4AGJA

Crystal structure of the capsid protein (110-267) from aura virus in complex with dioxane
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
152
structure length
152
Chain Sequence
DRTFAVKNEDGKIMGYAVAMEGKVIKPLHVKGTIDHPALAKLKFTKSSSYDMEFAKLPTEMKSDAFGYTTEHPEGFYNWHHGAVQFSGGRFTIPTGAGGPGDSGRPILDDSGKVVAIVLGGANEGARTALSVVTWNKKGAAIKTTHEDTVEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Aura Virus Capsid Protease and its Complex with Dioxane: New Insights Into Capsid-Glycoprotein Molecular Contacts.
pubmed doi rcsb
source organism Aura virus
molecule tags Hydrolase
molecule keywords CAPSID PROTEIN
total genus 30
structure length 152
sequence length 152
ec nomenclature ec 3.4.21.90: Togavirin.
pdb deposition date 2012-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4agjA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4agjA01
3TGJE 4ABFA 1RS0A 2FODA 2R9PA 1W11U 1K2I1 2W3IA 3UWIA 1TBQH 3VEQB 2A4RA 1WUNH 1WTGH 2ZTZA 4ZHAA 3PWBA 4XBBA 1DFPA 3QUMP 1PQ5A 4FUEA 1P2OA 3ZVBA 5F03A 1S81A 1XXFA 2VGCC 4I8LA 1TOCB 3SI3H 1T4VH 4I33A 2ODQA 4OS6A 4X6PA 2VIDA 5C20A 1DLKB 1EJNA 4K5ZA 1ZLRA 1BHXF 1UTLM 1ZJDA 2J9NA 2Y5HA 5L6NH 2Y7XA 4WMFA 5JB8S 1ZR0A 1KDQB 3RUOA 1GMDF 2OP9A 4AFUA 1AY6H 3ODFA 2G52A 4DY7B 5C5NA 1GCTC 1TONA 3BTKE 1ZMLA 1J14A 4XOJA 5FHTA 1NRNH 2FOHA 1XUHA 3PTNA 2OBQA 2I6SA 8GCHF 1ZTLA 4NA8A 1OWIA 3BEUA 3TPIZ 3A7TA 2WPMS 1HUTH 1ESTA 1TPPA 1YPJH 2GV7A 1TQ7B 2OC7A 2H9TH 3SUGA 1ABJH 4AGKA 4ISIH 3TGKE 2VIPA 1PPFE 2HNTC 1P02A 1SMFE 2NU3E 3SHAH 4AFSA 1IOEA 1PPHE 2ZFRH 1C2IA 4X1SU 4M7GA 4YLQH 1ZMNA 3S9BA 3MO9A 3OY6U 3A8CA 3KIDU 1S83A 4IBLH 1CT4E 4ISLA 1GBFA 1YC0A 1THPB 1AFQB 1P2IA 3LGYA 4XBDA 3RXGA 1ANDA 1SQTA 2PUXB 2P59A 1AIXH 1EJAA 1SGRE 2C8YB 1THRH 2K1QA 3MU0A 4K8YA 2A0QB 1O33A 8GCHG 1ANCA 1JIMA 4ABHA 1VGCB 1B7XB 1BRCE 1N6YA 3B23B 3K65B 2XC0A 1Z8JB 3STIA 3ZVCA 3SU6A 1DS2E 1TGCA 3CS7A 1ETTH 3M5MA 3VB6A 1D3QB 3S7KB 1Z8RA 4JZEH 1FAKH 4ZKNU 3T28A 3C27B 3GDUA 1MKWH 5DO4H 2OC8A 1RTLA 2UUKB 1UTMA 3JZ2B 1JXPA 4JMYA 1SC8U 2JH6D 4B73A 5L2YH 1YLCA 3LU9B 4X8VH 1O3OA 2VVUA 2PWXA 1SOTA 2WINI 3TIUA 3MTYA 4U2WA 3SJ9A 2QN5T 1H8DH 1ZSLA 3BG4C 4H6TA 3SV7A 1P04A 1WU1A 4KTUA 1SGPE 1INCA 3GYLB 3PTBA 1QBVH 1U6QA 1UTNA 2OINA 3RLYH 2ZTYA 4CHAB 3B9FH 1ZMJA 3SQHE 1LHDH 1GI9B 3HKJB 3ATMA 5DP8A 1Z6EA 3VGCB 4DIHH 1GDUA 2PSYA 1F5RA 1T8NA 1HV7A 3GCNA 1JBUH 2PTCE 2P3UB 4QT8C 2Z9GA 3GYMA 3Q77A 2UUJB 3M3SA 3MI4A 1LTOA 2D26C 2EI8A 4Q7XA 2ZDMA 2XNIA 3GY6A 4IN1A 3RXPA 3U8RH 1FDPA 1A0JA 2D2DA 3MH6A 4X6OA 1TRNA 2QC2A 1WQVH 1XX9A 1QRZA 2UUYA 4XBCA 2ZFSA 4I8KA 1P0SH 4TWWA 2A2XH 2XC5A 3ODDA 3RXDA 1F92A 1C5OH 1EPTB 3QDZB 1HLTH 3RC5A 4I8GA 1T8OA 1TPOA 1Q2WA 5CHAB 3BF6H 2BM2A 1TRMA 3SORA 1WTHD 4GPGA 3PYHA 3EYDA 4NZQA 4LZ1H 1QJ1B 3B8JA 1T32A 1QBNA 4OS4A 1ZGIA 2B9LA 2BHGA 1UMAH 2FOGA 3A89A 1TGBA 4YT7H 1GBTA 5LGOA 3A8DA 3RU4E 1HAYB 1Y3UA 3E8LA 1KLJH 4IMQA 4MNVA 2A45B 2F9VA 1QY6A 4K2YA 1UVUH 4K3JA 1MQ5A 1CA8B 2OLGA 5FPYA 1HDTH 1A3EH 4BTUB 1KLTA 2O8MA 5GCHF 3AW1A 3RXKA 4FXGH 3BTWE 1P06A 5HXFA 3R0FA 3QLPH 2W5EA 2ALVA 2OQUA 3NUMA 1AQ7A 4Y0ZE 2RCEA 3LGWA 1Y3YA 1O3FA 2KAIB 4J2YB 1C1RA 2UWPA 2ALPA 4I7YH 1AMHA 3P8FA 2IJOB 1DANH 1IAUA 3K6YA 4WXIA 1C2MA 5HMAA 2WYGA 4ZKOU 1RIWB 1V2ST 5PTPA 1J8AA 3NK8A 1TA2A 2ANKH 5DGJA 1P2QA 3F6UH 3GICB 2BDAA 1OSSA 1O2RA 4DIIH 2AGEX 1ESAA 4K8BA 1MKWK 2BX4A 2F91A 5SGAE 4WY3A 5JPMH 2FZZA 1UO6A 3EAJA 4IGDA 1O5BB 3RU4D 1MCVA 1GJ4H 1FY3A 1NTPA 1O3MA 1NU9A 2PW8H 4A7IB 1L0ZA 2BLQA 1Y3VA 4D9RA 3N7OA 1HJ9A 1SI5H 3F9EA 3FFGA 1HPGA 1KLIH 1DICA 2ZGBH 3E3TA 4HI3A 4CRFA 1LQEA 1V2LT 4MPWA 5J4QA 2QXGA 3OU0A 2AERH 1A3BH 1OWEA 1LHEH 1AE8H 3SQEE 2XRCA 1AZ8A 2QF3A 2FTMA 2R0LA 3ZZCA 1V2QT 2SGPE 1SHYA 1O2QA 2OXSA 3LC5A 4O97A 2PLXA 2Q6GA 1CA0B 5FX5A 1GI7B 5JBBS 3LONA 1LCYA 1O2UA 1KXBA 1V2OT 2GT7A 4NG9H 1FIWA 2HNTF 4ABGA 2VIVA 4INLA 1WV7H 1T8LA 3LKWA 1B5GH 1CGHA 4E7RG 2TGTA 2XTTB 3KNXA 1A46H 2GMTC 5TCCA 3URDA 2GKVE 3KQDA 1EAUA 1K1MA 1TOMH 4FUBA 3MH7A 3ZZAA 3U69H 1S82A 1TB6H 1TYNA 2VGCB 1OP2A 3AW0A 4FUDA 1JIRA 2SGEE 1GHAG 4KGAA 1NZQH 4DURA 3VXEH 1O5GH 1BUIA 1EZUC 3V13A 2ZZUH 1MBQA 1VR1H 1GVZA 5T3HA 3BTTE 2BY8X 2DE8A 4WH8A 3SUDA 1KXDA 1WCZA 3LDXH 4WVPE 2F3CE 1O2ZA 4ZAEA 3AAVA 5LPRA 1KY9A 2CXVA 1TMUH 3HKIB 2A5KA 1OWKA 4ZKRU 4KELA 3NCLA 1GPZA 3MU8A 3RXEA 1XVMA 4UFDH 2HNTE 4CRBA 2Z9LA 3NKKA 1CBWC 3EQ0H 3SNEA 1G9IE 1PQ7A 2PKSC 5HM9A 4FU9A 3MMGA 1AO5A 3UY9A 4JZDH 4ABBA 5TCAA 3SU1A 3RXLA 3RXJA 2OTVA 2VIOA 3SUFA 1TIOA 2J92A 3EA8A 1E36B 3UOPA 1ZRBA 5AFZH 1RGQA 3FP7E 3F9FA 1O5CB 1GBHA 1GCDA 2PUQH 3SHCH 1DY9A 3DUXH 2GVFA 1HBTH 1QHRB 1GG6C 1E38B 2QXHA 1GJDB 3GDSA 3OSYA 7KMEH 2UUFB 1ELVA 3TJOA 5EW1H 3ZVEA 1AFQC 3D49H 1O3LA 1ZGVA 3LGVA 1NY22 1IQKA 3Q00A 5EU8A 1NPMA 3SV8A 2H9EH 1Z71A 4GUXA 5ESTE 5DP5A 1TNJA 2W7UA 4RN6A 1MZAA 2W7SA 1TMTH 2BXTH 2ZFQH 4MTBA 1QBOA 1SLUB 1EPTA 1IHSH 1TNKA 3GCHB 1Z8IB 3RXFA 2ULLA 1BTPA 2BOHB 1E35B 1GHXH 1NC6A 3NXPA 1F0SA 1QL8A 3VPKA 1QIXB 1AWHB 2SNWA 1T8MA 2F9UA 4MPVA 2HLCA 1CT0E 1ABIH 1XXDA 4BAQB 3SV2H 2CHAB 3BEIB 2GX4A 3QK1A 1BMNH 1HIAB 1VITF 1TRYA 2BDIA 3SGBE 1EXFA 1AE5A 2VIQA 1HAIH 2BD4A 1TWXB 3ZYEA 2SGDE 2RA0A 5J4SA 3ZVAA 4D9QA 5EQSA 1GVLA 4ABIA 4OS2A 1ELCA 1HAVA 2ODYB 3QWCH 5F6MA 4LXBH 3V7TA 1GHBG 3RXIA 1GL1A 2J95A 2ZPQA 1AB9C 5A8ZA 4JK6A 1K22H 3EE0B 1BB0B 4GSOA 8KME2 1W14U 2TGDA 5EQQA 1LVYA 4GCHG 2FS9A 2R3UA 3VGCC 2ZHWH 2B0FA 2NU1E 1UJ1A 3I77A 2RG3A 1RRKA 1GL0E 3GCTF 4A6LA 3RXRA 1AHTH 3Q76A 2H2ZA 1ETRH 3MU4A 1MD8A 2QY0B 3TU7H 1QRWA 3SGAE 2OCVB 2HOBA 1BMMH 4X8TH 3HGPA 1RJXB 3RXBA 4AZ2B 1O3NA 3HPTB 3EA9A 1TFXA 2V3OH 3E16B 2ODPA 2ZU3A 4FVDA 4RKJB 5FXLA 1CGIE 1GI3A 1BITA 3E90B 1J17T 1IHTH 1C1MA 1G3DA 2BLOA 1O2GH 3RP2A 1C5ZB 2EI7A 3K9XB 3P70B 1VZQH 1W13U 3TITA 1HIAA 5AHGH 3VFEA 4BANB 2RA3A 1EJMA 1AU8A 2ZHQH 1C5UA 2ZC9H 1P03A 1HAOH 4B2CA 5JBTA 1UHBA 1D3TB 1GJ7B 2EC9H 2FO9A 1V3XA 3UREA 1C5VA 2ZDNA 2JKHA 1GJ6A 2FX6A 3V12A 3LGUA 6GCHF 4JYUH 2XW9A 2Q6FA 1WAYB 4XE4A 1BJUA 1CE5A 1F0UA 2NU4E 3T62A 2Y82A 3M7TA 1P2NA 3A81A 1J15A 3O8RA 4DJZB 3RU4T 1YPMH 1LPZB 2ZDAH 4J1YA 2WPKS 4R8TB 1EZXC 2ILNA 1S85A 1WBGB 4I8JA 1MKXH 1XM1A 5FAHA 3MNBA 1BTXA 4NIVA 2B5TB 4OGXA 2ZHEH 1AVWA 4IN2A 1TABE 3LGTA 2W3KA 2P8OC 2HPPH 3PWCA 5EOKA 3GISB 4Y6DA 1PYTC 3BTHE 1AUJA 1ID5H 2ANMH 2PSXA 1O5EH 3ZZ8A 5BPEA 3KHVA 1O3JA 2P95A 1MAXA 2ZHFH 1OYQA 2P8OB 2TIOA 1KDQA 3GY2A 4CRAA 1ARBA 1C5YB 1K1IA 1IQMA 1YGCH 4NSYA 4OGYA 1UK4A 3SZNA 3NWUA 3GY5A 3PMJA 4UE7H 1UVSH 3MO6A 4RKOB 2BB4A 1FV9A 1MU6B 4AFQA 1EP6A 4K1EA 5T6GA 4YLUA 1O3IA 1O2WA 2B7DH 4NIYA 2ZGCA 1OWDA 2JETC 4CRGA 3MYWA 1BBRE 1M9UA 3STJA 3SJIA 2PKAB 1OWJA 3QZRA 3Q3KA 1IQEA 3P95A 1C2LA 3PLKA 5EPNA 3QGJA 1DPOA 4BNRA 2BZ6H 4Y10E 3UWJH 2Z3DA 4NA9H 1HAXB 2SGQE 4YZUA 3TVJB 1FN6A 1H9IE 1W2KH 3H5CB 1YKTA 1QURH 3SO3A 3SUEA 1SGEE 3HK6B 4OS1A 3PO1C 4MVNA 4ABAA 3WY8A 2V3HH 4K60A 1QTFA 7LPRA 5F8XA 2YNAA 6CHAB 1EKBB 3A86A 1XUGA 3FP6E 4NA7A 5BRRE 2FYRA 4LK4A 1S0QA 2QF0A 1FN8A 4ZMAH 3HK3B 1Z1JA 1O2JA 8LPRA 5GWZA 3VB7A 1LVBA 3RC6A 2XYAA 3K6ZA 1NT1A 1EZQA 2GZ9A 5GIBA 3KQCA 6LPRA 1HJ8A 1FI8A 2Y6TA 1K1OA 2QV1A 1W7XH 2AYWA 2A2QH 1BBRK 2BD7A 2SGFE 2QAAA 3LC3A 3RXQA 5IYTA 1P9UA 1QCPA 2FOAA 1L1NA 1XKBC 1DXWA 2VINA 1FY8E 1VCQA 5FX6A 3FANA 4ESTE 4B2BA 4MDSA 4AYYB 1IQHA 1TX6A 4X1RU 1G2LA 1MTVA 4GLYA 1TNGA 2TPIZ 8ESTE 1A4WH 2ZP0H 4K1SA 3LJJA 2SGAA 3ATIA 3O8DA 3KQEA 3DD2H 3GDVA 1BHXB 9ESTA 2IOTA 1EOJA 3RXVA 1BZXE 1DWBH 3GY7A 1G37A 1MH0A 4CH2B 2UWLA 4MNYA 5E0HA 5HYOA 3NPSA 4WH6A 1ETSH 4BTTB 1Q3XA 1O3HA 2G5NA 2ZU4A 1V2TT 2WV4A 3TK5A 1GBCA 3ZZ5A 5A8XA 4BTIB 3E0NB 3P17H 3S9AA 1C5MD 1QA0A 2I6QA 4H42U 1PYTD 1DSTA 1UVPA 1O2PA 1ORFA 3RLWH 1G3BA 1TMBH 3F1SB 1IQLA 2A31A 2OBOA 1UTKA 2ZU5A 5HM2A 3A7VA 1Z7KA 1NESE 2BMGB 2RDLA 4INKA 2FLBH 5DP7A 1VJ9U 3BIVH 3O8CA 2STAE 1DWEH 1QL7A 1GBDA 3BTQE 3IITA 3KGPA 4BAHB 3TJNA 2NU2E 1P05A 2FYQA 4HGCA 1GI2A 3Q3YA 5A0CA 3I78A 1B0FA 4X6NA 5C1YA 1HFDA 1A1RA 3M36A 1O2LA 2BD5A 1WOFA 1ELBA 1O2OA 1BRBE 1W8BH 1PJPA 2VWOA 3E6PH 7ESTE 1AKSA 1L1GA 5GXPA 1QL9A 1SGIB 4B1TA 3A7ZA 2A4OA 3D62A 4YESB 3A85A 4X2WA 2A32A 2CHAC 4UD9H 1JWTA 4JYVH 2AS9A 2C3SA 1LQDB 1NRPH 2Y80A 2NU0E 3ZYDA 2JETB 3MNSA 1O5AB 1SLXB 2P3FH 2G51A 4F4OC 4TWYA 2ZWLH 3GY3A 2YOLA 2VIWA 1OKXA 1AN1E 3F68H 1GHVH 3NZIA 3BTME 2H5DA 2P94A 2F9BH 1V2UT 3TH3H 4X2YA 1BQYA 1CBWB 1O35A 4NIWA 1UK2A 4ZHLU 5EODA 3PV4A 3W95A 1VITH 1C5XB 4NSVA 1Y3WA 1Q31A 1C5PA 2CF8H 3SNBA 1GJ8B 3GOVB 1NM6A 3FZZA 3LH1A 1KIGH 4DVAU 1GMHF 4JZFH 1F2SE 1GJ9B 5K7RA 2ZI2H 1VCWA 4BAOB 5EXLA 3SJ8A 1GWAA 1EAXA 6CHAC 3P92A 2BDBA 2BQWB 2R0KA 2FDAA 2HALA 4NFEA 1NU7B 4SGAE 3VB5A 3V3MA 1AWFH 2H1UA 2G81E 3SV9A 2Z9JA 2V35A 1Y59T 1SGQE 4FUGA 3A80A 3HGNA 3QZQA 3PLBA 2ZO3H 2QXJA 1TGTA 4Y7AA 1IQIA 2XCNA 1BRUP 1UVOA 3SOSA 1C5RA 2GZ8A 5B6OA 4X1PU 5L30H 5CE1A 1BDAA 1FMGA 1O31A 1C1OA 3RMMH 4X6MA 3LJOA 1O36A 4XFQA 1XUFA 1LMWB 2TGPZ 4CBOA 2ZEBA 1MZDA 1TLDA 2FM2A 3BSQA 1XUKA 4PROA 4TYDA 2VWMA 1CGJE 2H9HA 1CQQA 1GJAB 1C1VH 1GI8B 3MNCA 1GBBA 1A5IA 2ZNKH 4B71A 1O30A 1ZOMA 6ESTA 2FI3E 5FBIA 5C67A 5FCKA 4CRCA 1DWCH 3A87A 4X2VA 2PV9B 1GHZA 4HTCH 4TY6A 1SR5C 1T4UH 1RTKA 1ZHMA 3SU0A 4JK5A 1A2CH 4FUJA 1YPHC 2QCYA 2SFAA 1PPZA 3FVFB 5LH8A 1SGFG 4IC5A 1VITG 2Y81A 3H7OA 3H7TA 2A7JA 3RMLH 2C90B 1QB6A 1WSSH 1S5SA 3GCHC 1DUEA 1HAGE 1KXEA 4YOIA 2BDCA 3S69A 5DP3A 1P11E 1MCTA 2FPZA 4JCNA 1GDNA 2ZPSA 1O2KA 1TNIA 2GDDA 5EGMA 1HGTH 5H4IB 1K9OE 1SGFA 1XMNB 1ELGA 1GHWH 4X8SH 5I25A 2GDEH 3U1IB 3L3TA 1C2GA 3CENA 1ZPZA 1GI1A 3PMAB 1TNHA 1G3CA 2G55A 1FY4A 1NFUA 1ZTKA 5FPSA 4NCYA 4Z6AH 5DP9A 1HXEH 5C1XA 1O3BA 2ZECA 4FUCA 1LDTT 2GCTC 2FTLE 1TNLA 1V6DA 1O2NA 1TA6A 1BT7A 3M37A 1HYLA 1Z8GA 4X1QU 3E1XB 4E05H 4AGJA 2VH0A 2FWWA 4A1VA 3A8BA 2FOEA 4YM9A 1SGNE 1OP0A 4NWKA 4X1NU 2F83A 4MNWA 4WF8A 1O3KA 1DLEA 1W10U 4YOGA 3ZZBA 2PGQB 3BEFB 2C93B 4WXVA 1GCTB 3BV9B 1SQAA 2ZTXA 5DJ7A 2CV3A 4ZROA 4ZKSU 2P3TB 1D6RA 1MQ6A 4CREA 1E37B 3UNSA 3TNTA 1UCYK 1VCPA 3RXTA 3PMBB 2BY7X 4WMEA 1F7ZA 1MUEB 1GI0A 1NS3A 5T6DA 5FCRA 4Y79A 1LPKB 1W0ZU 2F9PA 2ZF0H 1C4Y2 1GG6B 1SSXA 5AVDA 3DT0H 3TJVA 1ZSKA 4AG2A 3ZZ3A 1XUJA 5FPTA 1OPHB 5AFYH 3M35A 4VGCC 1YP9A 2VNTA 1O2VA 3TGIE 2ZU2A 2FOBA 2G00A 5E0JA 5HGGA 2R2WU 1GBJA 2VWLA 4HFPB 3PMHB 1SQOA 2VJ1A 2BD8A 2ZCKP 3FZDA 1A5GH 4VGCB 3DFJA 3CP7A 3ZV8A 5DKMA 1QB1A 2WPHS 2XCFA 3E91A 1YCPM 1HRTH 1CU1A 1PQ8A 4ISHH 3P6ZB 2BX3A 3GCOA 1AKSB 1DY8A 3SNCA 1AZZA 1P3EA 2XBVA 3AASA 1TALA 1FY5A 1GJ5H 3SU2A 4CBNA 3IWMA 1RXPA 1CHGA 1NRRH 1UCYE 4JYTA 1CSOE 2GCHF 3AVZA 1HAPH 1F0TA 3P8GA 5EPYA 1YPGH 4E7NA 3F9GA 3TH4H 2O8WA 3L33A 1GHBF 3RM0H 1J9CH 2GZ7A 2VU8E 3ATLA 3ESTA 2CN0H 1FJSA 3A7WA 3SU4A 1WYKA 1EATA 2WUBA 4X0WU 5DG6A 2ZCLP 1MKXK 3ZVFA 2BDYA 4H6SB 4CH8B 1KTTB 3KCGH 4AN7A 1QNJA 4ASHA 1MU8B 2ZKSA 1P10A 4TPIZ 1B0EA 1C5NH 1C9TA 1AGJA 2C8XB 3KL6A 1TGNA 2ZQ2A 4GHTA 4UFGH 1KSNA 5T6FA 4AORA 5JBCS 1HAVB 3RXAA 3ZVGA 2IPHA 4MQAA 1V2JT 3LPRA 1NFYA 3GY4A 2PGBB 4E06H 1SGTA 2FXRA 1F5KU 1W3CA 2HRVA 3UPEA 1D6WA 1C4V2 4WMDA 5FBEA 1SLWB 4CRDA 1JMOH 2WUCA 1GHAF 2NWNA 1A7SA 3E0PB 1YCPK 1BMAA 3AAUA 1V2PT 3Q3XA 2EI6A 1BA8B 3LH3A 1YM0A 3M3VA 1O32A 5CMXH 2J34A 3UR9A 1RFNA 2AIQA 4ZUHA 3RXCA 4MNXA 5E2OA 4A1XA 1DUAA 3MNXA 5GDSH 3RXOA 2F9NA 1QA7A 3P8NA 3D65E 1GBAA 1FONA 2PTNA 1QQ4A 3BTFE 1IQNA 1C1WH 1XVOA 2J4IA 2WV5A 1P3CA 1L4ZA 1QFKH 3UNRA 1GMHG 1HNEE 2BQ6B 1ZSJA 4FUIA 4O3TA 2PHBA 3RXMA 3S9CA 3SGQE 1OP8A 1YYY1 3PO1B 1DM4B 1Z6JH 1KXCA 4K1TA 1S6FA 3KF2A 1N8OC 1V2KT 4GVUA 2BDGA 5I46H 4ZXXH 1ZYOA 3MOCA 3RXSA 3TLOA 2OD3B 1ZPCA 1W12U 3U8TH 3RXHA 4Q2KA 3VB3A 5EW2H 1EOLA 1O3AA 4Q80A 1C5WB 1P09A 2AGIX 3ATKA 3I29A 1O37A 1N8OB 3T26A 3M7QA 2ZGJA 3EA7A 1G32B 3C1KA 4KP0A 2ZFTA 1TBRH 4X2XA 1ELTA 5GCHG 1O0DH 1YCPH 1YPHE 2HVXA 1A61H 1P2KA 2D8WA 3QN7A 1FPCH 2ZPRA 3EGKH 2FESH 4FU8A 1MTSA 1THSH 4XDEA 4ABEA 7GCHF 1N1LA 3MFJA 5DPAA 3SJOA 2CJIA 3ZZDA 1DITH 4Y71A 2VB0A 4B2AA 2CF9H 1GVKB 3KQBA 1FUJA 3SN8A 1EP5A 1GHYH 1TE0A 5JBAS 1BJVA 5ABWA 2FI5E 1DSUA 2BD3A 3U98H 4B76A 2Z94A 1DE7H 1K1NA 1O2MA 1P9SA 3BTGE 4WWYA 2ZDVH 4U30A 2A4QA 5C1UA 3RM2H 4HZHA 3RXUA 3SJKA 2O9QA 3VB4A 5IDKA 4Y76A 3U9AH 2BZAA 1NRQH 5A2MH 4FUFA 5LPEA 4A5TS 2AFQB 1C5QA 4FUHA 1C5TA 3ZZ6A 1IQFA 1X7AC 2ZDLA 1SHHB 1SGDE 1H1BA 1PFXC 2FI4E 1S6HA 3QTVH 4OS7A 4NIXA 1EZSC 1C9PA 5E8EH 1D3DB 1UTQA 1ZTJA 2HGTH 1C5SA 2FEQH 5JYIA 3MU1A 1SGYE 4B74A 4TPYA 2ANWA 2Z7FE 1Y5AT 1HJAC 3T2NA 2Y5FA 2BQ7B 2FOMB 1BCUH 1BIOA 2QA9E 1GBMA 3MO3A 4D8NA 1TPSA 1UCYH 5C2ZA 2G8TA 2WPJS 4AYVB 5A0AE 1GGDB 5LPFA 1GI4A 1NRSH 4WJG2 1HJAB 3UIRA 2BVSH 4UDWH 4F49A 2JH0D 2B8OH 1L1JA 4BAKB 1SL3A 1LHCH 3A82A 1OS8A 1GJBB 2GGVB 1MMJN 1K1LA 2DUCA 1NN6A 3U8OH 2BTCE 2AMQA 4AOQA 5C3NA 1IQGA 3OYPA 3PB1E 1QQUA 3SV6A 2OUAA 2Y7ZA 2H6MA 4D7GA 1GI5A 1LPGB 3M5LA 1BOQA 4DCDA 3ATWA 3M5NA 1CHOF 2XXLA 3A7YA 3TNSA 2ZGHA 1A5HA 5CHAC 3RC4A 1D4PB 4DT7B 5JDUB 1C2KA 2XBXA 1LO6A 4Y0YE 1N6XA 1EX3A 2Z9IA 1O39A 1P57B 5DK1A 2A1DB 2P16A 2C4FH 5G4BA 3GY8A 1OX1A 2ZQ1A 3O8BA 2BLVA 2FIRH 4BOHA 3ENSB 2BD2A 3LIWA 4NFFA 1DWDH 3SBKA 1FXYA 3M61U 2V6NA 3TH2H 1P12E 5ETXA 4MLFB 2WPLS 2GCHG 1V2WT 1BTUA 2BVXH 1TX8A 1FPHH 1DVAH 1GBLA 1C2EA 3L6PA 1TQ0B 4AB9A 1H8IH 3GCTG 3UR6A 1C1TA 2ZA5A 5DP4A 3UUZA 3URCA 1AI8H 3FP8E 5F8ZA 1C2HA 1GMDG 1ELFA 2ZDKA 5E0GA 4JZIA 5EG4A 3SU5A 1EB1H 2CGAA 2FMJA 4Y8YA 1BMLA 1SPJA 1LVMA 3T27A 1TX7A 1Y8TA 1YPLH 4UEHH 1DT2A 1GDQA 4NWLA 1ZPBA 2A4GA 2GD4B 4GHQA 5A09A 1WQSA 1UTPA 5EXMA 5EQRA 3SW2B 3TK6A 1RD3B 4Y8XA 2J38A 2JH5D 4LOYH 2G4TA 3TJUA 2ZG0H 3PM3A 4RSPA 2GV6A 3ZZ4A 1V2RT 1C1PA 3HATH 2AGGX 2GCTB 3A88A 4BAMB 2LPRA 2ZCHP 3MH5A 3A83A 3TK9A 1ELEE 2QGRA 1C1UH 2O8UA 1K1JA 1Y3XA 1XKAC 1TGSZ 4Z0KA 5F8TA 1O3EA 3ITIA 4KKDA 4KTSA 3P8OA 1FAXA 1G30B 2FOFA 1D3PB 3M3TA 1KXAA 4D76A 3LGIA 2R2MB 1OYTH 4I8HA 4O3UA 1K1PA 1SOZA 1KYNA 4IS5A 4GAWA 1SG8B 4ISOA 2P93A 1JRSA 5A0BA 1P01A 1EAIA 2F9OA 1MTNC 2W26A 1ELAA 1O2HA 1L2EA 2BD9A 1FY1A 4MG3A 4U01A 5GPIB 2ZU1A 2R3YA 1A0LA 3F9HA 2C8WB 1ZRKA 1AVXA 1F0RA 4Q7YA 1EASA 2XBYA 3SU3A 2AMPA 1PQAA 1SGCA 1QB9A 3QX5H 2QXIA 2EEKA 2A7HA 1ZHRA 2Z6BD 4UFFH 1NO9H 1SB1H 2PR3A 1YBWA 1CVWH 4XSKU 2BY5X 1GBEA 1W7GH 1V2NT 1Y5UT 4DOQA 1KTSB 2HPQH 3QGNB 4R0IA 1EPTC 1W0YH 1MAYA 5AF9H 1DXPA 2HWLB 3ZVDA 4INHA 3LT3A 4KTCA 1V2VT 1VGCC 2XWBI 1RIWC 2A7CA 2VVCA 3MHWU 1GBKA 5A8YA 2ASUB 1EB2A 2TBSA 3DA9B 2D1JA 4IMZA 4Y11E 1SLVB 1OXGA 1G3EA 1P2JA 2OC1A 1LHGH 4A92A 2IN2A 1O3PB 3RMOH 1TAWA 2ZIQH 1O2SA 1YF4A 3SNAA 1QR3E 1NFXA 1H9LB 1UTOA 3UNQA 5C5OA 2FS8A 4B75A 3BTDE 1RTFB 1L4DA 3SNDA 3W94A 3QO6A 4DGJA 1CO7E 1QJ6B 2WPIS 1MTUA 4MPXA 1ANEA 4IC6A 1F5LA 3EDXB 4K69A 3BG4B 3UQVA 4Q7ZA 2THFB 4AX9H 4AG1A 2WYJA 7GCHG 2ZHDA 2Q6DA 4Y8ZA 3IG6B 1LHFH 2BVRH 3MWIU 2AH4X 4IW4E 2XBWA 2VWNA 2GTBA 1UK3A 2QIQA 2BY9X 4YT6H 1C1QA 1ELDE 3T29A 2DE9A 2ZGXH 2Z3CA 4O9VA 3M5OA 3UTUH 1DDJA 2GP9B 1K21H 1P8VC 1SFIA 3RDZA 2PKAA 1BRAA 2LNCA 3ZV9A 2AMDA 2ANYA 1YPEH 3MH4A 4NZLA 3R3GB 2YNBA 2GMTB 2J2UA 1AFEH 1GGDC 2FP7B 1JRTA 1C2DA 2O8TA 4BXWA 4YO9A 1ZZZA 1FQ3A 1GMCF 1O3GA 1HAHH 4TY7A 2ZFPH 1OOKB 3M7UA 3VXFH 1BTWA 1ARCA 2QYIA 1S0RA 5E2PA 3DFLA 2STBE 1PPCE 1PPGE 3MU5A 1FZZA 5K0HA 1GMCG 1O2TA 1P2MA 3T25A 1V2MT 2BOKA 2AIPA 1XUIA 1C1NA 2M5TA 3OX7U 1NFWA 1O5FH 1C5LH 3OY5U 3BIUH 1LKBA 3ELAH 4LZ4B 1C2FA 2Y5GA 1H4WA 1IQJA 2TRMA 2A5IA 2BY6X 2Z9KA 1HAZB 3K2UA 4AB8A 1CA0C 1MTWA 1YLDA 2Q1JA 1HXFH 1ANBA 4ZH8A 3BG8A 1O2XA 3A8AA 2OQ5A 1C1SA 5GJ4B 4DW2U 1O3DA 2A5AA 5JB9S 2FOCA 2CMYA 2GT8A 2BXUH 2BYAX 3T5FH 1LKAA 2VH6A 4O03A 4UONA 3KEEA 4Y7BA 1K28D 1MTNB 1DOJA 1JOUB 1BTHH 1AUTC 1SFQB 4U32A 3ZZ9A 1G2MA 2FX4A 3RMNH 1O38A 1YPKH 1CT2E 2ZFFH 1VJAU 3A84A 5EXNA 4ZXYH 1CHOG 3SI4H 1C4U2 1GBIA 3A7XA 1EAWA 1Y5BT 1BTYA 1C2JA 4BXSA 6GCHG 1AVGH 5TJXA 4A1TA 1A0HB 4SGBE 2TGAA 1ACBE 3PROA 1S84A 2C8ZB 1H9HE 3OTJE 3S0NA 1UVTH 1T31A 1HB0B 1AB9B 1MD7A 2FLRH 3FAOA 2XC4A 2OC0A 1EUFA 4ABJA 3UQOA 4MPUA 1FNIA 2J94A 4DG4A 1PPBH 1OWHA 1GJCB 1Z1IA 2BLWA 2Z3EA 4FU7A 1O5DH 5DP6A 1ESBA 1TPAE 5ESBA 4AFZA 1ZHPA 2G5VA 1DX5M 3CS0A 1O2YA 1BBRH 4D7FA 4GCHF 1UHBB 1ZJKA 2O8LA 4X8UH 1LVOA 1O2IA 3S7HB 3G01A 2XWAA 1EQ9A 1QRXA 3KN2A 1AD8H 2PKSB 2V0BA 1MBMA 2H5CA 4THNH 1QGFA 3LOXA 3ZZ7A 2EA3A 2AEIH 3JZ1B 4I31A 4ABDA 1J16A 1O34A 1UTJA 4CR9A 2ESTE 1PPEE 2SNVA 1BTZA 4UFEH 2BDHA 4YTAA 5L2ZH 1GI6A 4FVBA 1SVPA 2KAIA 2UWOA 3D23A 1HCGA 2PFEA 4CR5A 3UOUA 1G36A 3U1JB 9LPRA 3V0XA 1SBWA 4CHAC 2G4UA 1NROH 1O3CA 3QTOH 4H4FA 4NGAH 1FLEE 1D9IA 4JZ1A 1TBZH 1E0FD 3DHKH 3BTEE 1KXFA 4ZHMU 3PLPA 1E34B 2VVVA 4ISNA 4OS5A 1QJ7B 3UFAA 4I32A 4YOJA 1T7CA 1FIZA 3BN9A
chains in the Genus database with same CATH superfamily
3TGJE 4ABFA 1RS0A 2FODA 2R9PA 1W11U 1K2I1 2W3IA 3UWIA 1TBQH 3VEQB 2A4RA 1WUNH 1WTGH 2EY4C 2ZTZA 4ZHAA 3PWBA 4XBBA 1DFPA 3QUMP 1PQ5A 4FUEA 1P2OA 3ZVBA 3GS9A 5F03A 5HIYA 1S81A 1XXFA 2VGCC 4I8LA 1TOCB 3SI3H 1T4VH 4I33A 2ODQA 4OS6A 4X6PA 2VIDA 5C20A 1DLKB 1EJNA 4K5ZA 1ZLRA 1BHXF 1UTLM 1ZJDA 2J9NA 2Y5HA 5L6NH 2Y7XA 4WMFA 5JB8S 1ZR0A 1KDQB 3RUOA 1GMDF 2OP9A 4AFUA 1AY6H 3ODFA 2G52A 4DY7B 5C5NA 1GCTC 1TONA 3BTKE 1ZMLA 1J14A 4XOJA 5FHTA 1NRNH 2FOHA 1XUHA 3PTNA 2OBQA 2I6SA 8GCHF 1ZTLA 4NA8A 1OWIA 3BEUA 3TPIZ 3A7TA 2F4LA 2WPMS 1HUTH 1ESTA 1TPPA 1YPJH 2GV7A 1TQ7B 2OC7A 2H9TH 3SUGA 1ABJH 4AGKA 4ISIH 3TGKE 2VIPA 1PPFE 2HNTC 1P02A 1SMFE 2NU3E 3SHAH 4AFSA 1IOEA 1PPHE 2ZFRH 1C2IA 4X1SU 4M7GA 4YLQH 1ZMNA 3S9BA 3MO9A 3OY6U 3A8CA 3KIDU 1S83A 4IBLH 1CT4E 4ISLA 1GBFA 1YC0A 1THPB 1AFQB 1P2IA 3LGYA 4XBDA 3RXGA 1ANDA 1SQTA 2PUXB 2P59A 1AIXH 1EJAA 1SGRE 2C8YB 1THRH 2K1QA 3MU0A 1WXRA 4K8YA 2A0QB 1O33A 3OE7D 8GCHG 1ANCA 1JIMA 4ABHA 1VGCB 1B7XB 1BRCE 1N6YA 3B23B 3K65B 2XC0A 1Z8JB 4F48B 3STIA 3ZVCA 3SU6A 1DS2E 1TGCA 3CS7A 1ETTH 3M5MA 3VB6A 3N7EA 1D3QB 3S7KB 1Z8RA 4JZEH 1FAKH 4ZKNU 3T28A 3C27B 3GDUA 1MKWH 2K8IA 5DO4H 2OC8A 1RTLA 2UUKB 1UTMA 3JZ2B 1JXPA 4JMYA 1SC8U 2JH6D 4B73A 5L2YH 1YLCA 3LU9B 4X8VH 1O3OA 2VVUA 2PWXA 2W6JD 1SOTA 2WINI 3TIUA 3MTYA 4U2WA 3SJ9A 2QN5T 1H8DH 1ZSLA 3BG4C 4H6TA 3SV7A 1P04A 1WU1A 4KTUA 1SGPE 1INCA 3GYLB 3PTBA 1QBVH 1U6QA 1UTNA 2OINA 3RLYH 2KZ4A 2ZTYA 4CHAB 3B9FH 1ZMJA 2YMSB 3SQHE 1LHDH 1GI9B 3HKJB 3ATMA 5DP8A 1Z6EA 3VGCB 4DIHH 1GDUA 2PSYA 1F5RA 1T8NA 1HV7A 3GCNA 1JBUH 2F43B 2PTCE 2P3UB 4QT8C 2Z9GA 3GYMA 3Q77A 2UUJB 3M3SA 3MI4A 1LTOA 2D26C 2EI8A 4Q7XA 2ZDMA 2XNIA 3GY6A 4IN1A 3RXPA 3U8RH 1FDPA 1A0JA 2D2DA 3MH6A 4X6OA 1TRNA 2QC2A 4XRNA 1WQVH 2KFWA 1XX9A 1QRZA 2QE7D 2UUYA 4XBCA 2ZFSA 4I8KA 1P0SH 4TWWA 2A2XH 2XC5A 3ODDA 3RXDA 1F92A 1C5OH 1EPTB 3QDZB 1HLTH 3RC5A 4I8GA 1T8OA 1TPOA 1Q2WA 5CHAB 3BF6H 3WW7A 2BM2A 1TRMA 3SORA 1WTHD 4GPGA 3PYHA 3EYDA 4NZQA 4LZ1H 1QJ1B 3B8JA 2XNDD 1T32A 1QBNA 4OS4A 1ZGIA 2B9LA 2BHGA 1UMAH 2FOGA 2WHXA 3A89A 1TGBA 4YT7H 1GBTA 5LGOA 3A8DA 3RU4E 1HAYB 1Y3UA 4OM9A 3E8LA 2HVYB 1KLJH 4IMQA 4MNVA 2A45B 2F9VA 1QY6A 4K2YA 1UVUH 4K3JA 1MQ5A 1CA8B 2OLGA 5FPYA 1HDTH 1A3EH 4BTUB 1KLTA 2O8MA 5GCHF 3AW1A 3RXKA 4FXGH 3BTWE 1P06A 5HXFA 3R0FA 3QLPH 2W5EA 5B6LA 2ALVA 2OQUA 3NUMA 1AQ7A 4Y0ZE 2RCEA 3LGWA 1Y3YA 1O3FA 2KAIB 4J2YB 3F2FA 1C1RA 2UWPA 2ALPA 4I7YH 1AMHA 3P8FA 2IJOB 2YMSD 1DANH 1IAUA 3K6YA 4WXIA 1C2MA 5HMAA 2WYGA 4ZKOU 1RIWB 1V2ST 5PTPA 1J8AA 3NK8A 1TA2A 2ANKH 5DGJA 1P2QA 2HLDD 3F6UH 3GICB 2BDAA 3VG8A 1OSSA 1O2RA 4DIIH 2AGEX 1ESAA 4K8BA 1MKWK 2BX4A 2F91A 5SGAE 4WY3A 5JPMH 2FZZA 1UO6A 3EAJA 5IK2D 4IGDA 1O5BB 3RU4D 1MCVA 1GJ4H 1FY3A 1NTPA 1O3MA 1NU9A 2PW8H 4A7IB 1L0ZA 2BLQA 1Y3VA 4D9RA 3N7OA 1HJ9A 1SI5H 3F9EA 3FFGA 1HPGA 1KLIH 1DICA 2ZGBH 3E3TA 4HI3A 4CRFA 1LQEA 1V2LT 4MPWA 5J4QA 2QXGA 3OU0A 2AERH 4ACBA 1A3BH 1OWEA 1LHEH 1AE8H 3SQEE 2XRCA 1AZ8A 2QF3A 2FTMA 2R0LA 3ZZCA 1V2QT 2SGPE 1SHYA 1O2QA 2OXSA 3LC5A 4O97A 2PLXA 2Q6GA 1CA0B 5FX5A 1GI7B 5JBBS 3LONA 1LCYA 1O2UA 1KXBA 1V2OT 2GT7A 4NG9H 1FIWA 2HNTF 4ABGA 2VIVA 3F2HA 4INLA 1WV7H 1T8LA 2VBCA 3LKWA 1B5GH 2YMSC 1CGHA 4E7RG 2TGTA 4M9FA 2XTTB 3KNXA 1A46H 2GMTC 5TCCA 3URDA 2GKVE 3KQDA 1EAUA 1K1MA 1TOMH 4FUBA 3MH7A 3ZZAA 5EJLA 3U69H 1S82A 1TB6H 1TYNA 2VGCB 1OP2A 3AW0A 4FUDA 1JIRA 5C0TA 2SGEE 1GHAG 4KGAA 1NZQH 4DURA 3VXEH 1O5GH 1BUIA 1EZUC 3V13A 2ZZUH 1MBQA 1VR1H 1GVZA 5T3HA 3BTTE 2BY8X 2DE8A 4WH8A 3SUDA 1KXDA 1WCZA 3LDXH 4WVPE 2F3CE 1O2ZA 5KEDA 4ZAEA 3AAVA 5LPRA 1KY9A 2CXVA 1TMUH 3HKIB 2A5KA 1OWKA 4ZKRU 4KELA 3NCLA 1GPZA 3MU8A 3RXEA 1XVMA 5DSFA 4UFDH 2HNTE 4CRBA 2Z9LA 3NKKA 2RDEA 1CBWC 3EQ0H 2JJ2D 3SNEA 1G9IE 1PQ7A 2PKSC 5HM9A 4FU9A 3MMGA 1AO5A 3UY9A 4JZDH 4ABBA 5TCAA 3SU1A 3RXLA 3RXJA 2OTVA 2VIOA 3SUFA 1TIOA 2J92A 3EA8A 1E36B 3UOPA 1ZRBA 5AFZH 1RGQA 3FP7E 3F9FA 1O5CB 1GBHA 1GCDA 2PUQH 3SHCH 1DY9A 3DUXH 2GVFA 1HBTH 1QHRB 1GG6C 1E38B 2QXHA 1GJDB 3GDSA 3OSYA 7KMEH 4AC9A 2UUFB 1ELVA 3TJOA 5EW1H 3ZVEA 1AFQC 3D49H 1O3LA 1ZGVA 3LGVA 1NY22 1IQKA 3Q00A 5EU8A 5DN6D 3CNRA 1NPMA 3SV8A 2H9EH 1Z71A 4GUXA 5ESTE 5DP5A 1TNJA 2W7UA 4RN6A 1MZAA 2W7SA 1TMTH 2BXTH 2ZFQH 4MTBA 1QBOA 1SLUB 1EPTA 1IHSH 1TNKA 3GCHB 1Z8IB 3RXFA 2ULLA 1UW7A 1BTPA 2BOHB 1E35B 1GHXH 1NC6A 3NXPA 1F0SA 1QL8A 3VPKA 1QIXB 1AWHB 2SNWA 1T8MA 2F9UA 3DSGA 4MPVA 2HLCA 1CT0E 1ABIH 1XXDA 4BAQB 3SV2H 2CHAB 3BEIB 2GX4A 3QK1A 1BMNH 1HIAB 1VITF 1TRYA 2BDIA 3SGBE 1EXFA 1AE5A 2VIQA 1HAIH 2BD4A 1TWXB 3ZYEA 2SGDE 5EJ1A 2RA0A 5J4SA 1H8HD 3ZVAA 4D9QA 5EQSA 1GVLA 4ABIA 4OS2A 1ELCA 1HAVA 2ODYB 3QWCH 5F6MA 4LXBH 3V7TA 1GHBG 3RXIA 1GL1A 2J95A 2ZPQA 1AB9C 5A8ZA 4JK6A 1K22H 3EE0B 1BB0B 4GSOA 8KME2 1W14U 2IPQX 2TGDA 5EQQA 1LVYA 4GCHG 2FS9A 2R3UA 3VGCC 2ZHWH 2B0FA 1COWD 2NU1E 1UJ1A 3I77A 2RG3A 1RRKA 1GL0E 3GCTF 4A6LA 3RXRA 1AHTH 3Q76A 2H2ZA 1ETRH 3MU4A 1MD8A 2QY0B 3TU7H 1QRWA 3SGAE 2OCVB 2HOBA 1BMMH 4X8TH 1S6LA 3HGPA 1RJXB 3RXBA 4AZ2B 1O3NA 3HPTB 3EA9A 5CHBA 1TFXA 2V3OH 3E16B 4HG6A 2ODPA 2ZU3A 4FVDA 4RKJB 5FXLA 1CGIE 1GI3A 1BITA 3E90B 1J17T 1IHTH 1C1MA 1G3DA 2BLOA 3OEHD 1O2GH 3RP2A 1C5ZB 2EI7A 1YY3A 2WSSD 3K9XB 3P70B 1VZQH 1W13U 2KCOA 3TITA 1HIAA 5AHGH 3VFEA 4BANB 2RA3A 1EJMA 1AU8A 2ZHQH 1C5UA 2ZC9H 1P03A 1HAOH 4B2CA 5JBTA 1UHBA 1D3TB 1GJ7B 2EC9H 2FO9A 1V3XA 3UREA 1C5VA 2ZDNA 2JKHA 1H8ED 1GJ6A 2FX6A 5EJZA 3V12A 3LGUA 6GCHF 4JYUH 2XW9A 2Q6FA 1WAYB 4XE4A 1BJUA 1CE5A 1F0UA 2NU4E 3T62A 2Y82A 3M7TA 1P2NA 3A81A 1J15A 3O8RA 1FX0B 4DJZB 3RU4T 1YPMH 2QF4A 2PP6A 1LPZB 2ZDAH 4J1YA 2WPKS 4R8TB 1EZXC 2ILNA 1S85A 1WBGB 4I8JA 1MKXH 1XM1A 5FAHA 3MNBA 1BTXA 4NIVA 2B5TB 4OGXA 2ZHEH 1AVWA 4IN2A 1TABE 3LGTA 2W3KA 2P8OC 2HPPH 4B6FA 3PWCA 5EOKA 3GISB 4Y6DA 1PYTC 3BTHE 1AUJA 1ID5H 2QF5A 2ANMH 2PSXA 1O5EH 3ZZ8A 5BPEA 3SYJA 3KHVA 1O3JA 2P95A 1MAXA 2ZHFH 1OYQA 3WWBA 2P8OB 2TIOA 1KDQA 3GY2A 4CRAA 1ARBA 1C5YB 5CDFE 1K1IA 1IQMA 1YGCH 4NSYA 2V3MA 1UK4A 4OGYA 3SZNA 2KX4A 3NWUA 3GY5A 3PMJA 4UE7H 1UVSH 3MO6A 4RKOB 2BB4A 1FV9A 1MU6B 4AFQA 2KCAA 1EP6A 4K1EA 5T6GA 4YLUA 1O3IA 1O2WA 2B7DH 4NIYA 2ZGCA 1OWDA 2JETC 4CRGA 3MYWA 1BBRE 5FL7D 1M9UA 3STJA 3SJIA 2PKAB 1OWJA 3QZRA 3Q3KA 1IQEA 3P95A 1C2LA 3PLKA 5EPNA 3QGJA 1DPOA 4BNRA 5GNDA 2BZ6H 4Y10E 3UWJH 2W6ID 2Z3DA 4NA9H 1VKYA 1HAXB 2SGQE 4YZUA 3TVJB 1FN6A 1H9IE 1W2KH 3H5CB 1YKTA 1QURH 3SO3A 3SUEA 1SGEE 3HK6B 4OS1A 3PO1C 4MVNA 4ABAA 3WY8A 2V3HH 4K60A 1QTFA 1NBMD 3DSPA 5F8XA 2KR7A 2YNAA 7LPRA 6CHAB 1EKBB 3A86A 1XUGA 3FP6E 2V7QD 4NA7A 5BRRE 2FYRA 4DT4A 4LK4A 1S0QA 2QF0A 1FN8A 4ZMAH 3HK3B 1Z1JA 1O2JA 8LPRA 5GWZA 3VB7A 1LVBA 3RC6A 2XYAA 3K6ZA 1NT1A 3WWFA 1EZQA 2GZ9A 5GIBA 3KQCA 6LPRA 1HJ8A 1FI8A 2Y6TA 1K1OA 2QV1A 1W7XH 2AYWA 2A2QH 1BBRK 2BD7A 2SGFE 2QAAA 3LC3A 3RXQA 5IYTA 3N99A 1P9UA 1QCPA 2FOAA 1L1NA 1XKBC 1DXWA 2VINA 1FY8E 1VCQA 5FX6A 3FANA 3PV2A 4ESTE 4B2BA 4P00A 4MDSA 4AYYB 1IQHA 4RI0A 1TX6A 4X1RU 1G2LA 1MTVA 4GLYA 1TNGA 2TPIZ 2J97A 8ESTE 1A4WH 2ZP0H 4K1SA 3LJJA 2SGAA 3ATIA 3O8DA 3KQEA 3DD2H 3GDVA 1BHXB 9ESTA 2IOTA 1EOJA 3RXVA 1BZXE 1DWBH 3GY7A 1G37A 1MH0A 4CH2B 2UWLA 4MNYA 4Z1MD 5E0HA 5HYOA 3NPSA 4WH6A 1ETSH 4BTTB 1Q3XA 5EIYA 1O3HA 2G5NA 2ZU4A 1V2TT 2WV4A 3TK5A 2KCPA 1GBCA 3ZZ5A 5A8XA 3FN8A 4BTIB 3E0NB 3P17H 3S9AA 4YXWD 1C5MD 1QA0A 2I6QA 4H42U 1PYTD 1DSTA 1UVPA 1O2PA 1ORFA 3RLWH 1G3BA 1TMBH 3F1SB 1IQLA 2A31A 2OBOA 1UTKA 2ZU5A 5HM2A 3A7VA 1Z7KA 1NESE 2BMGB 2RDLA 4INKA 2FLBH 5DP7A 4F55A 1VJ9U 3BIVH 3O8CA 2STAE 1DWEH 1QL7A 1GBDA 3BTQE 3IITA 3KGPA 4BAHB 3TJNA 2NU2E 1P05A 2FYQA 4HGCA 1GI2A 3Q3YA 5A0CA 3I78A 1B0FA 4X6NA 5C1YA 1HFDA 1A1RA 3M36A 1O2LA 2BD5A 1WOFA 1ELBA 1O2OA 4ASUD 1BRBE 1W8BH 1PJPA 4Q63A 2VWOA 3E6PH 7ESTE 1AKSA 4ACAA 1L1GA 5GXPA 1QL9A 1SGIB 4B1TA 3A7ZA 2A4OA 3D62A 4YESB 3A85A 4X2WA 2A32A 2LELA 2CHAC 4UD9H 1JWTA 4JYVH 4RT0A 2AS9A 2C3SA 1LQDB 1NRPH 2Y80A 2NU0E 1E1QD 3ZYDA 2JETB 3MNSA 3KYGA 1O5AB 1SLXB 2P3FH 2G51A 4F4OC 4TWYA 2ZWLH 3GY3A 2YOLA 2VIWA 1OKXA 1AN1E 3F68H 1GHVH 3NZIA 3DCLA 3BTME 2H5DA 2P94A 2F9BH 1V2UT 3TH3H 4X2YA 1BQYA 1CBWB 1O35A 4NIWA 1UK2A 4ZHLU 5EODA 3PV4A 3W95A 1VITH 1C5XB 4NSVA 5C0UA 1Y3WA 1Q31A 1C5PA 2CF8H 3SNBA 1GJ8B 3GOVB 1NM6A 3FZZA 3LH1A 1KIGH 4DVAU 1GMHF 4JZFH 1F2SE 1GJ9B 5K7RA 2ZI2H 1VCWA 4BAOB 5EXLA 3SJ8A 1GWAA 1EAXA 6CHAC 3P92A 2BDBA 2BQWB 2R0KA 2FDAA 2HALA 4NFEA 1NU7B 4SGAE 3VB5A 3V3MA 1AWFH 2KCYA 2J98A 2H1UA 2G81E 2L6OA 3SV9A 2Z9JA 2V35A 1Y59T 1SGQE 4FUGA 3A80A 3HGNA 3QZQA 3PLBA 2ZO3H 2QXJA 1TGTA 4Y7AA 1IQIA 2XCNA 1BRUP 1UVOA 3SOSA 1C5RA 2GZ8A 5B6OA 4X1PU 5L30H 5CE1A 1BDAA 1FMGA 1O31A 1C1OA 3RMMH 4X6MA 3LJOA 1O36A 4XFQA 1XUFA 1LMWB 2TGPZ 4CBOA 2ZEBA 1MZDA 1TLDA 2FM2A 3BSQA 1XUKA 2XOKD 4PROA 4TYDA 3SZEA 2VWMA 1CGJE 2H9HA 1CQQA 1GJAB 1C1VH 1GI8B 3MNCA 1GBBA 1A5IA 2ZNKH 4B71A 1O30A 1ZOMA 6ESTA 2FI3E 5FBIA 5C67A 5HIZA 5FCKA 4CRCA 1DWCH 3A87A 4X2VA 2PV9B 1GHZA 4HTCH 3OEED 4TY6A 1SR5C 1T4UH 1RTKA 1ZHMA 3SU0A 4JK5A 1A2CH 4FUJA 1YPHC 2QCYA 2SFAA 1PPZA 3FVFB 5LH8A 1SGFG 4IC5A 1VITG 2Y81A 3H7OA 3H7TA 2A7JA 3RMLH 2C90B 1QB6A 1WSSH 1S5SA 3GCHC 1W0KD 3PRBA 1DUEA 1HAGE 1KXEA 4YOIA 2BDCA 3S69A 5DP3A 1P11E 1MCTA 2FPZA 4JCNA 1GDNA 3FKSD 2ZPSA 1O2KA 1TNIA 2GDDA 5EGMA 1HGTH 5H4IB 1K9OE 1SGFA 1EFRD 1WDIA 1XMNB 2M2AA 1ELGA 1GHWH 4X8SH 5I25A 2GDEH 3U1IB 3L3TA 1C2GA 3CENA 1ZPZA 1GI1A 3PMAB 1SQRA 1G3CA 1TNHA 2G55A 1FY4A 1NFUA 1ZTKA 5FPSA 4NCYA 4Z6AH 5DP9A 1HXEH 5C1XA 1O3BA 2ZECA 4FUCA 1LDTT 2GCTC 2FTLE 1TNLA 1V6DA 1O2NA 1TA6A 1BT7A 3M37A 1HYLA 1Z8GA 4X1QU 3E1XB 4E05H 4AGJA 2VH0A 2FWWA 4A1VA 3A8BA 2FOEA 4YM9A 1SGNE 1OP0A 4NWKA 4X1NU 2F83A 4MNWA 4WF8A 1O3KA 1DLEA 1W10U 4YOGA 3ZZBA 2PGQB 3BEFB 4ZCNA 2C93B 4WXVA 1GCTB 3BV9B 1SQAA 2ZTXA 5DJ7A 2CV3A 4ZROA 4ZKSU 3AK5A 2P3TB 1D6RA 1MQ6A 4CREA 1E37B 3UNSA 3TNTA 1UCYK 1VCPA 3RXTA 3PMBB 2BY7X 4WMEA 3ZIAD 1F7ZA 1MUEB 1GI0A 1NS3A 5T6DA 5FCRA 4Y79A 1LPKB 1W0ZU 2F9PA 2ZF0H 1C4Y2 1GG6B 1SSXA 3OTPA 5AVDA 3DT0H 3TJVA 1ZSKA 4AG2A 3U28C 3ZZ3A 1XUJA 5FPTA 1OPHB 5AFYH 3M35A 4VGCC 1YP9A 2VNTA 1O2VA 3TGIE 2ZU2A 5C17A 2FOBA 2G00A 5E0JA 5HGGA 2R2WU 1GBJA 2VWLA 4HFPB 3PMHB 1YWUA 1SQOA 2VJ1A 2BD8A 2ZCKP 3FZDA 1A5GH 4VGCB 3DFJA 3CP7A 3ZV8A 5DKMA 1QB1A 2WPHS 2XCFA 3E91A 1YCPM 1HRTH 4FETA 1CU1A 1PQ8A 4ISHH 3P6ZB 2BX3A 3GCOA 1AKSB 1DY8A 3SNCA 1AZZA 1P3EA 2XBVA 3AASA 1TALA 1FY5A 1GJ5H 3SU2A 4CBNA 3IWMA 1RXPA 3EE7A 1CHGA 1NRRH 1UCYE 1SKYE 1CSOE 2GCHF 3AVZA 4JYTA 1HAPH 1F0TA 3P8GA 5EPYA 1YPGH 4P02A 4E7NA 3F9GA 3TH4H 2O8WA 3L33A 1GHBF 3RM0H 1J9CH 2GZ7A 2VU8E 3ATLA 3ESTA 1OHHD 1FJSA 2CN0H 3A7WA 3SU4A 1WYKA 1EATA 2WUBA 3PV5A 4X0WU 5DG6A 2ZCLP 1MKXK 3ZVFA 2BDYA 4H6SB 4CH8B 1KTTB 3KCGH 4AN7A 1QNJA 4ASHA 1MU8B 2ZKSA 1P10A 4TPIZ 1B0EA 1C5NH 1C9TA 1AGJA 2C8XB 3KL6A 1TGNA 2ZQ2A 4GHTA 4UFGH 1KSNA 5T6FA 4AORA 5JBCS 1HAVB 3RXAA 3ZVGA 2WV9A 2IPHA 4MQAA 3H09A 1V2JT 3LPRA 1NFYA 3GY4A 2PGBB 4E06H 1SGTA 2J98B 2FXRA 1F5KU 1W3CA 2HRVA 3UPEA 1D6WA 1C4V2 4WMDA 1W0JD 5FBEA 1SLWB 4CRDA 1JMOH 2WUCA 1GHAF 2NWNA 1A7SA 3E0PB 3UAIC 1YCPK 1BMAA 3AAUA 1V2PT 3Q3XA 2EI6A 1BA8B 3LH3A 1YM0A 3M3VA 1O32A 5CMXH 2J34A 3UR9A 1RFNA 2IJD1 2AIQA 4ZUHA 3RXCA 4MNXA 5E2OA 4A1XA 1DUAA 4TSFD 3MNXA 5GDSH 3RXOA 2F9NA 1QA7A 3P8NA 3D65E 1GBAA 1FONA 2PTNA 1QQ4A 3BTFE 1IQNA 1C1WH 3MQKC 1XVOA 2J4IA 2WV5A 1P3CA 1L4ZA 1QFKH 3W1EA 3UNRA 1GMHG 1QZ8A 1HNEE 2BQ6B 1ZSJA 2RFKC 4FUIA 4O3TA 2PHBA 3RXMA 3S9CA 3SGQE 1OP8A 1YYY1 3PO1B 1DM4B 1Z6JH 1KXCA 4K1TA 1S6FA 3KF2A 1N8OC 4Q4LA 1V2KT 4GVUA 2BDGA 5I46H 4ZXXH 1ZYOA 3MOCA 3RXSA 3TLOA 2OD3B 1ZPCA 1W12U 3U8TH 3RXHA 4Q2KA 3VB3A 5EW2H 1EOLA 1O3AA 4Q80A 1C5WB 1P09A 2AGIX 3ATKA 3I29A 1O37A 1N8OB 3T26A 3M7QA 2ZGJA 3EA7A 1G32B 3C1KA 4KP0A 2ZFTA 1TBRH 4X2XA 1ELTA 5GCHG 1O0DH 1YCPH 1YPHE 2HVXA 1A61H 1P2KA 2D8WA 3QN7A 1FPCH 2ZPRA 3EGKH 2FESH 4FU8A 1MTSA 1THSH 4XDEA 4ABEA 7GCHF 1N1LA 3MFJA 1NBME 5DPAA 3SJOA 2CJIA 2KM0A 3ZZDA 1DITH 4Y71A 2VB0A 3PRDA 4B2AA 2CF9H 1GVKB 3KQBA 1FUJA 3SN8A 1EP5A 1GHYH 1TE0A 5JBAS 1BJVA 5ABWA 2FI5E 1DSUA 2BD3A 3U98H 4B76A 2Z94A 1DE7H 1K1NA 1O2MA 1P9SA 3BTGE 4WWYA 2ZDVH 4U30A 2A4QA 5C1UA 3RM2H 4HZHA 3RXUA 1K0HA 3SJKA 2O9QA 3VB4A 5IDKA 4Y76A 3U9AH 2BZAA 1NRQH 5A2MH 4FUFA 5LPEA 4A5TS 2AFQB 1C5QA 4FUHA 1C5TA 3ZZ6A 1IQFA 1X7AC 2ZDLA 1SHHB 1SGDE 1H1BA 1PFXC 2FI4E 1S6HA 3QTVH 4OS7A 4NIXA 1EZSC 1C9PA 5E8EH 1D3DB 1UTQA 1ZTJA 2HGTH 1C5SA 2FEQH 5JYIA 3MU1A 1SGYE 1KMHB 4B74A 4TPYA 2ANWA 2Z7FE 4FOUC 1Y5AT 1HJAC 1MABB 3T2NA 2BQ7B 2Y5FA 2FOMB 1BCUH 1BIOA 2QA9E 1GBMA 3MO3A 4D8NA 1TPSA 1UCYH 5C2ZA 2G8TA 2WPJS 4AYVB 5A0AE 1GGDB 5LPFA 1GI4A 1NRSH 4WJG2 1HJAB 3UIRA 2BVSH 4UDWH 4F49A 2JH0D 2B8OH 1L1JA 4BAKB 1SL3A 1LHCH 3A82A 1OS8A 1GJBB 2GGVB 1MMJN 1K1LA 2DUCA 1NN6A 3U8OH 3UB0A 2BTCE 2AMQA 4AOQA 5C3NA 1IQGA 3OYPA 2CK3D 3PB1E 1QQUA 3SV6A 2OUAA 2Y7ZA 2H6MA 4D7GA 1GI5A 1LPGB 3M5LA 1BOQA 4DCDA 3ATWA 3M5NA 1CHOF 2XXLA 3A7YA 3TNSA 2ZGHA 1A5HA 5CHAC 3RC4A 1D4PB 4DT7B 5JDUB 4RT1A 1C2KA 2XBXA 1LO6A 4Y0YE 3N7DA 1N6XA 1EX3A 2Z9IA 1O39A 1P57B 5DK1A 2A1DB 2P16A 2C4FH 5G4BA 3GY8A 1OX1A 2ZQ1A 3O8BA 2BLVA 2FIRH 4I86A 4BOHA 3ENSB 2BD2A 3LIWA 4NFFA 1DWDH 3SBKA 1FXYA 3M61U 2V6NA 3TH2H 1P12E 5ETXA 4MLFB 2WPLS 2GCHG 1V2WT 1BTUA 2BVXH 3OFND 1TX8A 1FPHH 1DVAH 1GBLA 1C2EA 3L6PA 1TQ0B 4AB9A 1H8IH 3GCTG 3UR6A 1C1TA 3F2GA 2ZA5A 5DP4A 2AHME 2JDID 3KQ5A 3UUZA 3URCA 1AI8H 3FP8E 5F8ZA 1C2HA 1GMDG 1ELFA 2ZDKA 5E0GA 4JZIA 5EG4A 3SU5A 1EB1H 2CGAA 2FMJA 4B6EA 4Y8YA 1BMLA 1SPJA 1LVMA 3T27A 1TX7A 1Y8TA 1YPLH 4UEHH 1DT2A 1GDQA 4NWLA 1ZPBA 2A4GA 2GD4B 4GHQA 5A09A 1WQSA 4TT3D 1UTPA 5EXMA 5EQRA 3SW2B 3TK6A 5HKKD 1RD3B 4Y8XA 2J38A 2JH5D 4LOYH 2G4TA 3TJUA 2ZG0H 3PM3A 2JJ1D 4RSPA 2L74A 2GV6A 2EQNA 1V2RT 3ZZ4A 1C1PA 3HATH 2AGGX 2GCTB 3A88A 4BAMB 2LPRA 5C94A 2ZCHP 3MH5A 3A83A 3TK9A 1ELEE 2QGRA 1C1UH 2O8UA 1K1JA 1Y3XA 1XKAC 1TGSZ 4Z0KA 5F8TA 3FOAA 1O3EA 3ITIA 4KKDA 4KTSA 3P8OA 2WPDD 1FAXA 1G30B 2FOFA 1D3PB 3M3TA 1KXAA 4D76A 3LGIA 2R2MB 1OYTH 4I8HA 4O3UA 5T1VA 1K1PA 1SOZA 1KYNA 4IS5A 4GAWA 1SG8B 4ISOA 2P93A 1JRSA 5A0BA 1P01A 2K0QA 1EAIA 2F9OA 1MTNC 2W26A 1ELAA 1O2HA 1L2EA 2BD9A 1FY1A 4MG3A 1E79D 4U01A 2ZU1A 5GPIB 2R3YA 1A0LA 3F9HA 2C8WB 1ZRKA 1AVXA 1F0RA 4Q7YA 1EASA 5KGOA 2XBYA 3SU3A 2AMPA 1PQAA 1SGCA 1QB9A 3QX5H 2QXIA 2EEKA 2A7HA 1ZHRA 2Z6BD 4UFFH 1NO9H 1SB1H 2PR3A 1YBWA 1CVWH 4XSKU 2BY5X 1GBEA 1W7GH 1V2NT 1Y5UT 4DOQA 3F0PA 1KTSB 2HPQH 3QGNB 4R0IA 1EPTC 1W0YH 1MAYA 5AF9H 1DXPA 2HWLB 3ZVDA 3F0OA 4INHA 3LT3A 4KTCA 1V2VT 1VGCC 2XWBI 1RIWC 2A7CA 2VVCA 3MHWU 1GBKA 5A8YA 2ASUB 1EB2A 2TBSA 3DA9B 2D1JA 4IMZA 4Y11E 1SLVB 1OXGA 1G3EA 1P2JA 3DSOA 2OC1A 1LHGH 4A92A 2IN2A 1O3PB 3RMOH 1TAWA 2ZIQH 1O2SA 1YF4A 3SNAA 1QR3E 1NFXA 2WZQA 1H9LB 1UTOA 3UNQA 5C5OA 2FS8A 4B75A 3BTDE 1RTFB 1L4DA 2OK5A 3SNDA 3W94A 3QO6A 4DGJA 1CO7E 1QJ6B 2WPIS 1MTUA 5F53A 4MPXA 1ANEA 4IC6A 1F5LA 3EDXB 4K69A 3BG4B 3UQVA 4Q7ZA 2THFB 4AX9H 4AG1A 2WYJA 7GCHG 2ZHDA 2Q6DA 4Y8ZA 3IG6B 1LHFH 2BVRH 3MWIU 2AH4X 4IW4E 1YLNA 2XBWA 2VWNA 2GTBA 1UK3A 2QIQA 2BY9X 4YT6H 1C1QA 1ELDE 3T29A 2DE9A 2ZGXH 2Z3CA 4O9VA 3M5OA 3F3BA 3UTUH 1DDJA 2GP9B 1K21H 1P8VC 1SFIA 3RDZA 2PKAA 1BRAA 2LNCA 3ZV9A 2AMDA 2ANYA 1YPEH 3MH4A 2JIZD 4NZLA 3R3GB 2YNBA 2GMTB 2J2UA 1AFEH 1GGDC 2FP7B 1JRTA 1C2DA 2O8TA 4BXWA 4YO9A 1ZZZA 1FQ3A 1GMCF 1O3GA 1HAHH 4TY7A 2ZFPH 1OOKB 3M7UA 3VXFH 1BTWA 1ARCA 2QYIA 1S0RA 5E2PA 3DFLA 2STBE 1PPCE 1PPGE 3MU5A 1FZZA 5K0HA 1GMCG 1O2TA 1P2MA 3T25A 1V2MT 2BOKA 2AIPA 1XUIA 1C1NA 2M5TA 3OX7U 1NFWA 1O5FH 1C5LH 3OY5U 3BIUH 1LKBA 3ELAH 4LZ4B 1C2FA 2Y5GA 1H4WA 3OAAD 1IQJA 2TRMA 1E1RD 2A5IA 2BY6X 2Z9KA 1HAZB 3K2UA 4AB8A 1CA0C 1MTWA 1YLDA 2Q1JA 1HXFH 1ANBA 4ZH8A 3BG8A 1O2XA 3A8AA 2OQ5A 1C1SA 5GJ4B 4DW2U 1O3DA 2A5AA 5JB9S 2FOCA 2CMYA 2GT8A 2BXUH 2BYAX 3T5FH 1LKAA 2VH6A 4O03A 4UONA 3KEEA 4Y7BA 1K28D 1MTNB 1DOJA 1JOUB 1BTHH 1AUTC 1SFQB 4U32A 3ZZ9A 1BMFD 1G2MA 2FX4A 4XD7D 3RMNH 1O38A 1YPKH 1CT2E 2ZFFH 1VJAU 3A84A 3KYFA 5EXNA 4ZXYH 1CHOG 3SI4H 1C4U2 1GBIA 3A7XA 1EAWA 1Y5BT 1BTYA 1C2JA 4BXSA 6GCHG 1AVGH 5TJXA 4A1TA 1A0HB 4SGBE 2TGAA 3FO8D 1ACBE 3PROA 1S84A 2C8ZB 1H9HE 3OTJE 3S0NA 1UVTH 1T31A 1HB0B 1AB9B 1MD7A 2FLRH 3FAOA 2XC4A 2OC0A 1EUFA 4ABJA 3UQOA 4MPUA 1FNIA 2J94A 4DG4A 1PPBH 1OWHA 1GJCB 1Z1IA 2BLWA 2Z3EA 4FU7A 1O5DH 5DP6A 1ESBA 1TPAE 5ESBA 4AFZA 1ZHPA 2G5VA 1DX5M 3CS0A 1O2YA 1BBRH 2GJGA 4D7FA 4GCHF 1UHBB 1ZJKA 2O8LA 4X8UH 1LVOA 1O2IA 3S7HB 3G01A 2XWAA 1EQ9A 1QRXA 3KN2A 1AD8H 2PKSB 2V0BA 1MBMA 2H5CA 4THNH 1QGFA 3LOXA 3ZZ7A 2EA3A 2AEIH 3JZ1B 4I31A 4ABDA 1J16A 1O34A 1UTJA 4CR9A 2ESTE 1PPEE 2SNVA 1BTZA 4UFEH 2BDHA 4YTAA 5L2ZH 1GI6A 4FVBA 1SVPA 2KAIA 2UWOA 2LP6A 3D23A 1HCGA 5KECA 2J5UA 2PFEA 4CR5A 3UOUA 1G36A 3U1JB 9LPRA 3V0XA 1SBWA 4CHAC 2G4UA 1NROH 1O3CA 3QTOH 4H4FA 4NGAH 1FLEE 1D9IA 4JZ1A 1TBZH 1E0FD 3DHKH 3BTEE 1KXFA 3NRLA 4ZHMU 3PLPA 1E34B 2VVVA 4ISNA 4OS5A 1QJ7B 3UFAA 4I32A 4YOJA 1T7CA 1FIZA 3BN9A
chains in the Genus database with same CATH topology
3TGJE 4ABFA 1RS0A 2FODA 2R9PA 1W11U 1K2I1 2W3IA 3UWIA 1TBQH 3VEQB 2A4RA 1WUNH 1WTGH 2ZTZA 4ZHAA 3PWBA 4XBBA 1DFPA 3QUMP 1PQ5A 4FUEA 1P2OA 3ZVBA 5F03A 1S81A 1XXFA 2VGCC 4I8LA 1TOCB 3SI3H 1T4VH 4I33A 2ODQA 4OS6A 4X6PA 2VIDA 5C20A 1DLKB 1EJNA 4K5ZA 1ZLRA 1BHXF 1UTLM 1ZJDA 2J9NA 2Y5HA 5L6NH 2Y7XA 4WMFA 5JB8S 1ZR0A 1KDQB 3RUOA 1GMDF 2OP9A 4AFUA 1AY6H 3ODFA 2G52A 4DY7B 5C5NA 1GCTC 1TONA 3BTKE 1ZMLA 1J14A 4XOJA 5FHTA 1NRNH 2FOHA 1XUHA 3PTNA 2OBQA 2I6SA 8GCHF 1ZTLA 4NA8A 1OWIA 3BEUA 3TPIZ 3A7TA 2WPMS 1HUTH 1ESTA 1TPPA 1YPJH 2GV7A 1TQ7B 2OC7A 2H9TH 3SUGA 1ABJH 4AGKA 4ISIH 3TGKE 2VIPA 1PPFE 2HNTC 1P02A 1SMFE 2NU3E 3SHAH 4AFSA 1IOEA 1PPHE 2ZFRH 1C2IA 4X1SU 4M7GA 4YLQH 1ZMNA 3S9BA 3MO9A 3OY6U 3A8CA 3KIDU 1S83A 4IBLH 1CT4E 4ISLA 1GBFA 1YC0A 1THPB 1AFQB 1P2IA 3LGYA 4XBDA 3RXGA 1ANDA 1SQTA 2PUXB 2P59A 1AIXH 1EJAA 1SGRE 2C8YB 1THRH 2K1QA 3MU0A 4K8YA 2A0QB 1O33A 8GCHG 1ANCA 1JIMA 4ABHA 1VGCB 1B7XB 1BRCE 1N6YA 3B23B 3K65B 2XC0A 1Z8JB 3STIA 3ZVCA 3SU6A 1DS2E 1TGCA 3CS7A 1ETTH 3M5MA 3VB6A 1D3QB 3S7KB 1Z8RA 4JZEH 1FAKH 4ZKNU 3T28A 3C27B 3GDUA 1MKWH 5DO4H 2OC8A 1RTLA 2UUKB 1UTMA 3JZ2B 1JXPA 4JMYA 1SC8U 2JH6D 4B73A 5L2YH 1YLCA 3LU9B 4X8VH 1O3OA 2VVUA 2PWXA 1SOTA 2WINI 3TIUA 3MTYA 4U2WA 3SJ9A 2QN5T 1H8DH 1ZSLA 3BG4C 4H6TA 3SV7A 1P04A 1WU1A 4KTUA 1SGPE 1INCA 3GYLB 3PTBA 1QBVH 1U6QA 1UTNA 2OINA 3RLYH 2ZTYA 4CHAB 3B9FH 1ZMJA 3SQHE 1LHDH 1GI9B 3HKJB 3ATMA 5DP8A 1Z6EA 3VGCB 4DIHH 1GDUA 2PSYA 1F5RA 1T8NA 1HV7A 3GCNA 1JBUH 2PTCE 2P3UB 4QT8C 2Z9GA 3GYMA 3Q77A 2UUJB 3M3SA 3MI4A 1LTOA 2D26C 2EI8A 4Q7XA 2ZDMA 2XNIA 3GY6A 4IN1A 3RXPA 3U8RH 1FDPA 1A0JA 2D2DA 3MH6A 4X6OA 1TRNA 2QC2A 1WQVH 1XX9A 1QRZA 2UUYA 4XBCA 2ZFSA 4I8KA 1P0SH 4TWWA 2A2XH 2XC5A 3ODDA 3RXDA 1F92A 1C5OH 1EPTB 3QDZB 1HLTH 3RC5A 4I8GA 1T8OA 1TPOA 1Q2WA 5CHAB 3BF6H 2BM2A 1TRMA 3SORA 1WTHD 4GPGA 3PYHA 3EYDA 4NZQA 4LZ1H 1QJ1B 3B8JA 1T32A 1QBNA 4OS4A 1ZGIA 2B9LA 2BHGA 1UMAH 2FOGA 3A89A 1TGBA 4YT7H 1GBTA 5LGOA 3A8DA 3RU4E 1HAYB 1Y3UA 3E8LA 1KLJH 4IMQA 4MNVA 2A45B 2F9VA 1QY6A 4K2YA 1UVUH 4K3JA 1MQ5A 1CA8B 2OLGA 5FPYA 1HDTH 1A3EH 4BTUB 1KLTA 2O8MA 5GCHF 3AW1A 3RXKA 4FXGH 3BTWE 1P06A 5HXFA 3R0FA 3QLPH 2W5EA 2ALVA 2OQUA 3NUMA 1AQ7A 4Y0ZE 2RCEA 3LGWA 1Y3YA 1O3FA 2KAIB 4J2YB 1C1RA 2UWPA 2ALPA 4I7YH 1AMHA 3P8FA 2IJOB 1DANH 1IAUA 3K6YA 4WXIA 1C2MA 5HMAA 2WYGA 4ZKOU 1RIWB 1V2ST 5PTPA 1J8AA 3NK8A 1TA2A 2ANKH 5DGJA 1P2QA 3F6UH 3GICB 2BDAA 1OSSA 1O2RA 4DIIH 2AGEX 1ESAA 4K8BA 1MKWK 2BX4A 2F91A 5SGAE 4WY3A 5JPMH 2FZZA 1UO6A 3EAJA 4IGDA 1O5BB 3RU4D 1MCVA 1GJ4H 1FY3A 1NTPA 1O3MA 1NU9A 2PW8H 4A7IB 1L0ZA 2BLQA 1Y3VA 4D9RA 3N7OA 1HJ9A 1SI5H 3F9EA 3FFGA 1HPGA 1KLIH 1DICA 2ZGBH 3E3TA 4HI3A 4CRFA 1LQEA 1V2LT 4MPWA 5J4QA 2QXGA 3OU0A 2AERH 1A3BH 1OWEA 1LHEH 1AE8H 3SQEE 2XRCA 1AZ8A 2QF3A 2FTMA 2R0LA 3ZZCA 1V2QT 2SGPE 1SHYA 1O2QA 2OXSA 3LC5A 4O97A 2PLXA 2Q6GA 1CA0B 5FX5A 1GI7B 5JBBS 3LONA 1LCYA 1O2UA 1KXBA 1V2OT 2GT7A 4NG9H 1FIWA 2HNTF 4ABGA 2VIVA 4INLA 1WV7H 1T8LA 3LKWA 1B5GH 1CGHA 4E7RG 2TGTA 2XTTB 3KNXA 1A46H 2GMTC 5TCCA 3URDA 2GKVE 3KQDA 1EAUA 1K1MA 1TOMH 4FUBA 3MH7A 3ZZAA 3U69H 1S82A 1TB6H 1TYNA 2VGCB 1OP2A 3AW0A 4FUDA 1JIRA 2SGEE 1GHAG 4KGAA 1NZQH 4DURA 3VXEH 1O5GH 1BUIA 1EZUC 3V13A 2ZZUH 1MBQA 1VR1H 1GVZA 5T3HA 3BTTE 2BY8X 2DE8A 4WH8A 3SUDA 1KXDA 1WCZA 3LDXH 4WVPE 2F3CE 1O2ZA 4ZAEA 3AAVA 5LPRA 1KY9A 2CXVA 1TMUH 3HKIB 2A5KA 1OWKA 4ZKRU 4KELA 3NCLA 1GPZA 3MU8A 3RXEA 1XVMA 4UFDH 2HNTE 4CRBA 2Z9LA 3NKKA 1CBWC 3EQ0H 3SNEA 1G9IE 1PQ7A 2PKSC 5HM9A 4FU9A 3MMGA 1AO5A 3UY9A 4JZDH 4ABBA 5TCAA 3SU1A 3RXLA 3RXJA 2OTVA 2VIOA 3SUFA 1TIOA 2J92A 3EA8A 1E36B 3UOPA 1ZRBA 5AFZH 1RGQA 3FP7E 3F9FA 1O5CB 1GBHA 1GCDA 2PUQH 3SHCH 1DY9A 3DUXH 2GVFA 1HBTH 1QHRB 1GG6C 1E38B 2QXHA 1GJDB 3GDSA 3OSYA 7KMEH 2UUFB 1ELVA 3TJOA 5EW1H 3ZVEA 1AFQC 3D49H 1O3LA 1ZGVA 3LGVA 1NY22 1IQKA 3Q00A 5EU8A 1NPMA 3SV8A 2H9EH 1Z71A 4GUXA 5ESTE 5DP5A 1TNJA 2W7UA 4RN6A 1MZAA 2W7SA 1TMTH 2BXTH 2ZFQH 4MTBA 1QBOA 1SLUB 1EPTA 1IHSH 1TNKA 3GCHB 1Z8IB 3RXFA 2ULLA 1BTPA 2BOHB 1E35B 1GHXH 1NC6A 3NXPA 1F0SA 1QL8A 3VPKA 1QIXB 1AWHB 2SNWA 1T8MA 2F9UA 4MPVA 2HLCA 1CT0E 1ABIH 1XXDA 4BAQB 3SV2H 2CHAB 3BEIB 2GX4A 3QK1A 1BMNH 1HIAB 1VITF 1TRYA 2BDIA 3SGBE 1EXFA 1AE5A 2VIQA 1HAIH 2BD4A 1TWXB 3ZYEA 2SGDE 2RA0A 5J4SA 3ZVAA 4D9QA 5EQSA 1GVLA 4ABIA 4OS2A 1ELCA 1HAVA 2ODYB 3QWCH 5F6MA 4LXBH 3V7TA 1GHBG 3RXIA 1GL1A 2J95A 2ZPQA 1AB9C 5A8ZA 4JK6A 1K22H 3EE0B 1BB0B 4GSOA 8KME2 1W14U 2TGDA 5EQQA 1LVYA 4GCHG 2FS9A 2R3UA 3VGCC 2ZHWH 2B0FA 2NU1E 1UJ1A 3I77A 2RG3A 1RRKA 1GL0E 3GCTF 4A6LA 3RXRA 1AHTH 3Q76A 2H2ZA 1ETRH 3MU4A 1MD8A 2QY0B 3TU7H 1QRWA 3SGAE 2OCVB 2HOBA 1BMMH 4X8TH 3HGPA 1RJXB 3RXBA 4AZ2B 1O3NA 3HPTB 3EA9A 1TFXA 2V3OH 3E16B 2ODPA 2ZU3A 4FVDA 4RKJB 5FXLA 1CGIE 1GI3A 1BITA 3E90B 1J17T 1IHTH 1C1MA 1G3DA 2BLOA 1O2GH 3RP2A 1C5ZB 2EI7A 3K9XB 3P70B 1VZQH 1W13U 3TITA 1HIAA 5AHGH 3VFEA 4BANB 2RA3A 1EJMA 1AU8A 2ZHQH 1C5UA 2ZC9H 1P03A 1HAOH 4B2CA 5JBTA 1UHBA 1D3TB 1GJ7B 2EC9H 2FO9A 1V3XA 3UREA 1C5VA 2ZDNA 2JKHA 1GJ6A 2FX6A 3V12A 3LGUA 6GCHF 4JYUH 2XW9A 2Q6FA 1WAYB 4XE4A 1BJUA 1CE5A 1F0UA 2NU4E 3T62A 2Y82A 3M7TA 1P2NA 3A81A 1J15A 3O8RA 4DJZB 3RU4T 1YPMH 1LPZB 2ZDAH 4J1YA 2WPKS 4R8TB 1EZXC 2ILNA 1S85A 1WBGB 4I8JA 1MKXH 1XM1A 5FAHA 3MNBA 1BTXA 4NIVA 2B5TB 4OGXA 2ZHEH 1AVWA 4IN2A 1TABE 3LGTA 2W3KA 2P8OC 2HPPH 3PWCA 5EOKA 3GISB 4Y6DA 1PYTC 3BTHE 1AUJA 1ID5H 2ANMH 2PSXA 1O5EH 3ZZ8A 5BPEA 3KHVA 1O3JA 2P95A 1MAXA 2ZHFH 1OYQA 2P8OB 2TIOA 1KDQA 3GY2A 4CRAA 1ARBA 1C5YB 1K1IA 1IQMA 1YGCH 4NSYA 4OGYA 1UK4A 3SZNA 3NWUA 3GY5A 3PMJA 4UE7H 1UVSH 3MO6A 4RKOB 2BB4A 1FV9A 1MU6B 4AFQA 1EP6A 4K1EA 5T6GA 4YLUA 1O3IA 1O2WA 2B7DH 4NIYA 2ZGCA 1OWDA 2JETC 4CRGA 3MYWA 1BBRE 1M9UA 3STJA 3SJIA 2PKAB 1OWJA 3QZRA 3Q3KA 1IQEA 3P95A 1C2LA 3PLKA 5EPNA 3QGJA 1DPOA 4BNRA 2BZ6H 4Y10E 3UWJH 2Z3DA 4NA9H 1HAXB 2SGQE 4YZUA 3TVJB 1FN6A 1H9IE 1W2KH 3H5CB 1YKTA 1QURH 3SO3A 3SUEA 1SGEE 3HK6B 4OS1A 3PO1C 4MVNA 4ABAA 3WY8A 2V3HH 4K60A 1QTFA 7LPRA 5F8XA 2YNAA 6CHAB 1EKBB 3A86A 1XUGA 3FP6E 4NA7A 5BRRE 2FYRA 4LK4A 1S0QA 2QF0A 1FN8A 4ZMAH 3HK3B 1Z1JA 1O2JA 8LPRA 5GWZA 3VB7A 1LVBA 3RC6A 2XYAA 3K6ZA 1NT1A 1EZQA 2GZ9A 5GIBA 3KQCA 6LPRA 1HJ8A 1FI8A 2Y6TA 1K1OA 2QV1A 1W7XH 2AYWA 2A2QH 1BBRK 2BD7A 2SGFE 2QAAA 3LC3A 3RXQA 5IYTA 1P9UA 1QCPA 2FOAA 1L1NA 1XKBC 1DXWA 2VINA 1FY8E 1VCQA 5FX6A 3FANA 4ESTE 4B2BA 4MDSA 4AYYB 1IQHA 1TX6A 4X1RU 1G2LA 1MTVA 4GLYA 1TNGA 2TPIZ 8ESTE 1A4WH 2ZP0H 4K1SA 3LJJA 2SGAA 3ATIA 3O8DA 3KQEA 3DD2H 3GDVA 1BHXB 9ESTA 2IOTA 1EOJA 3RXVA 1BZXE 1DWBH 3GY7A 1G37A 1MH0A 4CH2B 2UWLA 4MNYA 5E0HA 5HYOA 3NPSA 4WH6A 1ETSH 4BTTB 1Q3XA 1O3HA 2G5NA 2ZU4A 1V2TT 2WV4A 3TK5A 1GBCA 3ZZ5A 5A8XA 4BTIB 3E0NB 3P17H 3S9AA 1C5MD 1QA0A 2I6QA 4H42U 1PYTD 1DSTA 1UVPA 1O2PA 1ORFA 3RLWH 1G3BA 1TMBH 3F1SB 1IQLA 2A31A 2OBOA 1UTKA 2ZU5A 5HM2A 3A7VA 1Z7KA 1NESE 2BMGB 2RDLA 4INKA 2FLBH 5DP7A 1VJ9U 3BIVH 3O8CA 2STAE 1DWEH 1QL7A 1GBDA 3BTQE 3IITA 3KGPA 4BAHB 3TJNA 2NU2E 1P05A 2FYQA 4HGCA 1GI2A 3Q3YA 5A0CA 3I78A 1B0FA 4X6NA 5C1YA 1HFDA 1A1RA 3M36A 1O2LA 2BD5A 1WOFA 1ELBA 1O2OA 1BRBE 1W8BH 1PJPA 2VWOA 3E6PH 7ESTE 1AKSA 1L1GA 5GXPA 1QL9A 1SGIB 4B1TA 3A7ZA 2A4OA 3D62A 4YESB 3A85A 4X2WA 2A32A 2CHAC 4UD9H 1JWTA 4JYVH 2AS9A 2C3SA 1LQDB 1NRPH 2Y80A 2NU0E 3ZYDA 2JETB 3MNSA 1O5AB 1SLXB 2P3FH 2G51A 4F4OC 4TWYA 2ZWLH 3GY3A 2YOLA 2VIWA 1OKXA 1AN1E 3F68H 1GHVH 3NZIA 3BTME 2H5DA 2P94A 2F9BH 1V2UT 3TH3H 4X2YA 1BQYA 1CBWB 1O35A 4NIWA 1UK2A 4ZHLU 5EODA 3PV4A 3W95A 1VITH 1C5XB 4NSVA 1Y3WA 1Q31A 1C5PA 2CF8H 3SNBA 1GJ8B 3GOVB 1NM6A 3FZZA 3LH1A 1KIGH 4DVAU 1GMHF 4JZFH 1F2SE 1GJ9B 5K7RA 2ZI2H 1VCWA 4BAOB 5EXLA 3SJ8A 1GWAA 1EAXA 6CHAC 3P92A 2BDBA 2BQWB 2R0KA 2FDAA 2HALA 4NFEA 1NU7B 4SGAE 3VB5A 3V3MA 1AWFH 2H1UA 2G81E 3SV9A 2Z9JA 2V35A 1Y59T 1SGQE 4FUGA 3A80A 3HGNA 3QZQA 3PLBA 2ZO3H 2QXJA 1TGTA 4Y7AA 1IQIA 2XCNA 1BRUP 1UVOA 3SOSA 1C5RA 2GZ8A 5B6OA 4X1PU 5L30H 5CE1A 1BDAA 1FMGA 1O31A 1C1OA 3RMMH 4X6MA 3LJOA 1O36A 4XFQA 1XUFA 1LMWB 2TGPZ 4CBOA 2ZEBA 1MZDA