6ESTA

Interaction of the peptide cf3-leu-ala-nh-c6h4-cf3(tfla) with porcine pancreatic elastase. x-ray studies at 1.8 angstroms
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(serine proteinase)
molecule keywords PORCINE PANCREATIC ELASTASE
publication title Interaction of the peptide CF3-Leu-Ala-NH-C6H4-CF3 (TFLA) with porcine pancreatic elastase. X-ray studies at 1.8 A.
pubmed doi rcsb
source organism Sus scrofa
total genus 57
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1990-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 6estA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 6estA01
1MAYA 4XOJA 2BDBA 2JKHA 2BX3A 3U8OH 1SR5C 2THFB 1B7XB 2OXSA 2GCTB 3M5LA 1S83A 3QWCH 1SG8B 2JH5D 2B7DH 1DPOA 4OS5A 3PLBA 2W5EA 4MNVA 2ZCKP 3LKWA 1ELAA 1OYTH 3NCLA 1GJ9B 1BBRH 1IAUA 2PKSB 1C9PA 2PSXA 1C5RA 1AE8H 1C5QA 3UY9A 4FUFA 1YLDA 2BDIA 1SGNE 1GI9B 4X6PA 3QTVH 2BY9X 1UK4A 2C4FH 1BZXE 1EZXC 4B2BA 3RXTA 1O3LA 7GCHG 2ILNA 2R0KA 1SGCA 4K3JA 1V2WT 2G55A 1O2JA 1KIGH 2OC8A 2TGAA 6CHAB 2FOCA 3GCHC 1Z8RA 2R9PA 2GCHF 2STBE 1EJMA 4JZFH 2TGTA 3TH3H 1H8DH 1Y3XA 1J14A 2BDAA 4ABIA 4D7FA 4IN1A 4RN6A 1BQYA 2ANWA 1GBHA 1J15A 6CHAC 4AB9A 4NIXA 2QN5T 2R0LA 2OUAA 1GBEA 2SGDE 1T4VH 1O2OA 1C1QA 2PV9B 2ZTZA 3K65B 3BIUH 2A2QH 4ZAEA 5HYOA 2ZDKA 5HM2A 1LVBA 1LCYA 2OINA 2WV5A 3RXAA 1O5EH 3IITA 1T8OA 1VZQH 1BTUA 1O3GA 2I6QA 2BM2A 1O33A 1BMNH 3C1KA 1V2NT 2EEKA 1AI8H 1VCPA 3S7HB 3A80A 3PM3A 1F0TA 4A1XA 1YPHC 3SJ8A 1AQ7A 3DFJA 4ABEA 4MNWA 4H6SB 3ZVFA 2QGRA 1PPCE 1HAIH 4SGBE 1ZHMA 1VJ9U 4CBOA 1C2HA 1ANCA 1H4WA 1FJSA 1BRUP 4X8UH 1G2LA 2FOHA 1ZSLA 2TBSA 3MWIU 3UQVA 1UHBB 3O8BA 3VB4A 2GGVB 3RU4T 3K2UA 2BQWB 1ID5H 1XUGA 2ZCLP 3EQ0H 3BTWE 1QQ4A 1GI5A 3GY2A 4UFFH 1SPJA 5JYIA 1OPHB 3A7WA 3A89A 3O8CA 3RC5A 3QGNB 3BF6H 4JCNA 4YTAA 1YCPK 4MPVA 4ZHLU 1O3BA 1QL7A 1VGCB 1EB2A 4ISOA 1GJ6A 3HGPA 4U2WA 1C4Y2 1J9CH 1ZSKA 3SGAE 1G3EA 4XSKU 2FODA 2NU0E 3A7TA 4JZEH 3A8DA 1S84A 4K8YA 4RKJB 4X0WU 1GJ8B 3A84A 1NTPA 2O9QA 2UWOA 3ZZAA 1ETSH 1V2MT 1D6RA 3TK9A 3NUMA 1BHXF 4O3TA 4JK5A 1P12E 4IS5A 2KAIA 2FLRH 1E35B 4K5ZA 2NU2E 3ATIA 3HGNA 3ZZ4A 4UFDH 2WYJA 2GZ7A 2OQUA 2TGDA 3TJNA 3LJOA 2QXHA 1A5IA 1O2SA 2AIPA 3QK1A 4R0IA 4NZQA 1D3DB 6GCHG 2FYQA 1FY4A 1IQMA 1TMTH 1UTLM 1MZAA 1PPGE 5EQQA 3HK3B 1GDNA 4BTIB 2F9OA 1FIWA 1O2UA 2SGAA 4DG4A 2BDCA 2FI5E 2ZPRA 1GL0E 4X6NA 4I8KA 1C1WH 1O2PA 3MI4A 3BSQA 3RM2H 1EX3A 2AGIX 1CGHA 1HYLA 2AMQA 5HMAA 4KKDA 3RXLA 2ALVA 2RCEA 3RXEA 1O3CA 1HCGA 1PQ7A 2WV4A 2BVSH 3MO6A 1HBTH 1SGRE 2QF3A 2J95A 4IC5A 2GZ8A 1ELCA 2TIOA 3MU1A 4PROA 1EAUA 5CMXH 1YP9A 5EODA 2A5IA 2FX6A 3RXKA 1MQ6A 1ARCA 3VB5A 3KHVA 4IC6A 1D3QB 3U69H 1DXPA 1TA6A 4TY7A 2Z9GA 4ZXYH 1SMFE 1E34B 3RXFA 1OWJA 3SNAA 5L6NH 3H5CB 3SU2A 5AFZH 1GHAG 1P02A 1QGFA 2PUXB 3BTHE 1BTHH 1RTFB 2EI8A 1C9TA 1AMHA 4H4FA 1UVTH 4CH8B 5HM9A 3LH1A 1L4ZA 1MZDA 1PJPA 3MNSA 2WUCA 1SFIA 2D2DA 1SGDE 1K1NA 2LNCA 1ANBA 2HPPH 3SUEA 3MMGA 4E05H 5I46H 5L30H 1LQEA 1JOUB 5K7RA 2XC4A 2V3HH 4BAKB 1PPHE 5GPIB 1RD3B 1KXCA 4FXGH 3BTGE 4HTCH 1IQLA 1OP2A 1D4PB 2P8OB 3W94A 4K1SA 5JBBS 1AWHB 3UUZA 2W7SA 5DG6A 2C3SA 1VITF 1O3MA 5GCHF 5GIBA 3GDSA 3JZ1B 5A0BA 1EAWA 2VVUA 3UWIA 3KQEA 1O3FA 1BIOA 2TRMA 1BMMH 2Y6TA 3SV2H 1N6XA 3BTME 3ZZBA 1SQOA 3A7ZA 1UVUH 1MH0A 4LXBH 3MYWA 2P59A 4LOYH 3E16B 4DCDA 1RJXB 3G01A 2IJOB 5FPTA 1N1LA 1C5OH 2P93A 2XNIA 2ZFTA 1EZSC 1BJUA 2BY7X 1EASA 4K60A 1D9IA 2GD4B 3FAOA 5J4SA 4A5TS 2QF0A 3SNBA 2A2XH 5ESTE 1XM1A 3P8NA 5TJXA 4B1TA 1MAXA 2I6SA 2A1DB 4YT7H 3V12A 1C2LA 3VB3A 2FZZA 1JIMA 1T4UH 2BY8X 1F0UA 2H9TH 4ZKRU 3SU6A 1O3DA 2WUBA 2ZWLH 4MPWA 3F9FA 3MO9A 2ZFQH 1ZRBA 2UUKB 1Q3XA 2VNTA 2Y81A 4ABHA 1HDTH 1ESBA 2Y7XA 2G4UA 3IG6B 1CQQA 2C90B 4IMZA 1TPSA 2PUQH 3PTBA 2IOTA 2P3TB 2VWNA 1HGTH 4K2YA 3SI4H 2PKAB 1NO9H 4OS7A 2STAE 2VIWA 3DD2H 3F9EA 1DVAH 1HAHH 4BXSA 2H2ZA 3KL6A 1EATA 1UVOA 3SV9A 1K1MA 1KDQA 3DHKH 3GY5A 4MLFB 2FMJA 1J16A 2O8UA 5FPYA 1C5PA 2HNTE 2XCFA 4K1TA 1P03A 2QYIA 5DP8A 4B75A 3E90B 1GJ5H 3LGYA 1LMWB 1GJ4H 1ANEA 3U1IB 1WBGB 5BPEA 1X7AC 4TPYA 4Q80A 1TNJA 4MQAA 1QA0A 1YCPH 2JETB 2UUFB 3EDXB 1ZYOA 4WF8A 3F9HA 1C5XB 1O3PB 2ZFRH 2AEIH 2ZIQH 1WOFA 3S0NA 1ZPZA 2NU4E 1O34A 2H5CA 2BZAA 5DK1A 3MH5A 5C3NA 2O8MA 3BTTE 3QX5H 3ZVBA 2JETC 3OU0A 1DY8A 1O2YA 2ZP0H 1L1GA 3RU4D 3I29A 1PPFE 3D23A 3M35A 1YPJH 3PYHA 3ENSB 3DA9B 2ZDNA 3DFLA 1KLTA 1CGIE 3KQDA 4HFPB 3D62A 4X2XA 1GHVH 1CO7E 5FCKA 2EI7A 1LVYA 1O30A 2RA3A 2BXTH 4WH8A 2ZGJA 2VJ1A 2PSYA 4X1NU 1TNHA 4YOIA 4FUIA 3GDUA 1FI8A 2XYAA 1DXWA 4UONA 3SORA 2HLCA 3E0PB 3ZV8A 4B74A 4K69A 3DT0H 4X2YA 1OP0A 1P3CA 1FUJA 2ZECA 1EPTB 4Q7ZA 1ORFA 2PHBA 2GZ9A 3AVZA 3GY7A 2ODPA 1AB9B 2VGCB 3ATLA 3D65E 2ZU4A 1UMAH 2BX4A 2CGAA 4CREA 1NZQH 1AVWA 1GBTA 3UR6A 1T32A 2BD7A 2ZQ1A 1NESE 2GMTB 1C1VH 4U32A 1BDAA 3U9AH 1TOCB 1AB9C 2BD5A 4I7YH 2VGCC 4Y6DA 1SGFA 3QGJA 1CHGA 1LHGH 1IQGA 1ESTA 1KXEA 1TX8A 2GT8A 3VXEH 3F9GA 3Q3KA 1ZTKA 3SUGA 1O5DH 1OWIA 2G4TA 5L2YH 1YKTA 1O5FH 1K2I1 1NY22 2GMTC 1TIOA 1P04A 1YBWA 3SQEE 5SGAE 1YPHE 1HIAA 4NA7A 5DP6A 3PV4A 1XKBC 3RXOA 1F92A 2ZU1A 4THNH 2HALA 2Y80A 5DP9A 1B5GH 1HJAB 1GI8B 3GCTF 1O2QA 1O35A 4UD9H 1S0RA 3STIA 1GHBG 2BB4A 3RM0H 3TVJB 4TWWA 2CMYA 3QN7A 1O2NA 1FXYA 5LPEA 1SI5H 3RXSA 1O3IA 2FDAA 4CHAC 5JDUB 2W3KA 4TYDA 1MBMA 3VXFH 6LPRA 3LGWA 1LHCH 1YM0A 3P92A 3BG4B 4Y0YE 3MU8A 4XBDA 7KMEH 4WWYA 1TNKA 1ELGA 2FOGA 1ZJDA 3TLOA 1O31A 1KLIH 1F2SE 3K6ZA 4D9RA 1LVMA 2G8TA 5DKMA 3LU9B 1QRWA 2PTCE 1GG6C 3T2NA 3BG4C 2FEQH 2OP9A 1V2UT 1QHRB 1ZMJA 1Z8GA 2PFEA 5FBEA 4CR5A 1DT2A 4BXWA 4MG3A 4INHA 3CS7A 2HPQH 3F68H 1ELVA 3GCOA 2IPHA 3M37A 3RXMA 1PFXC 2OC1A 3TIUA 1IOEA 1LPKB 2FOMB 1IQFA 5FAHA 1W12U 1QB1A 1GJBB 1P06A 4RSPA 4CBNA 4Q2KA 5AVDA 1CE5A 3SOSA 1EJAA 1YPKH 1VR1H 4GCHG 1NROH 4WY3A 1UCYK 3PLKA 5ETXA 1NM6A 3ELAH 3BEUA 4YLUA 1O39A 1PPBH 3GCHB 2R2MB 2BOHB 1HXEH 1LO6A 3MO3A 3FANA 4JMYA 1ACBE 1QRXA 3FZDA 2ZU5A 1QCPA 4NFEA 1K1LA 3OYPA 3KGPA 4FU9A 1HAVA 3LH3A 2XWBI 4ABDA 4NFFA 1S85A 1IQJA 2IN2A 1LKAA 1O36A 2W26A 4DVAU 5C1XA 3BTFE 1LQDB 1B0FA 1ZR0A 4YO9A 1V2PT 3LONA 3M5OA 1DDJA 4FUJA 4X6MA 3NK8A 1OOKB 3U8RH 3PMHB 3RC6A 4Y8XA 2Y7ZA 1OWKA 2QY0B 4TPIZ 1W0YH 1GCTB 4UE7H 1QB6A 1QL8A 5FX5A 3UNRA 2KAIB 1OX1A 5EXMA 1LHEH 2H1UA 1CHOF 1HPGA 4Y76A 2VVCA 1JXPA 2QXJA 1QY6A 1C1OA 1GMHF 2F83A 4IBLH 3A7VA 3RLWH 1GMDG 1U6QA 5FXLA 1GBBA 1ZTJA 5EXNA 1O3OA 2BLVA 1GCTC 1QTFA 5GXPA 2C8XB 2VH0A 1T8LA 4D8NA 1NRSH 3I77A 4Y7BA 4BTTB 1ZMLA 1C5LH 1BRCE 1VCWA 2BOKA 2FTMA 2ZHDA 3P17H 3TU7H 1UTOA 2ZEBA 1A4WH 1T7CA 1P2NA 4BAOB 1OSSA 3P70B 3RXVA 2XC5A 1GVZA 1FY5A 1F0RA 3A7YA 1P11E 3NKKA 1KY9A 2PLXA 5FHTA 2BD4A 1K21H 2A4QA 1IQNA 3SU0A 1AO5A 3V0XA 4INKA 1O38A 1THSH 1BUIA 2ZZUH 1LHDH 1ABJH 4HI3A 1TNIA 3BTDE 5FCRA 4B73A 4UDWH 3L3TA 1AU8A 5C5OA 1YC0A 3ITIA 3ZV9A 1L0ZA 3QZRA 1L4DA 1LPZB 1H1BA 2YOLA 3E91A 3BG8A 3LOXA 1Y5AT 1KXAA 3S9BA 4M7GA 3IWMA 1BBRE 1GBCA 1C1UH 4X8VH 1DOJA 2C8WB 1BA8B 2QA9E 1EUFA 1TPAE 1O2MA 1TLDA 1WAYB 5IYTA 1GI1A 1Z7KA 4O97A 2WINI 4F49A 1HUTH 1SC8U 1UTJA 2GV6A 2ZTXA 1H8IH 1KXDA 3LGVA 1Y5BT 1SGEE 1FNIA 1V2TT 5E8EH 1SGPE 3FFGA 2TPIZ 4R8TB 3SBKA 1GI0A 2A45B 1NRQH 3SI3H 1WUNH 4A92A 4D9QA 2F3CE 1NU9A 5C2ZA 1O5GH 3RMOH 3GYMA 1TOMH 4JZ1A 3BTQE 3ODFA 1TGBA 1B0EA 1Z8IB 1BTWA 3B23B 2FM2A 2Z7FE 1D3TB 4O3UA 2OQ5A 1MTVA 1C2IA 1TNLA 1HLTH 2XBXA 1S6FA 1GBFA 4BAQB 1GBIA 1F5KU 2BD9A 3L33A 2DE8A 2AS9A 2AMDA 1C2GA 4A7IB 5F6MA 1IHSH 2ZDLA 3TJUA 3M3TA 1CVWH 3RXQA 2GVFA 4JYUH 3SV6A 1TMUH 3HK6B 4ZKNU 1TGTA 1V2OT 3FP8E 2ZU2A 4Y0ZE 1AD8H 4NIWA 4INLA 1GI7B 4IW4E 1TWXB 5FBIA 4H42U 1SB1H 2XBVA 3OTJE 1V2ST 3N7OA 5G4BA 5GWZA 4MNYA 1DUAA 3UWJH 1KSNA 4Y7AA 3A8CA 4K1EA 3TGKE 1P01A 1E36B 2GDDA 3QUMP 4ZROA 1VJAU 1UTQA 2C8YB 3UR9A 1HAXB 1ZRKA 1H9HE 1MKWK 2R3YA 3Q76A 1O3JA 4B71A 1MQ5A 4FVBA 3UPEA 1NRPH 4KGAA 3HKJB 1WTHD 5EQRA 2Y5HA 5T6FA 3SJKA 2Z3CA 4AN7A 3A8AA 2AGEX 1SVPA 5TCCA 2OC0A 1G30B 2ZF0H 4IN2A 3ATWA 1AHTH 5EG4A 5H4IB 8ESTE 1S82A 1G9IE 4FUGA 4MPXA 4KTCA 1C5YB 3Q3YA 4BAHB 1JWTA 7GCHF 3TNTA 4DURA 4NGAH 1P2OA 1GBMA 1VITH 3M7TA 1O2IA 3AW1A 3MU4A 3RXCA 2D26C 4LZ4B 2A4RA 1LDTT 1FN8A 1H9LB 3ZZ8A 1C1RA 3RXBA 3KNXA 2UWPA 5ESBA 1UK2A 1NC6A 1XXDA 2ZFPH 3PWCA 3TH2H 3OX7U 1ELBA 1O2VA 1KDQB 1UCYH 3SNCA 1FV9A 3VFEA 4JYTA 1NU7B 3MOCA 2BVXH 3TITA 1JIRA 3V7TA 2OCVB 4OS6A 3KQBA 1EB1H 3RLYH 3P8FA 1GCDA 4FUHA 3LDXH 4AOQA 2HNTF 1TA2A 3LPRA 4ISNA 1ELFA 4Y71A 5EOKA 3FP7E 1DLEA 1V2LT 4ISHH 1O2XA 1A5HA 1TX7A 2BQ7B 2BVRH 4X1SU 1TQ0B 1YPLH 2D8WA 2ZGBH 2PGBB 4ABGA 3A87A 1AUJA 4GHTA 1XX9A 2ZA5A 2OBOA 4AB8A 1NPMA 4ISLA 4Z6AH 1A0LA 4AORA 3RXDA 4Q7XA 2WPMS 3QTOH 3BIVH 3I78A 4FVDA 1G2MA 1TBZH 4ISIH 3SJOA 3QDZB 1HNEE 3LJJA 3MU5A 1AE5A 3HPTB 2BD3A 2WPIS 3A81A 5DPAA 4ZHAA 4ZHMU 1AKSA 1PYTC 3K9XB 1LTOA 2AMPA 4DY7B 1C1TA 1GBKA 1SQAA 2XTTB 2BDHA 1D3PB 5GJ4B 2F9VA 3TH4H 2BD2A 1ELEE 1SGTA 2SGQE 4NIYA 4DJZB 5C5NA 1V2QT 3SNDA 4X2VA 2BDYA 2J94A 2ZC9H 1XKAC 1DS2E 5A0CA 5LGOA 4I8LA 4OS4A 4B2CA 1GGDC 3RXPA 1OWDA 4AFUA 4CRDA 3TK6A 2BHGA 1ZZZA 1C2FA 4ZXXH 2QCYA 3M5MA 5EGMA 1K1PA 3SJIA 1O2WA 1P0SH 2FPZA 1P10A 1SOTA 5HGGA 1RGQA 2A4GA 1W7GH 3MH4A 1A61H 1P05A 1GVLA 1GI3A 3SGBE 1O2TA 2ZFSA 3BV9B 1A7SA 1BHXB 1TB6H 2FO9A 4AG2A 4NA8A 1A5GH 1TRNA 3KCGH 1TABE 4I8GA 3PMBB 3ZZ6A 1GL1A 6GCHF 2H6MA 1UK3A 2GTBA 4Y79A 1ETRH 2FX4A 4WJG2 1FY1A 1UVSH 4A1TA 5JPMH 1AZZA 5DP5A 1HIAB 1C1SA 1SBWA 4DGJA 1O0DH 1C5UA 4YLQH 4X8SH 3VB6A 4BAMB 1KTSB 4BNRA 2BXUH 1ZGIA 1C5NH 4GPGA 3UREA 4E7RG 2BY5X 1HAPH 1O3NA 3SV7A 3MNXA 1C5WB 1F5LA 4NSYA 1VCQA 2A31A 1OYQA 2YNAA 2ZDVH 4BOHA 4HGCA 2FXRA 2AIQA 1TRYA 1GI2A 3UQOA 4MTBA 1XVMA 4OGYA 1RRKA 4X1RU 4KP0A 4AFQA 2AFQB 2HRVA 1C2KA 3FP6E 5JBCS 1BTPA 5GDSH 2FESH 1TGSZ 2PTNA 3U1JB 1GJDB 2P16A 3EAJA 3SHCH 3SW2B 2A32A 4KTUA 3UIRA 4F4OC 5C20A 1YYY1 3M3VA 4D7GA 1OWHA 5T6GA 1MD7A 4X1QU 1TBQH 4UFGH 4ABBA 3VPKA 2XCNA 1GHAF 4GAWA 2BLOA 1T31A 1RTKA 4GSOA 4AZ2B 3SU1A 3PROA 2EI6A 3F1SB 1FQ3A 3MTYA 2FLBH 3LGUA 1MCVA 1Q2WA 1BOQA 4ZMAH 5CHAB 3RXJA 1E0FD 1P2IA 1QURH 1ESAA 5AFYH 2R2WU 3H7OA 7ESTE 1XUKA 4XBBA 4X1PU 5E2PA 2J34A 2R3UA 3ZYEA 1MKXK 1V2JT 2ZG0H 1GHXH 3OY6U 4MPUA 1GBAA 1O2LA 4NWLA 3UFAA 4Y11E 1C1PA 2CN0H 1W14U 1HB0B 5CHAC 1NRRH 1JMOH 2WYGA 1MTWA 1W11U 4AGKA 3QLPH 4CH2B 3A82A 1F5RA 1HXFH 2P94A 1MKWH 2Z94A 4I8HA 1A1RA 4CHAB 1O32A 1GI4A 1CT2E 4AFZA 4MDSA 4A1VA 1IQEA 1GPZA 1THRH 2FS8A 2ODYB 3OY5U 1TBRH 1N8OC 1HAVB 1CA8B 1P9SA 1WV7H 3JZ2B 2J38A 1SGFG 4YM9A 4YESB 3RXIA 1CT4E 4ZKSU 4WVPE 1BT7A 1IHTH 3ZZ3A 1DWDH 2Z9LA 5E2OA 1GG6B 3RXUA 1SLWB 1YGCH 4U30A 4NZLA 1AY6H 3MU0A 2ZFFH 4O03A 1J17T 3SHAH 2XXLA 1QBNA 2FI3E 1CGJE 3ESTA 5HXFA 4AGJA 4WXVA 1FZZA 2ESTE 4OGXA 5A0AE 2C8ZB 3M36A 1Y3UA 2TGPZ 2ULLA 3BN9A 4FUEA 2A0QB 3M61U 3RMNH 2BQ6B 4CRAA 1C5TA 3VGCC 3E1XB 2XBWA 3A85A 4K8BA 2ZGHA 2HOBA 1INCA 3SNEA 4E06H 1EPTA 5LPFA 4GVUA 1OKXA 3URDA 3GY6A 5DGJA 1EZQA 2BZ6H 1C4V2 3ZZDA 3LC5A 3RU4E 2WPJS 1DWCH 1SLUB 4NG9H 1MTSA 2ZU3A 1WQVH 4GHQA 5F8ZA 5EW1H 1DX5M 1E37B 1SSXA 2Y5FA 3NZIA 4JYVH 3SN8A 3ZZ5A 5BRRE 1G3BA 3SZNA 1HAZB 1PYTD 3ZVAA 4XFQA 4FUCA 4Y8YA 3SV8A 3KF2A 1DWEH 4AYVB 2AGGX 4MVNA 1BB0B 3GYLB 2ZKSA 3E0NB 3WY8A 1GVKB 3TGIE 2Q6GA 4Y8ZA 1Z1IA 2GKVE 4AFSA 3GY4A 5CE1A 4CRFA 1ARBA 1BMLA 2GT7A 3D49H 3MHWU 3M5NA 4GUXA 1ELDE 2FOFA 2GCTC 1DSTA 1LHFH 3T27A 3P8OA 1N6YA 3FZZA 3SO3A 3AW0A 2UUYA 1GJCB 4YOJA 5DP7A 1XXFA 3F6UH 5AHGH 5TCAA 2ANKH 2W7UA 3A86A 4J2YB 2PKSC 2Q6DA 3ATKA 1ZJKA 1GBDA 1Z1JA 1YPEH 3RP2A 1ETTH 1CT0E 2ZNKH 4AYYB 2GV7A 1AZ8A 1FAKH 4X6OA 1PPZA 1SFQB 1BTZA 4MNXA 1TQ7B 1K1JA 1OP8A 1O3EA 1G3CA 4KELA 5DP3A 2H9HA 1VITG 1Q31A 1PPEE 2F9UA 1XUFA 2J92A 5GCHG 5F03A 1P8VC 1GMCG 1ELTA 3OSYA 4I33A 3HATH 1UVPA 2VWMA 1P2JA 2QXIA 3E6PH 3T28A 4TY6A 2LPRA 4O9VA 3SJ9A 2VWLA 1EQ9A 3KN2A 2ZHFH 4Q7YA 1QBVH 2ZGXH 1FDPA 2SGFE 1EJNA 1F0SA 2RA0A 2ZHWH 1TRMA 3W95A 3ZVCA 3URCA 1C1MA 1XUHA 2J4IA 3CS0A 5AF9H 3T29A 1W8BH 1DITH 2ZO3H 1BRBE 1ZTLA 1DM4B 4JK6A 1GJAB 1SOZA 1TGCA 4CRCA 1MTNB 1JRTA 3M7UA 4JZDH 1KXFA 2SNVA 1JRSA 3KIDU 1MU6B 1OS8A 3CP7A 4YZUA 1CU1A 1BTXA 1ZPCA 1HAOH 1Z71A 1O3AA 2H9EH 5T6DA 1K9OE 2AYWA 4UFEH 2VIDA 1GWAA 2FOAA 1PQ8A 1ZGVA 1MTNC 1AUTC 1RXPA 1BRAA 1FPHH 2BY6X 5DP4A 2QV1A 3AAVA 1HAYB 2P3UB 3K6YA 1TX6A 1C5SA 3Q77A 4DOQA 1S5SA 3SGQE 1RFNA 4ABJA 2NWNA 1K1OA 2QIQA 4WMEA 2ALPA 2VIVA 2ZDAH 2BMGB 3V13A 1AFEH 2JH6D 2D1JA 3MNBA 3U8TH 1ZHRA 2CHAB 3ODDA 5EU8A 3E8LA 5K0HA 3GDVA 4H6TA 4UEHH 3PB1E 3NXPA 1HAGE 3AASA 1VGCC 4A6LA 2F9PA 3TNSA 2AERH 1GHBF 1O2RA 8GCHG 2NU1E 2J9NA 3ZVDA 2CHAC 2Z6BD 3EA8A 1ABIH 2CXVA 1O5CB 3VEQB 1A3EH 2WPKS 1MKXH 1O2KA 3LGIA 1EOJA 1WSSH 4DW2U 1KTTB 5I25A 1GHWH 2FTLE 2HGTH 1XMNB 2RG3A 5DJ7A 1K22H 1TPPA 2QC2A 3ZZ9A 2J2UA 3L6PA 3RXGA 1ZOMA 3UTUH 4ABAA 5LPRA 4HZHA 2SFAA 4E7NA 1YCPM 2SGEE 4IMQA 5L2ZH 3ZZCA 4NA9H 5FPSA 2HWLB 1DICA 2CJIA 1YPMH 1ZHPA 3CENA 4CR9A 1ANDA 1DANH 2ODQA 1UHBA 5C67A 3ZVGA 1OXGA 2F9NA 3PWBA 8KME2 2EA3A 3MH7A 1GI6A 2B0FA 2F9BH 1P3EA 3BTKE 4JZIA 3PO1B 4XBCA 1GJ7B 3UOUA 1THPB 7LPRA 1V2VT 1SHHB 3TK5A 5JBTA 3UNSA 2PR3A 1Y8TA 1TPOA 1Z6JH 5C1UA 4YOGA 3B9FH 2WPHS 1CBWB 2VIOA 3BEFB 3RMMH 4GCHF 1GBJA 4FUBA 2FYRA 2A5AA 1HFDA 5LH8A 1W3CA 1SGQE 3PTNA 3BEIB 3PO1C 1Y59T 3Q00A 1QNJA 2PWXA 3LC3A 1G3DA 2ZCHP 3STJA 2QXGA 3R3GB 3S9CA 1AKSB 1NN6A 1AVGH 3SQHE 5DO4H 1C2MA 2VINA 2XW9A 2Y82A 1CBWC 4Z0KA 1XUJA 2GP9B 3RUOA 1FLEE 2G52A 4ZUHA 3ZVEA 3SU5A 1Y5UT 2G5NA 5EW2H 2Z3EA 2V3OH 1LKBA 2Z9IA 1ZLRA 1F7ZA 4OS1A 4RKOB 3A88A 3R0FA 1BITA 1EAIA 2XBYA 4ASHA 5F8TA 1G37A 2G51A 3GICB 1W2KH 1FMGA 1QL9A 2O8LA 1BMAA 1UTKA 4TWYA 2FI4E 3P8GA 2PGQB 1W0ZU 2QAAA 3EGKH 1PQAA 3RDZA 1WTGH 2ANYA 3TPIZ 3M7QA 1IQKA 2CF9H 2BTCE 2UUJB 1G36A 3Q3XA 4KTSA 2NU3E 1V2KT 1GMDF 6ESTA 3GCTG 3RC4A 4AX9H 1QFKH 3KQCA 2Q1JA 2G5VA 2A5KA 3H7TA 3MFJA 1TE0A 1GMCF 2OTVA 2FWWA 1FIZA 1TALA 1O2ZA 1RS0A 1P57B 1DWBH 1MBQA 1Y3VA 2P8OC 5A2MH 1TONA 3T26A 1TAWA 4NIVA 2ANMH 3GY8A 5FX6A 4DIHH 1ZMNA 2UWLA 1HV7A 1WU1A 2DUCA 1P2QA 1S6HA 5JB8S 1T8MA 4X8TH 5J4QA 4ESTE 2SNWA 5IDKA 1EAXA 1OWEA 1QA7A 2EC9H 1FPCH 3O8RA 2A7JA 2RDLA 1BBRK 2AH4X 1DUEA 3EE0B 1GGDB 3P6ZB 1EP5A 2M5TA 2P95A 1AFQB 1NFWA 1V3XA 1Y3WA 1DE7H 2A4OA 1MCTA 2ASUB 3RMLH 3VB7A 4BTUB 4ZKOU 3V3MA 3AAUA 2GDEH 1MTUA 1K1IA 1NFXA 1NT1A 1G32B 2B9LA 4NSVA 3SU3A 1SL3A 3RXHA 9ESTA 4GLYA 5C1YA 1AFQC 2ZTYA 1EKBB 5EXLA 3LT3A 1LVOA 3TJVA 2VH6A 3C27B 4VGCB 5EPYA 1H9IE 1V2RT 3P95A 4SGAE 1C2DA 1QJ1B 1NS3A 1P2MA 1GHYH 3U98H 5T3HA 1AGJA 4XDEA 1YLCA 1SHYA 2Z3DA 1P09A 5ABWA 1O3KA 1SLXB 1UTMA 1T8NA 2K1QA 3S9AA 2V6NA 4VGCC 3ZYDA 1PQ5A 2Q6FA 3PMJA 1C5VA 4NWKA 2XC0A 1M9UA 1DSUA 1QBOA 2PW8H 1A3BH 1CSOE 3TGJE 1DLKB 8GCHF 2VVVA 1S0QA 1UCYE 2XRCA 2OBQA 1EP6A 1AVXA 2BYAX 2V35A 1C2JA 2GCHG 2YNBA 3GCNA 1QR3E 1EOLA 1A2CH 2P3FH 3ZZ7A 4LZ1H 2ZPSA 5JBAS 1BJVA 1O5BB 2ZI2H 1AIXH 1S81A 2FOEA 3A8BA 2FIRH 1NRNH 2FP7B 3HKIB 2FOBA 1Z8JB 4WXIA 1C2EA 1EZUC 4I8JA 3E3TA 4FU8A 1UJ1A 2DE9A 1GHZA 3A83A 1CHOG 1GDQA 1QB9A 2FS9A 1WYKA 3SU4A 1GMHG 1W10U 1BTYA 1GBLA 3FVFB 4B76A 2C93B 3GOVB 1GDUA 1O3HA 1TYNA 2VIQA 3GISB 3QZQA 1O2HA 1IQHA 1L1NA 1UTNA 1QJ6B 3PLPA 4WMDA 5JB9S 1C5MD 4QT8C 2B8OH 1O2GH 2V0BA 2Y5GA 3GY3A 3B8JA 2CV3A 1KYNA 1KLJH 8LPRA 2A7CA 3S69A 3UOPA 2Z9KA 4DT7B 1W13U 3QO6A 2XWAA 4XE4A 5A8YA 5A09A 3SUFA 1UO6A 1WCZA 1SGIB 2PKAA 1MU8B 4OS2A 3MNCA 4DIIH 1O37A 2G81E 4I31A 1NFYA 1ZPBA 4FU7A 4I32A 4LK4A 3S7KB 2OD3B 4ABFA 2VWOA 3M3SA 4WMFA 1RIWB 1HRTH 3SUDA 1C4U2 1SGYE 3BTEE 1TMBH 4U01A 1ZSJA 1YF4A 3PMAB 1L2EA 4YT6H 1TGNA 1QQUA 2O8TA 1E38B 1N8OB 1EPTC 1RTLA 2OLGA 1CA0B 3NWUA 4IGDA 4Y10E 1P2KA 3T25A 1NFUA 5F8XA 1O5AB 2OC7A 1D6WA 1RIWC 1QIXB 2BLQA 1FN6A 1HJ9A 1MD8A 1UTPA 2ZPQA 5A8ZA 2JH0D 1XVOA 3TJOA 3ATMA 2VU8E 2ZHEH 4WH6A 1JBUH 1QJ7B 1CA0C 1KXBA 2BD8A 2Z9JA 5E0HA 2W3IA 3RXRA 1Z6EA 3KEEA 1J8AA 3T5FH 1SQTA 1Y3YA 3O8DA 1DY9A 4BANB 1TFXA 3NPSA 4ZH8A 2CF8H 3EA9A 2VIPA 2BLWA 5E0GA 1A46H 4CRBA 4AG1A 1AN1E 1FONA 9LPRA 2HVXA 3VGCB 5EQSA 2A7HA 1LPGB 2ZHQH 4FUDA 3A7XA 1V6DA 2WPLS 5EPNA 4X2WA 4NCYA 1MMJN 1HJAC 1A0HB 2F91A 1L1JA 1EXFA 2ZQ2A 1FY8E 3LGTA 1BCUH 2HNTC 1C1NA 1K28D 3EYDA 2ZDMA 1HJ8A 1MUEB 2G00A 2ZGCA 2SGPE 3LIWA 4D76A 3T62A 1W7XH 1C5ZB 4J1YA 1IQIA 1TNGA 3MH6A 1XUIA 1P9UA 3UNQA 5B6OA 1AWFH 2O8WA 1FAXA 4CRGA 2B5TB 1SLVB 1A0JA 1FY3A 2GX4A 1WQSA 2H5DA 3DUXH 1QRZA 2BDGA 4B2AA 3EA7A 1YPGH 5PTPA 5A8XA 5E0JA 2VB0A 1DFPA
chains in the Genus database with same CATH superfamily
1MAYA 4XOJA 2BDBA 2JKHA 2BX3A 3U8OH 1SR5C 2THFB 1B7XB 2OXSA 2GCTB 3M5LA 1S83A 3QWCH 1SG8B 2JH5D 2B7DH 1DPOA 4OS5A 3PLBA 2W5EA 4MNVA 2ZCKP 3LKWA 1ELAA 1OYTH 3NCLA 1GJ9B 1BBRH 1IAUA 2L6OA 2PKSB 1C9PA 2PSXA 1C5RA 2IPQX 1AE8H 1C5QA 3UY9A 4FUFA 1YLDA 2BDIA 1SGNE 1GI9B 4X6PA 3QTVH 2BY9X 1UK4A 2C4FH 1BZXE 1EZXC 4B2BA 3RXTA 1O3LA 7GCHG 2ILNA 2R0KA 1SGCA 4K3JA 5KECA 1V2WT 2G55A 1O2JA 1KIGH 2OC8A 2TGAA 6CHAB 2FOCA 3GCHC 1Z8RA 2R9PA 4Q4LA 2GCHF 2STBE 1EJMA 4JZFH 2TGTA 3TH3H 5EJLA 1H8DH 1Y3XA 1J14A 2BDAA 4ABIA 4D7FA 4IN1A 4RN6A 1BQYA 2ANWA 1GBHA 1J15A 3KYFA 6CHAC 4AB9A 4NIXA 2QN5T 2R0LA 2OUAA 1GBEA 2SGDE 1T4VH 5IK2D 1O2OA 1C1QA 2PV9B 2ZTZA 3K65B 3BIUH 2A2QH 4ZAEA 5HYOA 2ZDKA 5HM2A 1LVBA 1LCYA 2OINA 2WV5A 3RXAA 1O5EH 3IITA 1T8OA 1VZQH 3DSGA 1BTUA 1O3GA 2I6QA 2BM2A 1O33A 1BMNH 3C1KA 1V2NT 2EEKA 1AI8H 1VCPA 3WW7A 3A80A 5DN6D 3PM3A 1F0TA 3S7HB 4A1XA 1YPHC 2KZ4A 3SJ8A 1AQ7A 2W6JD 3DFJA 4ABEA 2KM0A 4MNWA 4H6SB 3ZVFA 2QGRA 1PPCE 1HAIH 4SGBE 1ZHMA 1VJ9U 4CBOA 1C2HA 1ANCA 1H4WA 1FJSA 1BRUP 4X8UH 1G2LA 2FOHA 1ZSLA 2TBSA 3MWIU 3UQVA 1UHBB 3O8BA 3VB4A 2GGVB 3RU4T 3K2UA 2BQWB 1ID5H 1XUGA 2ZCLP 3EQ0H 3BTWE 1QQ4A 1GI5A 3GY2A 4UFFH 1SPJA 5JYIA 1OPHB 3A7WA 3A89A 3O8CA 3RC5A 3QGNB 3BF6H 4JCNA 4YTAA 1YCPK 4MPVA 4ZHLU 1O3BA 1QZ8A 1QL7A 1VGCB 1EB2A 4ISOA 1GJ6A 3HGPA 4U2WA 2KCPA 1C4Y2 1J9CH 1ZSKA 3SGAE 1G3EA 4XSKU 2FODA 2NU0E 3A7TA 4JZEH 3A8DA 1S84A 4K8YA 4RKJB 4X0WU 1GJ8B 3A84A 1NTPA 2O9QA 2UWOA 3ZZAA 1ETSH 1V2MT 1D6RA 3TK9A 3NUMA 1BHXF 4O3TA 4JK5A 1P12E 4IS5A 2KAIA 2FLRH 4RT0A 1E35B 4K5ZA 2NU2E 3ATIA 3HGNA 3ZZ4A 4UFDH 2WYJA 2GZ7A 2OQUA 2TGDA 3TJNA 3LJOA 2JJ1D 2QF4A 2QXHA 1A5IA 1O2SA 2AIPA 3QK1A 4R0IA 4NZQA 1D3DB 6GCHG 1EFRD 2FYQA 1FY4A 1IQMA 1TMTH 1UTLM 1MZAA 1PPGE 5EQQA 3HK3B 4XD7D 1GDNA 4BTIB 2F9OA 1FIWA 1O2UA 2SGAA 4DG4A 2BDCA 2FI5E 3N7EA 2ZPRA 1GL0E 4X6NA 4I8KA 4F55A 1C1WH 1O2PA 3MI4A 3BSQA 3RM2H 1EX3A 4FOUC 2AGIX 1CGHA 1HYLA 2AMQA 5HMAA 4HG6A 4KKDA 3RXLA 2ALVA 2RCEA 2YMSD 3RXEA 1O3CA 1HCGA 1PQ7A 2WV4A 2RFKC 2BVSH 3MO6A 1HBTH 1SGRE 2QF3A 2J95A 4IC5A 2GZ8A 1ELCA 2TIOA 3MU1A 4PROA 1EAUA 5CMXH 1YP9A 5EODA 2A5IA 3F0OA 2FX6A 3RXKA 1MQ6A 1ARCA 3VB5A 3KHVA 4IC6A 1D3QB 3U69H 1DXPA 1TA6A 4TY7A 2Z9GA 4ZXYH 1SMFE 2J5UA 1E34B 3RXFA 1OWJA 3SNAA 5L6NH 3H5CB 3SU2A 5AFZH 1GHAG 1P02A 1QGFA 2PUXB 3BTHE 1BTHH 1RTFB 2EI8A 1C9TA 1AMHA 3CNRA 4H4FA 1UVTH 4CH8B 5HM9A 3LH1A 1L4ZA 1MZDA 1PJPA 3MNSA 2WUCA 1SFIA 2D2DA 1SGDE 1K1NA 2LNCA 1ANBA 2HPPH 3SUEA 3MMGA 4E05H 5I46H 2QF5A 1LQEA 1JOUB 5L30H 5K7RA 2EQNA 2XC4A 2V3HH 4BAKB 1PPHE 5GPIB 1RD3B 1KXCA 4FXGH 3BTGE 4HTCH 1IQLA 1OP2A 1D4PB 2P8OB 3OEHD 4K1SA 3W94A 4YXWD 5JBBS 1AWHB 3UUZA 2W7SA 5DG6A 2C3SA 1VITF 1O3MA 5GCHF 5GIBA 3GDSA 3JZ1B 5A0BA 1EAWA 2HLDD 3AK5A 2VVUA 3UWIA 3KQEA 1O3FA 1BIOA 1SQRA 2TRMA 1BMMH 2Y6TA 3SV2H 4ACBA 1N6XA 1S6LA 3BTME 3ZZBA 1SQOA 3A7ZA 1UVUH 1MH0A 4LXBH 3MYWA 2P59A 4LOYH 3E16B 4DCDA 1RJXB 3G01A 2IJOB 5FPTA 3NRLA 1N1LA 1C5OH 2P93A 2XNIA 2ZFTA 1EZSC 3H09A 1BJUA 2BY7X 1EASA 4K60A 1D9IA 2GD4B 3FAOA 5J4SA 4A5TS 2QF0A 3SNBA 2A2XH 5ESTE 1XM1A 3P8NA 2PP6A 5TJXA 4B1TA 3DSOA 1MAXA 2I6SA 2A1DB 4YT7H 3V12A 1C2LA 3VB3A 2FZZA 1JIMA 1T4UH 2BY8X 1F0UA 2H9TH 4ZKRU 3SU6A 1O3DA 2WUBA 2ZWLH 4MPWA 3F9FA 3MO9A 2ZFQH 1ZRBA 2UUKB 1Q3XA 2VNTA 2Y81A 4ABHA 1HDTH 1ESBA 2Y7XA 2G4UA 3IG6B 1CQQA 2C90B 4IMZA 1TPSA 2PUQH 3PTBA 2IOTA 4P00A 2P3TB 2VWNA 1HGTH 4K2YA 3SI4H 2PKAB 1NO9H 4OS7A 2STAE 2VIWA 3DD2H 3F9EA 1DVAH 1HAHH 4BXSA 2H2ZA 3KL6A 1EATA 1UVOA 4F48B 3SV9A 1K1MA 1KDQA 3DHKH 3GY5A 4MLFB 2FMJA 1J16A 2O8UA 5FPYA 1C5PA 2HNTE 2XCFA 4K1TA 1P03A 2QYIA 5DP8A 4B75A 3E90B 1GJ5H 3LGYA 1LMWB 1GJ4H 1ANEA 3U1IB 1WBGB 5BPEA 1X7AC 4TPYA 4Q80A 1TNJA 4MQAA 1QA0A 2WSSD 1YCPH 2JETB 2UUFB 3EDXB 1ZYOA 4WF8A 3F9HA 1C5XB 3OEED 1O3PB 2ZFRH 2AEIH 2ZIQH 1WOFA 3S0NA 1ZPZA 2NU4E 2W6ID 4RI0A 1O34A 2H5CA 2BZAA 5DK1A 3MH5A 5C3NA 2O8MA 3BTTE 3QX5H 3ZVBA 2JETC 3OU0A 1DY8A 1O2YA 5C0TA 4I86A 2ZP0H 1L1GA 3RU4D 3I29A 1PPFE 3D23A 3M35A 1YPJH 3PYHA 3ENSB 3DA9B 2ZDNA 3DFLA 1KLTA 1SKYE 1CGIE 3KQDA 4HFPB 3D62A 4X2XA 1GHVH 1CO7E 5FCKA 2EI7A 1LVYA 1O30A 2RA3A 2BXTH 4WH8A 2ZGJA 2VJ1A 2J98B 2PSYA 4X1NU 1TNHA 4YOIA 4FUIA 3GDUA 1FI8A 2XYAA 1DXWA 4UONA 3SORA 2HLCA 3E0PB 3ZV8A 4B74A 4K69A 2M2AA 3DT0H 4X2YA 1OP0A 1P3CA 1FUJA 2ZECA 1EPTB 4Q7ZA 1ORFA 2PHBA 2GZ9A 3AVZA 3GY7A 2ODPA 1AB9B 2VGCB 3ATLA 2V7QD 3D65E 2ZU4A 1UMAH 2BX4A 2CGAA 4CREA 1NZQH 1AVWA 1GBTA 3UR6A 1T32A 2BD7A 2ZQ1A 1NESE 2GMTB 3N99A 1C1VH 4U32A 1BDAA 3U9AH 1TOCB 1AB9C 2BD5A 4I7YH 2VGCC 4Y6DA 1SGFA 3VG8A 3QGJA 1CHGA 1LHGH 1IQGA 1ESTA 1KXEA 1TX8A 2GT8A 3VXEH 3F9GA 3Q3KA 1ZTKA 3SUGA 1O5DH 1OWIA 2G4TA 4Q63A 5L2YH 1YKTA 1O5FH 1K2I1 1NY22 2GMTC 1TIOA 1P04A 4M9FA 1YBWA 1W0KD 3SQEE 5SGAE 1YPHE 1HIAA 4NA7A 5GNDA 5DP6A 3PV4A 1XKBC 3RXOA 1F92A 2ZU1A 4THNH 2HALA 2Y80A 5DP9A 1B5GH 1HJAB 1GI8B 3GCTF 1O2QA 1O35A 4UD9H 2JJ2D 1S0RA 3STIA 1GHBG 2BB4A 3RM0H 3TVJB 4TWWA 2CMYA 3QN7A 1O2NA 1FXYA 5LPEA 1SI5H 3RXSA 1O3IA 2FDAA 4CHAC 5JDUB 2W3KA 4TYDA 1MBMA 3VXFH 6LPRA 3LGWA 1LHCH 1YM0A 3P92A 3BG4B 4Y0YE 3MU8A 4XBDA 7KMEH 4WWYA 1TNKA 1ELGA 2FOGA 1ZJDA 3TLOA 1O31A 1KLIH 1F2SE 3K6ZA 4D9RA 1LVMA 2G8TA 5DKMA 3LU9B 1QRWA 2PTCE 1GG6C 3T2NA 3BG4C 2FEQH 2OP9A 1V2UT 1QHRB 3OAAD 1ZMJA 3GS9A 1Z8GA 2PFEA 5FBEA 4CR5A 1DT2A 4BXWA 4MG3A 4INHA 3MQKC 3CS7A 2HPQH 3F68H 1ELVA 3GCOA 2IPHA 3M37A 3RXMA 1PFXC 2OC1A 3TIUA 1IOEA 1LPKB 2FOMB 1IQFA 5FAHA 1W12U 1QB1A 1GJBB 1P06A 4RSPA 4CBNA 4Q2KA 5AVDA 5F53A 2JDID 1CE5A 3SOSA 1EJAA 1YPKH 1VR1H 4GCHG 1NROH 4WY3A 1UCYK 3PLKA 5ETXA 1NM6A 3ELAH 3BEUA 4YLUA 1O39A 1PPBH 3GCHB 2R2MB 2BOHB 1HXEH 1LO6A 3MO3A 3FANA 4JMYA 1ACBE 1QRXA 3FZDA 2ZU5A 1QCPA 4NFEA 1K1LA 3OYPA 3KGPA 4FU9A 1HAVA 3LH3A 2XWBI 2KFWA 4ABDA 4NFFA 1S85A 1IQJA 2IN2A 1LKAA 1O36A 1H8HD 2W26A 4DVAU 5C1XA 3BTFE 1LQDB 1B0FA 1ZR0A 4YO9A 1V2PT 3LONA 3M5OA 1DDJA 4FUJA 4X6MA 3NK8A 2WZQA 1OOKB 3U8RH 3PMHB 3RC6A 4Y8XA 5KGOA 2Y7ZA 1OWKA 2JIZD 2QY0B 4TPIZ 1W0YH 1GCTB 4UE7H 1QB6A 1QL8A 5FX5A 3UNRA 2KAIB 1OX1A 5EXMA 1LHEH 2H1UA 1CHOF 1HPGA 4Y76A 2VVCA 1JXPA 2QXJA 1QY6A 1C1OA 1GMHF 2F83A 4IBLH 3A7VA 3RLWH 4Z1MD 1BMFD 5EIYA 1GMDG 1U6QA 5FXLA 1GBBA 1ZTJA 5EXNA 1O3OA 2BLVA 3KYGA 1GCTC 1QTFA 5GXPA 4B6EA 2C8XB 2VH0A 1T8LA 4D8NA 1NRSH 3I77A 5T1VA 4Y7BA 4BTTB 2HVYB 1ZMLA 1C5LH 1BRCE 1VCWA 2BOKA 2FTMA 2ZHDA 3P17H 3TU7H 1UTOA 2ZEBA 1A4WH 1T7CA 1P2NA 2XNDD 3WWBA 4BAOB 1OSSA 3P70B 3RXVA 2XC5A 1GVZA 1FY5A 1F0RA 3A7YA 1P11E 3NKKA 1KY9A 2PLXA 5FHTA 2BD4A 1K21H 2A4QA 1IQNA 3SU0A 1AO5A 3V0XA 4INKA 1O38A 1THSH 1BUIA 2ZZUH 1LHDH 1ABJH 4HI3A 1TNIA 3BTDE 5FCRA 4B73A 4UDWH 3L3TA 1AU8A 5C5OA 1YC0A 3ITIA 3ZV9A 1L0ZA 3QZRA 1L4DA 1LPZB 3KQ5A 1H1BA 2YOLA 2EY4C 3E91A 3BG8A 3LOXA 1Y5AT 1KXAA 4ACAA 3S9BA 4M7GA 3IWMA 1BBRE 1GBCA 1C1UH 4X8VH 1DOJA 2C8WB 1BA8B 2QA9E 1EUFA 1TPAE 1O2MA 1TLDA 1WAYB 5IYTA 1GI1A 1Z7KA 4O97A 2WINI 4F49A 1HUTH 1SC8U 1UTJA 2GV6A 2ZTXA 1H8IH 1KXDA 3LGVA 1Y5BT 1SGEE 2WV9A 1FNIA 1V2TT 5E8EH 1SGPE 3FFGA 2TPIZ 4R8TB 3SBKA 1GI0A 2A45B 1NRQH 3SI3H 1WUNH 4A92A 4D9QA 2F3CE 1NU9A 5C2ZA 1O5GH 3RMOH 3GYMA 1TOMH 3PV2A 4JZ1A 3BTQE 3ODFA 1TGBA 1B0EA 1Z8IB 1BTWA 3B23B 2FM2A 2Z7FE 1D3TB 4O3UA 2LELA 2OQ5A 1MTVA 1C2IA 1TNLA 1HLTH 2XBXA 1S6FA 1GBFA 4BAQB 1GBIA 1F5KU 2BD9A 3L33A 2DE8A 2AS9A 2AMDA 1C2GA 4A7IB 5F6MA 1IHSH 2ZDLA 3TJUA 3M3TA 1CVWH 3RXQA 2GVFA 1E79D 4JYUH 3SV6A 1TMUH 3HK6B 4ZKNU 1TGTA 1V2OT 3FP8E 2ZU2A 4Y0ZE 2KX4A 1AD8H 4NIWA 4INLA 1GI7B 4IW4E 1TWXB 5FBIA 4H42U 1SB1H 2XBVA 3DSPA 3OTJE 1V2ST 3N7OA 5G4BA 5GWZA 4MNYA 4TSFD 5C0UA 1W0JD 1DUAA 3UWJH 1KSNA 4Y7AA 3A8CA 4K1EA 3EE7A 3TGKE 1P01A 1E36B 2GDDA 3QUMP 4ZROA 1H8ED 1VJAU 1UTQA 2C8YB 3UR9A 1HAXB 1ZRKA 1H9HE 1MKWK 2R3YA 3Q76A 1O3JA 4B71A 1MQ5A 4FVBA 3UPEA 1NRPH 3UAIC 4KGAA 3HKJB 1WTHD 5EQRA 2Y5HA 5T6FA 3SJKA 2Z3CA 4AN7A 4DT4A 3A8AA 2AGEX 1SVPA 5TCCA 2OC0A 5C17A 1G30B 2ZF0H 4IN2A 3ATWA 1AHTH 5EG4A 5H4IB 3U28C 8ESTE 1S82A 1G9IE 4FUGA 4MPXA 4KTCA 1C5YB 3Q3YA 4BAHB 1JWTA 7GCHF 3F0PA 3TNTA 4DURA 4NGAH 1P2OA 1GBMA 1VITH 3M7TA 1O2IA 3AW1A 3MU4A 3RXCA 2D26C 4LZ4B 3OTPA 2A4RA 1LDTT 1FN8A 1H9LB 3ZZ8A 1C1RA 3RXBA 3KNXA 2UWPA 5ESBA 1UK2A 1NC6A 1XXDA 2ZFPH 3PWCA 3TH2H 3OX7U 1ELBA 1O2VA 1KDQB 1UCYH 1NBMD 3SNCA 1FV9A 3VFEA 4JYTA 1NU7B 3MOCA 2BVXH 3TITA 1JIRA 3V7TA 2OCVB 4OS6A 3KQBA 1EB1H 3RLYH 3P8FA 1GCDA 4FUHA 2VBCA 3LDXH 4AOQA 2HNTF 1TA2A 3LPRA 4ISNA 1ELFA 4Y71A 5EOKA 3FP7E 1DLEA 1V2LT 4ISHH 1O2XA 1A5HA 1TX7A 2BQ7B 2BVRH 4X1SU 1TQ0B 1YPLH 2D8WA 4OM9A 2ZGBH 2PGBB 4ABGA 3A87A 1AUJA 4GHTA 1XX9A 2ZA5A 2OBOA 4AB8A 1NPMA 4ISLA 4Z6AH 1A0LA 1FX0B 4AORA 3RXDA 4Q7XA 2WPMS 3QTOH 3BIVH 3I78A 4FVDA 1G2MA 1TBZH 4ISIH 3SJOA 3QDZB 1HNEE 3LJJA 3MU5A 1AE5A 3HPTB 2BD3A 2WPIS 3A81A 5DPAA 4ZHAA 4ZHMU 1AKSA 1PYTC 3K9XB 1LTOA 2AMPA 4DY7B 1C1TA 1GBKA 1SQAA 2XTTB 2BDHA 1D3PB 5GJ4B 2F9VA 3TH4H 2BD2A 1ELEE 1SGTA 2SGQE 4NIYA 4DJZB 5C5NA 1V2QT 3SNDA 4X2VA 2BDYA 2J94A 2ZC9H 1XKAC 1DS2E 5A0CA 5LGOA 4I8LA 4OS4A 4B2CA 1GGDC 3RXPA 1WXRA 1OWDA 2K0QA 4AFUA 4CRDA 3TK6A 2BHGA 1ZZZA 1C2FA 4ZXXH 2QCYA 2L74A 3F2FA 3M5MA 5EGMA 1K1PA 3SJIA 1O2WA 1P0SH 4ASUD 2FPZA 1P10A 1SOTA 4P02A 5HGGA 1RGQA 2A4GA 1W7GH 3MH4A 1A61H 1P05A 1GVLA 1GI3A 3SGBE 1O2TA 2ZFSA 3BV9B 1A7SA 1BHXB 1TB6H 2FO9A 4AG2A 4NA8A 1A5GH 3F2HA 1YLNA 1TRNA 3OE7D 3KCGH 1TABE 5DSFA 4I8GA 3PMBB 3ZZ6A 1GL1A 6GCHF 2H6MA 1UK3A 2GTBA 4Y79A 1ETRH 2FX4A 4WJG2 1FY1A 1UVSH 4A1TA 5JPMH 1AZZA 5DP5A 1HIAB 1C1SA 1SBWA 4DGJA 1O0DH 3FO8D 1C5UA 4YLQH 4X8SH 3VB6A 4BAMB 1KTSB 4BNRA 2BXUH 1ZGIA 1C5NH 4GPGA 3UREA 4E7RG 2BY5X 1HAPH 1O3NA 3SV7A 3MNXA 1C5WB 1F5LA 4NSYA 1VCQA 2A31A 1OYQA 2YNAA 2ZDVH 4BOHA 4ZCNA 4HGCA 2FXRA 2AIQA 1TRYA 1GI2A 3UQOA 4MTBA 1XVMA 4OGYA 3PRDA 1RRKA 1NBME 4X1RU 4KP0A 4AFQA 3PV5A 2AFQB 2HRVA 1C2KA 3FP6E 5JBCS 1BTPA 5GDSH 2FESH 1TGSZ 2PTNA 3U1JB 1GJDB 2P16A 3EAJA 3SHCH 3SW2B 2A32A 4KTUA 3UIRA 4F4OC 5C20A 1YYY1 3M3VA 4D7GA 1OWHA 5T6GA 1MD7A 4X1QU 1TBQH 4UFGH 4ABBA 3VPKA 2XCNA 1GHAF 4GAWA 2BLOA 1T31A 1RTKA 4GSOA 4AZ2B 3SU1A 3PROA 2EI6A 3F1SB 1FQ3A 3MTYA 2FLBH 3LGUA 1YWUA 1MCVA 5HKKD 1Q2WA 1BOQA 4ZMAH 5CHAB 3RXJA 1E0FD 1P2IA 3SYJA 1QURH 3WWFA 1ESAA 5AFYH 2R2WU 3H7OA 7ESTE 1XUKA 4XRNA 4XBBA 4X1PU 5E2PA 2J34A 2R3UA 3ZYEA 1MKXK 2WPDD 1V2JT 2ZG0H 1GHXH 3OY6U 4MPUA 1GBAA 1O2LA 4NWLA 3UFAA 4Y11E 1C1PA 2CN0H 1W14U 1HB0B 5CHAC 1NRRH 1JMOH 2WYGA 1MTWA 1W11U 4AGKA 3QLPH 4CH2B 3A82A 5CHBA 1F5RA 1HXFH 2P94A 1MKWH 2Z94A 4I8HA 3F2GA 1A1RA 4CHAB 1O32A 1GI4A 1CT2E 4AFZA 4MDSA 4A1VA 1IQEA 1GPZA 1THRH 2FS8A 2ODYB 3OY5U 1TBRH 1N8OC 1HAVB 1CA8B 1P9SA 3F3BA 1WV7H 3JZ2B 2J38A 1SGFG 4YM9A 4YESB 3RXIA 1CT4E 4ZKSU 4WVPE 1BT7A 1IHTH 3ZZ3A 1DWDH 2Z9LA 5E2OA 1GG6B 3RXUA 1SLWB 1YGCH 4U30A 4NZLA 1AY6H 3MU0A 3PRBA 2ZFFH 4O03A 1J17T 3SHAH 2XXLA 1QBNA 2FI3E 1CGJE 3ESTA 5HXFA 4AGJA 4WXVA 1FZZA 2ESTE 4OGXA 5A0AE 2C8ZB 3M36A 1Y3UA 2TGPZ 2ULLA 3BN9A 4FUEA 2A0QB 3M61U 3RMNH 2BQ6B 4CRAA 1C5TA 3VGCC 3E1XB 2XBWA 3A85A 4K8BA 2ZGHA 2HOBA 1INCA 3SNEA 4E06H 1EPTA 2CK3D 5LPFA 4RT1A 4GVUA 1OKXA 3URDA 2LP6A 3GY6A 2V3MA 1EZQA 2BZ6H 5DGJA 1C4V2 3ZZDA 3LC5A 2KCAA 3RU4E 2WPJS 1DWCH 1SLUB 4NG9H 1MTSA 2ZU3A 1WQVH 4GHQA 5F8ZA 5EW1H 1DX5M 1E37B 1SSXA 2Y5FA 3NZIA 4JYVH 3SN8A 3ZZ5A 5BRRE 1G3BA 3SZNA 1WDIA 1HAZB 1PYTD 3ZVAA 4XFQA 4FUCA 4Y8YA 3SV8A 2F4LA 3KF2A 1DWEH 4AYVB 2AGGX 4MVNA 1BB0B 3GYLB 2ZKSA 4TT3D 3E0NB 3WY8A 1GVKB 3TGIE 2Q6GA 4Y8ZA 1Z1IA 2GKVE 4AFSA 3GY4A 5CE1A 4CRFA 1ARBA 1BMLA 2GT7A 3D49H 3MHWU 3M5NA 4GUXA 1ELDE 2FOFA 2GCTC 1DSTA 1LHFH 3T27A 3P8OA 1N6YA 3FZZA 3SO3A 3AW0A 2UUYA 1GJCB 4YOJA 5DP7A 1XXFA 3F6UH 5AHGH 5TCAA 2ANKH 3SZEA 2W7UA 1VKYA 3A86A 4J2YB 2PKSC 2Q6DA 3ATKA 1YY3A 2KR7A 1ZJKA 1GBDA 1Z1JA 1YPEH 3RP2A 1ETTH 1CT0E 2ZNKH 4AYYB 2GV7A 1AZ8A 1FAKH 4X6OA 1PPZA 1SFQB 1BTZA 4MNXA 1TQ7B 5CDFE 1K1JA 1OP8A 1O3EA 1G3CA 4KELA 5DP3A 2H9HA 1VITG 2WHXA 1Q31A 1PPEE 2F9UA 1XUFA 2J92A 5GCHG 2OK5A 5F03A 1P8VC 1GMCG 1ELTA 3OSYA 4I33A 3HATH 1UVPA 2VWMA 1P2JA 3OFND 2QXIA 5KEDA 3E6PH 3T28A 4TY6A 2LPRA 4O9VA 3SJ9A 2VWLA 1EQ9A 3KN2A 2ZHFH 4Q7YA 1QBVH 2ZGXH 1FDPA 2SGFE 1EJNA 1F0SA 2RA0A 2ZHWH 1TRMA 3W95A 3ZVCA 3URCA 1C1MA 1XUHA 2J4IA 3CS0A 5AF9H 3T29A 1W8BH 1DITH 2ZO3H 1BRBE 1ZTLA 1DM4B 4JK6A 3UB0A 1GJAB 1SOZA 1TGCA 4CRCA 1MTNB 1JRTA 3M7UA 4JZDH 1KXFA 2SNVA 1JRSA 3KIDU 1MU6B 1OS8A 3CP7A 4YZUA 1CU1A 1BTXA 1ZPCA 1MABB 1HAOH 1Z71A 1O3AA 2H9EH 5T6DA 1K9OE 2AYWA 4UFEH 2VIDA 1GWAA 2FOAA 1PQ8A 1ZGVA 1MTNC 1AUTC 1RXPA 1BRAA 1FPHH 2BY6X 5DP4A 2QV1A 3AAVA 1HAYB 2P3UB 3K6YA 1TX6A 5C94A 1C5SA 3Q77A 4DOQA 1S5SA 3SGQE 1RFNA 4ABJA 2NWNA 1K1OA 2QIQA 4WMEA 2ALPA 2VIVA 2ZDAH 2BMGB 3V13A 1AFEH 2JH6D 2D1JA 3MNBA 3U8TH 1ZHRA 2CHAB 3ODDA 5EU8A 3E8LA 5K0HA 3GDVA 4H6TA 4UEHH 3PB1E 3NXPA 1HAGE 3AASA 1VGCC 4A6LA 2F9PA 3TNSA 2AERH 1GHBF 1O2RA 8GCHG 2NU1E 2J9NA 3ZVDA 2CHAC 2Z6BD 3EA8A 1ABIH 2CXVA 1O5CB 3VEQB 1A3EH 2WPKS 1MKXH 1O2KA 1KMHB 3LGIA 1EOJA 1WSSH 4DW2U 1KTTB 5I25A 1GHWH 2FTLE 2HGTH 1XMNB 2RG3A 5DJ7A 1K22H 1TPPA 2QC2A 3ZZ9A 2J2UA 3L6PA 3RXGA 1ZOMA 3UTUH 4ABAA 5LPRA 4HZHA 2SFAA 4E7NA 1YCPM 2SGEE 4IMQA 5L2ZH 3ZZCA 4NA9H 5FPSA 2HWLB 1DICA 2CJIA 1YPMH 1ZHPA 3CENA 3FKSD 4CR9A 1ANDA 1DANH 2ODQA 1UHBA 5C67A 3ZVGA 1OXGA 2F9NA 3PWBA 8KME2 2EA3A 3MH7A 1GI6A 2B0FA 2F9BH 1P3EA 3BTKE 4JZIA 3PO1B 4XBCA 1GJ7B 3UOUA 1THPB 7LPRA 1V2VT 1SHHB 3TK5A 5JBTA 3UNSA 2PR3A 1Y8TA 1TPOA 1Z6JH 5C1UA 4YOGA 3B9FH 2WPHS 1CBWB 2VIOA 3BEFB 3RMMH 4GCHF 1GBJA 4FUBA 2FYRA 2A5AA 1HFDA 5LH8A 1W3CA 1SGQE 3PTNA 3BEIB 3PO1C 1COWD 1Y59T 3Q00A 1QNJA 2PWXA 3LC3A 5FL7D 1G3DA 2ZCHP 3STJA 2QXGA 3R3GB 3S9CA 1AKSB 1NN6A 1AVGH 3SQHE 5DO4H 1C2MA 2VINA 2XW9A 2Y82A 1CBWC 5EJ1A 3W1EA 4Z0KA 1XUJA 2GP9B 3RUOA 1FLEE 2G52A 4ZUHA 3ZVEA 3SU5A 1Y5UT 2G5NA 5EW2H 2Z3EA 2IJD1 2V3OH 1LKBA 2Z9IA 1ZLRA 1F7ZA 4OS1A 4RKOB 3A88A 3R0FA 1BITA 1EAIA 2XBYA 4ASHA 5EJZA 5F8TA 2KCYA 1G37A 2G51A 3GICB 1W2KH 1FMGA 1QL9A 2O8LA 1BMAA 1UW7A 1UTKA 4TWYA 2FI4E 3P8GA 2PGQB 1W0ZU 2QAAA 3EGKH 1PQAA 3RDZA 1WTGH 2ANYA 3TPIZ 3M7QA 1IQKA 2CF9H 2BTCE 2UUJB 1G36A 3Q3XA 4KTSA 2NU3E 1V2KT 1GMDF 2KCOA 4AC9A 6ESTA 3GCTG 3N7DA 3RC4A 1QFKH 3KQCA 4AX9H 2Q1JA 2G5VA 2A5KA 3H7TA 3MFJA 1TE0A 1GMCF 2OTVA 2FWWA 1FIZA 1TALA 1O2ZA 1RS0A 1P57B 1DWBH 1MBQA 1Y3VA 2P8OC 5A2MH 1TONA 3T26A 1TAWA 4NIVA 2ANMH 3GY8A 5FX6A 4DIHH 1ZMNA 2UWLA 1HV7A 1WU1A 2DUCA 1P2QA 3FOAA 1S6HA 5JB8S 1T8MA 4X8TH 5J4QA 4ESTE 2SNWA 5IDKA 1EAXA 1OWEA 1QA7A 2EC9H 1FPCH 3O8RA 2A7JA 2RDLA 1BBRK 2AH4X 1DUEA 3EE0B 1GGDB 3P6ZB 1EP5A 2M5TA 2P95A 4B6FA 1AFQB 1NFWA 1V3XA 1Y3WA 1DE7H 2A4OA 1MCTA 2ASUB 3RMLH 3VB7A 4BTUB 4ZKOU 3V3MA 3AAUA 2GDEH 1MTUA 1K1IA 1NFXA 1NT1A 1G32B 2B9LA 4NSVA 3SU3A 2K8IA 1SL3A 3RXHA 9ESTA 4GLYA 5C1YA 1AFQC 2ZTYA 1EKBB 5EXLA 2AHME 3LT3A 1LVOA 3TJVA 2VH6A 3C27B 4VGCB 5EPYA 1H9IE 1V2RT 3P95A 4SGAE 1C2DA 1QJ1B 1NS3A 1P2MA 5HIYA 1GHYH 3U98H 5T3HA 1AGJA 4XDEA 1YLCA 1SHYA 2Z3DA 1P09A 5ABWA 1O3KA 1SLXB 1UTMA 1T8NA 2K1QA 3S9AA 2V6NA 4VGCC 3ZYDA 1PQ5A 2Q6FA 3PMJA 1C5VA 4NWKA 2XC0A 1M9UA 2QE7D 1DSUA 1QBOA 2PW8H 1A3BH 1CSOE 3TGJE 1DLKB 8GCHF 4FETA 2J97A 2VVVA 1S0QA 1UCYE 2XRCA 1K0HA 2OBQA 1EP6A 1AVXA 2BYAX 2V35A 1C2JA 3DCLA 2GCHG 2YNBA 3GCNA 1QR3E 1EOLA 1A2CH 2P3FH 3ZZ7A 4LZ1H 2ZPSA 5JBAS 1BJVA 1O5BB 2ZI2H 1AIXH 1S81A 2FOEA 3A8BA 5B6LA 2FIRH 1NRNH 2FP7B 3HKIB 2FOBA 1Z8JB 4WXIA 1C2EA 1EZUC 4I8JA 2F43B 3E3TA 4FU8A 1UJ1A 2DE9A 1GHZA 3A83A 1CHOG 1GDQA 1QB9A 2FS9A 1WYKA 3SU4A 1GMHG 1W10U 1BTYA 3FN8A 1GBLA 3FVFB 4B76A 2C93B 3GOVB 1GDUA 1O3HA 1TYNA 2VIQA 3GISB 3QZQA 1O2HA 2RDEA 1IQHA 1L1NA 1UTNA 1QJ6B 3PLPA 5HIZA 4WMDA 5JB9S 1C5MD 4QT8C 2B8OH 1O2GH 2V0BA 2Y5GA 3GY3A 3B8JA 2CV3A 1KYNA 1KLJH 8LPRA 2A7CA 3S69A 3UOPA 2GJGA 2Z9KA 2XOKD 4DT7B 1W13U 3QO6A 2XWAA 4XE4A 5A8YA 5A09A 3SUFA 1UO6A 1WCZA 1SGIB 2PKAA 1MU8B 4OS2A 3MNCA 4DIIH 1O37A 2G81E 4I31A 1NFYA 1ZPBA 4FU7A 4I32A 4LK4A 3S7KB 2OD3B 4ABFA 2VWOA 3M3SA 4WMFA 1RIWB 1HRTH 3SUDA 1C4U2 1SGYE 3BTEE 1TMBH 4U01A 1ZSJA 1YF4A 3PMAB 1L2EA 4YT6H 1TGNA 1QQUA 2O8TA 1E38B 1N8OB 1EPTC 1RTLA 2OLGA 1CA0B 3NWUA 4IGDA 4Y10E 1P2KA 3T25A 1NFUA 5F8XA 1O5AB 2OC7A 1D6WA 1RIWC 1QIXB 2BLQA 1FN6A 1HJ9A 1MD8A 1UTPA 2ZPQA 5A8ZA 2JH0D 1XVOA 3TJOA 3ATMA 2VU8E 2ZHEH 4WH6A 3ZIAD 1JBUH 1QJ7B 1CA0C 1KXBA 2BD8A 2Z9JA 5E0HA 2W3IA 3RXRA 2YMSB 1Z6EA 3KEEA 1J8AA 3T5FH 1SQTA 1Y3YA 3O8DA 1DY9A 4BANB 1TFXA 3NPSA 4ZH8A 2CF8H 3EA9A 2VIPA 2BLWA 5E0GA 1A46H 4CRBA 4AG1A 1AN1E 2YMSC 1FONA 9LPRA 2HVXA 3VGCB 5EQSA 2A7HA 1LPGB 2ZHQH 4FUDA 3A7XA 1V6DA 2WPLS 5EPNA 4X2WA 4NCYA 1E1RD 1MMJN 1HJAC 1A0HB 2J98A 2F91A 1E1QD 1EXFA 1L1JA 2ZQ2A 1FY8E 3LGTA 1BCUH 1OHHD 2HNTC 1C1NA 1K28D 3EYDA 2ZDMA 1HJ8A 1MUEB 2G00A 2ZGCA 2SGPE 3LIWA 4D76A 3T62A 1W7XH 1C5ZB 4J1YA 1IQIA 1TNGA 3MH6A 1XUIA 1P9UA 3UNQA 5B6OA 1AWFH 2O8WA 1FAXA 4CRGA 2B5TB 1SLVB 1A0JA 1FY3A 2GX4A 1WQSA 2H5DA 3DUXH 1QRZA 2BDGA 4B2AA 3EA7A 1YPGH 5PTPA 5A8XA 5E0JA 2VB0A 1DFPA
chains in the Genus database with same CATH topology
1MAYA 4XOJA 2BDBA 2JKHA 2BX3A 3U8OH 1SR5C 2THFB 1B7XB 2OXSA 2GCTB 3M5LA 1S83A 3QWCH 1SG8B 2JH5D 2B7DH 1DPOA 4OS5A 3PLBA 2W5EA 4MNVA 2ZCKP 3LKWA 1ELAA 1OYTH 3NCLA 1GJ9B 1BBRH 1IAUA 2PKSB 1C9PA 2PSXA 1C5RA 1AE8H 1C5QA 3UY9A 4FUFA 1YLDA 2BDIA 1SGNE 1GI9B 4X6PA 3QTVH 2BY9X 1UK4A 2C4FH 1BZXE 1EZXC 4B2BA 3RXTA 1O3LA 7GCHG 2ILNA 2R0KA 1SGCA 4K3JA 1V2WT 2G55A 1O2JA 1KIGH 2OC8A 2TGAA 6CHAB 2FOCA 3GCHC 1Z8RA 2R9PA 2GCHF 2STBE 1EJMA 4JZFH 2TGTA 3TH3H 1H8DH 1Y3XA 1J14A 2BDAA 4ABIA 4D7FA 4IN1A 4RN6A 1BQYA 2ANWA 1GBHA 1J15A 6CHAC 4AB9A 4NIXA 2QN5T 2R0LA 2OUAA 1GBEA 2SGDE 1T4VH 1O2OA 1C1QA 2PV9B 2ZTZA 3K65B 3BIUH 2A2QH 4ZAEA 5HYOA 2ZDKA 5HM2A 1LVBA 1LCYA 2OINA 2WV5A 3RXAA 1O5EH 3IITA 1T8OA 1VZQH 1BTUA 1O3GA 2I6QA 2BM2A 1O33A 1BMNH 3C1KA 1V2NT 2EEKA 1AI8H 1VCPA 3S7HB 3A80A 3PM3A 1F0TA 4A1XA 1YPHC 3SJ8A 1AQ7A 3DFJA 4ABEA 4MNWA 4H6SB 3ZVFA 2QGRA 1PPCE 1HAIH 4SGBE 1ZHMA 1VJ9U 4CBOA 1C2HA 1ANCA 1H4WA 1FJSA 1BRUP 4X8UH 1G2LA 2FOHA 1ZSLA 2TBSA 3MWIU 3UQVA 1UHBB 3O8BA 3VB4A 2GGVB 3RU4T 3K2UA 2BQWB 1ID5H 1XUGA 2ZCLP 3EQ0H 3BTWE 1QQ4A 1GI5A 3GY2A 4UFFH 1SPJA 5JYIA 1OPHB 3A7WA 3A89A 3O8CA 3RC5A 3QGNB 3BF6H 4JCNA 4YTAA 1YCPK 4MPVA 4ZHLU 1O3BA 1QL7A 1VGCB 1EB2A 4ISOA 1GJ6A 3HGPA 4U2WA 1C4Y2 1J9CH 1ZSKA 3SGAE 1G3EA 4XSKU 2FODA 2NU0E 3A7TA 4JZEH 3A8DA 1S84A 4K8YA 4RKJB 4X0WU 1GJ8B 3A84A 1NTPA 2O9QA 2UWOA 3ZZAA 1ETSH 1V2MT 1D6RA 3TK9A 3NUMA 1BHXF 4O3TA 4JK5A 1P12E 4IS5A 2KAIA 2FLRH 1E35B 4K5ZA 2NU2E 3ATIA 3HGNA 3ZZ4A 4UFDH 2WYJA 2GZ7A 2OQUA 2TGDA 3TJNA 3LJOA 2QXHA 1A5IA 1O2SA 2AIPA 3QK1A 4R0IA 4NZQA 1D3DB 6GCHG 2FYQA 1FY4A 1IQMA 1TMTH 1UTLM 1MZAA 1PPGE 5EQQA 3HK3B 1GDNA 4BTIB 2F9OA 1FIWA 1O2UA 2SGAA 4DG4A 2BDCA 2FI5E 2ZPRA 1GL0E 4X6NA 4I8KA 1C1WH 1O2PA 3MI4A 3BSQA 3RM2H 1EX3A 2AGIX 1CGHA 1HYLA 2AMQA 5HMAA 4KKDA 3RXLA 2ALVA 2RCEA 3RXEA 1O3CA 1HCGA 1PQ7A 2WV4A 2BVSH 3MO6A 1HBTH 1SGRE 2QF3A 2J95A 4IC5A 2GZ8A 1ELCA 2TIOA 3MU1A 4PROA 1EAUA 5CMXH 1YP9A 5EODA 2A5IA 2FX6A 3RXKA 1MQ6A 1ARCA 3VB5A 3KHVA 4IC6A 1D3QB 3U69H 1DXPA 1TA6A 4TY7A 2Z9GA 4ZXYH 1SMFE 1E34B 3RXFA 1OWJA 3SNAA 5L6NH 3H5CB 3SU2A 5AFZH 1GHAG 1P02A 1QGFA 2PUXB 3BTHE 1BTHH 1RTFB 2EI8A 1C9TA 1AMHA 4H4FA 1UVTH 4CH8B 5HM9A 3LH1A 1L4ZA 1MZDA 1PJPA 3MNSA 2WUCA 1SFIA 2D2DA 1SGDE 1K1NA 2LNCA 1ANBA 2HPPH 3SUEA 3MMGA 4E05H 5I46H 5L30H 1LQEA 1JOUB 5K7RA 2XC4A 2V3HH 4BAKB 1PPHE 5GPIB 1RD3B 1KXCA 4FXGH 3BTGE 4HTCH 1IQLA 1OP2A 1D4PB 2P8OB 3W94A 4K1SA 5JBBS 1AWHB 3UUZA 2W7SA 5DG6A 2C3SA 1VITF 1O3MA 5GCHF 5GIBA 3GDSA 3JZ1B 5A0BA 1EAWA 2VVUA 3UWIA 3KQEA 1O3FA 1BIOA 2TRMA 1BMMH 2Y6TA 3SV2H 1N6XA 3BTME 3ZZBA 1SQOA 3A7ZA 1UVUH 1MH0A 4LXBH 3MYWA 2P59A 4LOYH 3E16B 4DCDA 1RJXB 3G01A 2IJOB 5FPTA 1N1LA 1C5OH 2P93A 2XNIA 2ZFTA 1EZSC 1BJUA 2BY7X 1EASA 4K60A 1D9IA 2GD4B 3FAOA 5J4SA 4A5TS 2QF0A 3SNBA 2A2XH 5ESTE 1XM1A 3P8NA 5TJXA 4B1TA 1MAXA 2I6SA 2A1DB 4YT7H 3V12A 1C2LA 3VB3A 2FZZA 1JIMA 1T4UH 2BY8X 1F0UA 2H9TH 4ZKRU 3SU6A 1O3DA 2WUBA 2ZWLH 4MPWA 3F9FA 3MO9A 2ZFQH 1ZRBA 2UUKB 1Q3XA 2VNTA 2Y81A 4ABHA 1HDTH 1ESBA 2Y7XA 2G4UA 3IG6B 1CQQA 2C90B 4IMZA 1TPSA 2PUQH 3PTBA 2IOTA 2P3TB 2VWNA 1HGTH 4K2YA 3SI4H 2PKAB 1NO9H 4OS7A 2STAE 2VIWA 3DD2H 3F9EA 1DVAH 1HAHH 4BXSA 2H2ZA 3KL6A 1EATA 1UVOA 3SV9A 1K1MA 1KDQA 3DHKH 3GY5A 4MLFB 2FMJA 1J16A 2O8UA 5FPYA 1C5PA 2HNTE 2XCFA 4K1TA 1P03A 2QYIA 5DP8A 4B75A 3E90B 1GJ5H 3LGYA 1LMWB 1GJ4H 1ANEA 3U1IB 1WBGB 5BPEA 1X7AC 4TPYA 4Q80A 1TNJA 4MQAA 1QA0A 1YCPH 2JETB 2UUFB 3EDXB 1ZYOA 4WF8A 3F9HA 1C5XB 1O3PB 2ZFRH 2AEIH 2ZIQH 1WOFA 3S0NA 1ZPZA 2NU4E 1O34A 2H5CA 2BZAA 5DK1A 3MH5A 5C3NA 2O8MA 3BTTE 3QX5H 3ZVBA 2JETC 3OU0A 1DY8A 1O2YA 2ZP0H 1L1GA 3RU4D 3I29A 1PPFE 3D23A 3M35A 1YPJH 3PYHA 3ENSB 3DA9B 2ZDNA 3DFLA 1KLTA 1CGIE 3KQDA 4HFPB 3D62A 4X2XA 1GHVH 1CO7E 5FCKA 2EI7A 1LVYA 1O30A 2RA3A 2BXTH 4WH8A 2ZGJA 2VJ1A 2PSYA 4X1NU 1TNHA 4YOIA 4FUIA 3GDUA 1FI8A 2XYAA 1DXWA 4UONA 3SORA 2HLCA 3E0PB 3ZV8A 4B74A 4K69A 3DT0H 4X2YA 1OP0A 1P3CA 1FUJA 2ZECA 1EPTB 4Q7ZA 1ORFA 2PHBA 2GZ9A 3AVZA 3GY7A 2ODPA 1AB9B 2VGCB 3ATLA 3D65E 2ZU4A 1UMAH 2BX4A 2CGAA 4CREA 1NZQH 1AVWA 1GBTA 3UR6A 1T32A 2BD7A 2ZQ1A 1NESE 2GMTB 1C1VH 4U32A 1BDAA 3U9AH 1TOCB 1AB9C 2BD5A 4I7YH 2VGCC 4Y6DA 1SGFA 3QGJA 1CHGA 1LHGH 1IQGA 1ESTA 1KXEA 1TX8A 2GT8A 3VXEH 3F9GA 3Q3KA 1ZTKA 3SUGA 1O5DH 1OWIA 2G4TA 5L2YH 1YKTA 1O5FH 1K2I1 1NY22 2GMTC 1TIOA 1P04A 1YBWA 3SQEE 5SGAE 1YPHE 1HIAA 4NA7A 5DP6A 3PV4A 1XKBC 3RXOA 1F92A 2ZU1A 4THNH 2HALA 2Y80A 5DP9A 1B5GH 1HJAB 1GI8B 3GCTF 1O2QA 1O35A 4UD9H 1S0RA 3STIA 1GHBG 2BB4A 3RM0H 3TVJB 4TWWA 2CMYA 3QN7A 1O2NA 1FXYA 5LPEA 1SI5H 3RXSA 1O3IA 2FDAA 4CHAC 5JDUB 2W3KA 4TYDA 1MBMA 3VXFH 6LPRA 3LGWA 1LHCH 1YM0A 3P92A 3BG4B 4Y0YE 3MU8A 4XBDA 7KMEH 4WWYA 1TNKA 1ELGA 2FOGA 1ZJDA 3TLOA 1O31A 1KLIH 1F2SE 3K6ZA 4D9RA 1LVMA 2G8TA 5DKMA 3LU9B 1QRWA 2PTCE 1GG6C 3T2NA 3BG4C 2FEQH 2OP9A 1V2UT 1QHRB 1ZMJA 1Z8GA 2PFEA 5FBEA 4CR5A 1DT2A 4BXWA 4MG3A 4INHA 3CS7A 2HPQH 3F68H 1ELVA 3GCOA 2IPHA 3M37A 3RXMA 1PFXC 2OC1A 3TIUA 1IOEA 1LPKB 2FOMB 1IQFA 5FAHA 1W12U 1QB1A 1GJBB 1P06A 4RSPA 4CBNA 4Q2KA 5AVDA 1CE5A 3SOSA 1EJAA 1YPKH 1VR1H 4GCHG 1NROH 4WY3A 1UCYK 3PLKA 5ETXA 1NM6A 3ELAH 3BEUA 4YLUA 1O39A 1PPBH 3GCHB 2R2MB 2BOHB 1HXEH 1LO6A 3MO3A 3FANA 4JMYA 1ACBE 1QRXA 3FZDA 2ZU5A 1QCPA 4NFEA 1K1LA 3OYPA 3KGPA 4FU9A 1HAVA 3LH3A 2XWBI 4ABDA 4NFFA 1S85A 1IQJA 2IN2A 1LKAA 1O36A 2W26A 4DVAU 5C1XA 3BTFE 1LQDB 1B0FA 1ZR0A 4YO9A 1V2PT 3LONA 3M5OA 1DDJA 4FUJA 4X6MA 3NK8A 1OOKB 3U8RH 3PMHB 3RC6A 4Y8XA 2Y7ZA 1OWKA 2QY0B 4TPIZ 1W0YH 1GCTB 4UE7H 1QB6A 1QL8A 5FX5A 3UNRA 2KAIB 1OX1A 5EXMA 1LHEH 2H1UA 1CHOF 1HPGA 4Y76A 2VVCA 1JXPA 2QXJA 1QY6A 1C1OA 1GMHF 2F83A 4IBLH 3A7VA 3RLWH 1GMDG 1U6QA 5FXLA 1GBBA 1ZTJA 5EXNA 1O3OA 2BLVA 1GCTC 1QTFA 5GXPA 2C8XB 2VH0A 1T8LA 4D8NA 1NRSH 3I77A 4Y7BA 4BTTB 1ZMLA 1C5LH 1BRCE 1VCWA 2BOKA 2FTMA 2ZHDA 3P17H 3TU7H 1UTOA 2ZEBA 1A4WH 1T7CA 1P2NA 4BAOB 1OSSA 3P70B 3RXVA 2XC5A 1GVZA 1FY5A 1F0RA 3A7YA 1P11E 3NKKA 1KY9A 2PLXA 5FHTA 2BD4A 1K21H 2A4QA 1IQNA 3SU0A 1AO5A 3V0XA 4INKA 1O38A 1THSH 1BUIA 2ZZUH 1LHDH 1ABJH 4HI3A 1TNIA 3BTDE 5FCRA 4B73A 4UDWH 3L3TA 1AU8A 5C5OA 1YC0A 3ITIA 3ZV9A 1L0ZA 3QZRA 1L4DA 1LPZB 1H1BA 2YOLA 3E91A 3BG8A 3LOXA 1Y5AT 1KXAA 3S9BA 4M7GA 3IWMA 1BBRE 1GBCA 1C1UH 4X8VH 1DOJA 2C8WB 1BA8B 2QA9E 1EUFA 1TPAE 1O2MA 1TLDA 1WAYB 5IYTA 1GI1A 1Z7KA 4O97A 2WINI 4F49A 1HUTH 1SC8U 1UTJA 2GV6A 2ZTXA 1H8IH 1KXDA 3LGVA 1Y5BT 1SGEE 1FNIA 1V2TT 5E8EH 1SGPE 3FFGA 2TPIZ 4R8TB 3SBKA 1GI0A 2A45B 1NRQH 3SI3H 1WUNH 4A92A 4D9QA 2F3CE 1NU9A 5C2ZA 1O5GH 3RMOH 3GYMA 1TOMH 4JZ1A 3BTQE 3ODFA 1TGBA 1B0EA 1Z8IB 1BTWA 3B23B 2FM2A 2Z7FE 1D3TB 4O3UA 2OQ5A 1MTVA 1C2IA 1TNLA 1HLTH 2XBXA 1S6FA 1GBFA 4BAQB 1GBIA 1F5KU 2BD9A 3L33A 2DE8A 2AS9A 2AMDA 1C2GA 4A7IB 5F6MA 1IHSH 2ZDLA 3TJUA 3M3TA 1CVWH 3RXQA 2GVFA 4JYUH 3SV6A 1TMUH 3HK6B 4ZKNU 1TGTA 1V2OT 3FP8E 2ZU2A 4Y0ZE 1AD8H 4NIWA 4INLA 1GI7B 4IW4E 1TWXB 5FBIA 4H42U 1SB1H 2XBVA 3OTJE 1V2ST 3N7OA 5G4BA 5GWZA 4MNYA 1DUAA 3UWJH 1KSNA 4Y7AA 3A8CA 4K1EA 3TGKE 1P01A 1E36B 2GDDA 3QUMP 4ZROA 1VJAU 1UTQA 2C8YB 3UR9A 1HAXB 1ZRKA 1H9HE 1MKWK 2R3YA 3Q76A 1O3JA 4B71A 1MQ5A 4FVBA 3UPEA 1NRPH 4KGAA 3HKJB 1WTHD 5EQRA 2Y5HA 5T6FA 3SJKA 2Z3CA 4AN7A 3A8AA 2AGEX 1SVPA 5TCCA 2OC0A 1G30B 2ZF0H 4IN2A 3ATWA 1AHTH 5EG4A 5H4IB 8ESTE 1S82A 1G9IE 4FUGA 4MPXA 4KTCA 1C5YB 3Q3YA 4BAHB 1JWTA 7GCHF 3TNTA 4DURA 4NGAH 1P2OA 1GBMA 1VITH 3M7TA 1O2IA 3AW1A 3MU4A 3RXCA 2D26C 4LZ4B 2A4RA 1LDTT 1FN8A 1H9LB 3ZZ8A 1C1RA 3RXBA 3KNXA 2UWPA 5ESBA 1UK2A 1NC6A 1XXDA 2ZFPH 3PWCA 3TH2H 3OX7U 1ELBA 1O2VA 1KDQB 1UCYH 3SNCA 1FV9A 3VFEA 4JYTA 1NU7B 3MOCA 2BVXH 3TITA 1JIRA 3V7TA 2OCVB 4OS6A 3KQBA 1EB1H 3RLYH 3P8FA 1GCDA 4FUHA 3LDXH 4AOQA 2HNTF 1TA2A 3LPRA 4ISNA 1ELFA 4Y71A 5EOKA 3FP7E 1DLEA 1V2LT 4ISHH 1O2XA 1A5HA 1TX7A 2BQ7B 2BVRH 4X1SU 1TQ0B 1YPLH 2D8WA 2ZGBH 2PGBB 4ABGA 3A87A 1AUJA 4GHTA 1XX9A 2ZA5A 2OBOA 4AB8A 1NPMA 4ISLA 4Z6AH 1A0LA 4AORA 3RXDA 4Q7XA 2WPMS 3QTOH 3BIVH 3I78A 4FVDA 1G2MA 1TBZH </