6ESTA

Interaction of the peptide cf3-leu-ala-nh-c6h4-cf3(tfla) with porcine pancreatic elastase. x-ray studies at 1.8 angstroms
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PORCINE PANCREATIC ELASTASE
publication title Interaction of the peptide CF3-Leu-Ala-NH-C6H4-CF3 (TFLA) with porcine pancreatic elastase. X-ray studies at 1.8 A.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Hydrolase(serine proteinase)
total genus 57
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1990-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 6estA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 6estA01
3I77A 3TVJB 1DLKB 2HGTH 5LPRA 1YCPM 3GCHC 4YT7H 2PLXA 5A8XA 1EB1H 5E0JA 1A3BH 3SUFA 5EGMA 3UR6A 1NTPA 3E90B 1A5GH 3RLYH 3KIDU 3SGAE 3KN2A 1DITH 1GVZA 5HYOA 1G3DA 1AZZA 1KXEA 2GDEH 2JH5D 4ISLA 1SLWB 1AU8A 1C2KA 1OWEA 2GDDA 1O3MA 1NM6A 1L1NA 2WYGA 2ZA5A 3BTGE 1K28D 4DT7B 1MH0A 2VWLA 4LZ1H 5DP7A 1BRBE 2BDCA 3MU4A 2FPZA 1P2JA 3P8OA 2TGAA 2H2ZA 3ZZ5A 1KSNA 1O5GH 2Z3EA 4NG9H 1LHCH 1O32A 4Q7ZA 2WPHS 1LO6A 3A8CA 4AB8A 1O3DA 3RC5A 2FYRA 3SHAH 2FDAA 1EAIA 1YYY1 1W14U 4K1SA 1Q31A 3KQDA 1A4WH 4FUHA 3VGCC 3SGQE 1GMDF 1BTXA 1VR1H 1QNJA 4J2YB 2G8TA 3BV9B 4ABHA 1UTJA 1WOFA 4I7YH 2PV9B 1HAPH 3WY8A 2GCHF 1GJ7B 2ZPRA 2HLCA 1ETTH 1AE5A 4MPUA 3TGJE 3D23A 1GHBG 1OYQA 1P09A 5GDSH 7LPRA 3M3SA 3MNCA 4VGCB 3GY5A 4OS5A 4WVPE 3UREA 2VINA 1GI2A 1MTNB 4CRAA 1GBDA 2QIQA 2ZGBH 3QGJA 4X8UH 1TRNA 4H4FA 5EODA 5AF9H 2P3TB 1J17T 1GJDB 3N7OA 4HFPB 1QBVH 3BTKE 2R9PA 3VXFH 4JZIA 5HM9A 1GJ5H 4MDSA 1TGCA 1LMWB 5TCCA 5L30H 3NKKA 3RMMH 2XTTB 1BTYA 3P92A 3RXMA 1NU9A 3RXVA 2Y5FA 2QXHA 3ZV9A 1CA8B 2XNIA 1GBKA 1OYTH 1O2ZA 3TIUA 1AUTC 1YCPH 1CA0B 1BT7A 4E7RG 1VCPA 4ABAA 3RU4T 1S6FA 4XOJA 1EOJA 1QL8A 3S9AA 3LU9B 2AS9A 1BOQA 2VIDA 2BQ7B 1QTFA 1N8OB 5A0AE 1MCVA 1T4VH 5DP8A 2OC8A 2XC0A 4AN7A 2G51A 2O8LA 3KCGH 1LCYA 2CGAA 2QA9E 1BITA 3MU5A 2VIQA 1V2NT 3AAUA 1O3AA 4NZLA 4DOQA 3TU7H 1WUNH 2BM2A 2XBYA 1Q3XA 1RS0A 1HAGE 3LGWA 5JBAS 5AFYH 1VGCC 2ZU2A 3BTFE 2FX6A 1ZHMA 2A2QH 1TABE 1EAXA 3CENA 2B5TB 2PKSC 2Z7FE 1ETSH 5J4QA 1JRTA 1YPGH 4JK6A 3QTOH 1WU1A 2GCTC 1F5KU 8KME2 4KTSA 4XFQA 2A45B 1RTLA 1RTFB 1AVXA 1UVOA 1Y8TA 3GOVB 4AG1A 1D6RA 4B75A 4JYVH 1TLDA 2Y6TA 1V2QT 2RA3A 4I31A 1B0EA 3LPRA 1YCPK 4KGAA 4ISIH 4NSVA 1MTVA 1SB1H 1LTOA 1C1RA 2O8WA 2ZHWH 1CT2E 4X8VH 1SC8U 1Z8IB 1XXDA 3KQCA 5TJXA 4A92A 2OTVA 1GJ6A 3LH3A 3RXOA 1BTUA 2R3UA 3RC6A 1RTKA 3BG4C 5LGOA 3MU8A 4ZKSU 5E8EH 4DIHH 4JZFH 1BMNH 2ZDNA 2YNBA 4GHQA 1P10A 4AX9H 1WTHD 2A7JA 3A7VA 1O36A 1QCPA 2HVXA 2SGFE 1RXPA 2VIVA 4TYDA 2BY5X 4INLA 3O8CA 2ZG0H 1C5YB 5AHGH 1EUFA 4ISOA 5JBTA 2NU3E 2ZFSA 2BQWB 4CREA 4Q7XA 1GBLA 1ZOMA 2A5AA 2G4TA 3P70B 3SN8A 1W10U 2W7SA 4ZHMU 2BDHA 2AMPA 1V6DA 1C2FA 2J9NA 1AKSA 2ASUB 5BRRE 2BLOA 2WINI 1AY6H 3H7OA 1LHFH 1UCYH 1WQSA 2J4IA 1A0HB 2ZU3A 1A0JA 1LVBA 1SL3A 2ZP0H 4WXVA 3IWMA 2PFEA 1DLEA 4NWLA 2HOBA 2BVSH 2PTCE 4LZ4B 3GY8A 1ZTJA 1ABIH 1DT2A 4OGYA 1AFEH 2O8MA 5FPTA 2Q6FA 1O39A 1LPGB 4XE4A 3T26A 1CU1A 2DE8A 1OKXA 4YM9A 2BD5A 4UFEH 4Y79A 4ZKNU 2R3YA 3K9XB 4MNYA 2OUAA 2SGEE 2FI3E 2W7UA 1GI3A 2CN0H 3GCTG 1XM1A 1LVYA 4FU7A 3HGNA 2P3UB 5T6FA 1BZXE 1GI9B 2DE9A 3GDUA 1OP8A 3NK8A 4RKOB 1RRKA 4A1XA 1Y3XA 5EXNA 4DY7B 4IMQA 2B7DH 2D1JA 4KTUA 1ZRBA 1XUIA 4AG2A 3Q77A 3ZYEA 2Y80A 3LKWA 1UCYK 1FAKH 1P03A 1O2MA 4DG4A 4WWYA 4LK4A 1KXDA 1TOMH 1VGCB 2ALVA 1ID5H 4K2YA 1FY1A 3SI3H 1HCGA 4O3TA 3AW1A 2PKSB 3RXCA 4DIIH 5F03A 1TA6A 1G3CA 3FZDA 2GCTB 1AFQC 7GCHF 2FWWA 5A8ZA 1DWBH 3AASA 4JYTA 3PWCA 2ZTZA 2LPRA 1Y5AT 1QBOA 3TH2H 1HNEE 1VJAU 4YESB 5E2PA 1C1NA 3W95A 1VITG 4INKA 4NIYA 2AIPA 4YOJA 1C4V2 1O30A 1P2IA 3SQEE 1SPJA 3SNDA 4Z6AH 1D3DB 4BAQB 1GI0A 1W7GH 1AD8H 1FIZA 3V7TA 4ABIA 3MTYA 1P05A 3EA8A 1WSSH 1BUIA 3EE0B 1SGEE 1KY9A 2PKAB 3LIWA 3RXTA 4NZQA 2QXGA 3KF2A 2IPHA 2V35A 4MPWA 1GBJA 4YO9A 4X1SU 4BXSA 1BMMH 1GJ4H 2UUJB 3PM3A 5HXFA 5EU8A 1BCUH 2NU1E 1QGFA 2GKVE 5HMAA 2VIOA 3SNEA 3T62A 3DFJA 3HKJB 1ZYOA 1Y3UA 1GBTA 1O38A 1IQKA 3SBKA 1P57B 1OPHB 2EI7A 5FCRA 1BHXB 5H4IB 1NN6A 3RXDA 1C2HA 1O3PB 2ZFPH 4D76A 1C5SA 2JH6D 3IITA 1LPKB 4I8LA 1EOLA 1FY4A 1DWEH 3M61U 3M7TA 4F4OC 1UTLM 2BZAA 4X2YA 2FOMB 4BNRA 5EQSA 1HB0B 2UUKB 3BTHE 1OOKB 1DUEA 1VZQH 4Y10E 1GJ8B 1C1OA 1XUGA 3A89A 1WAYB 1F0RA 1GBBA 1QRZA 2Z9IA 4F49A 4ZHAA 1O2SA 5A0CA 1DM4B 5FHTA 2WV4A 2PUQH 3S7HB 4B2CA 4OS1A 1TGTA 1C2IA 1JRSA 3ZVGA 4A5TS 2ZC9H 7KMEH 3UR9A 4O97A 4WMFA 2GV6A 1O2GH 1SQTA 3EAJA 1S0RA 1EX3A 8GCHG 1MKXH 2VIPA 8LPRA 1O3HA 3LC3A 1K1NA 1C5TA 2J34A 1M9UA 1NFXA 2GT8A 3TGIE 1YF4A 1Z1JA 5IDKA 3D65E 1OWJA 1G36A 1TNLA 2BD7A 2A7HA 3RM2H 1C2JA 3T25A 4ABFA 4CR9A 2ILNA 2TGTA 3MYWA 4X6MA 2ZCLP 1TAWA 3T2NA 3M5OA 3NUMA 3F9FA 4NIVA 2Y7XA 2CHAC 2QN5T 3NZIA 1C1WH 1TWXB 1ZSJA 1AGJA 3UNQA 1NY22 3QGNB 2QF3A 3L6PA 1EP5A 5CHAC 1GBEA 3TJNA 5EG4A 4CRDA 1AUJA 1KDQB 1O34A 4SGAE 1ORFA 3ZZCA 5C5NA 1TX7A 2H5CA 1RFNA 2F9PA 2ZGJA 2ZF0H 1HIAA 1C5UA 1UVUH 1C1SA 2G81E 1GMCG 2OC1A 3BTDE 4X6NA 1C5OH 1FPCH 2PSYA 1DX5M 1HJAC 1AFQB 3SV6A 1MD8A 3I29A 1W0YH 3QX5H 1MCTA 4E05H 4X6OA 1MKXK 1SGFA 4BAMB 5LH8A 1RGQA 2BXTH 3K6YA 3PB1E 1BTZA 2XWBI 5GWZA 1SGFG 3RMNH 1C4Y2 1UTQA 4R8TB 3ATLA 1FPHH 1EATA 2ANKH 3E3TA 3GCTF 1O5EH 3ZVEA 3MOCA 1TNKA 2FXRA 2V6NA 3RMOH 5GXPA 1GHAG 2G00A 1ZRKA 2QCYA 2BYAX 1G3BA 3LOXA 1Y5UT 1MD7A 1N6XA 1T8LA 2F9VA 1PPZA 2Q6GA 2PR3A 1G32B 3P95A 2JETC 1FAXA 2YNAA 4AYVB 2ZFTA 3SJOA 4NA7A 2ZQ1A 1O3OA 1XKAC 2VVVA 2QGRA 3UPEA 3E1XB 1A7SA 3U1IB 1PFXC 2VU8E 2VWMA 1C1UH 1Z6JH 1MTSA 3FP8E 3STIA 5C67A 4ZKOU 2YOLA 1A5IA 4AGKA 3GY3A 2WPMS 3K6ZA 5ABWA 3SUGA 2ZU4A 1WBGB 2BDGA 3TJUA 3BIUH 4Q2KA 2BD8A 3MNXA 1UVTH 1C2EA 4NFEA 3QK1A 1TQ0B 5FCKA 1CT0E 1JOUB 1P02A 1UJ1A 2G5NA 5C2ZA 5DO4H 1G3EA 1HAZB 1GVKB 2XWAA 1IQEA 1TE0A 2A4GA 1S81A 1JIMA 1U6QA 2JKHA 1SGYE 3LGIA 1WQVH 6GCHG 1GBFA 5BPEA 3S0NA 1AN1E 1GMHG 4Y8XA 1C5WB 3SNCA 3UUZA 1QHRB 1P8VC 1QL7A 3PLBA 2ZIQH 4IW4E 2Z9GA 3EA9A 4D9RA 1D3QB 1FLEE 1NFWA 1NZQH 4ABJA 1P2OA 4MNVA 1UTMA 3D62A 4ZMAH 1P01A 1QBNA 2Z9KA 3ZZ6A 3SJIA 1C1TA 1K1LA 1MBMA 2GD4B 4KKDA 3RXKA 3A84A 1YPHE 3BF6H 1GJ9B 3ZYDA 1TX6A 1K1PA 4B2BA 5LPFA 4BXWA 2CHAB 3OY5U 2SGAA 4JK5A 4RKJB 1DANH 1KLTA 2AMDA 2VWNA 2CF9H 5GPIB 2C90B 3M5NA 3A87A 3Q00A 1BTHH 2IOTA 2Z9JA 2QXIA 1O0DH 1C5RA 1SGPE 4KP0A 5CHAB 3RXAA 1HAHH 1V2RT 2GTBA 3VB4A 1SVPA 1GGDC 3VFEA 3O8BA 1E38B 2ZDVH 1KLIH 2Q6DA 3HK6B 4GVUA 2ZDMA 2OD3B 2H6MA 2A2XH 4D7GA 4MQAA 3RU4D 1HJAB 1FZZA 3ODFA 5F6MA 2D2DA 2BD4A 1GI8B 2ZO3H 1K22H 5JBCS 1YLCA 9ESTA 1TA2A 1C5VA 5PTPA 4GLYA 1GBMA 3V3MA 8GCHF 3Q76A 1AHTH 2CJIA 1E35B 2Z3DA 2WUCA 5AFZH 1ELTA 1J9CH 2BY9X 2GZ7A 1BBRH 1SR5C 3A7ZA 3L3TA 3P6ZB 2QXJA 5F8ZA 3V0XA 1UTNA 4LXBH 1TALA 1D4PB 1OS8A 3PMAB 1MU8B 1KXBA 4IC6A 1S0QA 5FX5A 4GCHG 1YC0A 1TBRH 3MMGA 1GHYH 3ZVDA 1PPFE 1UO6A 1TOCB 2BDBA 2ZU1A 3MHWU 3FVFB 1HV7A 1TPSA 4FUFA 5GJ4B 4AZ2B 2WPKS 1B5GH 2ZFFH 2WV5A 1XUFA 2JETB 2J92A 4NIXA 3GY6A 4Y7AA 5ESTE 1UK4A 2R0KA 1NRNH 3SJKA 2XBXA 5L6NH 1TPOA 1C9PA 3M37A 2AYWA 1G37A 1DY8A 1ELVA 2H9EH 1H8DH 4IMZA 4THNH 1O35A 5DPAA 3URDA 3BSQA 4FVDA 1GMCF 4X1NU 4UEHH 1IAUA 4I8JA 2W26A 3ESTA 1PPHE 1DSUA 1O2TA 4M7GA 1FN6A 1W11U 1ZTKA 4ZUHA 4NFFA 1EPTC 1C5ZB 2V3HH 1XVMA 3LJJA 1QQUA 1OX1A 2CMYA 2PGQB 1P2NA 4H6SB 1FV9A 2F9OA 3PTNA 3SO3A 4FUDA 1T31A 1TPAE 3QDZB 3FP7E 7ESTE 5F8TA 1ELFA 1QJ1B 1BBRK 2HALA 1DXWA 4UD9H 3UQVA 1GHWH 4AGJA 2G4UA 1O2XA 4ABBA 3MI4A 1O2NA 1P3CA 1MAXA 8ESTE 3DFLA 1HJ8A 1L1JA 2J94A 1TRMA 3Q3KA 1NFYA 1UCYE 2GZ8A 3FAOA 1S5SA 2Y5HA 1XX9A 3LGTA 3LT3A 2QV1A 1PYTD 1UVPA 1O2HA 1DOJA 1CHGA 5JBBS 1IHSH 1EJNA 4YLUA 1O3FA 1T32A 2Z3CA 2F9NA 4K8BA 4ZH8A 4ABDA 2SGQE 1BJUA 2NU4E 2W3IA 1F7ZA 3HATH 4UFGH 4FUEA 3PMJA 4AB9A 2BDIA 4WXIA 1O2YA 4X1RU 3SOSA 3NPSA 5JPMH 2SNVA 3UTUH 1SLVB 2QF0A 1ETRH 2ZU5A 1IQJA 4A6LA 1V2WT 4CBNA 2WYJA 2SGDE 1P12E 1P9SA 4NSYA 1KTTB 1HAVA 3QZQA 4DURA 1GGDB 1O3NA 2FZZA 1V2ST 2XC5A 1TBZH 5F8XA 4BAOB 1O3CA 1C1VH 1RIWB 2BD2A 2WUBA 4INHA 1MZDA 5JYIA 3ZV8A 1NO9H 4Q80A 3GCNA 3ZVCA 3SU2A 4IGDA 4BAHB 6GCHF 1IQGA 1TB6H 1GMHF 3BEIB 1MTWA 1XMNB 4CHAB 5FPSA 3RP2A 2ZGXH 3VB7A 2PUXB 5EPYA 4A1VA 3RU4E 1GL0E 1DDJA 1SOTA 3A7WA 3ZVBA 2FOGA 1TNHA 3C27B 3MU0A 2UWOA 3BTWE 3TH3H 1XVOA 4FUGA 2C8YB 4ISNA 2FESH 1O2JA 1SFIA 1ZJKA 1QRWA 3SV8A 1EAUA 3RXRA 4I8GA 1AO5A 3ZZ4A 3PYHA 3EDXB 3TNSA 1OP0A 1ZTLA 1ZMJA 2WPIS 5K7RA 2CXVA 5TCAA 4H6TA 5EOKA 3E6PH 5FX6A 3A8BA 4TPIZ 3UFAA 1QA0A 5JB8S 3UQOA 1TMBH 1FXYA 1SGIB 5SGAE 3RXLA 5EQQA 3URCA 1L1GA 1GDNA 3FP6E 1Y5BT 1GHBF 3AVZA 1ABJH 1G2LA 3PLKA 1NRRH 1THSH 4XBBA 1AB9B 1EPTB 2EI6A 2BY8X 1JXPA 2XBWA 1OWKA 1TMUH 3ELAH 1CT4E 1Z1IA 3RLWH 1GWAA 3S69A 1YLDA 3RMLH 1S83A 1SLXB 1C5XB 2AMQA 1S85A 1C4U2 2D26C 4DVAU 1PQAA 3HK3B 2F9BH 3GYMA 4ZXXH 3RXBA 3O8RA 1O2VA 3SNAA 1GI1A 4U30A 1YPMH 4X2WA 5FBIA 4JZEH 2XW9A 1MMJN 3SZNA 1ZMLA 1D3PB 4GCHF 2EI8A 1W2KH 3M3TA 4SGBE 1T8OA 1LVMA 3Q3XA 3CP7A 2XCNA 2HPQH 1G30B 3M35A 2C4FH 4D9QA 1TNGA 4X2XA 1DFPA 4K1EA 4O03A 1CBWB 2GP9B 3GYLB 3HGPA 2OP9A 5JDUB 2UWLA 3K65B 3MO9A 3DT0H 4Y6DA 1AKSB 1V2VT 1ANCA 1KXAA 2KAIA 3LJOA 1UMAH 3UWJH 2J38A 1J8AA 5DKMA 2BVRH 1AWHB 1V2TT 1GJBB 2GVFA 2A4OA 3BG8A 2Y7ZA 1C5NH 4FUBA 3ATKA 2ZKSA 4TWYA 2ZNKH 2ZGHA 1XUKA 1GHXH 1OWHA 2BMGB 1SGCA 5C3NA 4BANB 3PO1C 1ELCA 1F5RA 2VVCA 3RC4A 1AZ8A 5B6OA 2TPIZ 2ZFQH 1FI8A 1NS3A 1ACBE 1O2KA 1EB2A 1SFQB 4MVNA 1IQNA 5I46H 4WJG2 1SGQE 1O2OA 4CBOA 1LHDH 5DJ7A 3KQBA 2NU0E 3RXHA 1P2MA 1ELAA 3M36A 5EW2H 2ZHEH 3MFJA 4I8KA 4KTCA 4CRFA 1ZHPA 1SGRE 3ZZ3A 1P9UA 3SU3A 1Z7KA 2H9HA 4NA8A 3OY6U 1NFUA 3ENSB 5E0GA 1QFKH 4ASHA 1DS2E 4ZROA 2P3FH 2C8WB 1RD3B 2RDLA 1HYLA 3SUEA 2BY6X 1ANEA 4K5ZA 4DW2U 2C8XB 4OS7A 4B2AA 1BRAA 3QO6A 1HPGA 3F9EA 1EXFA 4Y7BA 5A2MH 4AFUA 4WH6A 1G9IE 1GBIA 1J15A 1ZSLA 3PTBA 2OXSA 2H5DA 4H42U 3U8OH 2CV3A 1EP6A 1H8IH 2VWOA 4MNWA 2ODQA 3E0PB 2HNTE 4R0IA 2HPPH 4MNXA 2ZCHP 1XXFA 4AOQA 3SU6A 1C1QA 1PQ8A 3BEFB 4ZKRU 4UFDH 1EASA 1DPOA 2ZTXA 1K1OA 2FEQH 1H9HE 4WH8A 4AFSA 1MU6B 3RXUA 1TPPA 1K2I1 3AAVA 4HZHA 1HAXB 4K60A 1QA7A 2RA0A 1BIOA 1FY8E 1ZSKA 1ELGA 2FOBA 3TPIZ 1NRQH 1ZMNA 3FFGA 3RXFA 1Z71A 2AIQA 4HGCA 1A1RA 3JZ1B 1PQ5A 2ZWLH 2P8OC 4A1TA 1LVOA 2ANWA 3A86A 1TFXA 2WPJS 3C1KA 2OC0A 1C2GA 1O5CB 1XUHA 2UWPA 3ATWA 4GUXA 5AVDA 1TBQH 1L2EA 1TGBA 4IN1A 4IS5A 1KYNA 5DP6A 2OCVB 3P17H 1GHVH 1T8NA 3W94A 2OQUA 2ANMH 1PQ7A 1WV7H 4U32A 1P3EA 3T27A 1V2PT 1P06A 1C1MA 3E91A 4KELA 3EQ0H 1GCTC 1A0LA 1HAOH 1DXPA 1X7AC 3SU0A 1TNJA 4FUIA 2ZCKP 5L2ZH 4YZUA 2ZGCA 1GCDA 3VB6A 3NCLA 2DUCA 1SMFE 2F83A 3OSYA 4E7NA 3FZZA 1RJXB 1QR3E 3QUMP 1WYKA 1HUTH 1E0FD 1LHEH 1SBWA 1H1BA 3GDSA 1CHOG 3JZ2B 2XBVA 2BOHB 2TGDA 3QN7A 1AVWA 1Y3YA 1BB0B 5T6DA 3FANA 3SGBE 3M3VA 1BDAA 1V2UT 4JZ1A 3U98H 1FY5A 1EZUC 1FUJA 2PTNA 1SGNE 3A81A 1YPHC 3STJA 1PPBH 3PO1B 3PMHB 1YPEH 3A8DA 1A61H 1HXEH 3SU1A 1TGSZ 5CE1A 1D9IA 2FX4A 1YP9A 3EA7A 4RSPA 4Y11E 2A4RA 4U2WA 1AWFH 3KEEA 5HGGA 1EJAA 4FVBA 1GJCB 5A09A 2IJOB 5EPNA 3M7UA 1JMOH 1VITF 4O3UA 3M7QA 2ODYB 1GI5A 1L0ZA 1C5LH 2FLRH 4IC5A 1O33A 5DK1A 1SG8B 1ZLRA 3ZZBA 3TK6A 4TPYA 1O2RA 1KXCA 2NU2E 2TIOA 5FAHA 3E16B 3UY9A 1TGNA 1ZPZA 2Z9LA 4ABEA 2Z6BD 2PSXA 1CSOE 4OS2A 1E34B 4WMEA 1D3TB 1YPLH 2BX3A 4Y76A 4Y8YA 1NPMA 2FS9A 4BTUB 3F9HA 3U8TH 1LKBA 2ZFRH 3OX7U 4O9VA 1BMLA 3UNRA 5A0BA 3RXSA 3UOPA 1BBRE 3HPTB 2GV7A 1F0TA 3GY4A 3B23B 3VB3A 1FJSA 1HIAB 1K1MA 2B0FA 2QY0B 3F68H 4YOGA 3BN9A 4FU9A 2P59A 1P11E 3TGKE 4TY7A 3A7YA 2F3CE 2P94A 2ANYA 2SFAA 1EZSC 3ODDA 4XBDA 4HI3A 5K0HA 1K9OE 1NU7B 3Q3YA 2QC2A 1IHTH 2R2WU 1AVGH 1BMAA 3DHKH 2TGPZ 1N1LA 1UHBB 2ODPA 4XBCA 4OS6A 3TLOA 4AORA 1XKBC 4CR5A 2P8OB 1YPKH 1F92A 1KIGH 1GBAA 5G4BA 2R2MB 2ZDAH 6CHAC 1RIWC 1HAIH 3A8AA 4NA9H 3A83A 3GISB 3NXPA 2ESTE 1A5HA 3ZZ9A 1BTWA 1EZXC 2HNTF 2VJ1A 4FUCA 3SORA 4DGJA 4CHAC 1J14A 3MH5A 1C5PA 4Q7YA 1O5AB 4CRGA 1YM0A 3A7TA 2FO9A 1GCTB 1HDTH 3SHCH 5GCHG 1DWCH 3D49H 2CF8H 2QYIA 3MWIU 2FIRH 1FONA 1A2CH 3ATIA 1C2MA 1HXFH 2FS8A 5T6GA 1GL1A 3UNSA 3SJ9A 5C20A 1H9IE 1UTKA 1J16A 1MQ5A 1CGJE 1SLUB 2STAE 7GCHG 4AYYB 5LPEA 3LH1A 2VGCC 4JZDH 3ZZDA 2ZECA 3DA9B 4B1TA 4ABGA 1HFDA 5DG6A 1V2KT 1UK3A 3ZZ8A 2XRCA 1K21H 4WMDA 2PHBA 1ANBA 1SHHB 2ZZUH 5EQRA 5GIBA 1DSTA 3A88A 4UFFH 2VIWA 2STBE 1C1PA 4Z0KA 3KNXA 1ELDE 2OBQA 1NESE 2OQ5A 3RM0H 1VCWA 4PROA 4ZHLU 2JH0D 1AB9C 1PPEE 1OWIA 3SV9A 4YOIA 1O2LA 1FY3A 1QRXA 2XC4A 2AGGX 2O9QA 1V2LT 2D8WA 2BOKA 1ZGIA 1B0FA 1PJPA 3LGUA 1Q2WA 3PMBB 1QL9A 1K1JA 2ZEBA 1MKWH 3LGVA 4AFZA 1FQ3A 2FI4E 3MH6A 4Y71A 5DP4A 1EQ9A 4Y0ZE 1ZHRA 1E37B 4K1TA 1P2KA 1O3EA 3QTVH 2THFB 3GCHB 5A8YA 1ANDA 1IQMA 1GHAF 1SGDE 5FPYA 1SI5H 1O3KA 2B9LA 1O2QA 1QJ7B 1DY9A 1GBHA 2ALPA 4MTBA 1TMTH 3BIVH 1CHOF 2ZHQH 4K3JA 4TY6A 4XSKU 1ZPCA 2A1DB 2OBOA 4AFQA 1BQYA 5T3HA 2K1QA 1CBWC 3ZZ7A 2AH4X 2C3SA 4JMYA 3U8RH 3V13A 3VXEH 1DVAH 3M5LA 1CGHA 1EPTA 1WTGH 1EZQA 2VH6A 2A4QA 2Y5GA 3BTME 3PWBA 2FOAA 3VEQB 1INCA 1TQ7B 2J2UA 4D7FA 5EXLA 1GDQA 3RXQA 1O5FH 3V12A 3RXIA 1GI6A 1JBUH 5EW1H 1O2UA 2FOEA 4YT6H 2BD3A 2QAAA 1QIXB 2FI5E 3LGYA 1QY6A 1YKTA 1IQIA 4IBLH 4X1QU 1AMHA 3M5MA 3F9GA 1UTPA 1E36B 2P16A 1ZZZA 1QURH 1OWDA 1MKWK 4X8TH 1NC6A 6CHAB 1ARCA 1S82A 1L4DA 2NWNA 1C2DA 1VCQA 1W7XH 3VGCB 4MLFB 3SU5A 1GI4A 1JWTA 2ZDLA 1ZPBA 2BTCE 3A82A 4GHTA 2VNTA 1N6YA 1D6WA 1A3EH 2G55A 1Y59T 2OC7A 2P95A 1O2WA 4I8HA 2PKAA 3GCOA 1F0SA 4FUJA 3CS7A 4OGXA 2AGEX 2SGPE 3UIRA 2Q1JA 5J4SA 3G01A 1VJ9U 1W13U 1BRCE 2PW8H 1CVWH 4J1YA 2BLVA 1Y3WA 2V0BA 1TX8A 1H9LB 1F5LA 1MUEB 1ELEE 3S9BA 1GPZA 5CMXH 1Y3VA 2OINA 1IQLA 1QB9A 2GZ9A 2BZ6H 2O8UA 2A31A 3E0NB 3SW2B 2B8OH 1THRH 4HTCH 4ESTE 4NCYA 2BDAA 2I6QA 2VGCB 3MO3A 1HLTH 1O5BB 4GSOA 3TITA 6LPRA 1NRSH 2F9UA 5C1UA 2ZDKA 2HRVA 4X1PU 2P93A 2XXLA 1ZGVA 5DP3A 1ELBA 1HJ9A 4Y8ZA 2FOHA 3VPKA 1AI8H 3K2UA 1KLJH 1PYTC 2UUYA 3P8GA 4NWKA 2BHGA 2BVXH 4XDEA 4CRCA 1ESTA 2H9TH 2ZQ2A 1GI7B 2FOCA 3MO6A 1H4WA 6ESTA 1ESBA 2RG3A 3OTJE 3QWCH 1KXFA 4GPGA 1TNIA 1WCZA 3P8NA 3CS0A 2F91A 1EJMA 3RDZA 2LNCA 3ZZAA 2A5KA 3RXGA 3LDXH 3SV2H 3KHVA 2A0QB 2H1UA 2FMJA 2IN2A 1CGIE 2ZTYA 3DD2H 5ESBA 1LPZB 1O3LA 2FYQA 1UTOA 4IN2A 1OSSA 1QB6A 2V3OH 2BY7X 3ATMA 3HKIB 5GCHF 3S7KB 2GMTC 3A80A 3H5CB 1T8MA 1W0ZU 2FOFA 3SJ8A 1FDPA 1YPJH 1O31A 5ETXA 3U69H 4JCNA 1O3GA 2FLBH 1T4UH 3BEUA 4K69A 1GVLA 1GG6C 3TJVA 1KTSB 3SUDA 3ZVFA 4RN6A 4GAWA 5FBEA 1MZAA 1DE7H 1HAVB 4B76A 1B7XB 1NT1A 4DCDA 1ZR0A 4ZAEA 4FXGH 4CH2B 1ARBA 1O3JA 3OYPA 1KDQA 1DICA 3QZRA 1CE5A 2VVUA 3F6UH 3R3GB 1T7CA 3MH4A 2GT7A 3RXJA 1AQ7A 3DUXH 5JB9S 4MPVA 1V2JT 2HNTC 1THPB 3AW0A 3BG4B 3KQEA 5IYTA 2EEKA 4D8NA 3TK5A 1YBWA 2PWXA 1O3IA 2BB4A 1C9TA 5C1YA 2BXUH 1HGTH 4X2VA 3LONA 2RCEA 1QJ6B 4TWWA 3I78A 3H7TA 1HBTH 1W12U 1HAYB 5L2YH 3MU1A 1HRTH 1MTUA 1Z8GA 5DP5A 3U9AH 4YTAA 4BOHA 1FNIA 2VH0A 3RXEA 3SNBA 2TRMA 4B74A 5I25A 1EAWA 2M5TA 1DWDH 1GJAB 2AFQB 2GGVB 4UONA 1GMDG 1V2OT 5C1XA 1BTPA 1Z8JB 1G2MA 3UOUA 3E8LA 1GHZA 2BX4A 1PPGE 4YLQH 4K8YA 2UUFB 4BAKB 1IQHA 2GCHG 1LQEA 2AEIH 2PGBB 3SQHE 4E06H 3L33A 1P2QA 3B8JA 2WPLS 1A46H 4CH8B 2GX4A 2OLGA 4MG3A 1S6HA 4I33A 4JYUH 2Z94A 3TK9A 2BDYA 3PV4A 3GICB 1V3XA 4X6PA 3R0FA 3T28A 1C5QA 3A7XA 1UVSH 2ZPQA 1SHYA 2XYAA 5C5OA 2FM2A 2O8TA 3PLPA 1VITH 2FP7B 1DUAA 1O3BA 1IQFA 1W8BH 3ITIA 1F0UA 1CO7E 2ULLA 3TNTA 4NGAH 3O8DA 2I6SA 1V2MT 3IG6B 1P0SH 2ZHFH 4BTTB 2FODA 1FIWA 1SOZA 3QLPH 1SQAA 5DP9A 3BTTE 1OXGA 4B71A 4X8SH 1SSXA 5DGJA 1GBCA 5FXLA 3BTEE 4WF8A 1F2SE 2C8ZB 2Y82A 3LC5A 3GY2A 1QB1A 2BLQA 1ESAA 1P04A 2Y81A 4CRBA 3S9CA 3SI4H 2EC9H 1NROH 2J95A 5E0HA 2A7CA 2VB0A 1SGTA 2GMTB 3OU0A 3TH4H 3SV7A 2KAIB 3VB5A 1MAYA 3MNSA 2FTMA 2R0LA 1UK2A 1BJVA 4VGCC 1MBQA 4LOYH 1LQDB 4MPXA 4OS4A 4X0WU 3MH7A 3KL6A 3EYDA 2ZI2H 1MTNC 1OP2A 3MNBA 1GG6B 2G5VA 1BHXF 1S84A 3UWIA 1TRYA 1O2IA 1Z8RA 1ZJDA 2G52A 1CQQA 3RUOA 4I32A 1L4ZA 3KGPA 3B9FH 4ZXYH 2W3KA 1UHBA 3PROA 2A32A 2BD9A 1FN8A 1YGCH 1LDTT 1QQ4A 1MQ6A 3T29A 1O5DH 1K1IA 3SU4A 2BQ6B 2ZHDA 2W5EA 1JIRA 5E2OA 3GY7A 1LKAA 9LPRA 2HWLB 1AE8H 2AERH 4QT8C 4A7IB 2C93B 1CA0C 2ZPSA 1O37A 3T5FH 1XUJA 2TBSA 3NWUA 2EA3A 1W3CA 2XCFA 4DJZB 2FTLE 1GDUA 1SQOA 4B73A 2SNWA 1N8OC 2A5IA 1TYNA 2BLWA 4UDWH 1LHGH 4WY3A 3EGKH 1PPCE 5HM2A 1AIXH 1O2PA 3U1JB 4FU8A 1Z6EA 1C5MD 4UE7H 1C2LA 1EKBB 1NRPH 3BTQE 4U01A 4Y0YE 3TJOA 2AGIX 4BTIB 1BA8B 1TIOA 1TONA 1FMGA 3ZVAA 4ISHH 1BRUP 1IOEA 3P8FA 5EXMA 3GDVA 3A85A 3RXPA 4NIWA 3F1SB
chains in the Genus database with same CATH superfamily
1VKYA 4P00A 3I77A 3TVJB 1DLKB 2HGTH 5LPRA 1YCPM 3GCHC 4YT7H 2PLXA 5A8XA 1EB1H 5E0JA 1A3BH 3SUFA 5EGMA 3UR6A 1NTPA 3E90B 1A5GH 3RLYH 3KIDU 3SGAE 3KN2A 1DITH 1GVZA 5HYOA 1G3DA 1AZZA 1KXEA 1UW7A 2GDEH 2JH5D 3KYGA 4ISLA 1SLWB 1AU8A 1C2KA 1OWEA 2GDDA 1O3MA 1NM6A 1L1NA 2WYGA 4P02A 2ZA5A 3BTGE 1K28D 3AK5A 4DT7B 1MH0A 2VWLA 4LZ1H 5DP7A 3MQKC 1BRBE 2BDCA 3MU4A 2FPZA 1P2JA 3P8OA 2TGAA 2H2ZA 3ZZ5A 1KSNA 1O5GH 2Z3EA 4NG9H 1LHCH 1O32A 4Q7ZA 2WPHS 1LO6A 3A8CA 4AB8A 1O3DA 3RC5A 2F43B 3PRDA 2FYRA 3SHAH 2FDAA 1EAIA 1YYY1 1W14U 4K1SA 1Q31A 3KQDA 1A4WH 4FUHA 3VGCC 3SGQE 1GMDF 1BTXA 1VR1H 1QNJA 4J2YB 5KGOA 2G8TA 3BV9B 4ABHA 1UTJA 1WOFA 4I7YH 2PV9B 1HAPH 3WY8A 2GCHF 1GJ7B 2ZPRA 1NBMD 2HLCA 1ETTH 1AE5A 4MPUA 3TGJE 3D23A 1GHBG 1OYQA 1P09A 5GDSH 7LPRA 3M3SA 3MNCA 4VGCB 3GY5A 4OS5A 4WVPE 3UREA 2AHME 2VINA 1GI2A 1MTNB 3U28C 4CRAA 1GBDA 2QIQA 2ZGBH 3QGJA 4X8UH 1TRNA 4H4FA 5EODA 5AF9H 2P3TB 1J17T 1GJDB 3N7OA 4HFPB 1QBVH 3BTKE 2R9PA 3VXFH 4JZIA 5HM9A 1GJ5H 4MDSA 1TGCA 1K0HA 1LMWB 5TCCA 5L30H 3NKKA 3RMMH 2XTTB 1BTYA 3P92A 3RXMA 1NU9A 3RXVA 3DCLA 2Y5FA 2QXHA 3ZV9A 1CA8B 2XNIA 1GBKA 5HIYA 1OYTH 1O2ZA 2CK3D 3TIUA 1AUTC 1YCPH 1CA0B 2WV9A 1BT7A 4E7RG 1VCPA 4ABAA 3RU4T 1S6FA 4XOJA 1EOJA 1QL8A 3S9AA 3LU9B 2AS9A 1BOQA 2VIDA 2BQ7B 1QTFA 1N8OB 5A0AE 1MCVA 1T4VH 5DP8A 2OC8A 2XC0A 4AN7A 2G51A 2O8LA 3KCGH 1LCYA 4RT1A 2CGAA 3NRLA 2QA9E 1BITA 3MU5A 2VIQA 1V2NT 3AAUA 1O3AA 4NZLA 4DOQA 3OFND 3TU7H 1WUNH 2BM2A 2XBYA 1Q3XA 1RS0A 3N7DA 1HAGE 1OHHD 3LGWA 5JBAS 5AFYH 1VGCC 2ZU2A 3BTFE 2FX6A 1ZHMA 2A2QH 1TABE 1EAXA 3CENA 2B5TB 2PKSC 2Z7FE 1ETSH 5J4QA 1JRTA 1YPGH 4JK6A 3QTOH 1WU1A 2GCTC 1F5KU 8KME2 4KTSA 4XFQA 2A45B 1RTLA 1RTFB 1AVXA 1UVOA 1S6LA 1Y8TA 3GOVB 4AG1A 1D6RA 4B75A 4JYVH 1TLDA 2Y6TA 1V2QT 2RA3A 4I31A 1B0EA 3FO8D 3LPRA 4ACAA 1YCPK 4KGAA 2J5UA 4ISIH 4NSVA 1MTVA 1SB1H 1LTOA 1C1RA 2O8WA 2ZHWH 1CT2E 4X8VH 1SC8U 1Z8IB 1XXDA 3KQCA 5TJXA 4A92A 2OTVA 1GJ6A 3LH3A 3RXOA 1BTUA 2R3UA 3RC6A 1RTKA 3BG4C 5LGOA 3MU8A 4ZKSU 5E8EH 4DIHH 4JZFH 1BMNH 2ZDNA 2YNBA 4GHQA 1P10A 4AX9H 1WTHD 2A7JA 3A7VA 1O36A 1QCPA 2HVXA 2SGFE 1RXPA 2VIVA 4TYDA 2BY5X 4INLA 3O8CA 2ZG0H 1C5YB 4F55A 5AHGH 1EUFA 4ISOA 5JBTA 2NU3E 2ZFSA 2BQWB 4CREA 4Q7XA 1GBLA 1ZOMA 2A5AA 2G4TA 2WZQA 2M2AA 3P70B 3SN8A 1W10U 2JIZD 2W7SA 4ZHMU 2BDHA 2AMPA 1V6DA 1C2FA 2J9NA 1AKSA 2ASUB 5BRRE 2BLOA 2WINI 1AY6H 3H7OA 1LHFH 1UCYH 1WQSA 2J4IA 1A0HB 2ZU3A 1A0JA 1LVBA 1SL3A 2ZP0H 4WXVA 3IWMA 2PFEA 1DLEA 4NWLA 2HOBA 2BVSH 2PTCE 4LZ4B 3GY8A 1ZTJA 1ABIH 1DT2A 4OGYA 1AFEH 2O8MA 5FPTA 2Q6FA 1O39A 1LPGB 4XE4A 3T26A 1CU1A 2L6OA 2DE8A 1OKXA 4YM9A 2BD5A 4UFEH 4Y79A 4ZKNU 2R3YA 3K9XB 4MNYA 3UB0A 2OUAA 2SGEE 2FI3E 2W7UA 1GI3A 2CN0H 3GCTG 1XM1A 1LVYA 4FU7A 3HGNA 2P3UB 5T6FA 1BZXE 1GI9B 2DE9A 3GDUA 1OP8A 3NK8A 4RKOB 1RRKA 4A1XA 1Y3XA 5KEDA 5EXNA 4DY7B 4IMQA 2B7DH 2D1JA 4KTUA 1ZRBA 1XUIA 4AG2A 3Q77A 3OAAD 3ZYEA 2Y80A 3LKWA 1UCYK 1FAKH 1P03A 1O2MA 4DG4A 4WWYA 4LK4A 1KXDA 1TOMH 1VGCB 2ALVA 5HIZA 1ID5H 4K2YA 1FY1A 3SI3H 1HCGA 4O3TA 3AW1A 2PKSB 3RXCA 4DIIH 5F03A 1TA6A 1G3CA 3FZDA 2GCTB 1AFQC 7GCHF 2FWWA 5A8ZA 1DWBH 3AASA 4JYTA 3PWCA 2KCPA 2ZTZA 2LPRA 1Y5AT 1QBOA 3TH2H 1HNEE 1VJAU 4YESB 5E2PA 1C1NA 3W95A 1VITG 4INKA 4NIYA 2AIPA 4YOJA 1C4V2 3F0OA 1O30A 1P2IA 3SQEE 1SPJA 3SNDA 4Z6AH 1D3DB 4BAQB 1GI0A 1W7GH 1AD8H 1FIZA 3V7TA 4ABIA 3MTYA 1P05A 3EA8A 1WSSH 1BUIA 3EE0B 1SGEE 1KY9A 2PKAB 2J98A 3LIWA 4NZQA 3RXTA 2QXGA 3KF2A 2IPHA 2V35A 4MPWA 1GBJA 4YO9A 4X1SU 4BXSA 1BMMH 1GJ4H 2UUJB 3PM3A 5HXFA 5EU8A 1BCUH 2NU1E 1QGFA 2GKVE 5HMAA 2VIOA 3SNEA 3T62A 3DFJA 3HKJB 1ZYOA 1Y3UA 1GBTA 1O38A 1IQKA 3SBKA 2KCYA 1P57B 1OPHB 2EI7A 5FCRA 1BHXB 5H4IB 1NN6A 3RXDA 1C2HA 1O3PB 2ZFPH 4D76A 1C5SA 2JH6D 3IITA 1LPKB 4I8LA 1EOLA 1FY4A 1DWEH 3M61U 3M7TA 4F4OC 1UTLM 2BZAA 4X2YA 2FOMB 4BNRA 5EQSA 1HB0B 2UUKB 3BTHE 1OOKB 1DUEA 1VZQH 4Y10E 1GJ8B 1C1OA 1XUGA 3A89A 1WAYB 1F0RA 1GBBA 1QRZA 2Z9IA 4F49A 4ZHAA 1O2SA 5A0CA 1DM4B 5FHTA 2WV4A 2PUQH 3S7HB 4B2CA 4ZCNA 4OS1A 1TGTA 1C2IA 1JRSA 3ZVGA 4A5TS 2ZC9H 1YLNA 7KMEH 3UR9A 4O97A 4TT3D 4WMFA 2GV6A 1O2GH 1SQTA 3EAJA 1S0RA 1EX3A 8GCHG 1MKXH 2VIPA 8LPRA 1O3HA 3LC3A 4DT4A 1K1NA 1C5TA 2J34A 1M9UA 1NFXA 2GT8A 3TGIE 1YF4A 1Z1JA 5IDKA 3D65E 1OWJA 1G36A 1TNLA 2BD7A 2A7HA 3RM2H 1WXRA 1C2JA 3T25A 3SYJA 4ABFA 3F0PA 5EJLA 4CR9A 2ILNA 2TGTA 3MYWA 4X6MA 2ZCLP 1TAWA 3T2NA 3M5OA 3NUMA 3F9FA 4NIVA 2Y7XA 2CHAC 2QN5T 3NZIA 1E79D 1C1WH 1TWXB 1ZSJA 1AGJA 3UNQA 1NY22 3QGNB 2QF3A 3N7EA 3L6PA 4RI0A 1EP5A 5CHAC 1GBEA 3TJNA 5EG4A 4CRDA 1AUJA 1KDQB 1O34A 4SGAE 1ORFA 3ZZCA 5C5NA 1TX7A 2H5CA 1RFNA 2F9PA 2ZGJA 2ZF0H 1HIAA 1C5UA 1UVUH 1C1SA 2G81E 1GMCG 2OC1A 3BTDE 4X6NA 1C5OH 1FPCH 2PSYA 1DX5M 1HJAC 1AFQB 3SV6A 1MD8A 3I29A 1W0YH 3QX5H 2J97A 1MCTA 4E05H 4X6OA 1MKXK 1SGFA 4BAMB 5LH8A 1RGQA 2BXTH 3K6YA 3PB1E 1BTZA 2XWBI 5GWZA 1SGFG 3RMNH 1C4Y2 1UTQA 4R8TB 3ATLA 1FPHH 1EATA 2ANKH 3E3TA 3GCTF 1O5EH 4TSFD 3ZVEA 3MOCA 1TNKA 2FXRA 2V6NA 3RMOH 5GXPA 1GHAG 2G00A 1ZRKA 3PV2A 2QCYA 2BYAX 1G3BA 3LOXA 1Y5UT 1MD7A 1N6XA 2F4LA 1T8LA 2F9VA 1PPZA 2Q6GA 2PR3A 1G32B 3P95A 2JETC 1FAXA 2YNAA 4AYVB 2ZFTA 3SJOA 4NA7A 2ZQ1A 1O3OA 1XKAC 2VVVA 2QGRA 4RT0A 2V3MA 5GNDA 3UPEA 3E1XB 1A7SA 3U1IB 1PFXC 2VU8E 2VWMA 1C1UH 1Z6JH 1MTSA 3FP8E 3STIA 5C67A 4ZKOU 2YOLA 1A5IA 4AGKA 3GY3A 2WPMS 3K6ZA 5ABWA 3SUGA 2ZU4A 1WBGB 2BDGA 3TJUA 3BIUH 4Q2KA 2BD8A 3MNXA 1UVTH 1C2EA 4NFEA 3QK1A 1TQ0B 5FCKA 1CT0E 1JOUB 1P02A 1UJ1A 3F2FA 2G5NA 5C2ZA 5DO4H 1G3EA 1HAZB 1GVKB 2XWAA 1IQEA 1TE0A 2A4GA 5CDFE 1S81A 1JIMA 1U6QA 2JKHA 1SGYE 3LGIA 1WQVH 6GCHG 1GBFA 5BPEA 3S0NA 1AN1E 1GMHG 4Y8XA 1C5WB 3SNCA 3UUZA 1QHRB 1P8VC 1QL7A 3PLBA 2GJGA 2ZIQH 4IW4E 2Z9GA 3EA9A 4D9RA 1D3QB 1FLEE 1NFWA 1NZQH 1EFRD 4ABJA 1P2OA 4MNVA 1UTMA 3D62A 4ZMAH 1P01A 1QBNA 2Z9KA 3ZZ6A 3SJIA 1C1TA 1K1LA 1MBMA 2GD4B 4KKDA 3RXKA 3A84A 1YPHE 3BF6H 1GJ9B 3ZYDA 1TX6A 1K1PA 4B2BA 5LPFA 4BXWA 2CHAB 3OY5U 2SGAA 4JK5A 4RKJB 1DANH 1KLTA 2AMDA 2VWNA 2CF9H 5GPIB 2C90B 3M5NA 5DSFA 3A87A 3Q00A 1BTHH 2IOTA 2Z9JA 2QXIA 1O0DH 1C5RA 1SGPE 4KP0A 4Q4LA 5CHAB 3RXAA 1HAHH 1V2RT 2GTBA 3VB4A 1SVPA 1GGDC 3VFEA 3O8BA 1E38B 2ZDVH 1KLIH 2Q6DA 3HK6B 4GVUA 2ZDMA 2OD3B 2H6MA 2A2XH 4D7GA 4MQAA 3RU4D 1HJAB 1FZZA 3ODFA 5F6MA 2D2DA 2RFKC 2BD4A 1GI8B 2ZO3H 1K22H 5JBCS 1YLCA 9ESTA 1TA2A 1C5VA 5PTPA 4FOUC 4GLYA 1GBMA 3V3MA 8GCHF 3Q76A 1AHTH 2CJIA 1E35B 1MABB 2Z3DA 3OE7D 2WUCA 5AFZH 1ELTA 1J9CH 2BY9X 2GZ7A 1BBRH 1SR5C 3A7ZA 3L3TA 3P6ZB 2QXJA 5F8ZA 3V0XA 1UTNA 4LXBH 1TALA 1D4PB 1OS8A 3PMAB 1MU8B 2V7QD 1KXBA 4IC6A 1S0QA 5FX5A 4GCHG 1YC0A 1TBRH 3MMGA 1H8HD 1GHYH 3ZVDA 1PPFE 1UO6A 1TOCB 2BDBA 2ZU1A 3MHWU 3FVFB 1HV7A 1TPSA 4FUFA 5GJ4B 4AZ2B 2WPKS 1B5GH 2ZFFH 2WV5A 1XUFA 2JETB 2J92A 4NIXA 3GY6A 4Y7AA 5ESTE 1UK4A 1QZ8A 2R0KA 1NRNH 3SJKA 2XBXA 5L6NH 4ACBA 1TPOA 2WSSD 1C9PA 3M37A 2AYWA 1G37A 1DY8A 1ELVA 2XNDD 2H9EH 1H8DH 4IMZA 4I86A 1O35A 4THNH 5DPAA 3URDA 3BSQA 4FVDA 1GMCF 4X1NU 4UEHH 5C0TA 1IAUA 4I8JA 2W26A 3ESTA 1PPHE 4Z1MD 1DSUA 1O2TA 4M7GA 1FN6A 1W11U 1ZTKA 4ZUHA 1YWUA 4NFFA 1EPTC 1C5ZB 2V3HH 1XVMA 3LJJA 1QQUA 1OX1A 2CMYA 2PGQB 1P2NA 4H6SB 1COWD 1FV9A 2F9OA 3PTNA 3SO3A 4FUDA 1T31A 1TPAE 3QDZB 3FP7E 7ESTE 5F8TA 1ELFA 1QJ1B 1BBRK 2HALA 1DXWA 3OEHD 4UD9H 3UQVA 1GHWH 4AGJA 2G4UA 1O2XA 4ABBA 3MI4A 1O2NA 1P3CA 1MAXA 4Q63A 8ESTE 3DFLA 1HJ8A 1L1JA 2J94A 1TRMA 3Q3KA 1NFYA 1UCYE 2GZ8A 3FAOA 1S5SA 2Y5HA 1XX9A 3LGTA 3LT3A 2QV1A 1PYTD 1UVPA 1O2HA 1DOJA 1CHGA 5JBBS 1IHSH 1EJNA 4YLUA 1O3FA 1T32A 2Z3CA 2F9NA 4K8BA 4ZH8A 2JJ2D 4ABDA 2SGQE 1BJUA 2NU4E 2W3IA 1F7ZA 3HATH 4UFGH 4FUEA 3PMJA 4AB9A 2BDIA 4WXIA 2KFWA 1O2YA 4X1RU 3SOSA 3NPSA 5JPMH 2SNVA 3UTUH 1SLVB 2QF0A 1ETRH 2ZU5A 1IQJA 4A6LA 1V2WT 4CBNA 2WYJA 2SGDE 1P12E 1P9SA 4NSYA 1KTTB 1HAVA 3QZQA 4DURA 1GGDB 1O3NA 2FZZA 1V2ST 2XC5A 1TBZH 5F8XA 4BAOB 1O3CA 1C1VH 1RIWB 2BD2A 2WUBA 4INHA 1MZDA 5JYIA 3ZV8A 1NO9H 4Q80A 3GCNA 3ZVCA 3SU2A 4IGDA 4BAHB 6GCHF 1IQGA 1TB6H 1GMHF 3BEIB 1MTWA 1XMNB 4CHAB 3DSGA 5FPSA 3RP2A 2ZGXH 3VB7A 2YMSD 2PUXB 5EPYA 4A1VA 3RU4E 1GL0E 1DDJA 1SOTA 3A7WA 3ZVBA 2FOGA 1TNHA 3C27B 3MU0A 2UWOA 3BTWE 3TH3H 5EJ1A 1XVOA 4FUGA 2C8YB 4ISNA 2FESH 1O2JA 1SFIA 1ZJKA 1QRWA 3SV8A 2WPDD 1EAUA 3RXRA 4I8GA 1AO5A 3ZZ4A 3PYHA 3EDXB 3TNSA 1OP0A 1ZTLA 1ZMJA 2WPIS 3ZIAD 5K7RA 2CXVA 5TCAA 4H6TA 5EOKA 2HVYB 3E6PH 5FX6A 3A8BA 4TPIZ 2W6ID 3UFAA 1QA0A 5JB8S 3UQOA 1TMBH 1FXYA 1SGIB 5SGAE 3RXLA 5EQQA 3URCA 3PV5A 1L1GA 1GDNA 3FP6E 1Y5BT 1GHBF 3AVZA 1ABJH 1G2LA 3PLKA 1NRRH 1THSH 2IPQX 4XBBA 1AB9B 1EPTB 2EI6A 2BY8X 1JXPA 2XBWA 1OWKA 1TMUH 3ELAH 1CT4E 1Z1IA 3RLWH 1GWAA 3S69A 1YLDA 3RMLH 1S83A 1SLXB 1C5XB 2EY4C 2AMQA 1S85A 1C4U2 2D26C 4DVAU 1PQAA 3HK3B 2F9BH 3GYMA 4ZXXH 3RXBA 3O8RA 1O2VA 3SNAA 1GI1A 4U30A 1YPMH 4X2WA 5FBIA 4JZEH 2XW9A 1MMJN 3SZNA 1ZMLA 1D3PB 4GCHF 2EI8A 1W2KH 3M3TA 4SGBE 1T8OA 1LVMA 5HKKD 3Q3XA 3CP7A 2XCNA 2HPQH 1G30B 3M35A 2C4FH 4D9QA 1TNGA 4X2XA 1DFPA 4K1EA 4O03A 1CBWB 2GP9B 3GYLB 3HGPA 2OP9A 5JDUB 2UWLA 3K65B 3MO9A 3DT0H 4Y6DA 1AKSB 1V2VT 1ANCA 1KXAA 2KAIA 3LJOA 1UMAH 3UWJH 2J38A 1J8AA 5DKMA 2BVRH 1AWHB 1V2TT 1GJBB 2GVFA 2A4OA 3BG8A 2Y7ZA 1C5NH 4FUBA 3ATKA 2ZKSA 4TWYA 2ZNKH 2ZGHA 1XUKA 1GHXH 1OWHA 2BMGB 1SGCA 5C3NA 4BANB 3PO1C 1ELCA 1F5RA 2VVCA 3RC4A 1AZ8A 5B6OA 2TPIZ 2ZFQH 1FI8A 1NS3A 1ACBE 1O2KA 1EB2A 1SFQB 4MVNA 1IQNA 5I46H 4WJG2 1SGQE 1O2OA 4CBOA 1LHDH 5DJ7A 3KQBA 2NU0E 3RXHA 1P2MA 1ELAA 3M36A 5EW2H 3F2GA 2ZHEH 3MFJA 4I8KA 4KTCA 3WWFA 4CRFA 1ZHPA 5KECA 1SGRE 3ZZ3A 1P9UA 3SU3A 1Z7KA 2H9HA 4NA8A 3OY6U 1NFUA 3ENSB 5E0GA 1QFKH 4ASHA 1DS2E 4ZROA 2P3FH 2C8WB 1RD3B 2RDLA 1HYLA 3SUEA 2BY6X 1ANEA 4K5ZA 4DW2U 2C8XB 2K8IA 4OS7A 4B2AA 1BRAA 3QO6A 1HPGA 3F9EA 2RDEA 1WDIA 1EXFA 3DSPA 4Y7BA 5A2MH 4AFUA 4WH6A 1G9IE 1GBIA 1J15A 1ZSLA 3PTBA 2OXSA 2H5DA 4H42U 3U8OH 2CV3A 1EP6A 1H8IH 2VWOA 4MNWA 2ODQA 3E0PB 2HNTE 4R0IA 2HPPH 4MNXA 2ZCHP 1XXFA 4AOQA 3SU6A 1C1QA 1PQ8A 3BEFB 4ZKRU 4UFDH 1EASA 1DPOA 2ZTXA 1K1OA 2FEQH 1H9HE 4WH8A 4AFSA 1MU6B 3RXUA 1TPPA 1K2I1 3AAVA 4HZHA 1HAXB 4K60A 1QA7A 2RA0A 1BIOA 1FY8E 1ZSKA 1ELGA 2FOBA 3TPIZ 1NRQH 5B6LA 1ZMNA 3FFGA 3RXFA 1Z71A 2AIQA 4HGCA 1A1RA 3JZ1B 1PQ5A 2ZWLH 2P8OC 4A1TA 1LVOA 2ANWA 3A86A 1TFXA 2WPJS 3C1KA 2OC0A 1C2GA 1O5CB 1XUHA 2UWPA 3ATWA 4GUXA 5AVDA 1TBQH 1L2EA 1TGBA 4IN1A 4IS5A 1KYNA 5DP6A 2OCVB 3P17H 1GHVH 1T8NA 3W94A 2OQUA 2ANMH 1PQ7A 1WV7H 4U32A 1P3EA 3F2HA 3T27A 3PRBA 1V2PT 1P06A 1C1MA 3E91A 4KELA 3EQ0H 1GCTC 1A0LA 1HAOH 1DXPA 1X7AC 3SU0A 1TNJA 4FUIA 2ZCKP 5L2ZH 4YZUA 2ZGCA 1GCDA 3VB6A 3NCLA 2DUCA 1SMFE 2F83A 3OSYA 4E7NA 3FZZA 1RJXB 1QR3E 3QUMP 1WYKA 1HUTH 1E0FD 1LHEH 1SBWA 1H1BA 3GDSA 1CHOG 3JZ2B 2XBVA 2BOHB 2TGDA 3QN7A 1AVWA 1Y3YA 1BB0B 5T6DA 3OTPA 3FANA 3SGBE 3M3VA 1BDAA 1V2UT 4JZ1A 3U98H 1FY5A 1EZUC 1FUJA 2PTNA 1SGNE 3A81A 1YPHC 3STJA 1PPBH 3PO1B 3PMHB 1YPEH 3A8DA 1A61H 1HXEH 3SU1A 1TGSZ 5CE1A 1D9IA 2FX4A 1YP9A 3EA7A 4RSPA 4Y11E 2A4RA 4U2WA 1AWFH 3KEEA 5HGGA 1EJAA 4FVBA 5F53A 1GJCB 5A09A 2IJOB 5EPNA 3M7UA 1JMOH 1VITF 2JDID 4O3UA 3M7QA 2ODYB 1GI5A 1L0ZA 1C5LH 2FLRH 4IC5A 1O33A 5DK1A 1SG8B 1ZLRA 3ZZBA 3TK6A 4TPYA 1O2RA 3WWBA 1KXCA 2NU2E 2TIOA 5FAHA 3E16B 3UY9A 1TGNA 1ZPZA 2KZ4A 2Z9LA 4ABEA 2Z6BD 5FL7D 2PSXA 1CSOE 4OS2A 1E34B 4WMEA 1D3TB 1YPLH 2BX3A 4Y76A 4Y8YA 1NPMA 2FS9A 4BTUB 3F9HA 3U8TH 1LKBA 2ZFRH 3OX7U 4O9VA 2W6JD 1BMLA 3UNRA 5A0BA 3RXSA 3UOPA 1BBRE 3HPTB 2GV7A 1F0TA 3GY4A 3B23B 3VB3A 1FJSA 1HIAB 1K1MA 2B0FA 2QY0B 3F68H 4YOGA 3BN9A 4FU9A 2P59A 1P11E 3TGKE 4TY7A 3A7YA 3W1EA 2F3CE 2P94A 2ANYA 2SFAA 1EZSC 3ODDA 4XBDA 3WW7A 4HI3A 5K0HA 5IK2D 1K9OE 1NU7B 3Q3YA 2QC2A 1IHTH 2R2WU 1AVGH 1BMAA 3DHKH 2TGPZ 1N1LA 1UHBB 2ODPA 4XBCA 4OS6A 3TLOA 4AORA 1XKBC 4CR5A 2P8OB 1YPKH 1F92A 1FX0B 1KIGH 1GBAA 5G4BA 2R2MB 2ZDAH 6CHAC 1RIWC 1HAIH 3A8AA 4NA9H 3A83A 3GISB 3NXPA 2ESTE 1A5HA 3ZZ9A 4B6FA 1BTWA 1EZXC 2HNTF 2VJ1A 4FUCA 3SORA 4DGJA 4CHAC 1J14A 3MH5A 1C5PA 4Q7YA 1O5AB 4CRGA 1YM0A 3A7TA 2FO9A 1GCTB 1HDTH 3SHCH 5GCHG 3N99A 1DWCH 3D49H 2CF8H 2QYIA 3MWIU 2FIRH 1FONA 1A2CH 3ATIA 1C2MA 1HXFH 2FS8A 5T6GA 1GL1A 3UNSA 3SJ9A 5C20A 1H9IE 1UTKA 1J16A 1MQ5A 1CGJE 1SLUB 2STAE 7GCHG 4AYYB 5LPEA 3LH1A 2VGCC 4JZDH 3ZZDA 2ZECA 3DA9B 4B1TA 4ABGA 1HFDA 5DG6A 1V2KT 2QF5A 1UK3A 3ZZ8A 2XRCA 1K21H 4WMDA 2PHBA 5EJZA 1ANBA 1SHHB 2ZZUH 5EQRA 5GIBA 1DSTA 3A88A 4UFFH 2VIWA 2STBE 2L74A 1C1PA 4Z0KA 3KNXA 1W0KD 1ELDE 2OBQA 1NESE 2OQ5A 3RM0H 1VCWA 4PROA 4ZHLU 2JH0D 1AB9C 1PPEE 2WHXA 1OWIA 3SV9A 4YOIA 1O2LA 1FY3A 1QRXA 2XC4A 2AGGX 2O9QA 3GS9A 1V2LT 2D8WA 2LP6A 4AC9A 2BOKA 1ZGIA 1B0FA 1PJPA 3LGUA 1Q2WA 3PMBB 3FKSD 1QL9A 1K1JA 2ZEBA 1MKWH 3LGVA 4AFZA 1FQ3A 4YXWD 2FI4E 3MH6A 4Y71A 5DP4A 1EQ9A 4Y0ZE 1ZHRA 1E37B 4K1TA 1P2KA 1O3EA 4XD7D 3QTVH 2THFB 3GCHB 5A8YA 1ANDA 1IQMA 1GHAF 1SGDE 5FPYA 1SI5H 1O3KA 2B9LA 1O2QA 1QJ7B 1DY9A 1GBHA 2ALPA 4MTBA 1TMTH 3BIVH 1CHOF 2ZHQH 1H8ED 4K3JA 4TY6A 4XSKU 1ZPCA 2A1DB 3FOAA 2OBOA 4AFQA 1BQYA 5T3HA 2K1QA 1CBWC 3ZZ7A 2AH4X 2C3SA 4JMYA 3U8RH 2IJD1 3V13A 3VXEH 5T1VA 1DVAH 3M5LA 1CGHA 1EPTA 1WTGH 1EZQA 2VH6A 2A4QA 2Y5GA 3BTME 3PWBA 2FOAA 3VEQB 1INCA 1TQ7B 2J2UA 4D7FA 5EXLA 1GDQA 3RXQA 1O5FH 3V12A 3RXIA 1GI6A 1JBUH 2LELA 5EW1H 1O2UA 2FOEA 4YT6H 2BD3A 2QAAA 1QIXB 2FI5E 3LGYA 1QY6A 1YKTA 1IQIA 4IBLH 4X1QU 1AMHA 3M5MA 3F9GA 1UTPA 1E36B 2P16A 2VBCA 1ZZZA 1QURH 1OWDA 1MKWK 4X8TH 1NC6A 6CHAB 1ARCA 1S82A 1L4DA 2NWNA 1C2DA 1VCQA 1W7XH 3VGCB 4MLFB 3SU5A 1GI4A 1JWTA 2ZDLA 1ZPBA 2BTCE 3SZEA 3A82A 4GHTA 2VNTA 1N6YA 1D6WA 1A3EH 2G55A 1Y59T 2OC7A 2P95A 1O2WA 4I8HA 2PKAA 3GCOA 1BMFD 1F0SA 4FUJA 3CS7A 4OGXA 2AGEX 2SGPE 3UIRA 2Q1JA 5J4SA 4HG6A 3G01A 1VJ9U 1W13U 1BRCE 2PW8H 1CVWH 4J1YA 1NBME 5DN6D 2BLVA 1Y3WA 2V0BA 1TX8A 1H9LB 1F5LA 1MUEB 1ELEE 3S9BA 1GPZA 5CMXH 1Y3VA 2OINA 2PP6A 1IQLA 1QB9A 2GZ9A 2BZ6H 2O8UA 2A31A 3E0NB 3SW2B 2B8OH 1THRH 4HTCH 4ESTE 4NCYA 2BDAA 2I6QA 1SKYE 2VGCB 3MO3A 1HLTH 1O5BB 2JJ1D 4GSOA 3TITA 6LPRA 1NRSH 2F9UA 5C1UA 2ZDKA 2HRVA 4X1PU 2P93A 2EQNA 2XXLA 1ZGVA 5DP3A 1ELBA 1HJ9A 4Y8ZA 2FOHA 3VPKA 1AI8H 2KR7A 3K2UA 1KLJH 1PYTC 2UUYA 3P8GA 4NWKA 2BHGA 4XRNA 2BVXH 4XDEA 4CRCA 1ESTA 2H9TH 2ZQ2A 1GI7B 2FOCA 3MO6A 1H4WA 6ESTA 1ESBA 5C0UA 2RG3A 3KYFA 3OTJE 3QWCH 1KXFA 4GPGA 1TNIA 1WCZA 3P8NA 3CS0A 2F91A 1EJMA 3RDZA 2LNCA 3ZZAA 2A5KA 3RXGA 3LDXH 3SV2H 3KHVA 2A0QB 2H1UA 2FMJA 2IN2A 1CGIE 2ZTYA 3DD2H 5ESBA 2KM0A 1LPZB 1O3LA 2FYQA 1UTOA 4IN2A 1OSSA 1QB6A 2KCAA 2V3OH 4FETA 2BY7X 3ATMA 3HKIB 4OM9A 5GCHF 3S7KB 2GMTC 3A80A 3H5CB 1T8MA 2QE7D 1W0ZU 2FOFA 3SJ8A 4F48B 1FDPA 1YPJH 1O31A 5ETXA 3U69H 4B6EA 4JCNA 1W0JD 1O3GA 3F3BA 2FLBH 1T4UH 3BEUA 4K69A 1GVLA 1GG6C 3TJVA 1KTSB 3SUDA 3ZVFA 4RN6A 4GAWA 5FBEA 1MZAA 1DE7H 1HAVB 4B76A 1B7XB 1NT1A 4DCDA 1ZR0A 4ZAEA 2YMSC 3DSOA 4FXGH 4CH2B 1ARBA 1O3JA 3OYPA 1KDQA 1DICA 3QZRA 1CE5A 2VVUA 3F6UH 3R3GB 1T7CA 3UAIC 3MH4A 2GT7A 3RXJA 1AQ7A 3DUXH 5JB9S 2OK5A 4MPVA 1V2JT 2HNTC 1THPB 3AW0A 3BG4B 3KQEA 5IYTA 2EEKA 4D8NA 3TK5A 1YBWA 2PWXA 1O3IA 2BB4A 1C9TA 5C1YA 2BXUH 1HGTH 4X2VA 3LONA 2RCEA 1QJ6B 4TWWA 3I78A 3H7TA 1HBTH 1W12U 1HAYB 5L2YH 3MU1A 1HRTH 1MTUA 1Z8GA 5DP5A 3U9AH 4YTAA 4BOHA 1FNIA 2VH0A 3RXEA 3SNBA 2TRMA 4B74A 5I25A 1EAWA 2M5TA 1DWDH 1E1RD 1GJAB 2AFQB 2GGVB 4UONA 1GMDG 1V2OT 5C1XA 1BTPA 1Z8JB 1G2MA 3UOUA 3E8LA 1GHZA 2BX4A 1PPGE 4YLQH 4K8YA 2UUFB 4BAKB 1IQHA 2GCHG 1LQEA 2KX4A 2AEIH 2PGBB 3SQHE 4E06H 3L33A 1P2QA 3B8JA 3CNRA 2WPLS 1A46H 4CH8B 2GX4A 5CHBA 2OLGA 4MG3A 1S6HA 4I33A 4JYUH 2Z94A 3TK9A 2BDYA 3PV4A 3GICB 1V3XA 5C17A 4X6PA 3OEED 3R0FA 3T28A 1C5QA 3A7XA 1UVSH 2ZPQA 1SHYA 2XYAA 5C5OA 2FM2A 2O8TA 3PLPA 1VITH 2FP7B 5C94A 1DUAA 1O3BA 1SQRA 1IQFA 1W8BH 3ITIA 1F0UA 1CO7E 2ULLA 3TNTA 4NGAH 3O8DA 2I6SA 1V2MT 3IG6B 3KQ5A 1P0SH 2ZHFH 4BTTB 2FODA 1FIWA 1SOZA 3QLPH 3EE7A 1SQAA 5DP9A 3BTTE 1OXGA 4B71A 4X8SH 1SSXA 5DGJA 1GBCA 5FXLA 3BTEE 4WF8A 1F2SE 3H09A 2C8ZB 2Y82A 3LC5A 3GY2A 1QB1A 2BLQA 2J98B 1ESAA 1P04A 2Y81A 4CRBA 3S9CA 3SI4H 2EC9H 1NROH 2J95A 5E0HA 2A7CA 2VB0A 1SGTA 2GMTB 3OU0A 3TH4H 3SV7A 2KAIB 3VB5A 1MAYA 3MNSA 2FTMA 2K0QA 1YY3A 2R0LA 1UK2A 1BJVA 4VGCC 1MBQA 4LOYH 1LQDB 4MPXA 4OS4A 3FN8A 4X0WU 3MH7A 3VG8A 3KL6A 3EYDA 2ZI2H 1MTNC 1OP2A 3MNBA 1GG6B 2G5VA 1BHXF 2KCOA 1S84A 3UWIA 1TRYA 1O2IA 1Z8RA 1ZJDA 2G52A 1CQQA 3RUOA 4I32A 1L4ZA 2YMSB 3KGPA 3B9FH 4ZXYH 2W3KA 1UHBA 3PROA 2QF4A 2A32A 2BD9A 1FN8A 1YGCH 1KMHB 1LDTT 1QQ4A 1MQ6A 3T29A 1O5DH 1K1IA 3SU4A 2BQ6B 2ZHDA 4ASUD 2W5EA 1JIRA 5E2OA 3GY7A 1LKAA 9LPRA 5EIYA 2HWLB 2XOKD 1AE8H 4M9FA 2AERH 4QT8C 4A7IB 2C93B 1CA0C 2ZPSA 1O37A 3T5FH 1XUJA 2TBSA 3NWUA 2EA3A 1W3CA 2XCFA 4DJZB 2FTLE 1GDUA 1SQOA 4B73A 2SNWA 1N8OC 2A5IA 1TYNA 2BLWA 4UDWH 1LHGH 4WY3A 3EGKH 1PPCE 5HM2A 1AIXH 1O2PA 3U1JB 2HLDD 4FU8A 1Z6EA 1C5MD 4UE7H 1C2LA 1EKBB 1NRPH 3BTQE 4U01A 4Y0YE 3TJOA 2AGIX 4BTIB 1BA8B 1TIOA 1TONA 1FMGA 3ZVAA 1E1QD 4ISHH 1BRUP 1IOEA 3P8FA 5EXMA 3GDVA 3A85A 3RXPA 4NIWA 3F1SB
chains in the Genus database with same CATH topology
3I77A 3TVJB 1DLKB 2HGTH 5LPRA 1YCPM 3GCHC 4YT7H 2PLXA 5A8XA 1EB1H 5E0JA 1A3BH 3SUFA 5EGMA 3UR6A 1NTPA 3E90B 1A5GH 3RLYH 3KIDU 3SGAE 3KN2A 1DITH 1GVZA 5HYOA 1G3DA 1AZZA 1KXEA 2GDEH 2JH5D 4ISLA 1SLWB 1AU8A 1C2KA 1OWEA 2GDDA 1O3MA 1NM6A 1L1NA 2WYGA 2ZA5A 3BTGE 1K28D 4DT7B 1MH0A 2VWLA 4LZ1H 5DP7A 1BRBE 2BDCA 3MU4A 2FPZA 1P2JA 3P8OA 2TGAA 2H2ZA 3ZZ5A 1KSNA 1O5GH 2Z3EA 4NG9H 1LHCH 1O32A 4Q7ZA 2WPHS 1LO6A 3A8CA 4AB8A 1O3DA 3RC5A 2FYRA 3SHAH 2FDAA 1EAIA 1YYY1 1W14U 4K1SA 1Q31A 3KQDA 1A4WH 4FUHA 3VGCC 3SGQE 1GMDF 1BTXA 1VR1H 1QNJA 4J2YB 2G8TA 3BV9B 4ABHA 1UTJA 1WOFA 4I7YH 2PV9B 1HAPH 3WY8A 2GCHF 1GJ7B 2ZPRA 2HLCA 1ETTH 1AE5A 4MPUA 3TGJE 3D23A 1GHBG 1OYQA 1P09A 5GDSH 7LPRA 3M3SA 3MNCA 4VGCB 3GY5A 4OS5A 4WVPE 3UREA 2VINA 1GI2A 1MTNB 4CRAA 1GBDA 2QIQA 2ZGBH 3QGJA 4X8UH 1TRNA 4H4FA 5EODA 5AF9H 2P3TB 1J17T 1GJDB 3N7OA 4HFPB 1QBVH 3BTKE 2R9PA 3VXFH 4JZIA 5HM9A 1GJ5H 4MDSA 1TGCA 1LMWB 5TCCA 5L30H 3NKKA 3RMMH 2XTTB 1BTYA 3P92A 3RXMA 1NU9A 3RXVA 2Y5FA 2QXHA 3ZV9A 1CA8B 2XNIA 1GBKA 1OYTH 1O2ZA 3TIUA 1AUTC 1YCPH 1CA0B 1BT7A 4E7RG 1VCPA 4ABAA 3RU4T 1S6FA 4XOJA 1EOJA 1QL8A 3S9AA 3LU9B 2AS9A 1BOQA 2VIDA 2BQ7B 1QTFA 1N8OB 5A0AE 1MCVA 1T4VH 5DP8A 2OC8A 2XC0A 4AN7A 2G51A 2O8LA 3KCGH 1LCYA 2CGAA 2QA9E 1BITA 3MU5A 2VIQA 1V2NT 3AAUA 1O3AA 4NZLA 4DOQA 3TU7H 1WUNH 2BM2A 2XBYA 1Q3XA 1RS0A 1HAGE 3LGWA 5JBAS 5AFYH 1VGCC 2ZU2A 3BTFE 2FX6A 1ZHMA 2A2QH 1TABE 1EAXA 3CENA 2B5TB 2PKSC 2Z7FE 1ETSH 5J4QA 1JRTA 1YPGH 4JK6A 3QTOH 1WU1A 2GCTC 1F5KU 8KME2 4KTSA 4XFQA 2A45B 1RTLA 1RTFB 1AVXA 1UVOA 1Y8TA 3GOVB 4AG1A 1D6RA 4B75A 4JYVH 1TLDA 2Y6TA 1V2QT 2RA3A 4I31A 1B0EA 3LPRA 1YCPK 4KGAA 4ISIH 4NSVA 1MTVA 1SB1H 1LTOA 1C1RA 2O8WA 2ZHWH 1CT2E 4X8VH 1SC8U 1Z8IB 1XXDA 3KQCA 5TJXA 4A92A 2OTVA 1GJ6A 3LH3A 3RXOA 1BTUA 2R3UA 3RC6A 1RTKA 3BG4C 5LGOA 3MU8A 4ZKSU 5E8EH 4DIHH 4JZFH 1BMNH 2ZDNA 2YNBA 4GHQA 1P10A 4AX9H 1WTHD 2A7JA 3A7VA 1O36A 1QCPA 2HVXA 2SGFE 1RXPA 2VIVA 4TYDA 2BY5X 4INLA 3O8CA 2ZG0H 1C5YB 5AHGH 1EUFA 4ISOA 5JBTA 2NU3E 2ZFSA 2BQWB 4CREA 4Q7XA 1GBLA 1ZOMA 2A5AA 2G4TA 3P70B 3SN8A 1W10U 2W7SA 4ZHMU 2BDHA 2AMPA 1V6DA 1C2FA 2J9NA 1AKSA 2ASUB 5BRRE 2BLOA 2WINI 1AY6H 3H7OA 1LHFH 1UCYH 1WQSA 2J4IA 1A0HB 2ZU3A 1A0JA 1LVBA 1SL3A 2ZP0H 4WXVA 3IWMA 2PFEA 1DLEA 4NWLA 2HOBA 2BVSH 2PTCE 4LZ4B 3GY8A 1ZTJA 1ABIH 1DT2A 4OGYA 1AFEH 2O8MA 5FPTA 2Q6FA 1O39A 1LPGB 4XE4A 3T26A 1CU1A 2DE8A 1OKXA 4YM9A 2BD5A 4UFEH 4Y79A 4ZKNU 2R3YA 3K9XB 4MNYA 2OUAA 2SGEE 2FI3E 2W7UA 1GI3A 2CN0H 3GCTG 1XM1A 1LVYA 4FU7A 3HGNA 2P3UB 5T6FA 1BZXE 1GI9B 2DE9A 3GDUA 1OP8A 3NK8A 4RKOB 1RRKA 4A1XA 1Y3XA 5EXNA 4DY7B 4IMQA 2B7DH 2D1JA 4KTUA 1ZRBA 1XUIA 4AG2A 3Q77A 3ZYEA 2Y80A 3LKWA 1UCYK 1FAKH 1P03A 1O2MA 4DG4A 4WWYA 4LK4A 1KXDA 1TOMH 1VGCB 2ALVA 1ID5H 4K2YA 1FY1A 3SI3H 1HCGA 4O3TA 3AW1A 2PKSB 3RXCA 4DIIH 5F03A 1TA6A 1G3CA 3FZDA 2GCTB 1AFQC 7GCHF 2FWWA 5A8ZA 1DWBH 3AASA 4JYTA 3PWCA 2ZTZA 2LPRA 1Y5AT 1QBOA 3TH2H 1HNEE 1VJAU 4YESB 5E2PA 1C1NA 3W95A 1VITG 4INKA 4NIYA 2AIPA 4YOJA 1C4V2 1O30A 1P2IA 3SQEE 1SPJA 3SNDA 4Z6AH 1D3DB 4BAQB 1GI0A 1W7GH 1AD8H 1FIZA 3V7TA 4ABIA 3MTYA 1P05A 3EA8A 1WSSH 1BUIA 3EE0B 1SGEE 1KY9A 2PKAB 3LIWA 3RXTA 4NZQA 2QXGA 3KF2A 2IPHA 2V35A 4MPWA 1GBJA 4YO9A 4X1SU 4BXSA 1BMMH 1GJ4H 2UUJB 3PM3A 5HXFA 5EU8A 1BCUH 2NU1E 1QGFA 2GKVE 5HMAA 2VIOA 3SNEA 3T62A 3DFJA 3HKJB 1ZYOA 1Y3UA 1GBTA 1O38A 1IQKA 3SBKA 1P57B 1OPHB 2EI7A 5FCRA 1BHXB 5H4IB 1NN6A 3RXDA 1C2HA 1O3PB 2ZFPH 4D76A 1C5SA 2JH6D 3IITA 1LPKB 4I8LA 1EOLA 1FY4A 1DWEH 3M61U 3M7TA 4F4OC 1UTLM 2BZAA 4X2YA 2FOMB 4BNRA 5EQSA 1HB0B 2UUKB 3BTHE 1OOKB 1DUEA 1VZQH 4Y10E 1GJ8B 1C1OA 1XUGA 3A89A 1WAYB 1F0RA 1GBBA 1QRZA 2Z9IA 4F49A 4ZHAA 1O2SA 5A0CA 1DM4B 5FHTA 2WV4A 2PUQH 3S7HB 4B2CA 4OS1A 1TGTA 1C2IA 1JRSA 3ZVGA 4A5TS 2ZC9H 7KMEH 3UR9A 4O97A 4WMFA 2GV6A 1O2GH 1SQTA 3EAJA 1S0RA 1EX3A 8GCHG 1MKXH 2VIPA 8LPRA 1O3HA 3LC3A 1K1NA 1C5TA 2J34A 1M9UA 1NFXA 2GT8A 3TGIE 1YF4A 1Z1JA 5IDKA 3D65E 1OWJA 1G36A 1TNLA 2BD7A 2A7HA 3RM2H 1C2JA 3T25A 4ABFA 4CR9A 2ILNA 2TGTA 3MYWA 4X6MA 2ZCLP 1TAWA 3T2NA 3M5OA 3NUMA 3F9FA 4NIVA 2Y7XA 2CHAC 2QN5T 3NZIA 1C1WH 1TWXB 1ZSJA 1AGJA 3UNQA 1NY22 3QGNB 2QF3A 3L6PA 1EP5A 5CHAC 1GBEA 3TJNA 5EG4A 4CRDA 1AUJA 1KDQB 1O34A 4SGAE 1ORFA 3ZZCA 5C5NA 1TX7A 2H5CA 1RFNA 2F9PA 2ZGJA 2ZF0H 1HIAA 1C5UA 1UVUH 1C1SA 2G81E 1GMCG 2OC1A 3BTDE 4X6NA 1C5OH 1FPCH 2PSYA 1DX5M 1HJAC 1AFQB 3SV6A 1MD8A 3I29A 1W0YH 3QX5H 1MCTA 4E05H 4X6OA 1MKXK 1SGFA 4BAMB 5LH8A 1RGQA 2BXTH 3K6YA 3PB1E 1BTZA 2XWBI 5GWZA 1SGFG 3RMNH 1C4Y2 1UTQA 4R8TB 3ATLA 1FPHH 1EATA 2ANKH 3E3TA 3GCTF 1O5EH 3ZVEA 3MOCA 1TNKA 2FXRA 2V6NA 3RMOH 5GXPA 1GHAG 2G00A 1ZRKA 2QCYA 2BYAX 1G3BA 3LOXA 1Y5UT 1MD7A 1N6XA 1T8LA 2F9VA 1PPZA 2Q6GA 2PR3A 1G32B 3P95A 2JETC 1FAXA 2YNAA 4AYVB 2ZFTA 3SJOA 4NA7A 2ZQ1A 1O3OA 1XKAC 2VVVA 2QGRA 3UPEA 3E1XB 1A7SA 3U1IB 1PFXC 2VU8E 2VWMA 1C1UH 1Z6JH 1MTSA 3FP8E 3STIA 5C67A 4ZKOU 2YOLA 1A5IA 4AGKA 3GY3A 2WPMS 3K6ZA 5ABWA 3SUGA 2ZU4A 1WBGB 2BDGA 3TJUA 3BIUH 4Q2KA 2BD8A 3MNXA 1UVTH 1C2EA 4NFEA 3QK1A 1TQ0B 5FCKA 1CT0E 1JOUB 1P02A 1UJ1A 2G5NA 5C2ZA 5DO4H 1G3EA 1HAZB 1GVKB 2XWAA 1IQEA 1TE0A 2A4GA 1S81A 1JIMA 1U6QA 2JKHA 1SGYE 3LGIA 1WQVH 6GCHG 1GBFA 5BPEA 3S0NA 1AN1E 1GMHG 4Y8XA 1C5WB 3SNCA 3UUZA 1QHRB 1P8VC 1QL7A 3PLBA 2ZIQH 4IW4E 2Z9GA 3EA9A 4D9RA 1D3QB 1FLEE 1NFWA 1NZQH 4ABJA 1P2OA 4MNVA 1UTMA 3D62A 4ZMAH 1P01A 1QBNA 2Z9KA 3ZZ6A 3SJIA 1C1TA 1K1LA 1MBMA 2GD4B 4KKDA 3RXKA 3A84A 1YPHE 3BF6H 1GJ9B 3ZYDA 1TX6A 1K1PA 4B2BA 5LPFA 4BXWA 2CHAB 3OY5U 2SGAA 4JK5A 4RKJB 1DANH 1KLTA 2AMDA 2VWNA 2CF9H 5GPIB 2C90B 3M5NA 3A87A 3Q00A 1BTHH 2IOTA 2Z9JA 2QXIA 1O0DH 1C5RA 1SGPE 4KP0A 5CHAB 3RXAA 1HAHH 1V2RT 2GTBA 3VB4A 1SVPA 1GGDC 3VFEA 3O8BA 1E38B 2ZDVH 1KLIH 2Q6DA 3HK6B 4GVUA 2ZDMA 2OD3B 2H6MA 2A2XH 4D7GA 4MQAA 3RU4D 1HJAB 1FZZA 3ODFA 5F6MA 2D2DA 2BD4A 1GI8B 2ZO3H 1K22H 5JBCS 1YLCA 9ESTA 1TA2A 1C5VA 5PTPA 4GLYA 1GBMA 3V3MA 8GCHF 3Q76A 1AHTH 2CJIA 1E35B 2Z3DA 2WUCA 5AFZH 1ELTA 1J9CH 2BY9X 2GZ7A 1BBRH 1SR5C 3A7ZA 3L3TA 3P6ZB 2QXJA 5F8ZA 3V0XA 1UTNA 4LXBH 1TALA 1D4PB 1OS8A 3PMAB 1MU8B 1KXBA 4IC6A 1S0QA 5FX5A 4GCHG 1YC0A 1TBRH 3MMGA 1GHYH 3ZVDA 1PPFE 1UO6A 1TOCB 2BDBA 2ZU1A 3MHWU 3FVFB 1HV7A 1TPSA 4FUFA 5GJ4B 4AZ2B 2WPKS 1B5GH 2ZFFH 2WV5A 1XUFA 2JETB 2J92A 4NIXA 3GY6A 4Y7AA 5ESTE 1UK4A 2R0KA 1NRNH 3SJKA 2XBXA 5L6NH 1TPOA 1C9PA 3M37A 2AYWA 1G37A 1DY8A 1ELVA 2H9EH 1H8DH 4IMZA 4THNH 1O35A 5DPAA 3URDA 3BSQA 4FVDA 1GMCF 4X1NU 4UEHH 1IAUA 4I8JA 2W26A 3ESTA 1PPHE 1DSUA 1O2TA 4M7GA 1FN6A 1W11U 1ZTKA 4ZUHA 4NFFA 1EPTC 1C5ZB 2V3HH 1XVMA 3LJJA 1QQUA 1OX1A 2CMYA 2PGQB 1P2NA 4H6SB 1FV9A 2F9OA 3PTNA 3SO3A 4FUDA 1T31A 1TPAE 3QDZB 3FP7E 7ESTE 5F8TA 1ELFA 1QJ1B 1BBRK 2HALA 1DXWA 4UD9H 3UQVA 1GHWH 4AGJA 2G4UA 1O2XA 4ABBA 3MI4A 1O2NA 1P3CA 1MAXA 8ESTE 3DFLA 1HJ8A 1L1JA 2J94A 1TRMA 3Q3KA 1NFYA 1UCYE 2GZ8A 3FAOA 1S5SA 2Y5HA 1XX9A 3LGTA 3LT3A 2QV1A 1PYTD 1UVPA 1O2HA 1DOJA 1CHGA 5JBBS 1IHSH 1EJNA 4YLUA 1O3FA 1T32A 2Z3CA 2F9NA 4K8BA 4ZH8A 4ABDA 2SGQE 1BJUA 2NU4E 2W3IA 1F7ZA 3HATH 4UFGH 4FUEA 3PMJA 4AB9A 2BDIA 4WXIA 1O2YA 4X1RU 3SOSA 3NPSA 5JPMH 2SNVA 3UTUH 1SLVB 2QF0A 1ETRH 2ZU5A 1IQJA 4A6LA 1V2WT 4CBNA 2WYJA 2SGDE 1P12E 1P9SA 4NSYA 1KTTB 1HAVA 3QZQA 4DURA 1GGDB 1O3NA 2FZZA 1V2ST 2XC5A 1TBZH 5F8XA 4BAOB 1O3CA 1C1VH 1RIWB 2BD2A 2WUBA 4INHA 1MZDA 5JYIA 3ZV8A 1NO9H 4Q80A 3GCNA 3ZVCA 3SU2A 4IGDA 4BAHB 6GCHF 1IQGA 1TB6H 1GMHF 3BEIB 1MTWA 1XMNB 4CHAB 5FPSA 3RP2A 2ZGXH 3VB7A 2PUXB 5EPYA 4A1VA 3RU4E 1GL0E 1DDJA 1SOTA 3A7WA 3ZVBA 2FOGA 1TNHA 3C27B 3MU0A 2UWOA 3BTWE 3TH3H 1XVOA 4FUGA 2C8YB 4ISNA 2FESH 1O2JA 1SFIA 1ZJKA 1QRWA 3SV8A 1EAUA 3RXRA 4I8GA 1AO5A 3ZZ4A 3PYHA 3EDXB 3TNSA 1OP0A 1ZTLA 1ZMJA 2WPIS 5K7RA 2CXVA 5TCAA 4H6TA 5EOKA 3E6PH 5FX6A 3A8BA 4TPIZ 3UFAA 1QA0A 5JB8S 3UQOA 1TMBH 1FXYA 1SGIB 5SGAE 3RXLA 5EQQA 3URCA 1L1GA 1GDNA 3FP6E 1Y5BT 1GHBF 3AVZA 1ABJH 1G2LA 3PLKA 1NRRH 1THSH 4XBBA 1AB9B 1EPTB 2EI6A 2BY8X 1JXPA 2XBWA 1OWKA 1TMUH 3ELAH 1CT4E 1Z1IA 3RLWH