3PB1E

Crystal structure of a michaelis complex between plasminogen activator inhibitor-1 and urokinase-type plasminogen activator
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDAGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor/hydrolase
molecule keywords Plasminogen activator inhibitor 1
publication title Structural basis for recognition of urokinase-type plasminogen activator by plasminogen activator inhibitor-1.
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2010-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3pb1E02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3pb1E01
3OSYA 1Y5BT 1MTVA 1DLEA 1ZHRA 3TJNA 1YYY1 5EG4A 5A0AE 4IN1A 1GMDF 2XWBI 1OWKA 3D65E 2BXUH 5IYTA 1MD8A 1IQHA 3E0PB 1Q2WA 2OUAA 1C1OA 3M36A 3SI4H 2SGFE 1W3CA 1ABJH 3ATIA 2A0QB 3Q00A 4YOIA 3KGPA 3KHVA 1RJXB 1Y3UA 3TIUA 2BDHA 2OP9A 5F8ZA 1EAWA 1QJ1B 1VCWA 1C1WH 3MO3A 3C1KA 1CT0E 2AEIH 4K5ZA 3A87A 1F0RA 2XC0A 1V2JT 1Y5AT 2PSYA 4WMDA 3PYHA 2OC8A 5TCAA 4KTSA 2BD9A 2Z9JA 3LT3A 4X6PA 3QDZB 3M61U 3STJA 1NFUA 4FU9A 2C93B 4X8TH 1A1RA 1EPTC 2G8TA 1BJVA 1AO5A 1J17T 5TCCA 2QXJA 3KQBA 4X1QU 2VVUA 1SGEE 1DUEA 1EJMA 3VGCC 5B6OA 3GDSA 3FP7E 1AY6H 3MH5A 3MO9A 1UVTH 2C8ZB 3NXPA 2ZFPH 3LU9B 1TQ0B 4BAQB 1AFQB 3ATLA 3SV6A 4JYUH 4JK5A 1QTFA 2P94A 1NU7B 2RA0A 4MLFB 1AE5A 1ZJDA 1RXPA 2ZCKP 1BTPA 4X8SH 3GCHC 1O34A 1IOEA 3LGUA 1O33A 1TMUH 3FP6E 1SGPE 1ANBA 2STBE 1EPTA 2WPLS 1MAYA 2THFB 3GY2A 1V2TT 4JCNA 3P92A 5C3NA 2Y7XA 3O8BA 1BITA 4ISLA 1A4WH 1SHHB 2ZFRH 3RLWH 1SSXA 4OS2A 4JMYA 3QGNB 4MPXA 5DO4H 4LZ4B 2SNVA 5FCKA 1H9LB 2FWWA 3ELAH 1FIWA 4H4FA 1GHZA 1GJBB 1HPGA 1XUFA 1QQ4A 3LKWA 5PTPA 1QJ7B 2BX3A 3Q77A 2AERH 1MMJN 3DFLA 5K7RA 4XBBA 3TJVA 5JBBS 1BBRK 4BTUB 5LPFA 2M5TA 2XCNA 2PKSC 1GI2A 3P8OA 1SGNE 2UWOA 1FZZA 3IWMA 2R9PA 1HAVB 3LGTA 1YKTA 2TGTA 1ELCA 3BG4C 1FPHH 5AVDA 4Y79A 2G5VA 4DIHH 2ZKSA 3S9AA 1P02A 3OU0A 1SGRE 2GVFA 2XBVA 1BMAA 1C5YB 1EB1H 1ZZZA 1GG6C 1O2PA 1YM0A 2C8YB 1IQIA 1UTLM 4Y11E 4GHQA 2Z3DA 4I7YH 1MQ6A 2CN0H 1MZDA 4JZDH 3D62A 3A7WA 3SNDA 1A3EH 2WYJA 2D2DA 3A85A 2D26C 2UUJB 2J92A 4Y10E 1VJ9U 1O3NA 1O5AB 5FBIA 3SUGA 1IAUA 4BTIB 1CT2E 2VIWA 3RMMH 1GJAB 1OWJA 1Y3XA 2ZFTA 1BZXE 7GCHG 1YGCH 1CA8B 4Y7BA 5EPNA 4IS5A 1NFYA 4CRAA 1GMHG 3SUDA 1JRSA 3SU3A 4FXGH 1TLDA 4NFFA 4TY6A 4CH8B 3SV8A 1HJ8A 1WAYB 1F7ZA 1O35A 3AVZA 2W26A 4K60A 2FX4A 5EQQA 1O2QA 8GCHG 1W12U 2Z3CA 3RXVA 4I8KA 1HJ9A 4LZ1H 1ZSKA 2ZHFH 4NSYA 2NU2E 1A61H 4X1RU 1DS2E 3EYDA 1ZRKA 1BUIA 5J4QA 2WV5A 1OWHA 1YPEH 1C2LA 1HIAB 1D3QB 1W14U 1DY9A 3TPIZ 2G81E 4A5TS 1A5HA 3GICB 4WXIA 1BA8B 3A8AA 1ACBE 1GHBG 5A8YA 3LDXH 4Y0YE 3BTHE 4I32A 4MPVA 1S6FA 1Z8IB 3ZZ9A 1GHAF 2C3SA 2PGBB 4JK6A 2XBXA 2SGPE 3RM0H 1QRZA 4BXWA 7KMEH 1O3MA 3S7KB 2BY6X 1OP8A 2W5EA 1TOCB 3RMLH 2BOHB 1ZJKA 1QNJA 1YLCA 3T25A 1MBMA 2P3UB 4UE7H 2FYRA 4X1NU 3URCA 1EASA 3ZVCA 1QRXA 3E91A 5L2ZH 3O8CA 4CR9A 1BRAA 1CU1A 4X6OA 3T26A 2OBQA 1CBWB 1RRKA 2STAE 1O2KA 5LPRA 2G51A 3PROA 2ZU2A 2ZTZA 3P6ZB 1QURH 3GY7A 3N7OA 1E34B 2GT8A 1JBUH 1MTNC 4BXSA 1O3KA 1ETTH 1O3LA 1SLWB 1TWXB 1YF4A 3F68H 1ELEE 1TGBA 2EC9H 3BTDE 1B0EA 3A7ZA 2XTTB 3ATWA 1W10U 2J38A 1QFKH 2BZAA 2B7DH 1KSNA 2C90B 4AYYB 4KP0A 2SGDE 4MPWA 3SJIA 1PYTD 5JB9S 1L4DA 1V2MT 1CGHA 4NWLA 3B23B 1O3OA 1RTFB 1EQ9A 1AUTC 1DXWA 2PKAB 2AGEX 1QR3E 3E6PH 1DPOA 1GJ5H 1NRQH 1W7XH 5GCHG 3SU5A 2XNIA 1AQ7A 1C5UA 3JZ1B 2F3CE 3TJOA 3K6ZA 1TNJA 1W11U 3LGYA 1O3DA 1QB1A 1QBVH 1XX9A 2ZU3A 3DUXH 1EJAA 1VCPA 1KDQA 2I6QA 1DX5M 3RC5A 4UEHH 5DP7A 1TX8A 4A1VA 1P05A 3MU8A 4A6LA 1PFXC 3FVFB 5F6MA 3SU1A 1CQQA 1SQOA 1KYNA 2TGDA 4AN7A 1E35B 4GCHF 4X6MA 1G3EA 1ABIH 1DUAA 3RXAA 4CRFA 2F9PA 2YNBA 3ZZ3A 3QX5H 2Y5GA 1ZMNA 3A86A 3ZVGA 4BOHA 1P03A 3RXPA 1CHOG 2NU4E 3ODDA 8ESTE 3PMAB 1ZTJA 2ANYA 3U1IB 5ETXA 1ZMJA 2Q6DA 4O9VA 3L3TA 1BTHH 1A5IA 4ZMAH 2AGIX 4NA7A 3UNSA 1V2UT 5T3HA 3HGNA 1A5GH 4U2WA 4Y71A 1TA6A 5C20A 1TYNA 1GVKB 4ISIH 1V2WT 1QL9A 1MBQA 3PWBA 1GL0E 1N6YA 2CF9H 2ZCLP 2R3YA 1GBLA 3HKIB 2BVRH 1TMBH 2A7CA 5JBCS 1D6WA 1D3TB 4ZHLU 4WH8A 3QGJA 1LKBA 3GISB 1ZPZA 4MNVA 2GCTB 5G4BA 4GPGA 4INKA 1SLVB 4CBNA 1J16A 2VWNA 5F8XA 3UOUA 4YT7H 5BRRE 2PFEA 1HJAC 1WYKA 2Z9IA 3PB1E 4FUGA 1VITG 2BY8X 3VB7A 3BEFB 6ESTA 4MTBA 2CXVA 2V3HH 1ZR0A 2HVXA 1LHCH 1O2LA 2O8WA 3MH7A 2D1JA 4CREA 4NIXA 1Z8JB 2Y82A 1EPTB 2GCHF 3PO1B 5EPYA 1LVOA 1O2UA 1TRNA 1XVOA 3A8DA 5T6FA 1V2NT 1K22H 3SI3H 2A7JA 4IN2A 1V3XA 1S5SA 5K0HA 3BG8A 1YPMH 1B7XB 3Q3KA 5C5NA 1J8AA 1V2LT 1PPBH 1LVMA 2A4GA 1K1PA 1JWTA 5ESTE 3UY9A 1C5RA 2ZGHA 3DA9B 1ZPCA 4MNWA 4FVDA 3ZZDA 1G32B 4YO9A 3SZNA 5C1UA 1DLKB 1PPGE 1T31A 5BPEA 2BY7X 3RXHA 3A83A 1GI6A 4Q2KA 1S6HA 2WUBA 2P59A 2BD4A 1GI8B 1V2ST 1CA0C 1MKWK 1L1JA 4NZQA 2GP9B 3SHCH 1EP6A 5DP3A 2W3KA 1EOJA 4K8YA 5A8XA 1EJNA 5DP8A 2FYQA 2IPHA 1G3DA 1BT7A 1ESAA 5E2OA 2VVCA 2SNWA 3ATKA 1ZSLA 3OTJE 5T6GA 2SGAA 1GBHA 2RDLA 1SGYE 1QBOA 3F9HA 2IN2A 3ZVEA 3S9BA 3E1XB 4YZUA 2ZGXH 3ZZ4A 3MNXA 5E2PA 1O32A 2ASUB 4WWYA 2OQ5A 3SUFA 2KAIA 1AUJA 1O3FA 1KLTA 2HPPH 4AFQA 2XRCA 1UVSH 3PMJA 4GUXA 2P16A 2ALVA 4XSKU 1AE8H 1ZOMA 1CVWH 1TRYA 2TRMA 4KTUA 1T4VH 2BTCE 2A5IA 1HLTH 3MNCA 1O0DH 2VH0A 3ZZ6A 2R2MB 1FAKH 2Z7FE 5C2ZA 2V0BA 2OC0A 3ZZ8A 1MKWH 3LPRA 4B2CA 2O8UA 1RTLA 1FPCH 4KELA 1GBFA 5FPYA 1P10A 1GI5A 3MU4A 2JETC 2W7SA 2ULLA 1GI4A 2OC1A 1L1GA 2A7HA 4Q7YA 3FANA 4A7IB 3S9CA 2VIDA 1KTTB 1FI8A 1BRCE 4GLYA 3HGPA 4NCYA 4D7FA 3TK9A 1P2KA 1U6QA 1LHFH 2AMDA 3LGIA 1ELVA 4KGAA 3LJJA 4X2XA 1SMFE 2AIPA 2QF0A 3TVJB 3M5NA 4DT7B 4RKJB 1UO6A 2LNCA 2QIQA 2TGAA 5AF9H 3SNBA 3V13A 1C5NH 5FX6A 1IQMA 4FUEA 3RXKA 3LOXA 4XE4A 2BVXH 1XMNB 2ZCHP 4NSVA 4X8UH 3RXRA 1FDPA 4I33A 1SGIB 3S69A 4B76A 1TBRH 1L0ZA 1O3BA 1C2KA 1CO7E 4BAMB 1GPZA 4X2YA 3A84A 1FXYA 4A92A 3GCOA 4JYVH 1ELDE 3F1SB 3CS7A 3MU1A 4X0WU 1E37B 1F5LA 4FVBA 1SGFA 3MWIU 2ESTE 1OP2A 4XBCA 2C4FH 2XC4A 2ZC9H 1SGFG 2Q6GA 2CHAB 2VGCC 3SU0A 1IQLA 4TYDA 1SI5H 4GHTA 2QY0B 1O2WA 2BD3A 1SC8U 1PPEE 1W8BH 1MAXA 1THPB 1UVOA 3QZRA 3A89A 3RXQA 3QUMP 4E06H 1LO6A 3R0FA 4ZKSU 3LIWA 4CHAB 3SV2H 1C5PA 1THSH 3SQHE 1OPHB 3M7UA 2VIOA 3GY3A 3TH4H 1AB9B 4FU7A 3HKJB 3A8BA 4FUHA 1TAWA 3C27B 3B9FH 2W3IA 3GY8A 1SB1H 1GJ8B 5EODA 3A7XA 3BTWE 4MG3A 1O2GH 3M5OA 2GKVE 5LPEA 1L4ZA 3OX7U 2OD3B 3PLBA 1K9OE 1YPHC 3ZZAA 5IDKA 1KDQB 2B5TB 1EZQA 2BLVA 2WPHS 4VGCB 1AVGH 4UFFH 4UFGH 4X1SU 1O2RA 4ABHA 2ZGCA 3JZ2B 3ZV8A 2OTVA 2H9TH 2B9LA 2VWMA 4AB8A 3MFJA 1C1TA 2HNTE 1C1SA 1TA2A 6GCHF 2YOLA 4X8VH 1WOFA 2Y81A 4ZKRU 3SORA 1AMHA 1TFXA 2XBYA 3KCGH 2Z9GA 1GBTA 7LPRA 2AMPA 4ZXYH 1C2GA 3SJ8A 3E0NB 1W13U 1SFQB 3GCNA 3L6PA 1ANEA 1FY1A 1UK3A 4JZIA 5ABWA 5FAHA 1OWIA 4ABFA 4AYVB 1THRH 1S85A 4TWWA 4BAOB 1S84A 2A5AA 2ZHQH 2VU8E 3RXEA 5E0HA 1O2NA 1O2SA 4CRDA 2FOEA 1F0UA 4RN6A 1O3EA 1BDAA 6CHAB 5GPIB 3TLOA 5EGMA 2GMTB 3KQDA 1T8LA 5DPAA 2D8WA 3T5FH 2AS9A 1TPSA 2ZTXA 3MO6A 1F92A 2VH6A 1O3GA 4YESB 4AFSA 2Y6TA 1WCZA 1YPKH 4HFPB 3A8CA 2F91A 1P2MA 1FJSA 3SU4A 4DG4A 2FO9A 5A09A 1FY3A 3SGAE 1UTPA 2GX4A 1AN1E 2BHGA 3CENA 5E8EH 1DICA 4K8BA 5DP9A 1Y59T 2VWLA 1BTXA 1GJ4H 1GWAA 4NA8A 3BEUA 3GY4A 1NTPA 5JBTA 2ANKH 2DE8A 1HUTH 4A1TA 3AW0A 5DP6A 1C5OH 3MH4A 2QXHA 5HGGA 1H9IE 2BQ7B 6LPRA 1PQ5A 1MU6B 4DCDA 1GVLA 3ZVBA 3QTVH 1RS0A 5JDUB 3PLKA 2QN5T 1OSSA 1ELFA 3P8GA 1O30A 4B71A 3A7TA 1NROH 1ZMLA 4Y0ZE 1DVAH 3BSQA 3RXDA 3E90B 1O5DH 1Z7KA 4ZAEA 4HTCH 1QIXB 1GGDC 1B5GH 1A46H 4U32A 5C67A 1EXFA 3BTGE 3UR6A 1BMNH 4XFQA 1T7CA 1D6RA 2BDYA 4SGAE 2Y80A 1TPOA 3NK8A 1TGNA 1P04A 1QA0A 4K1EA 1D9IA 2ZU5A 1C2IA 2VB0A 5FX5A 2FMJA 3BN9A 1MD7A 1HCGA 1SPJA 5DKMA 2IOTA 3DD2H 2AH4X 1IHTH 1NM6A 5E0GA 5CMXH 4TWYA 1QBNA 4R0IA 1GHWH 1YBWA 5C5OA 4UFEH 4TPIZ 3V0XA 2J2UA 3RXJA 3GCTG 3MYWA 2ZDMA 1FY5A 2F9NA 2DUCA 2GGVB 1J15A 3BV9B 3EA8A 3RXFA 3UQOA 2FX6A 2NWNA 3B8JA 2BXTH 4D9QA 3S7HB 2SFAA 1GMCF 1LQEA 1NPMA 3I77A 3LONA 3RXMA 4IMZA 1O3CA 1QQUA 1H4WA 3SGBE 3FFGA 1NY22 2EI8A 2ANMH 2ODPA 2ZFFH 4XDEA 4GVUA 3BTQE 1XUJA 2CJIA 2ZG0H 3I29A 4MDSA 1SQTA 1UJ1A 1UMAH 3PMHB 1TNKA 1C2JA 1GVZA 4Q7ZA 5EW2H 2BVSH 2WPMS 5DP5A 3SU2A 1WQSA 5CHAB 3V12A 3EE0B 3LC3A 2ZDAH 3V3MA 1SL3A 3T28A 2KAIB 3MNBA 1TMTH 1YCPM 3M7QA 3NCLA 3KF2A 3KNXA 1AVWA 4DW2U 4O3UA 3UNQA 1C1QA 3RC4A 4HZHA 2PSXA 1AFQC 3R3GB 1BQYA 2TGPZ 3SGQE 2FS8A 3MNSA 1P2NA 2BM2A 1KXDA 1QB9A 1SLXB 1HDTH 4ISHH 3SBKA 1V2KT 3SJKA 1Z6JH 2Z94A 1SGDE 1XUKA 4OGYA 1RIWB 3E8LA 4D76A 3TGIE 3UR9A 2P3TB 2TPIZ 3UUZA 1W7GH 1C5LH 3F9GA 2J4IA 4WVPE 4BTTB 2WYGA 1QA7A 2PR3A 2BDAA 2BLOA 1P2OA 5F8TA 1TPPA 1IHSH 3BTKE 2P93A 1GI3A 3SOSA 3EA7A 1VJAU 2PWXA 4YOGA 1G37A 1A3BH 1D3PB 1NC6A 2Y5HA 1Y8TA 4K2YA 5CE1A 2PW8H 1XKBC 2NU1E 2V35A 1DANH 4B1TA 3TJUA 1G2MA 1W0ZU 1NFXA 3K6YA 1C4Y2 4WMEA 3NPSA 4FUDA 1ELAA 1ANCA 2BDBA 1UTMA 1W0YH 2WPKS 1G3CA 4D7GA 2OBOA 1LPZB 2BLWA 3FZDA 2RG3A 4TPYA 1YPLH 1DITH 5FPTA 4AFUA 2J34A 4ZH8A 3ATMA 1GMHF 1EKBB 2A4QA 1GJ7B 1VCQA 3VXEH 1FUJA 2ZECA 2ZU1A 2BD2A 1ANDA 5J4SA 2WUCA 4UFDH 3RXUA 1RFNA 3LGVA 4LK4A 1HAOH 1GBCA 3W95A 1BMLA 1WBGB 3F9EA 8GCHF 2H6MA 3D49H 4E7RG 3ZVFA 4Y8YA 1Y5UT 1VZQH 1C1VH 1N8OC 2ZFSA 4UD9H 5FHTA 1P11E 1C2MA 1EX3A 3M7TA 4FUJA 4K69A 3BTEE 4I8LA 1YCPH 1CSOE 2GZ8A 2HRVA 1JIMA 1BTZA 2CF8H 1HRTH 3RXBA 1NRNH 1RD3B 3HPTB 4K3JA 4PROA 1TBZH 1GHBF 3VB5A 3MOCA 4NIYA 1CE5A 1GJ6A 2UUYA 2VVVA 4O3TA 2FODA 1K1NA 4IGDA 1WV7H 1UCYE 2ZO3H 3RXIA 3OY5U 2XXLA 1HYLA 3TK6A 5GXPA 1O2OA 5EOKA 2Q1JA 2CV3A 2IJOB 2UUKB 1O2JA 1H8DH 1FNIA 2W7UA 4FUFA 1NN6A 1WSSH 3QWCH 1G36A 1HV7A 2ZF0H 5JBAS 3E16B 3ZVDA 1HGTH 2FEQH 3H5CB 1C5ZB 3GDVA 2VIQA 1NFWA 4FUBA 1AD8H 3M35A 1BIOA 1GDNA 1OP0A 1C1PA 1V2VT 2R2WU 1DE7H 1V6DA 3RUOA 2ZHEH 1HAZB 3VGCB 1OS8A 1MCTA 4ESTE 1XUGA 2OQUA 5EQSA 2BYAX 1O5CB 1NESE 3ZYDA 2OCVB 1INCA 4H6SB 2PV9B 3TITA 2BDIA 3M3TA 1T8OA 3PLPA 4OS1A 1KXBA 1GMDG 3URDA 2GV6A 1ZGIA 3T27A 3GCHB 1D4PB 4I8GA 2BQWB 3U9AH 1B0FA 3M3SA 4CBOA 2ANWA 2FI4E 1QY6A 1S0QA 1C2HA 2HLCA 1MTSA 1FLEE 1DOJA 2F9OA 3M5MA 4KTCA 1O3JA 3TNSA 3GY5A 1HAHH 2A4RA 5F03A 1TQ7B 5GCHF 4HI3A 3TK5A 1UHBA 2OINA 1SFIA 4ZHAA 4YLUA 1IQKA 2H5DA 4AGKA 2BLQA 1SOTA 2GZ7A 2FOFA 1K1LA 2ZPRA 1PPFE 1SOZA 1FQ3A 1BRUP 2NU3E 1QJ6B 2A4OA 3RXTA 1P2IA 1OYQA 1JIRA 3SJ9A 1T8MA 1YP9A 3GDUA 1M9UA 1RGQA 1VGCC 1O2IA 2O8LA 1GBJA 3BF6H 2JH0D 1FMGA 3BIUH 3Q76A 2HNTC 2ZFQH 2PKSB 2V6NA 3NWUA 1BHXB 2FDAA 3MU5A 4YT6H 3LGWA 2GDDA 3SNAA 4NFEA 4NIVA 1KXCA 1LHGH 1TIOA 2QA9E 4OS7A 4CRBA 2GV7A 3BG4B 5TJXA 1UK2A 1JRTA 2H9EH 1TNLA 1FONA 1P01A 3GOVB 3ZYEA 4D9RA 1G9IE 4Q7XA 1SGCA 1CGJE 1CHOF 3OY6U 5C1YA 1EAIA 4E7NA 2P8OC 1C1UH 2BB4A 1EP5A 4GSOA 1XKAC 5JB8S 1GG6B 1ESBA 1Y3YA 2QGRA 3QK1A 4MNXA 1XXFA 4ASHA 3RMNH 1QCPA 1IQFA 1O2MA 2UWLA 4WY3A 3PMBB 2SGEE 2FIRH 2ZHDA 1O5BB 4K1SA 3RXOA 4GAWA 2CGAA 1HNEE 4MNYA 2C8XB 1EOLA 5HM9A 2VWOA 1ZSJA 1GCTC 1A2CH 1O39A 4H6TA 4X2VA 1OXGA 3KEEA 2QC2A 4B73A 1F5KU 4I8JA 1ZLRA 1SQAA 4DVAU 1C4V2 3QTOH 1Y3WA 5A2MH 1GBEA 2BD8A 3RXSA 3D23A 1V2RT 3AW1A 1P2JA 1AHTH 1EZSC 2H1UA 4AOQA 2A32A 1O31A 1O5GH 4JZ1A 3O8RA 2G4TA 1ELTA 2FOAA 4FUCA 2JKHA 4TY7A 4AFZA 1TGCA 1GJ9B 2FOBA 4ABGA 2FM2A 2FTLE 1BTYA 3U69H 4FU8A 1DWEH 4ZKNU 9ESTA 1GJDB 5L2YH 4OS4A 5A8ZA 4UONA 1TB6H 1LDTT 2UWPA 1Z8GA 3Q3XA 1AWHB 3KQCA 3UTUH 3M37A 1P9UA 1O2HA 1ZRBA 1GHYH 1A7SA 1PJPA 2A1DB 5E0JA 2K1QA 2G00A 3VB6A 5DK1A 1CT4E 1JXPA 2O8TA 3PWCA 2PHBA 1HAGE 2FOGA 3EQ0H 3VB3A 4FUIA 1GI7B 2ZQ1A 2QYIA 1S83A 2A5KA 2Y5FA 1C4U2 4K1TA 1MCVA 2BY5X 1MTWA 2ZPQA 3QZQA 1D3DB 4IBLH 3ZZ7A 3EDXB 1HAXB 2GZ9A 2GCTC 3RXGA 3H7OA 1NRSH 1C2DA 4KKDA 1ELBA 3RP2A 1K1OA 1P0SH 1C1NA 1Q3XA 1G3BA 2BQ6B 4THNH 1MKXH 2O8MA 1O2VA 1MTNB 1SGQE 1ZTKA 1WTHD 5FCRA 3MH6A 1NS3A 1LMWB 3PO1C 5FBEA 3T29A 2Z9LA 1ESTA 2RA3A 3SW2B 1NO9H 1UVUH 2SGQE 4YLQH 2ZDKA 1QRWA 4CRCA 1BBRE 2G5NA 4NZLA 3ENSB 3WY8A 1EZUC 1GL1A 3W94A 2ZZUH 3UOPA 1MU8B 1A0JA 2EEKA 1X7AC 2O9QA 2ZP0H 1H1BA 2HNTF 3OYPA 1GHAG 1EB2A 1ZPBA 4A1XA 1TRMA 3EAJA 1FIZA 2ZGBH 1YLDA 2BD5A 3VFEA 1SLUB 3QO6A 1V2OT 1C5SA 2BDCA 2C8WB 1GMCG 3MMGA 2VIVA 1TABE 2OC7A 3KQEA 2WV4A 1H9HE 4WJG2 2AIQA 3RXCA 1ZGVA 2YNAA 2B0FA 1BB0B 1P06A 3TU7H 3UPEA 3RC6A 3BTTE 4CR5A 3M3VA 1V2PT 2OLGA 1VITH 3KN2A 2ZHWH 1LPGB 1H8IH 1PPHE 1HAYB 1C5QA 4IW4E 1SG8B 2GDEH 3F9FA 1E36B 1AZ8A 1LQDB 1OOKB 1TBQH 3BEIB 1DWBH 5I25A 2G52A 3LC5A 1ORFA 4NG9H 5GIBA 1LVBA 1L2EA 3VEQB 4Z6AH 4Y7AA 3ZZBA 3PTBA 2ZDNA 2WPJS 3K9XB 3TH2H 1TPAE 3GY6A 4B74A 2H9HA 1MQ5A 1P57B 2PTCE 1S81A 3TGKE 4BAKB 4ZXXH 5LH8A 2A31A 2A2QH 2EA3A 1N8OB 1C5MD 1O3IA 2BOKA 1O5EH 2ODQA 1FN8A 1Z1JA 1QL8A 2EI6A 1F0TA 4ISNA 3RU4D 3ODFA 1K1MA 4Y76A 4LXBH 3HK6B 3MU0A 1A0HB 3LJOA 5EXMA 5C1XA 4OS5A 2GTBA 4D8NA 1PQ8A 1BOQA 2PUXB 2FOCA 5FXLA 5GDSH 1GBAA 3UNRA 2PUQH 2Z9KA 8LPRA 5AFYH 2HGTH 4BANB 2ZI2H 3RDZA 3TH3H 4I31A 4Y6DA 1FN6A 2AMQA 2BY9X 1RTKA 4GCHG 4ISOA 2GD4B 1OKXA 3F6UH 3UIRA 1EAXA 1T8NA 1HBTH 1DDJA 1HJAB 1C5XB 3HATH 1AIXH 1TGSZ 1BBRH 1DWCH 2VNTA 1MTUA 5LGOA 1OYTH 1TNHA 1L1NA 1O2ZA 3M5LA 1GBDA 1SR5C 4NWKA 3MHWU 1DM4B 4ZROA 1FV9A 2WPIS 4WF8A 3SQEE 1O3AA 3IG6B 4X1PU 4DY7B 4AB9A 5DP4A 3LH3A 1O3PB 4YOJA 4SGBE 3T2NA 3A80A 2ALPA 4AX9H 1SHYA 4ABBA 4QT8C 2R0KA 2AYWA 1AKSA 1UHBB 5DJ7A 3T62A 3VPKA 3AAVA 1DY8A 3P8NA 3FZZA 1LCYA 4ABDA 1O5FH 1BTWA 4Z0KA 3SNEA 1E0FD 1HXFH 2ZGJA 4ZKOU 1K21H 1OWEA 1HXEH 1PPZA 2HOBA 2PLXA 3G01A 3NKKA 4O97A 3H7TA 2F83A 1AWFH 2XWAA 1XUHA 3K65B 4AGJA 1NZQH 2UUFB 1FAXA 4MQAA 5GJ4B 2CHAC 3RLYH 1YPGH 3HK3B 4XOJA 1CA0B 2DE9A 1KIGH 1GBBA 3SN8A 2XW9A 3AASA 4Y8ZA 2PGQB 2BD7A 2FS9A 3ITIA 2ZU4A 3SV7A 5L30H 5HM2A 1UTNA 3ZVAA 5L6NH 2Z3EA 3A7VA 1CGIE 3BTFE 1AFEH 4CHAC 4J1YA 5HXFA 2FTMA 5EW1H 4RSPA 3TNTA 5JYIA 1AB9C 2GCHG 1EZXC 3KIDU 4WMFA 2BZ6H 3A88A 1VGCB 1YPHE 2FP7B 3DT0H 2XYAA 3IITA 5H4IB 1VR1H 1F5RA 4DURA 1AU8A 4OGXA 4F4OC 3RU4T 1KTSB 4X2WA 1TOMH 5DGJA 4ZHMU 1N1LA 1TX7A 2XCFA 1GHVH 1Z71A 1TX6A 1YCPK 3STIA 4YM9A 1A0LA 4VGCC 1W2KH 2G55A 4DJZB 2P8OB 4DIIH 2ILNA 4XBDA 1C9TA 4X6NA 1AGJA 1UTKA 1WTGH 1BHXF 2CMYA 2QXGA 1UK4A 2V3OH 2ZDVH 1JOUB 1QB6A 4BAHB 1IQEA 4AORA 4NIWA 4CRGA 2XBWA 2R3UA 1ARCA 3EA9A 3Q3YA 1XUIA 1EAUA 4HGCA 2QCYA 1O38A 3RM2H 4ABJA 1G2LA 1ARBA 3DHKH 4AG2A 3UWJH 1NU9A 7GCHF 1GCTB 2JETB 3UREA 2FI5E 1OX1A 1QGFA 4YTAA 4H42U 3BIVH 4E05H 5AFZH 1LTOA 3K2UA 1K1IA 1BJUA 3NUMA 4Y8XA 2TIOA 1PQAA 4JYTA 1GDUA 1PQ7A 3EGKH 2FESH 1E38B 6CHAC 1P09A 9LPRA 1Z8RA 1LHEH 3P70B 1WU1A 3U8TH 3FAOA 2GMTC 3A82A 1ETSH 1C2FA 4B2AA 1J9CH 1C1RA 2H5CA 2TBSA 5EQRA 3PTNA 1HFDA 1C5VA 1IQJA 1BCUH 1J14A 4IC6A 1WQVH 3UQVA 3TGJE 1C9PA 1LPKB 2VIPA 2JH6D 2ZEBA 1DWDH 1TALA 4NGAH 2QF3A 4Q80A 2RCEA 1HAVA 3ESTA 1GBIA 1Y3VA 4UDWH 1GI1A 2WINI 1ELGA 1V2QT 5SGAE 3S0NA 3AAUA 3O8DA 3PM3A 2ZPSA 5T6DA 1KLJH 1GCDA 2A45B 1TONA 1MZAA 1OWDA 2ZTYA 3GCTF 5JPMH 4INHA 1CHGA 4B75A 2FPZA 3U8OH 1K1JA 1TE0A 1DSUA 5EXLA 1ETRH 1HAIH 1TNGA 4DGJA 1C2EA 2PTNA 2VGCB 5HYOA 1G30B 1MUEB 1P12E 2ZQ2A 1WUNH 4J2YB 3A7YA 1NRPH 3MI4A 3SUEA 4ABAA 2R0LA 2J94A 1NRRH 1O36A 4MPUA 4NA9H 3U8RH 3SNCA 3V7TA 1P2QA 2BMGB 1K2I1 4AG1A 1DSTA 1AZZA 3SHAH 3ZZ5A 4ABEA 5GWZA 4DOQA 1LKAA 1PYTC 1HAPH 3L33A 4U01A 1AVXA 1XXDA 3BTME 1C1MA 1C5TA 1F2SE 2AGGX 2VJ1A 4M7GA 3MTYA 2Y7ZA 4ABIA 1QHRB 1BRBE 1N6XA 2ZWLH 3ZV9A 3ZZCA 5EXNA 2ZA5A 2B8OH 1LVYA 1UCYK 4MVNA 1T4UH 1PPCE 4CH2B 2LPRA 1P3EA 2FI3E 1IQGA 1P9SA 4IC5A 1P8VC 1DXPA 1DT2A 5AHGH 3QLPH 2NU0E 2P3FH 4WH6A 1HIAA 3CS0A 3A81A 1DFPA 1XVMA 1GHXH 2F9UA 3RXLA 1UVPA 1EATA 1GBKA 2ODYB 3PV4A 2ZDLA 2A2XH 1CBWC 3SO3A 8KME2 1GI9B 4WXVA 1Q31A 2Z6BD 1KY9A 1ZHPA 2FXRA 1SVPA 2AFQB 1Z1IA 5CHAC 2Q6FA 1KXAA 2J95A 2VINA 3CP7A 1KLIH 2QAAA 1O2XA 2OXSA 4IMQA 5FPSA 3VXFH 1KXFA 1SBWA 4AZ2B 1UTJA 1JMOH 2F9VA 1P3CA 3P95A 3RU4E 3I78A 4B2BA 1KXEA 2GT7A 1O37A 2ZIQH 1FY8E 1TNIA 3GYLB 4INLA 3GYMA 3LH1A 1UTQA 2F9BH 2BX4A 4BNRA 1O2TA 4RKOB 1UCYH 5I46H 2FZZA 3P17H 1GBMA 2HWLB 1RIWC 1UTOA 1Z6EA 2JH5D 5EU8A 2XC5A 4U30A 4F49A 3NZIA 1C5WB 4O03A 1NT1A 6GCHG 1EUFA 1GI0A 2HALA 3E3TA 3FP8E 2P95A 5A0CA 1FY4A 3U98H 1S82A 1IQNA 2FOHA 2QV1A 1YC0A 2HPQH 3RMOH 2PKAA 1ZTLA 1AI8H 7ESTE 3U1JB 1F0SA 1GJCB 2FLBH 5A0BA 1GDQA 2BDGA 1K28D 2I6SA 1SGTA 1O2YA 4LOYH 2EI7A 4OS6A 5HMAA 1BMMH 4JZFH 1ZHMA 1BTUA 2FLRH 2G4UA 3QN7A 2ZNKH 3DFJA 1MKXK 1VITF 1GGDB 1T32A 4I8HA 4JZEH 1AKSB 2H2ZA 1QL7A 2QXIA 1HB0B 1O3HA 5ESBA 2J9NA 3SV9A 1S0RA 3SJOA 3P8FA 5DG6A 1LHDH 3SU6A 1YPJH 3VB4A 3KL6A 2FOMB 3UFAA 3UWIA 1ID5H 1XM1A 1ZYOA 1MH0A 4R8TB 1TGTA 4ZUHA
chains in the Genus database with same CATH superfamily
3OSYA 1Y5BT 1MTVA 1DLEA 1ZHRA 3TJNA 1YYY1 3FKSD 5EG4A 5A0AE 4IN1A 1GMDF 2XWBI 1OWKA 3D65E 2BXUH 5IYTA 1MD8A 1IQHA 3E0PB 1Q2WA 2OUAA 1C1OA 3M36A 3SI4H 2SGFE 1W3CA 1ABJH 3ATIA 2A0QB 3Q00A 4YOIA 1W0JD 3KGPA 3KHVA 1RJXB 1Y3UA 3TIUA 2BDHA 2OP9A 5F8ZA 1EAWA 1QJ1B 1VCWA 1C1WH 3MO3A 3C1KA 1CT0E 2AEIH 4K5ZA 3A87A 1F0RA 2XC0A 1V2JT 1Y5AT 2PSYA 4WMDA 3PYHA 2OC8A 5TCAA 4KTSA 2BD9A 2Z9JA 3LT3A 4X6PA 5GNDA 3QDZB 3M61U 3STJA 1NFUA 4FU9A 2C93B 4X8TH 1A1RA 1EPTC 2G8TA 1BJVA 1AO5A 1J17T 5TCCA 2QXJA 3KQBA 4X1QU 2VVUA 1SGEE 1DUEA 1E79D 1EJMA 3VGCC 5B6OA 3GDSA 3FP7E 1AY6H 3MH5A 3MO9A 1UVTH 2C8ZB 3NXPA 2ZFPH 3LU9B 1TQ0B 4BAQB 1AFQB 3ATLA 3SV6A 4JYUH 4JK5A 1QTFA 2P94A 1NU7B 2RA0A 4MLFB 1AE5A 1ZJDA 1RXPA 2ZCKP 1BTPA 4X8SH 3GCHC 1O34A 1IOEA 3LGUA 1O33A 1TMUH 3FP6E 1SGPE 1ANBA 2STBE 1EPTA 2WPLS 1MAYA 2JJ2D 2THFB 3GY2A 1V2TT 4JCNA 3VG8A 3P92A 5C3NA 2Y7XA 3O8BA 1BITA 4ISLA 1A4WH 2KZ4A 1SHHB 2ZFRH 3RLWH 1SSXA 4OS2A 4JMYA 3QGNB 4MPXA 5DO4H 4LZ4B 4XRNA 2SNVA 5FCKA 1H9LB 2FWWA 3ELAH 1FIWA 4H4FA 1GHZA 1GJBB 1HPGA 1XUFA 1QQ4A 3LKWA 5PTPA 1QJ7B 2BX3A 3Q77A 2AERH 1MMJN 3DFLA 5K7RA 2QE7D 4XBBA 3TJVA 5JBBS 1BBRK 4BTUB 5LPFA 2M5TA 2XCNA 2PKSC 1GI2A 3P8OA 1SGNE 2UWOA 1FZZA 3IWMA 2R9PA 1HAVB 3LGTA 1YKTA 2TGTA 1ELCA 3BG4C 1FPHH 5AVDA 4Y79A 2G5VA 4DIHH 2ZKSA 3OE7D 3S9AA 3WWBA 1P02A 4HG6A 3OU0A 1SGRE 2GVFA 2XBVA 1BMAA 1C5YB 1EB1H 1ZZZA 1GG6C 1O2PA 1YM0A 2C8YB 3PV5A 1IQIA 1UTLM 4Y11E 4B6FA 4GHQA 2Z3DA 4I7YH 1MQ6A 2CN0H 1MZDA 4JZDH 3D62A 3A7WA 3SNDA 1A3EH 2WYJA 2D2DA 3A85A 2D26C 2UUJB 1COWD 2J92A 4Y10E 1VJ9U 1O3NA 2KFWA 1O5AB 5FBIA 3SUGA 1IAUA 4BTIB 1CT2E 2GJGA 2VIWA 3RMMH 1GJAB 1OWJA 5DN6D 1Y3XA 2ZFTA 1BZXE 7GCHG 1YGCH 1CA8B 4Y7BA 5EPNA 4IS5A 1NFYA 4CRAA 1GMHG 3SUDA 2V7QD 1JRSA 3SU3A 4FXGH 1TLDA 4NFFA 4TY6A 4CH8B 3SV8A 1HJ8A 1WAYB 1F7ZA 1O35A 3AVZA 2W26A 4K60A 2FX4A 5EQQA 1O2QA 8GCHG 4OM9A 1W12U 2Z3CA 3RXVA 4RT0A 4I8KA 1HJ9A 4LZ1H 1ZSKA 2ZHFH 4NSYA 4F48B 2NU2E 1A61H 4X1RU 1DS2E 3EYDA 1ZRKA 3WW7A 1BUIA 5J4QA 2WV5A 1OWHA 1YPEH 1C2LA 1HIAB 1D3QB 1W14U 1DY9A 3TPIZ 2G81E 4A5TS 1A5HA 3GICB 4WXIA 1BA8B 3A8AA 1ACBE 1GHBG 5A8YA 3LDXH 2KM0A 4Y0YE 3BTHE 3DCLA 4I32A 4MPVA 1S6FA 1Z8IB 3OEHD 3ZZ9A 1GHAF 2C3SA 2PGBB 4AC9A 4JK6A 2XBXA 2SGPE 3RM0H 1QRZA 4BXWA 1H8HD 7KMEH 1O3MA 3S7KB 2BY6X 1OP8A 2W5EA 1TOCB 3RMLH 2BOHB 1ZJKA 1QNJA 1YLCA 3T25A 1MBMA 2P3UB 4UE7H 1VKYA 2FYRA 4X1NU 3URCA 1EASA 3ZVCA 1QRXA 3E91A 5L2ZH 3O8CA 4CR9A 1BRAA 1CU1A 4X6OA 3T26A 2OBQA 1CBWB 1RRKA 2STAE 1O2KA 5LPRA 2G51A 3PROA 2HLDD 2ZU2A 2ZTZA 3P6ZB 1QURH 3GY7A 3N7OA 1E34B 2GT8A 1JBUH 1MTNC 4BXSA 1O3KA 1ETTH 1O3LA 1SLWB 1TWXB 1YF4A 3F68H 5FL7D 1ELEE 1TGBA 2EC9H 3BTDE 1B0EA 3A7ZA 4Q4LA 2XTTB 3ATWA 3F3BA 1S6LA 1W10U 2J38A 1QFKH 2BZAA 2B7DH 1KSNA 2C90B 4AYYB 5KECA 4KP0A 2SGDE 4MPWA 3SJIA 1PYTD 5JB9S 1L4DA 1V2MT 1CGHA 4NWLA 1KMHB 3B23B 2J5UA 1O3OA 1RTFB 1EQ9A 1AUTC 1DXWA 2PKAB 2AGEX 1QR3E 3E6PH 1DPOA 1GJ5H 1NRQH 1W7XH 5GCHG 3SU5A 2XNIA 1AQ7A 1C5UA 3JZ1B 2F3CE 3TJOA 3K6ZA 1TNJA 1W11U 3LGYA 5C0UA 1O3DA 1QB1A 1QBVH 1XX9A 2ZU3A 3DUXH 1EJAA 4FETA 1VCPA 1KDQA 2I6QA 1DX5M 1E1RD 3RC5A 4UEHH 5DP7A 1TX8A 4A1VA 1P05A 2WPDD 3MU8A 4A6LA 1PFXC 5F53A 3FVFB 5F6MA 3SU1A 1CQQA 1SQOA 1KYNA 2TGDA 4AN7A 1E35B 4GCHF 4X6MA 1G3EA 1ABIH 1DUAA 3RXAA 4CRFA 2F9PA 2YNBA 3ZZ3A 3QX5H 2Y5GA 1ZMNA 3A86A 3ZVGA 4BOHA 1P03A 3RXPA 5B6LA 1SKYE 1CHOG 2NU4E 3ODDA 8ESTE 3PMAB 1ZTJA 2ANYA 3U1IB 5ETXA 1ZMJA 2Q6DA 4O9VA 3L3TA 1BTHH 1A5IA 4ZMAH 2AGIX 4NA7A 3UNSA 1V2UT 5T3HA 3HGNA 1A5GH 4U2WA 4Y71A 1TA6A 5C20A 1TYNA 1GVKB 4ISIH 1V2WT 1H8ED 1QL9A 1MBQA 3PWBA 5C0TA 1GL0E 1N6YA 2CF9H 2ZCLP 2R3YA 1GBLA 3HKIB 2BVRH 1TMBH 2A7CA 5JBCS 1D6WA 1D3TB 4ZHLU 4WH8A 3QGJA 1LKBA 3GISB 1ZPZA 4MNVA 2GCTB 5G4BA 4GPGA 4INKA 1SLVB 4CBNA 1J16A 2VWNA 5F8XA 3UOUA 4YT7H 5BRRE 5EIYA 2PFEA 1HJAC 2KCYA 1WYKA 2Z9IA 3PB1E 4FUGA 3OEED 1VITG 2BY8X 3VB7A 3BEFB 6ESTA 4MTBA 2CXVA 2V3HH 1ZR0A 2HVXA 1LHCH 1O2LA 2O8WA 3MH7A 2D1JA 4CREA 4NIXA 1Z8JB 2Y82A 1EPTB 2GCHF 3PO1B 5EPYA 1LVOA 1O2UA 1TRNA 1XVOA 3A8DA 2KR7A 5T6FA 1V2NT 1K22H 3SI3H 2A7JA 4IN2A 1V3XA 1S5SA 5K0HA 3BG8A 5KGOA 1YPMH 1B7XB 3Q3KA 5C5NA 1J8AA 1V2LT 1PPBH 1LVMA 5EJ1A 2A4GA 1K1PA 1JWTA 5ESTE 3UY9A 1C5RA 2ZGHA 5KEDA 3DA9B 3FOAA 1ZPCA 4MNWA 4FVDA 3ZZDA 1G32B 4YO9A 3SZNA 5C1UA 1DLKB 1PPGE 1T31A 5BPEA 2BY7X 3RXHA 3A83A 1GI6A 4Q2KA 1S6HA 2XOKD 2WUBA 2P59A 2BD4A 2V3MA 1GI8B 1V2ST 1CA0C 1MKWK 1L1JA 4NZQA 3FO8D 2GP9B 3SHCH 1EP6A 5DP3A 2W3KA 1EOJA 4K8YA 5A8XA 1EJNA 5DP8A 2FYQA 2IPHA 1G3DA 1BT7A 1ESAA 5E2OA 2VVCA 2SNWA 3ATKA 1ZSLA 3OTJE 5T6GA 2SGAA 1GBHA 2RDLA 1SGYE 1QBOA 3F9HA 2IN2A 3ZVEA 3S9BA 3E1XB 4YZUA 2ZGXH 3N7DA 3ZZ4A 3MNXA 5E2PA 1O32A 2ASUB 4WWYA 2KCOA 2OQ5A 3SUFA 2KAIA 1AUJA 1O3FA 1KLTA 2HPPH 4AFQA 2XRCA 1UVSH 3PMJA 4GUXA 2P16A 2ALVA 4XSKU 1AE8H 1ZOMA 1CVWH 1TRYA 2TRMA 4KTUA 1T4VH 2BTCE 2A5IA 1HLTH 3MNCA 1O0DH 2VH0A 3ZZ6A 2R2MB 1FAKH 2Z7FE 5C2ZA 2V0BA 5HIYA 2OC0A 3ZZ8A 1MKWH 3LPRA 3WWFA 4B2CA 2O8UA 1RTLA 1FPCH 2K8IA 4KELA 1GBFA 5FPYA 1P10A 1GI5A 3MU4A 2JETC 2W7SA 2ULLA 1GI4A 2OC1A 1L1GA 2A7HA 4Q7YA 3FANA 4A7IB 3S9CA 2VIDA 1KTTB 1FI8A 1BRCE 4GLYA 3HGPA 4NCYA 4D7FA 3TK9A 1P2KA 1U6QA 1LHFH 3UB0A 2AMDA 3F2GA 3FN8A 1ELVA 3LGIA 3LJJA 4KGAA 4X2XA 1SMFE 2AIPA 2QF0A 3TVJB 3M5NA 4DT7B 4RKJB 1UO6A 2LNCA 2QIQA 2TGAA 5AF9H 3SNBA 3V13A 3F2HA 1C5NH 5FX6A 1IQMA 4FUEA 3RXKA 3LOXA 4XE4A 2BVXH 1XMNB 2ZCHP 4NSVA 4X8UH 3RXRA 1FDPA 4I33A 1SGIB 3S69A 4B76A 1TBRH 1L0ZA 1O3BA 1C2KA 1CO7E 4BAMB 1GPZA 4X2YA 4ACAA 3A84A 1FXYA 4A92A 3GCOA 4JYVH 1ELDE 3F1SB 4P02A 2WHXA 3CS7A 3MU1A 4X0WU 1E37B 1F5LA 4FVBA 1SGFA 3MWIU 2ESTE 1OP2A 4XBCA 2C4FH 2XC4A 2ZC9H 1SGFG 2Q6GA 2CHAB 2VGCC 3SU0A 1IQLA 4TYDA 1SI5H 4GHTA 2QY0B 1O2WA 2BD3A 1YLNA 1SC8U 1PPEE 1W8BH 1MAXA 1THPB 1UVOA 3QZRA 3A89A 3RXQA 3QUMP 4E06H 1LO6A 3R0FA 4ZKSU 3LIWA 4CHAB 3SV2H 1C5PA 1THSH 3SQHE 1OPHB 3M7UA 2VIOA 3GY3A 3TH4H 1AB9B 4FU7A 3HKJB 3A8BA 4FUHA 1TAWA 3C27B 3B9FH 2W3IA 3GY8A 1SB1H 1GJ8B 5EODA 3A7XA 3BTWE 4MG3A 1O2GH 3M5OA 2GKVE 5LPEA 1L4ZA 3OX7U 2OD3B 3PLBA 1K9OE 1YPHC 3ZZAA 5IDKA 1KDQB 2B5TB 1EZQA 2BLVA 2WPHS 4VGCB 1AVGH 4UFFH 4UFGH 4X1SU 1O2RA 4ABHA 2ZGCA 3JZ2B 3ZV8A 2OTVA 2H9TH 2B9LA 2VWMA 4AB8A 3MFJA 1C1TA 2HNTE 3F2FA 1C1SA 1TA2A 6GCHF 2YOLA 4X8VH 1WOFA 2Y81A 4YXWD 4ZKRU 3SORA 1AMHA 1TFXA 2XBYA 3KCGH 2Z9GA 1GBTA 7LPRA 2AMPA 4ZXYH 1C2GA 3SJ8A 3E0NB 1W13U 1SFQB 3GCNA 3L6PA 1ANEA 1FY1A 1UK3A 4JZIA 5ABWA 5FAHA 1OWIA 4ABFA 4AYVB 1THRH 1S85A 4TWWA 4BAOB 1S84A 2A5AA 2ZHQH 2VU8E 3RXEA 5E0HA 1O2NA 1O2SA 5T1VA 4CRDA 2FOEA 1F0UA 4RN6A 1O3EA 1BDAA 6CHAB 1YY3A 5GPIB 1WXRA 3TLOA 5EGMA 2GMTB 3KQDA 1T8LA 5DPAA 2D8WA 3T5FH 2AS9A 1TPSA 2ZTXA 3MO6A 1F92A 1FX0B 2VH6A 1O3GA 4YESB 4AFSA 2Y6TA 1WCZA 1YPKH 4B6EA 4HFPB 3A8CA 2F91A 1P2MA 1FJSA 3SU4A 4DG4A 2FO9A 5A09A 1FY3A 3SGAE 1UTPA 2GX4A 1AN1E 2BHGA 3CENA 5E8EH 1DICA 4K8BA 5DP9A 1Y59T 2VWLA 1BTXA 1GJ4H 1GWAA 4NA8A 3BEUA 3GY4A 3OAAD 1NTPA 5JBTA 2ANKH 2DE8A 1HUTH 4A1TA 3AW0A 5DP6A 1C5OH 3MH4A 2QXHA 5HGGA 1H9IE 2BQ7B 6LPRA 1PQ5A 1MU6B 2F43B 4DCDA 1GVLA 3AK5A 3ZVBA 3QTVH 1RS0A 5JDUB 3PLKA 2QN5T 1OSSA 1ELFA 3P8GA 1O30A 4B71A 4F55A 3A7TA 1NROH 1ZMLA 4Y0ZE 1DVAH 3BSQA 3RXDA 3E90B 1O5DH 1Z7KA 4ZAEA 4HTCH 1QIXB 1GGDC 1B5GH 1A46H 4U32A 4DT4A 2OK5A 5C67A 1EXFA 3BTGE 3UR6A 1BMNH 4XFQA 1T7CA 1D6RA 2BDYA 4SGAE 2Y80A 1TPOA 3NK8A 1TGNA 1P04A 1QA0A 4K1EA 1D9IA 2ZU5A 1C2IA 2VB0A 5FX5A 2FMJA 3BN9A 1MD7A 5IK2D 1HCGA 4ZCNA 1SPJA 5DKMA 2IOTA 3DD2H 2AH4X 1IHTH 1NM6A 5E0GA 5CMXH 4TWYA 1QBNA 4R0IA 1GHWH 1YBWA 5C5OA 4UFEH 4TPIZ 3V0XA 2J2UA 3RXJA 3GCTG 3MYWA 2ZDMA 1FY5A 2F9NA 2DUCA 2GGVB 1J15A 3BV9B 3EA8A 3RXFA 3UQOA 2FX6A 2NWNA 2WV9A 2BXTH 3B8JA 2K0QA 4D9QA 3S7HB 2SFAA 1GMCF 1LQEA 1NPMA 3I77A 3LONA 3RXMA 4IMZA 1O3CA 1QQUA 1H4WA 3SGBE 3FFGA 1NY22 2EI8A 2ANMH 2ODPA 2ZFFH 3OTPA 4GVUA 4XDEA 3BTQE 1XUJA 2CJIA 2ZG0H 3I29A 4MDSA 1SQTA 1UJ1A 1NBME 1UMAH 3PMHB 1TNKA 1C2JA 1GVZA 4Q7ZA 5EW2H 2BVSH 2WPMS 5DP5A 3SU2A 1WQSA 5CHAB 3V12A 3EE0B 3LC3A 2ZDAH 3V3MA 1SL3A 3T28A 2KAIB 3MNBA 1TMTH 1YCPM 3M7QA 3NCLA 3KF2A 3KNXA 1AVWA 4DW2U 4O3UA 3UNQA 1C1QA 3RC4A 4HZHA 2PSXA 1AFQC 3R3GB 1BQYA 2TGPZ 3SGQE 2FS8A 3MNSA 3DSOA 1P2NA 2BM2A 1KXDA 1QB9A 1SLXB 1HDTH 4ISHH 3SBKA 1V2KT 3SJKA 1Z6JH 2Z94A 1SGDE 1XUKA 4OGYA 1RIWB 2QF4A 3E8LA 4D76A 3TGIE 3UR9A 2P3TB 2TPIZ 3UUZA 1W7GH 1C5LH 3F9GA 2J4IA 4WVPE 4BTTB 2WYGA 1QA7A 2PR3A 2BDAA 2BLOA 1P2OA 5F8TA 1TPPA 1IHSH 2EQNA 3BTKE 2P93A 1GI3A 3SOSA 3EA7A 1VJAU 2PWXA 4YOGA 1G37A 1A3BH 1D3PB 1NC6A 2Y5HA 1Y8TA 4K2YA 5CE1A 2PW8H 1XKBC 2NU1E 2V35A 1DANH 4B1TA 3TJUA 1G2MA 1W0ZU 1NFXA 3K6YA 1C4Y2 4WMEA 3NPSA 4FUDA 1ELAA 1ANCA 2BDBA 1UTMA 1W0YH 2WPKS 1G3CA 4D7GA 2OBOA 1LPZB 2BLWA 3FZDA 2RG3A 4TPYA 2XNDD 1YPLH 1DITH 5FPTA 4AFUA 2J34A 4ZH8A 3ATMA 1GMHF 1EKBB 2A4QA 1GJ7B 1VCQA 3VXEH 1FUJA 2ZECA 2ZU1A 2BD2A 1ANDA 5J4SA 2WUCA 4UFDH 3RXUA 1RFNA 3LGVA 4LK4A 1HAOH 1GBCA 3W95A 1BMLA 1WBGB 3F9EA 8GCHF 2H6MA 3D49H 4E7RG 3ZVFA 4Y8YA 1Y5UT 1VZQH 2KCAA 1C1VH 1N8OC 2YMSC 5C94A 2ZFSA 4UD9H 5FHTA 1P11E 1C2MA 1EX3A 3M7TA 4FUJA 4K69A 3BTEE 4I8LA 3F0OA 1YCPH 1CSOE 2GZ8A 2HRVA 1JIMA 1BTZA 2F4LA 2CF8H 2J97A 1HRTH 3RXBA 1NRNH 1RD3B 3HPTB 4K3JA 4PROA 1TBZH 1GHBF 3VB5A 3MOCA 4NIYA 1CE5A 1GJ6A 2UUYA 2W6JD 2VVVA 4O3TA 2FODA 1K1NA 4IGDA 1WV7H 1UCYE 2ZO3H 1WDIA 3RXIA 3OY5U 2XXLA 1HYLA 3TK6A 5GXPA 2KCPA 1O2OA 5EOKA 2Q1JA 2CV3A 1SQRA 2IJOB 2EY4C 2UUKB 1O2JA 1H8DH 1FNIA 2W7UA 4FUFA 1NN6A 1WSSH 3QWCH 1G36A 1HV7A 2ZF0H 5JBAS 3E16B 2M2AA 3ZVDA 1HGTH 2FEQH 3H5CB 1C5ZB 3GDVA 2VIQA 1NFWA 4FUBA 1AD8H 3M35A 1BIOA 1GDNA 1MABB 1C1PA 1OP0A 1V2VT 2R2WU 1DE7H 1V6DA 3RUOA 2ZHEH 1HAZB 3VGCB 1OS8A 1MCTA 4ESTE 1XUGA 2OQUA 5EQSA 2BYAX 1O5CB 1NESE 3ZYDA 2OCVB 1INCA 4H6SB 2PV9B 3TITA 2BDIA 3M3TA 1T8OA 3PLPA 4OS1A 1KXBA 1GMDG 3URDA 2GV6A 1ZGIA 3T27A 3GCHB 1D4PB 4I8GA 2BQWB 3U9AH 2CK3D 1B0FA 3M3SA 4CBOA 2ANWA 2FI4E 1QY6A 2WZQA 1S0QA 1C2HA 2HLCA 3F0PA 1MTSA 1FLEE 1DOJA 2F9OA 3M5MA 4KTCA 3OFND 1O3JA 3TNSA 3GY5A 1HAHH 2A4RA 5F03A 3N99A 1TQ7B 5GCHF 4HI3A 3TK5A 1UHBA 3PRDA 2OINA 1SFIA 4ZHAA 4YLUA 1IQKA 2H5DA 4AGKA 2BLQA 1SOTA 2GZ7A 2FOFA 1K1LA 2ZPRA 2QF5A 1PPFE 1SOZA 1FQ3A 1BRUP 2NU3E 1QJ6B 2A4OA 3RXTA 1P2IA 1OYQA 1JIRA 3SJ9A 1T8MA 1YP9A 3GDUA 1M9UA 1RGQA 1VGCC 1O2IA 2O8LA 1GBJA 3BF6H 2JH0D 1FMGA 3BIUH 2L74A 3Q76A 2HNTC 2ZFQH 2PKSB 2V6NA 3NWUA 1BHXB 2FDAA 3MU5A 4YT6H 3LGWA 2AHME 2GDDA 3SNAA 4NFEA 4NIVA 1NBMD 1KXCA 1LHGH 1TIOA 2QA9E 4OS7A 4CRBA 2GV7A 3BG4B 3EE7A 5TJXA 1UK2A 1JRTA 2H9EH 1TNLA 2HVYB 1FONA 1P01A 3GOVB 3ZYEA 4D9RA 1G9IE 4Q7XA 1SGCA 1CGJE 1CHOF 3OY6U 5C1YA 1EAIA 4E7NA 2P8OC 1C1UH 2BB4A 1EP5A 4GSOA 1XKAC 5JB8S 1GG6B 1ESBA 1Y3YA 2QGRA 2L6OA 3QK1A 4MNXA 1XXFA 4ASHA 3CNRA 3RMNH 1QCPA 1IQFA 1O2MA 4ACBA 2UWLA 4WY3A 3PMBB 2SGEE 2FIRH 2ZHDA 1O5BB 4K1SA 3RXOA 1EFRD 4GAWA 2CGAA 1HNEE 4MNYA 2C8XB 1EOLA 5HM9A 2VWOA 1ZSJA 1GCTC 4RI0A 1A2CH 1O39A 3SZEA 4H6TA 4X2VA 1OXGA 3KEEA 2QC2A 4B73A 1F5KU 4I8JA 1ZLRA 5DSFA 1SQAA 4DVAU 4Z1MD 1C4V2 3QTOH 2LELA 1Y3WA 5A2MH 1GBEA 2BD8A 3RXSA 3D23A 1V2RT 3AW1A 1P2JA 1AHTH 1EZSC 2H1UA 4AOQA 2A32A 1O31A 1O5GH 4JZ1A 3O8RA 2G4TA 1ELTA 2FOAA 4FUCA 2JKHA 4TY7A 4AFZA 1TGCA 1GJ9B 2FOBA 4ABGA 2FM2A 2FTLE 1BTYA 3U69H 4FU8A 1DWEH 4ZKNU 9ESTA 1GJDB 5L2YH 4OS4A 3H09A 5A8ZA 4UONA 1TB6H 1LDTT 2UWPA 1Z8GA 3Q3XA 1AWHB 3KQCA 3UTUH 3M37A 4ASUD 1P9UA 1O2HA 1ZRBA 2J98A 1GHYH 1A7SA 1PJPA 2A1DB 5E0JA 2K1QA 2G00A 3VB6A 5DK1A 1CT4E 1JXPA 2O8TA 3PWCA 2PHBA 1UW7A 1HAGE 2FOGA 3EQ0H 3VB3A 4FUIA 1GI7B 2ZQ1A 2QYIA 1S83A 2A5KA 2Y5FA 1C4U2 4K1TA 1MCVA 2BY5X 1MTWA 2ZPQA 3QZQA 1D3DB 4IBLH 3ZZ7A 3EDXB 1HAXB 2GZ9A 5EJZA 2GCTC 3RXGA 5HKKD 3H7OA 1NRSH 1C2DA 4KKDA 1ELBA 3RP2A 1K1OA 1P0SH 1C1NA 1Q3XA 1G3BA 2BQ6B 4THNH 1MKXH 2O8MA 1O2VA 1MTNB 1SGQE 1ZTKA 1WTHD 5FCRA 3MH6A 1NS3A 1LMWB 3PO1C 5FBEA 3T29A 2Z9LA 1ESTA 2RA3A 3SW2B 1NO9H 1UVUH 2SGQE 4YLQH 2ZDKA 1QRWA 4CRCA 1BBRE 4TT3D 2G5NA 4NZLA 3ENSB 3WY8A 1EZUC 2RFKC 1GL1A 3W94A 2ZZUH 3UOPA 3ZIAD 1MU8B 1A0JA 2EEKA 1X7AC 2O9QA 2ZP0H 1H1BA 2HNTF 3OYPA 1GHAG 1EB2A 1ZPBA 4A1XA 1TRMA 3EAJA 1FIZA 2ZGBH 1YLDA 2BD5A 2JJ1D 3VFEA 1SLUB 3QO6A 1V2OT 1C5SA 2BDCA 2C8WB 1GMCG 3MMGA 2VIVA 1TABE 2OC7A 3KQEA 2WV4A 1H9HE 4WJG2 2VBCA 2AIQA 3RXCA 1ZGVA 2YNAA 2B0FA 1BB0B 1P06A 1YWUA 3TU7H 3UPEA 3RC6A 3BTTE 4CR5A 3M3VA 1V2PT 2OLGA 1VITH 3KN2A 2ZHWH 1LPGB 1H8IH 1PPHE 1HAYB 1C5QA 3PRBA 4IW4E 1SG8B 2GDEH 3F9FA 1E36B 1AZ8A 1LQDB 1OOKB 1TBQH 3BEIB 1DWBH 5I25A 2G52A 3LC5A 1ORFA 4NG9H 5GIBA 1LVBA 1L2EA 3VEQB 4Z6AH 4Y7AA 3ZZBA 2W6ID 3PTBA 2ZDNA 2WPJS 3K9XB 3TH2H 1TPAE 3GY6A 4B74A 2H9HA 1MQ5A 1P57B 2PTCE 1S81A 3TGKE 4BAKB 4ZXXH 5LH8A 2A31A 2A2QH 2EA3A 1N8OB 1C5MD 1O3IA 2BOKA 1O5EH 2YMSB 2ODQA 1FN8A 1Z1JA 1QL8A 2EI6A 1F0TA 3MQKC 4ISNA 3RU4D 3ODFA 1K1MA 4Y76A 4LXBH 3HK6B 3MU0A 1A0HB 3LJOA 5EXMA 5C1XA 4OS5A 2GTBA 4D8NA 1PQ8A 1BOQA 2PUXB 2FOCA 5FXLA 5GDSH 1GBAA 3UNRA 2PUQH 2Z9KA 8LPRA 5AFYH 2HGTH 4BANB 2ZI2H 3RDZA 3TH3H 4I31A 4Y6DA 1FN6A 2AMQA 2BY9X 1RTKA 4GCHG 4ISOA 3NRLA 2GD4B 1OKXA 3F6UH 3UIRA 1EAXA 1T8NA 1HBTH 1DDJA 1HJAB 1C5XB 3HATH 1AIXH 1TGSZ 1BBRH 1DWCH 2VNTA 1MTUA 5LGOA 4TSFD 1OYTH 1TNHA 1L1NA 1O2ZA 3M5LA 1GBDA 1SR5C 4NWKA 3MHWU 1DM4B 4ZROA 1FV9A 2WPIS 3DSPA 4WF8A 3SQEE 1O3AA 3IG6B 4X1PU 4DY7B 4AB9A 5DP4A 3LH3A 1O3PB 4YOJA 4SGBE 3T2NA 3A80A 2ALPA 2WSSD 4AX9H 2IPQX 1SHYA 4ABBA 4QT8C 2R0KA 2AYWA 1AKSA 1UHBB 5DJ7A 3T62A 3VPKA 3AAVA 1DY8A 3P8NA 3FZZA 2YMSD 1LCYA 4ABDA 1O5FH 1BTWA 4Z0KA 3SNEA 1E0FD 1HXFH 2ZGJA 4ZKOU 1K21H 1OWEA 1HXEH 1PPZA 2HOBA 2JIZD 2PLXA 5CHBA 3G01A 3NKKA 4O97A 4P00A 3H7TA 2F83A 1AWFH 2XWAA 3UAIC 1XUHA 3K65B 4AGJA 1NZQH 2UUFB 1FAXA 4MQAA 5GJ4B 2CHAC 3RLYH 1YPGH 3HK3B 4XOJA 1CA0B 2DE9A 2RDEA 1KIGH 1GBBA 3SN8A 2XW9A 3AASA 4Y8ZA 2PGQB 2BD7A 2FS9A 3ITIA 2ZU4A 3SV7A 5L30H 5HM2A 1UTNA 3ZVAA 5L6NH 2Z3EA 3A7VA 1CGIE 3BTFE 1AFEH 4CHAC 4J1YA 5HXFA 2FTMA 5EW1H 4RSPA 3TNTA 2JDID 5JYIA 1AB9C 2GCHG 1EZXC 3KIDU 4WMFA 2BZ6H 3A88A 1VGCB 1YPHE 4XD7D 2FP7B 3DT0H 2XYAA 3IITA 5H4IB 1VR1H 1F5RA 4DURA 1AU8A 4OGXA 4F4OC 3RU4T 1KTSB 4X2WA 1TOMH 5DGJA 4ZHMU 1N1LA 1TX7A 2XCFA 1GHVH 1Z71A 1TX6A 1YCPK 3STIA 4YM9A 1A0LA 4VGCC 1W2KH 2G55A 4DJZB 2P8OB 4DIIH 2ILNA 4XBDA 1C9TA 4X6NA 1AGJA 1UTKA 1WTGH 1BHXF 2CMYA 2QXGA 1UK4A 2V3OH 2ZDVH 1JOUB 4I86A 1QB6A 4BAHB 1IQEA 4AORA 4NIWA 4CRGA 2XBWA 2R3UA 1ARCA 3EA9A 3Q3YA 1XUIA 1EAUA 4HGCA 2QCYA 1O38A 1W0KD 3RM2H 4ABJA 1G2LA 1ARBA 3DHKH 4AG2A 3UWJH 3PV2A 1NU9A 7GCHF 1GCTB 2JETB 3UREA 2FI5E 1OX1A 1BMFD 1QGFA 4YTAA 4H42U 3BIVH 4E05H 5AFZH 1LTOA 3K2UA 1K1IA 1BJUA 3NUMA 4Y8XA 2TIOA 1PQAA 4JYTA 1GDUA 1PQ7A 3EGKH 2FESH 1E38B 6CHAC 1P09A 9LPRA 1Z8RA 1LHEH 3P70B 1WU1A 3U8TH 3FAOA 2J98B 2GMTC 3A82A 1ETSH 1C2FA 4B2AA 1J9CH 1C1RA 2H5CA 2TBSA 5EQRA 3PTNA 1HFDA 1C5VA 1IQJA 1BCUH 1J14A 4IC6A 1WQVH 3UQVA 3TGJE 1C9PA 1LPKB 1OHHD 2VIPA 2JH6D 2ZEBA 1DWDH 1TALA 4NGAH 2QF3A 3KQ5A 4Q80A 2RCEA 1HAVA 3ESTA 1GBIA 1Y3VA 4UDWH 1GI1A 2WINI 1ELGA 1V2QT 5SGAE 3S0NA 3AAUA 3O8DA 3PM3A 2ZPSA 5T6DA 1KLJH 1GCDA 5C17A 2A45B 1TONA 1MZAA 1OWDA 2ZTYA 3GCTF 5JPMH 4INHA 1CHGA 4B75A 3N7EA 2FPZA 3U8OH 1K1JA 1TE0A 1DSUA 5EXLA 1ETRH 1HAIH 1TNGA 3U28C 4DGJA 1K0HA 1C2EA 2PTNA 2VGCB 4Q63A 5HYOA 3DSGA 1G30B 1MUEB 1P12E 2ZQ2A 4RT1A 1WUNH 4J2YB 3A7YA 1NRPH 2IJD1 3MI4A 3SUEA 4ABAA 2R0LA 2J94A 1NRRH 1O36A 4MPUA 4NA9H 3U8RH 3SNCA 3W1EA 3V7TA 1P2QA 2BMGB 1K2I1 4AG1A 1DSTA 1AZZA 3SHAH 3ZZ5A 4ABEA 5GWZA 4DOQA 1LKAA 1PYTC 1HAPH 3L33A 4U01A 1AVXA 3GS9A 1XXDA 3BTME 3KYGA 1C1MA 1C5TA 1F2SE 2AGGX 2VJ1A 4M7GA 3MTYA 2Y7ZA 4ABIA 1QHRB 1BRBE 1N6XA 2ZWLH 3ZV9A 3ZZCA 5EXNA 2ZA5A 2B8OH 1LVYA 4M9FA 1UCYK 4MVNA 1T4UH 1PPCE 4CH2B 2LPRA 1P3EA 2FI3E 1IQGA 1P9SA 4IC5A 1P8VC 1DXPA 1DT2A 5AHGH 3QLPH 2NU0E 2P3FH 4WH6A 1HIAA 3CS0A 3A81A 1DFPA 1XVMA 1GHXH 2F9UA 3RXLA 1UVPA 1EATA 1GBKA 2ODYB 3PV4A 2ZDLA 2A2XH 1CBWC 3SO3A 8KME2 1GI9B 1E1QD 4WXVA 1Q31A 4FOUC 2Z6BD 1KY9A 1ZHPA 2FXRA 1SVPA 2AFQB 3KYFA 1Z1IA 5CHAC 2Q6FA 1KXAA 2J95A 2VINA 3CP7A 1KLIH 2QAAA 1O2XA 3SYJA 2OXSA 4IMQA 5FPSA 3VXFH 1KXFA 1SBWA 4AZ2B 1UTJA 1JMOH 2F9VA 1P3CA 3P95A 3RU4E 3I78A 4B2BA 1KXEA 2GT7A 1O37A 2ZIQH 1FY8E 1TNIA 3GYLB 4INLA 3GYMA 3LH1A 1UTQA 2F9BH 2BX4A 4BNRA 1O2TA 2LP6A 4RKOB 1UCYH 5I46H 2FZZA 3P17H 1GBMA 2HWLB 1RIWC 1UTOA 1Z6EA 2JH5D 5EU8A 2XC5A 4U30A 4F49A 3NZIA 1C5WB 4O03A 1NT1A 2PP6A 6GCHG 1EUFA 1GI0A 2HALA 3E3TA 3FP8E 2P95A 5A0CA 1FY4A 3U98H 1S82A 1IQNA 2FOHA 2QV1A 1YC0A 2HPQH 3RMOH 1QZ8A 2PKAA 1ZTLA 1AI8H 7ESTE 3U1JB 1F0SA 1GJCB 2FLBH 5A0BA 1GDQA 2BDGA 1K28D 2I6SA 1SGTA 1O2YA 4LOYH 2EI7A 4OS6A 5HMAA 1BMMH 4JZFH 1ZHMA 1BTUA 2FLRH 2G4UA 3QN7A 5HIZA 2ZNKH 3DFJA 1MKXK 1VITF 1GGDB 1T32A 4I8HA 4JZEH 1AKSB 5EJLA 2H2ZA 1QL7A 2QXIA 1HB0B 2KX4A 1O3HA 5ESBA 2J9NA 3SV9A 1S0RA 3SJOA 3P8FA 5DG6A 1LHDH 3SU6A 1YPJH 3VB4A 3KL6A 5CDFE 2FOMB 3UFAA 3UWIA 1ID5H 1XM1A 1ZYOA 1MH0A 4R8TB 1TGTA 4ZUHA
chains in the Genus database with same CATH topology
3OSYA 1Y5BT 1MTVA 1DLEA 1ZHRA 3TJNA 1YYY1 5EG4A 5A0AE 4IN1A 1GMDF 2XWBI 1OWKA 3D65E 2BXUH 5IYTA 1MD8A 1IQHA 3E0PB 1Q2WA 2OUAA 1C1OA 3M36A 3SI4H 2SGFE 1W3CA 1ABJH 3ATIA 2A0QB 3Q00A 4YOIA 3KGPA 3KHVA 1RJXB 1Y3UA 3TIUA 2BDHA 2OP9A 5F8ZA 1EAWA 1QJ1B 1VCWA 1C1WH 3MO3A 3C1KA 1CT0E 2AEIH 4K5ZA 3A87A 1F0RA 2XC0A 1V2JT 1Y5AT 2PSYA 4WMDA 3PYHA 2OC8A 5TCAA 4KTSA 2BD9A 2Z9JA 3LT3A 4X6PA 3QDZB 3M61U 3STJA 1NFUA 4FU9A 2C93B 4X8TH 1A1RA 1EPTC 2G8TA 1BJVA 1AO5A 1J17T 5TCCA 2QXJA 3KQBA 4X1QU 2VVUA 1SGEE 1DUEA 1EJMA 3VGCC 5B6OA 3GDSA 3FP7E 1AY6H 3MH5A 3MO9A 1UVTH 2C8ZB 3NXPA 2ZFPH 3LU9B 1TQ0B 4BAQB 1AFQB 3ATLA 3SV6A 4JYUH 4JK5A 1QTFA 2P94A 1NU7B 2RA0A 4MLFB 1AE5A 1ZJDA 1RXPA 2ZCKP 1BTPA 4X8SH 3GCHC 1O34A 1IOEA 3LGUA 1O33A 1TMUH 3FP6E 1SGPE 1ANBA 2STBE 1EPTA 2WPLS 1MAYA 2THFB 3GY2A 1V2TT 4JCNA 3P92A 5C3NA 2Y7XA 3O8BA 1BITA 4ISLA 1A4WH 1SHHB 2ZFRH 3RLWH 1SSXA 4OS2A 4JMYA 3QGNB 4MPXA 5DO4H 4LZ4B 2SNVA 5FCKA 1H9LB 2FWWA 3ELAH 1FIWA 4H4FA 1GHZA 1GJBB 1HPGA 1XUFA 1QQ4A 3LKWA 5PTPA 1QJ7B 2BX3A 3Q77A 2AERH 1MMJN 3DFLA 5K7RA 4XBBA 3TJVA 5JBBS 1BBRK 4BTUB 5LPFA 2M5TA 2XCNA 2PKSC 1GI2A 3P8OA 1SGNE 2UWOA 1FZZA 3IWMA 2R9PA 1HAVB 3LGTA 1YKTA 2TGTA 1ELCA 3BG4C 1FPHH 5AVDA 4Y79A 2G5VA 4DIHH 2ZKSA 3S9AA 1P02A 3OU0A 1SGRE 2GVFA 2XBVA 1BMAA 1C5YB 1EB1H 1ZZZA 1GG6C 1O2PA 1YM0A 2C8YB 1IQIA 1UTLM 4Y11E 4GHQA 2Z3DA 4I7YH 1MQ6A 2CN0H 1MZDA 4JZDH 3D62A 3A7WA 3SNDA 1A3EH 2WYJA 2D2DA 3A85A 2D26C 2UUJB 2J92A 4Y10E 1VJ9U 1O3NA 1O5AB 5FBIA 3SUGA 1IAUA 4BTIB 1CT2E 2VIWA 3RMMH 1GJAB 1OWJA 1Y3XA 2ZFTA 1BZXE 7GCHG 1YGCH 1CA8B 4Y7BA 5EPNA 4IS5A 1NFYA 4CRAA 1GMHG 3SUDA 1JRSA 3SU3A 4FXGH 1TLDA 4NFFA 4TY6A 4CH8B 3SV8A 1HJ8A 1WAYB 1F7ZA 1O35A 3AVZA 2W26A 4K60A 2FX4A 5EQQA 1O2QA 8GCHG 1W12U 2Z3CA 3RXVA 4I8KA 1HJ9A 4LZ1H 1ZSKA 2ZHFH 4NSYA 2NU2E 1A61H 4X1RU 1DS2E 3EYDA 1ZRKA 1BUIA 5J4QA 2WV5A 1OWHA 1YPEH 1C2LA 1HIAB 1D3QB 1W14U 1DY9A 3TPIZ 2G81E 4A5TS 1A5HA 3GICB 4WXIA 1BA8B 3A8AA 1ACBE 1GHBG 5A8YA 3LDXH 4Y0YE 3BTHE 4I32A 4MPVA 1S6FA 1Z8IB 3ZZ9A 1GHAF 2C3SA 2PGBB 4JK6A 2XBXA 2SGPE 3RM0H 1QRZA 4BXWA 7KMEH 1O3MA 3S7KB 2BY6X 1OP8A 2W5EA 1TOCB 3RMLH 2BOHB 1ZJKA 1QNJA 1YLCA 3T25A 1MBMA 2P3UB 4UE7H 2FYRA 4X1NU 3URCA 1EASA 3ZVCA 1QRXA 3E91A 5L2ZH 3O8CA 4CR9A 1BRAA 1CU1A 4X6OA 3T26A 2OBQA 1CBWB 1RRKA 2STAE 1O2KA 5LPRA 2G51A 3PROA 2ZU2A 2ZTZA 3P6ZB 1QURH 3GY7A 3N7OA 1E34B 2GT8A 1JBUH 1MTNC 4BXSA 1O3KA 1ETTH 1O3LA 1SLWB 1TWXB 1YF4A 3F68H 1ELEE 1TGBA 2EC9H 3BTDE 1B0EA 3A7ZA 2XTTB 3ATWA 1W10U 2J38A 1QFKH 2BZAA 2B7DH 1KSNA 2C90B 4AYYB 4KP0A 2SGDE 4MPWA 3SJIA 1PYTD 5JB9S 1L4DA 1V2MT 1CGHA 4NWLA 3B23B 1O3OA 1RTFB 1EQ9A 1AUTC 1DXWA 2PKAB 2AGEX 1QR3E 3E6PH 1DPOA 1GJ5H 1NRQH 1W7XH 5GCHG 3SU5A 2XNIA 1AQ7A 1C5UA 3JZ1B 2F3CE 3TJOA 3K6ZA 1TNJA 1W11U 3LGYA 1O3DA 1QB1A 1QBVH 1XX9A 2ZU3A 3DUXH 1EJAA 1VCPA 1KDQA 2I6QA 1DX5M 3RC5A 4UEHH 5DP7A 1TX8A 4A1VA 1P05A 3MU8A 4A6LA 1PFXC 3FVFB 5F6MA 3SU1A 1CQQA 1SQOA 1KYNA 2TGDA 4AN7A 1E35B 4GCHF 4X6MA 1G3EA 1ABIH 1DUAA 3RXAA 4CRFA 2F9PA 2YNBA 3ZZ3A 3QX5H 2Y5GA 1ZMNA 3A86A 3ZVGA 4BOHA 1P03A 3RXPA 1CHOG 2NU4E 3ODDA 8ESTE 3PMAB 1ZTJA 2ANYA 3U1IB 5ETXA 1ZMJA 2Q6DA 4O9VA 3L3TA 1BTHH 1A5IA 4ZMAH 2AGIX 4NA7A 3UNSA 1V2UT 5T3HA 3HGNA 1A5GH 4U2WA 4Y71A 1TA6A 5C20A 1TYNA 1GVKB 4ISIH 1V2WT 1QL9A 1MBQA 3PWBA 1GL0E 1N6YA 2CF9H 2ZCLP 2R3YA 1GBLA 3HKIB 2BVRH 1TMBH 2A7CA 5JBCS 1D6WA 1D3TB 4ZHLU 4WH8A 3QGJA 1LKBA 3GISB 1ZPZA 4MNVA 2GCTB 5G4BA 4GPGA 4INKA 1SLVB 4CBNA 1J16A 2VWNA 5F8XA 3UOUA 4YT7H 5BRRE 2PFEA 1HJAC 1WYKA 2Z9IA 3PB1E 4FUGA 1VITG 2BY8X 3VB7A 3BEFB 6ESTA 4MTBA 2CXVA 2V3HH 1ZR0A 2HVXA 1LHCH 1O2LA 2O8WA 3MH7A 2D1JA 4CREA 4NIXA 1Z8JB 2Y82A 1EPTB 2GCHF 3PO1B 5EPYA 1LVOA 1O2UA 1TRNA 1XVOA 3A8DA 5T6FA 1V2NT 1K22H 3SI3H 2A7JA 4IN2A 1V3XA 1S5SA 5K0HA 3BG8A 1YPMH 1B7XB 3Q3KA 5C5NA 1J8AA 1V2LT 1PPBH 1LVMA 2A4GA 1K1PA 1JWTA 5ESTE 3UY9A 1C5RA 2ZGHA 3DA9B 1ZPCA 4MNWA 4FVDA 3ZZDA 1G32B 4YO9A 3SZNA 5C1UA 1DLKB 1PPGE 1T31A 5BPEA 2BY7X 3RXHA 3A83A 1GI6A 4Q2KA 1S6HA 2WUBA 2P59A 2BD4A 1GI8B 1V2ST 1CA0C 1MKWK 1L1JA 4NZQA 2GP9B 3SHCH 1EP6A 5DP3A 2W3KA 1EOJA 4K8YA 5A8XA 1EJNA 5DP8A 2FYQA 2IPHA 1G3DA 1BT7A 1ESAA 5E2OA 2VVCA 2SNWA 3ATKA 1ZSLA 3OTJE 5T6GA 2SGAA 1GBHA 2RDLA 1SGYE 1QBOA 3F9HA 2IN2A 3ZVEA 3S9BA 3E1XB 4YZUA 2ZGXH 3ZZ4A 3MNXA 5E2PA 1O32A 2ASUB 4WWYA 2OQ5A 3SUFA 2KAIA 1AUJA 1O3FA 1KLTA 2HPPH 4AFQA 2XRCA 1UVSH 3PMJA 4GUXA 2P16A 2ALVA 4XSKU 1AE8H 1ZOMA 1CVWH 1TRYA 2TRMA 4KTUA 1T4VH 2BTCE 2A5IA 1HLTH 3MNCA 1O0DH 2VH0A 3ZZ6A 2R2MB 1FAKH 2Z7FE 5C2ZA 2V0BA 2OC0A 3ZZ8A 1MKWH 3LPRA 4B2CA 2O8UA 1RTLA 1FPCH 4KELA 1GBFA 5FPYA 1P10A 1GI5A 3MU4A 2JETC 2W7SA 2ULLA 1GI4A 2OC1A 1L1GA 2A7HA 4Q7YA 3FANA 4A7IB 3S9CA 2VIDA 1KTTB 1FI8A 1BRCE 4GLYA 3HGPA 4NCYA 4D7FA 3TK9A 1P2KA 1U6QA 1LHFH 2AMDA 3LGIA 1ELVA 4KGAA 3LJJA 4X2XA 1SMFE 2AIPA 2QF0A 3TVJB 3M5NA 4DT7B 4RKJB 1UO6A 2LNCA 2QIQA 2TGAA 5AF9H 3SNBA 3V13A 1C5NH 5FX6A 1IQMA 4FUEA 3RXKA 3LOXA 4XE4A 2BVXH 1XMNB 2ZCHP 4NSVA 4X8UH 3RXRA 1FDPA 4I33A 1SGIB 3S69A 4B76A 1TBRH 1L0ZA 1O3BA 1C2KA 1CO7E 4BAMB 1GPZA 4X2YA 3A84A 1FXYA 4A92A 3GCOA 4JYVH 1ELDE 3F1SB 3CS7A 3MU1A 4X0WU 1E37B 1F5LA 4FVBA 1SGFA 3MWIU 2ESTE 1OP2A 4XBCA 2C4FH 2XC4A 2ZC9H 1SGFG 2Q6GA 2CHAB 2VGCC 3SU0A 1IQLA 4TYDA 1SI5H 4GHTA 2QY0B 1O2WA 2BD3A 1SC8U 1PPEE 1W8BH 1MAXA 1THPB 1UVOA 3QZRA 3A89A 3RXQA 3QUMP 4E06H 1LO6A 3R0FA 4ZKSU 3LIWA 4CHAB 3SV2H 1C5PA 1THSH 3SQHE 1OPHB 3M7UA 2VIOA 3GY3A 3TH4H 1AB9B 4FU7A 3HKJB 3A8BA 4FUHA 1TAWA 3C27B 3B9FH 2W3IA 3GY8A 1SB1H 1GJ8B 5EODA 3A7XA 3BTWE 4MG3A 1O2GH 3M5OA 2GKVE 5LPEA 1L4ZA 3OX7U 2OD3B 3PLBA 1K9OE 1YPHC 3ZZAA 5IDKA 1KDQB 2B5TB 1EZQA 2BLVA 2WPHS 4VGCB 1AVGH 4UFFH 4UFGH 4X1SU 1O2RA 4ABHA 2ZGCA 3JZ2B 3ZV8A 2OTVA 2H9TH 2B9LA 2VWMA 4AB8A 3MFJA 1C1TA 2HNTE 1C1SA 1TA2A 6GCHF 2YOLA 4X8VH 1WOFA 2Y81A 4ZKRU 3SORA 1AMHA 1TFXA 2XBYA 3KCGH 2Z9GA 1GBTA 7LPRA 2AMPA 4ZXYH 1C2GA 3SJ8A 3E0NB 1W13U 1SFQB 3GCNA 3L6PA 1ANEA 1FY1A 1UK3A 4JZIA 5ABWA 5FAHA 1OWIA 4ABFA 4AYVB 1THRH 1S85A 4TWWA 4BAOB 1S84A 2A5AA 2ZHQH 2VU8E 3RXEA 5E0HA 1O2NA 1O2SA 4CRDA 2FOEA 1F0UA 4RN6A 1O3EA 1BDAA 6CHAB 5GPIB 3TLOA 5EGMA 2GMTB 3KQDA 1T8LA 5DPAA 2D8WA 3T5FH 2AS9A 1TPSA 2ZTXA 3MO6A 1F92A 2VH6A 1O3GA 4YESB 4AFSA 2Y6TA 1WCZA 1YPKH 4HFPB 3A8CA 2F91A 1P2MA 1FJSA 3SU4A 4DG4A 2FO9A 5A09A 1FY3A 3SGAE 1UTPA 2GX4A 1AN1E 2BHGA 3CENA 5E8EH 1DICA 4K8BA 5DP9A 1Y59T 2VWLA 1BTXA 1GJ4H 1GWAA 4NA8A 3BEUA 3GY4A 1NTPA 5JBTA 2ANKH 2DE8A 1HUTH 4A1TA 3AW0A 5DP6A 1C5OH 3MH4A 2QXHA 5HGGA 1H9IE 2BQ7B 6LPRA 1PQ5A 1MU6B 4DCDA 1GVLA 3ZVBA 3QTVH 1RS0A 5JDUB 3PLKA 2QN5T 1OSSA 1ELFA 3P8GA 1O30A 4B71A 3A7TA 1NROH 1ZMLA 4Y0ZE 1DVAH 3BSQA 3RXDA 3E90B 1O5DH 1Z7KA 4ZAEA 4HTCH 1QIXB 1GGDC 1B5GH 1A46H 4U32A 5C67A 1EXFA 3BTGE 3UR6A 1BMNH 4XFQA 1T7CA 1D6RA 2BDYA 4SGAE 2Y80A 1TPOA 3NK8A 1TGNA 1P04A 1QA0A 4K1EA 1D9IA 2ZU5A 1C2IA 2VB0A 5FX5A 2FMJA 3BN9A 1MD7A 1HCGA 1SPJA 5DKMA 2IOTA 3DD2H 2AH4X 1IHTH 1NM6A 5E0GA 5CMXH 4TWYA 1QBNA 4R0IA 1GHWH 1YBWA 5C5OA 4UFEH 4TPIZ 3V0XA 2J2UA 3RXJA 3GCTG 3MYWA 2ZDMA 1FY5A 2F9NA 2DUCA 2GGVB 1J15A 3BV9B 3EA8A 3RXFA 3UQOA 2FX6A 2NWNA 3B8JA 2BXTH 4D9QA 3S7HB 2SFAA 1GMCF 1LQEA 1NPMA 3I77A 3LONA 3RXMA 4IMZA 1O3CA 1QQUA 1H4WA 3SGBE 3FFGA 1NY22 2EI8A 2ANMH 2ODPA 2ZFFH 4XDEA 4GVUA 3BTQE 1XUJA 2CJIA 2ZG0H 3I29A 4MDSA 1SQTA 1UJ1A 1UMAH 3PMHB 1TNKA 1C2JA 1GVZA 4Q7ZA 5EW2H 2BVSH 2WPMS 5DP5A 3SU2A 1WQSA 5CHAB 3V12A 3EE0B 3LC3A 2ZDAH 3V3MA 1SL3A 3T28A 2KAIB 3MNBA 1TMTH 1YCPM 3M7QA 3NCLA 3KF2A 3KNXA 1AVWA 4DW2U 4O3UA 3UNQA 1C1QA 3RC4A 4HZHA 2PSXA 1AFQC 3R3GB 1BQYA 2TGPZ 3SGQE 2FS8A 3MNSA 1P2NA 2BM2A 1KXDA 1QB9A 1SLXB 1HDTH 4ISHH 3SBKA 1V2KT 3SJKA 1Z6JH 2Z94A 1SGDE 1XUKA 4OGYA 1RIWB 3E8LA 4D76A 3TGIE 3UR9A 2P3TB 2TPIZ 3UUZA 1W7GH 1C5LH 3F9GA 2J4IA 4WVPE 4BTTB 2WYGA 1QA7A 2PR3A 2BDAA 2BLOA 1P2OA 5F8TA 1TPPA 1IHSH 3BTKE 2P93A 1GI3A 3SOSA 3EA7A 1VJAU 2PWXA 4YOGA 1G37A 1A3BH 1D3PB 1NC6A 2Y5HA 1Y8TA 4K2YA 5CE1A 2PW8H 1XKBC 2NU1E 2V35A 1DANH 4B1TA 3TJUA</