C1OA 4MLFB 4UFDH 2ZFQH 5FPTA 2XCNA 3F68H 3V12A 2H9EH 4MDSA 3P8GA 4H6SB 2Y5HA 3GY4A 3LGYA 1YYY1 1EZSC 1XUGA 1D3DB 2FPZA 2ANWA 2P3TB 4CBOA 2O8UA 1PPCE 1K1LA 5LH8A 1SGRE 1O3JA 1TGNA 4DW2U 1ZHMA 5G4BA 3MU0A 4K1TA 1NN6A 4B2AA 1C5UA 4A5TS 1DFPA 1FIWA 3UOPA 2IOTA 1EUFA 1UTQA 1FPHH 4VGCB 1CGHA 2PUXB 5DK1A 3SQHE 3W95A 4WMEA 3E0PB 2XBYA 5F8XA 1GI4A 2RDLA 3UNSA 5I46H 2XC5A 4O9VA 1MD7A 2Q1JA 1LPKB 1LQDB 3JZ1B 2VIPA 3PTNA 1UTLM 4OGXA 5K7RA 5FX5A 1FONA 1RXPA 3BN9A 2ODYB 4Y71A 2OUAA 3A81A 4DVAU 1MCVA 1OXGA 3R0FA 1AVWA 1C2HA 1UVTH 1P2JA 3SGBE 4TWWA 3PM3A 4GSOA 1DWBH 1QQUA 1GJ9B 3M5LA 1SB1H 1V6DA 1JXPA 1W7GH 4IGDA 4JYUH 3EQ0H 3VEQB 1SFQB 1EPTB 1K1JA 5EGMA 3SV8A 1UJ1A 1O3IA 1DM4B 1NRNH 5JBAS 1SBWA 1K9OE 2ZPQA 1VZQH 3RXEA 1KDQB 5EQRA 1F2SE 1C2LA 1FMGA 1TNGA 2A4GA 4BXSA 1C5LH 3VB6A 3UIRA 3LGWA 1U6QA 2WPJS 2DE9A 5F03A 2BDCA 4X6OA 1TBQH 1O3OA 2OXSA 4DURA 1GBHA 1DSTA 3RC6A 3HATH 2BDGA 1V2WT 2G5NA 2QIQA 1EJAA 3E16B 5H4IB 3QDZB 3AAVA 2GCHF 2Q6GA 1VJ9U 1DE7H 4A1TA 2OBQA 3DD2H 1TBZH 1ZLRA 1BDAA 2M5TA 4GUXA 1C4U2 1QJ6B 2GZ8A 1TLDA 3M37A 2GCHG 1BBRH 3I29A 3TGIE 3PO1B 6LPRA 1GPZA 4MPWA 1PPZA 4ABHA 1GHYH 1VCPA 1DXWA 2P93A 5C2ZA 3ZZDA 5LPEA 3KQBA 1F0TA 4WVPE 1ZJKA 4NA9H 4UE7H 3LJJA 1YCPK 2CV3A 5LGOA 1P2KA 2OC7A 2XWBI 3F9FA 1VITF 3SUGA 5A0AE 3P8NA 1MU8B 2Z9IA 4D7GA 4AFSA 2PKSB 3UFAA 2AGIX 1AB9C 1AZ8A 1UTJA 3SJKA 1O30A 2R2WU 1CBWB 1OWKA 2HVXA 1J8AA 1OPHB 1HAIH 4AYVB 1ID5H 3BTDE 4AGKA 1SLUB 4NWKA 4ABDA 1O3NA 4YLQH 4X1PU 4D76A 4JZ1A 1ZYOA 1QL9A 5L6NH 1V2UT 2GV7A 2ZHDA 4Y8XA 1VCQA 4I7YH 1EOLA 3DHKH 3BTHE 4ABJA 2ZPRA 1LMWB 2NU0E 8KME2 2FI5E 2GTBA 5TCCA 1YPEH 1IAUA 1ZGVA 2BQ7B 2LNCA 4NWLA 5E0HA 1TQ7B 1CSOE 1TRYA 3S9AA 1SI5H 2GKVE 1TX8A 1CA8B 1QBNA 4B73A 5CHAB 3O8RA 5C67A 4I8KA 2ZDAH 4AZ2B 2BDBA 1FAKH 1PJPA 1QTFA 3TU7H 2PTCE 1C5PA 3PO1C 5DP7A 1HNEE 1GMHF 1P3CA 4K1EA 1L1JA 1C5RA 1E37B 2FMJA 2ZI2H 1F5RA 1GMHG 3M5NA 4K1SA 3PMJA 2FIRH 3MHWU 1P01A 3EA7A 1GBEA 3T2NA 2IJOB 2Y7XA 3A83A 1UCYH 2AMPA 4OS1A 1BHXF 1K22H 3RP2A 1JBUH 1IQMA 1FLEE 2BDHA 3A87A 1AE8H 1GBCA 3PROA 1RFNA 1G2LA 1AFEH 1GJ8B 1CA0C 1CBWC 6ESTA 2ZDVH 1GBIA 4JZFH 4ZH8A 3UPEA 3RXKA 1P04A 3U98H 3QZRA 4H42U 5FPYA 6CHAC 2PLXA 3SZNA 2D8WA 2HALA 3O8CA 4XE4A 3PLKA 3A7XA 3SHCH 1O34A 3LGUA 3TITA 4JZIA 1T8LA 5JB8S 1QIXB 1LO6A 4YT7H 1E34B 2BLQA 5AVDA 1UK3A 3H7OA 3B23B 3OTJE 3MYWA 4DG4A 3TGJE 2R0KA 3KF2A 2BM2A 2HNTE 2P95A 4HFPB 3M35A 2ZHEH 1WOFA 3ZV8A 2D1JA 5C5NA 3SQEE 1AD8H 4IBLH 2PHBA 3UQOA 2VH0A 3ZZCA 2FZZA 5EQSA 1TX6A 1JIMA 3URDA 4ZAEA 3SBKA 2OCVB 2SGAA 1ZSLA 3ZYDA 3ZZ8A 1SGQE 1A3BH 4CRFA 4OS4A 3A7VA 3NXPA 2CHAC 5FXLA 4XFQA 1LHFH 2J95A 5JBCS 1WYKA 2CXVA 1XVOA 1BA8B 1OYQA 1YGCH 3A7TA 2A2QH 3S9BA 1SGNE 4LZ1H 1GMCF 3UTUH 1YLDA 1C1TA 4LK4A 1DXPA 5A0CA 2W7UA 3RXPA 3VB4A 4ZMAH 1GMCG 1AFQB 1IHTH 2FLRH 1AIXH 3BTEE 1C5VA 4Z6AH 2BX3A 3F9HA 2ILNA 3EGKH 2B7DH 2GX4A 1C1VH 1K2I1 2XW9A 1CGJE 1SLWB 3GDSA 1Z71A 5EPYA 2BD5A 1RTLA 1NU9A 2QXGA 2GVFA 1O2SA 3A8AA 1GI2A 5DJ7A 4TPIZ 3ITIA 2B0FA 3RXRA 2O8TA 4MVNA 1TNHA 1AN1E 5T6DA 4K60A 2PSXA 5FCKA 1VGCC 2GMTB 1LVYA 3ZZAA 1GL1A 1O5CB 1Y5UT 3RLWH 3U1IB 2H6MA 1HIAB 1FI8A 2F9UA 3SU5A 3BG8A 1ORFA 1W3CA 4FUGA 1MAYA 2ZP0H 2PGQB 1AKSB 1SLXB 3HK6B 2WPIS 2ZU1A 2GT7A 2VWLA 2PUQH 2ZGJA 3GICB 2P59A 1GMDG 2FOGA 1T4VH 2EEKA 4XSKU 3MMGA 3K9XB 3FZDA 3P70B 3U8TH 4X1QU 3ODFA 1OP2A 3T62A 2VNTA 3VXFH 1V3XA 5FAHA 3VB3A 4KP0A 1O0DH 3QX5H 1IQKA 1UVPA 2C8XB 3STIA 1L0ZA 4I8LA 8LPRA 4BAQB 2YNAA 1SGTA 1THPB 2H9HA 1O38A 5L2YH 1CGIE 2ZGHA 3I78A 1C5OH 1ZPBA 1Y59T 4MG3A 3A7YA 3RU4D 1ANEA 1F0SA 2JKHA 4K8YA 2QXHA 4FUDA 3T29A 1ZTLA 5DP5A 1O35A 1A0HB 2VWMA 2PR3A 2FDAA 4AFQA 2ZFFH 1SGFG 1GHZA 5HM2A 3SOSA 1MBQA 1GVLA 1C2GA 2TBSA 2A31A 2A7HA 1YP9A 1O3CA 2H9TH 2SGEE 3ZVAA 1UTMA 2I6QA 4FVBA 2VVVA 4X2XA 2HOBA 1ZTJA 1C2JA 4YOIA 5PTPA 4SGAE 1O33A 1GCTC 3QK1A 1NT1A 1ZZZA 3DA9B 1GI7B 1E0FD 3K65B 2GMTC 4X1SU 3V13A 1G3DA 1SGPE 2A1DB 1N8OC 2EI7A 1K21H 3KQCA 2KAIB 1DPOA 1QRZA 1C2MA 3ZZBA 4CRGA 1YPHE 1KXDA 1C2KA 1UHBB 1A5GH 1O3PB 2AGGX 2Y7ZA 1FJSA 2XBXA 2FEQH 4AG1A 3HGPA 1K28D 1AY6H 1GBTA 1O2UA 2D2DA 4UD9H 1ELFA 5A8XA 1PQ8A 3MFJA 2O8LA 4SGBE 1CT4E 2OQ5A 3JZ2B 2GZ7A 2NWNA 2G52A 2QGRA 1TGTA 2VIOA 4B2CA 2HRVA 3RC4A 3SNBA 1MZAA 2XBWA 1BUIA 3RXLA 2F9VA 4NFFA 1NS3A 2BYAX 4X6PA 3A89A 1ETSH 4BTTB 1A0LA 1GG6B 2J34A 3KGPA 3IG6B 1TWXB 2RCEA 1BRUP 4WMFA 1P05A 1O3LA 2BTCE 3BTQE 3VB5A 1BTPA 3F1SB 1G32B 1WAYB 1GBDA 3A84A 3PMBB 2ZPSA 5FCRA 4KTSA 1ZTKA 1V2OT 1Q3XA 1Y5BT 1P9SA 1OWIA 2Y5GA 1QCPA 1Z8RA 3FANA 1QL8A 3RXOA 1MZDA 1EP5A 4AOQA 3L33A 1LQEA 1YCPH 2ZTXA 4O03A 1EJMA 3MU4A 2ZEBA 1C4Y2 1SSXA 1DS2E 1GI9B 1EAUA 1VJAU 2ZG0H 3P17H 3ZYEA 4IMQA 1OS8A 5EW2H 5I25A 1L4DA 2LPRA 1P06A 5HYOA 4A6LA 1RTFB 4PROA 1B0EA 1FNIA 6GCHG 3M3VA 5DP4A 4DCDA 1C1WH 1B0FA 1HAXB 2WYJA 2FYQA 2V3OH 4UFGH 3RMOH 2ZC9H 2VIQA 4LZ4B 1O2GH 3NK8A 5A8ZA 3RXUA 5DKMA 2FOCA 2J2UA 3A85A 2BX4A 5J4SA 1HAVA 2FLBH 4GHQA 1FY8E 2O9QA 3K2UA 1Z7KA 2XCFA 2ALPA 1S5SA 1TQ0B 1GJDB 2VB0A 4CRCA 5ABWA 1N6XA 1G36A 1C5QA 1TRMA 2NU3E 3PMHB 2QA9E 2WPHS 2ZFTA 1J9CH 3SV9A 2PGBB 1F92A 1HJ8A 1RTKA 3M3TA 2BY7X 2NU4E 2EC9H 5IDKA 2HGTH 3FP7E 1WTGH 3BTFE 2AFQB 1DDJA 2XRCA 1GHWH 1SOZA 3A86A 1XKAC 3LT3A 1QA0A 3TGKE 3MI4A 4Y6DA 1P9UA 3M61U 1YLCA 1KTSB 3GY2A 1EXFA 4X2WA 2EI8A 1A61H 2ZU3A 3QTVH 1GJ7B 2A5IA 3P95A 3A8DA 2CF8H 1AUTC 1EP6A 3PWCA 1NRSH 1O3EA 2R3YA 2ODPA 4I31A 1HAGE 3C27B 1HAPH 3BEUA 5DGJA 1W14U 1O2RA 2SFAA 4CH2B 4O3UA 1WQSA 1ABJH 1ELAA 1GJBB 3RMMH 3E91A 1C4V2 1JIRA 4TY7A 4YM9A 3P8FA 2ZU5A 1BTYA 2C8YB 1T4UH 2F83A 1EPTA 1MKXK 1O2OA 1FY3A 1SG8B 4E06H 1BHXB 1H4WA 2ZHFH 2BOKA 3TJVA 2OTVA 3A7ZA 2ANKH 1D6RA 1MH0A 4RSPA 1OX1A 1KDQA 1FY5A 3U9AH 1MTNB 1T8MA 1Z6EA 3T26A 4Y10E 3O8BA 1KXFA 1QY6A 4IC6A 1XUHA 1QFKH 4E05H 3A8CA 1O3KA 3EYDA 4NSYA 3N7OA 2UWLA 1S0RA 2TGPZ 5LPFA 1FN8A 1CQQA 1GBLA 1W0YH 1A4WH 2CJIA 4NIXA 2Z9JA 2WPMS 4CREA 2B5TB 2C4FH 4Y76A 3SJ8A 1O37A 1AO5A 2WPKS 4FUBA 4MQAA 5TCAA 4BAKB 4MPVA 3ZZ7A 2SGQE 1QRWA 1O39A 1QB6A 1ZRBA 4ZXYH 3Q3XA