3PB1E

Crystal structure of a michaelis complex between plasminogen activator inhibitor-1 and urokinase-type plasminogen activator
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDAGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for recognition of urokinase-type plasminogen activator by plasminogen activator inhibitor-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor/hydrolase
molecule keywords Plasminogen activator inhibitor 1
total genus 54
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2010-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3pb1E02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3pb1E01
1XUHA 1V2WT 2BHGA 1AHTH 1THSH 1ELGA 3BTQE 1VZQH 2ZA5A 3SUFA 1UJ1A 2ZU2A 5GPIB 3FZDA 1OWDA 1EXFA 1NO9H 1V2NT 3TVJB 1AUJA 3ZVCA 1TA2A 1LHEH 1CBWC 1XKBC 2G5NA 1NZQH 2PGQB 1MU6B 1GL0E 1NC6A 4I8LA 4AB8A 1AZ8A 2H5DA 3N7OA 2RA0A 2W7SA 3ZZ7A 2D26C 1JRSA 2CJIA 4YOJA 4H6SB 1DWBH 1JXPA 2ZI2H 1A3EH 1C2MA 1C5OH 1WBGB 5C5OA 1BRBE 4NCYA 1GBAA 2UUYA 1O2IA 5DP7A 1C5XB 3SGAE 1QHRB 1S0QA 1ETTH 1GMDG 1THPB 1O2ZA 1PQ5A 1N1LA 2GCTC 2PV9B 3RXFA 3SNAA 1DXWA 1C1MA 4FUGA 5DP4A 4YESB 3UOUA 1FMGA 4NWKA 4I7YH 4F4OC 1FY5A 1Q2WA 1WQSA 1XUGA 1L1JA 4BTIB 1AU8A 1F5LA 2O8LA 2GX4A 1A0LA 4NA7A 1SMFE 1EOJA 3PM3A 3BV9B 4UEHH 2TGDA 2GV7A 1AI8H 2AS9A 3ODFA 1DWDH 1VCWA 1D6WA 4JMYA 1F0UA 3LGYA 2FLBH 2P8OB 4SGBE 1QL7A 2ZPRA 1XUFA 2RDLA 3A7VA 4GCHF 3M3TA 1IQHA 1HAPH 3TU7H 1C1VH 3A83A 4X1RU 3GY4A 1O2LA 1G3EA 3ZVEA 1ELAA 1FN8A 1GHAG 4B75A 1C4V2 3MU4A 1CHOG 3RXVA 4DGJA 1TALA 4JCNA 3SHCH 2XYAA 4UD9H 2XC5A 1XVOA 1Z1IA 1ELFA 2F3CE 1V2VT 2BX4A 3PB1E 8ESTE 4FUJA 3H7OA 2WPKS 1YPHC 3PMAB 3VGCB 1S84A 1DWCH 2HNTF 5K0HA 2Y5GA 2VIWA 4Y76A 1ORFA 2TBSA 2C4FH 2WYJA 3ZZ3A 4Z0KA 1WTHD 4FUFA 3GY2A 1QBOA 3SBKA 3VB5A 1XX9A 1JIMA 4X6PA 3A88A 2OINA 3MU0A 4BNRA 1O5EH 1XVMA 1EB1H 4VGCB 1W7GH 4CH8B 3ZZCA 5DJ7A 1LHGH 3ZVBA 4NZLA 2BOKA 1NRNH 3M36A 3ATMA 1KXAA 3SZNA 4E7RG 2V0BA 3PV4A 2HGTH 1YPGH 1V2TT 1EPTC 1IQJA 2J38A 2C8XB 1OS8A 4INKA 4MNVA 3E1XB 5BRRE 3SJOA 2Y81A 5AF9H 1OYTH 1GVZA 4YZUA 2EEKA 1W2KH 3ENSB 4INLA 1C5RA 1C2KA 2A45B 1HB0B 2G00A 4O9VA 4NWLA 2ALVA 4OS1A 1SGQE 3RXLA 5B6OA 4GSOA 3UWIA 3VPKA 2D8WA 1MAXA 3QTOH 4X1PU 4YLQH 3TK5A 1ANCA 2ANMH 2R2MB 5CHAB 1BRCE 4FU7A 3ZVGA 1UTMA 3M7TA 4FUDA 1F92A 2Q6FA 3EGKH 2Z6BD 3P17H 4ASHA 1Y5BT 1IQNA 4ZAEA 2VJ1A 1CE5A 2GZ9A 4OGXA 5FX6A 2VB0A 1FNIA 1B0EA 3KN2A 4X2XA 2OCVB 1BJUA 1UO6A 1KTTB 2R0LA 3MOCA 4DIHH 2ZDNA 4B76A 8GCHG 1ZRBA 3SORA 1NT1A 2BD2A 1K1LA 4X2YA 1C5PA 4KTCA 3U1IB 5C1UA 4U01A 1EJMA 1EAWA 3U8RH 4CRFA 1VCQA 3PWBA 1BTYA 5JPMH 2Q6DA 1GBMA 4YTAA 2VNTA 2BTCE 1AUTC 4X6MA 3RXDA 1GHWH 1QB6A 2AGEX 1O5FH 2ODYB 5HXFA 3ZZ9A 5JYIA 1MTSA 2CF9H 4XBBA 2ZNKH 1H9IE 4X8VH 1DE7H 1LPGB 1HIAA 2YOLA 1QRZA 4X8SH 1DY9A 2QXJA 1WSSH 3RXIA 1DPOA 1XXFA 2IJOB 3LT3A 1BDAA 2ZIQH 3UR9A 1K21H 1W3CA 2H9HA 1AFQB 4I8JA 3AAUA 2ZDKA 3DT0H 2J2UA 1GHVH 4X1QU 2ZFFH 3R0FA 4XFQA 1GGDC 3BTFE 4NFFA 3F1SB 4K1SA 1WCZA 4YO9A 1QIXB 2H2ZA 2VIQA 1A3BH 1RIWB 1PPZA 1PYTD 1HV7A 2EI8A 3AASA 5EQSA 5FBEA 2BXUH 3TH3H 1O5DH 4MPWA 1B0FA 5EXMA 5AFYH 1C2FA 1A4WH 3A8AA 1DSUA 3RC5A 4HI3A 3ZV9A 3KQEA 4ZKNU 4O3UA 1MBMA 1C1NA 3LGUA 1P8VC 1Z8GA 1C2DA 1ZRKA 1O3FA 2PTCE 4UE7H 4BAQB 1HCGA 1WU1A 2PKSB 1G36A 3QZRA 2XBWA 1BIOA 2QC2A 3M37A 1DICA 1C1RA 1SBWA 5FPYA 2NWNA 1O32A 1ZTLA 3STIA 3HK3B 3SO3A 3S7HB 3BTWE 1NESE 4DURA 1SGYE 3LGWA 4F49A 2TGTA 3O8DA 3RU4D 5T6FA 1BTUA 1D4PB 2BDCA 3GOVB 2ZO3H 3P95A 3SGBE 1NTPA 4IW4E 1FIZA 1LCYA 5TCAA 4Q7ZA 1Y59T 4CHAC 3GY8A 2FM2A 3SI3H 1TMBH 4MTBA 1H9LB 1LKBA 5LPFA 2NU4E 2UUFB 2BQ7B 2CF8H 3BEFB 2H9EH 5I25A 2PUXB 1C1UH 1T4VH 2GD4B 3SV9A 3MO9A 5ESTE 2A5IA 2XC0A 2D2DA 2ZTXA 4YLUA 2P93A 3QDZB 1HYLA 1C5NH 1OX1A 2B5TB 2F9PA 1SVPA 2P95A 2HOBA 2BDGA 2SGAA 4X2VA 3E0NB 2SGFE 4WH6A 1GHBG 3RXAA 1F5KU 2OQ5A 5HYOA 2P3UB 1W12U 2FX4A 1GBDA 5GCHF 4A7IB 1OSSA 2SNVA 2JH6D 1C5QA 1ELBA 6GCHG 2A7HA 1XM1A 5JBAS 1QQUA 2OC8A 9ESTA 3SQHE 1ZJDA 2WPLS 1LVMA 1MTNB 1W11U 3A84A 2ODQA 3T29A 4E05H 1P09A 4ZMAH 2FI5E 2BLQA 4O03A 1CA0B 4WY3A 4WXVA 3I77A 1RRKA 1GI4A 4TWWA 1SOTA 4GHTA 3MH5A 5EODA 1VCPA 3CP7A 1S5SA 3M5OA 4DCDA 3ESTA 1W0YH 1ANBA 2QXGA 4K5ZA 3KCGH 1C5TA 1CGHA 1MKXH 3A8CA 1JIRA 4D9RA 1TE0A 2YNAA 1NU7B 1F0SA 5EPNA 1YCPK 4BXWA 2GCTB 3OYPA 1VGCB 3MO6A 3FFGA 4CHAB 2FEQH 3PMBB 1GBHA 4MDSA 2ZQ2A 5FBIA 4I31A 4K69A 4VGCC 4X2WA 2TGPZ 2ZFTA 1AKSA 1KXCA 1WYKA 1SFIA 3LONA 1S6HA 2BDBA 1TX6A 4ABJA 4ABAA 1VJAU 1VGCC 2FX6A 2KAIB 4TWYA 2V35A 2FIRH 3S9BA 3E90B 2A4GA 1AMHA 3T27A 3G01A 2BQ6B 4JK5A 3RXRA 3GYLB 4ISHH 5L2ZH 2ALPA 1RJXB 3STJA 3A82A 2F9NA 5I46H 1JOUB 1P02A 4HZHA 1KLJH 5DP5A 1G30B 1TNIA 5AFZH 2HALA 1J16A 1KXDA 1NN6A 1IAUA 3LPRA 2J92A 2FS8A 2IPHA 3ITIA 2P59A 2DE8A 4CR9A 3A7WA 1SGDE 2Y6TA 3ELAH 1BTPA 2PFEA 3MYWA 4WJG2 4NSVA 1GMCG 2G4TA 1HDTH 5DGJA 5C67A 4BOHA 1TRMA 1BTXA 4WVPE 1O3BA 3F6UH 1E38B 3ZZBA 4BAOB 3U8TH 1SGPE 1V2PT 4IS5A 1ABIH 3MMGA 1SQAA 2Y7ZA 4D9QA 4OS6A 1GI9B 1UK3A 1Q31A 2W26A 1O3KA 1GJ6A 2FMJA 1DS2E 4KTUA 2VWOA 3SJ9A 3SNBA 2BY8X 1FLEE 1MBQA 4Y10E 1UK4A 4FUBA 4J1YA 2FOEA 2OC1A 4J2YB 2FWWA 4Q7XA 2WYGA 4QT8C 1KXEA 2AERH 1AB9C 3UWJH 4NIYA 1P11E 1CA8B 2OC0A 5FHTA 3GICB 1UK2A 2H6MA 7GCHF 3MNCA 1ABJH 1RFNA 3SU0A 1AFEH 5EGMA 1TBQH 2ZECA 4MLFB 3MO3A 1N6XA 2AH4X 2ZPQA 1UVOA 1PJPA 3AAVA 1UCYK 3SU2A 2FESH 5LGOA 2SFAA 5GCHG 4KELA 1EP6A 2I6QA 1DOJA 4MPVA 4FU8A 1FPCH 3GY6A 3T25A 4NA8A 2HNTC 3KQDA 3S9CA 2ZG0H 1EB2A 1S81A 2J94A 4TY7A 1J17T 1YM0A 4AYVB 2BZAA 1GI5A 2OBOA 3RXMA 4OS5A 1OPHB 2J4IA 1UCYE 1C2LA 3ATKA 4B2CA 2BD7A 4Q80A 1GMHF 1D3PB 4H4FA 1MTWA 3S0NA 1SL3A 1GBEA 3S69A 1S0RA 1AO5A 4A1VA 4Y11E 5L2YH 1KDQA 1W7XH 4XBDA 2ZFRH 1LO6A 1YF4A 4ZKSU 3BTEE 1QB9A 3UREA 4FUEA 5ETXA 2NU1E 2ZDLA 1MD7A 3GCOA 4CRDA 1YBWA 1BZXE 2CHAC 3U69H 1E37B 1GHYH 3GY5A 2TPIZ 1MKWH 3Q3KA 3TLOA 2Z9IA 3SU5A 5AVDA 3GCTG 4X6NA 1UTOA 1Y3XA 2ZGBH 4Y6DA 2XRCA 5C1YA 2A4OA 3UR6A 2FOHA 3IITA 1YCPH 5HM2A 1DM4B 1EASA 3NUMA 1S82A 2QXHA 1BITA 1HJAC 3FANA 4OS4A 5F6MA 1Y3WA 3UQOA 1EZQA 2G81E 1D6RA 2ANKH 3B23B 3HKIB 1C4U2 4A5TS 1LHFH 1TRYA 2AYWA 1C2IA 3A7XA 1ZPZA 3E16B 4Y7BA 3P8NA 2AFQB 1GJCB 2GKVE 5EQRA 1QRXA 1LVBA 1ELEE 2UUKB 3PMHB 2Y5HA 3QTVH 2PLXA 3VB4A 3SQEE 4BAHB 1RXPA 1OWEA 1AD8H 1TQ0B 1L4ZA 1EQ9A 1GJBB 1MH0A 1DFPA 1YYY1 2AGGX 1SOZA 3LJJA 1C5WB 3FZZA 3VFEA 4DG4A 3ZZAA 3QK1A 7ESTE 3RDZA 3EA7A 1E35B 3TNTA 4H6TA 3SN8A 1T8OA 3PYHA 4ISIH 2GDEH 4A92A 1P01A 1C5YB 1LPKB 3LH1A 1C2HA 3ZZ4A 3HK6B 1ZPCA 2FTMA 1KSNA 1GBJA 4A1XA 2WPJS 1G9IE 1XUJA 1PQ8A 4ZKRU 5C3NA 1IQFA 1ZSJA 1C9TA 3E0PB 1AWFH 2OP9A 1MQ5A 1BMAA 2O8WA 4ABEA 1NRSH 5F8ZA 4Y0YE 1AVWA 3LC3A 4JYUH 4Y8ZA 4ZXYH 3RXOA 2WUBA 3SNEA 5EW2H 1NFYA 1VITG 1NM6A 4OGYA 2AMPA 1O2XA 3BTKE 1FZZA 1O2PA 3ATLA 5ESBA 4B1TA 1ESAA 1RIWC 1O2GH 1Z1JA 2NU2E 4JZFH 5EG4A 2ZDVH 5E2PA 1DVAH 4XBCA 3RLWH 1XXDA 1O2UA 1O2VA 3I78A 1MKWK 4I32A 1RD3B 1O37A 1WV7H 4K8BA 4MVNA 2UUJB 4YT6H 4MPXA 1T7CA 4ZUHA 1F2SE 1TNLA 1MCTA 5A09A 1NFUA 1ETSH 1ARCA 4AORA 4ISOA 1DLEA 1IQKA 2LNCA 6CHAC 1YPEH 3URCA 3B8JA 2GZ8A 3L3TA 1IQIA 3M3VA 1TPSA 4DT7B 3OTJE 2GCHF 3B9FH 1EUFA 4FUIA 1K1PA 1TX8A 3V13A 1GCTC 4I8HA 5F8TA 2CN0H 2ODPA 1Y3UA 3QX5H 4AZ2B 3K9XB 4D8NA 2GMTB 1SI5H 3BTGE 1O2HA 3S7KB 2BYAX 3EQ0H 2J34A 1B5GH 1LQDB 3SJKA 2G52A 1UVTH 1V2RT 4RN6A 2EI6A 4TYDA 5LPEA 5J4QA 1ELTA 1LKAA 1SR5C 3GDUA 3U98H 1MTNC 1L1GA 5LH8A 4IC6A 2FDAA 3BG8A 2PGBB 2A1DB 1GI8B 1SG8B 4XDEA 1PPFE 2ZFSA 1G32B 1T8LA 4FUCA 1TA6A 1QJ7B 3P70B 2ZCLP 1FI8A 3H5CB 1QJ1B 2Q6GA 1ZHMA 1ZZZA 4OS7A 1AGJA 3EAJA 1O3HA 2PKAB 4BAKB 3QWCH 1KLIH 2BB4A 3A80A 4AN7A 1LVYA 2CGAA 2HLCA 1SGFG 1EJNA 3S9AA 1Z7KA 1D9IA 1DY8A 1BTWA 2BQWB 1P57B 2BVRH 3ATWA 3F9GA 2ZHQH 4A1TA 4ABGA 2JETC 1CA0C 3BN9A 5T3HA 1SHHB 1MQ6A 4ISNA 1W10U 2O8TA 2J9NA 4WH8A 3SJIA 3UNQA 1SLVB 2WPHS 3DA9B 1EATA 1S85A 4Q7YA 5FAHA 3SV6A 1OWJA 3QUMP 1FONA 1O3NA 5GIBA 3NKKA 1G3BA 3MNSA 3T2NA 3RXCA 3L33A 3LJOA 3RXTA 3E3TA 3MTYA 4ABDA 1O34A 2FOMB 5F8XA 1HAVB 1MTVA 3PO1C 1P2MA 5AHGH 1G2LA 4JYTA 1GVKB 3M7UA 1P2NA 1UHBA 5PTPA 3LKWA 3T28A 5CE1A 1H8DH 1K1IA 3URDA 1V2ST 1GDNA 2VIPA 1SC8U 2TIOA 3LGIA 3QGNB 2FPZA 1RTLA 4IGDA 1NRQH 4YOGA 3V12A 2BDAA 3K6ZA 5FPTA 3TK9A 1LVOA 1K1JA 1XKAC 1P05A 3TGIE 1MU8B 2WUCA 1N8OC 2F91A 5TJXA 1QBVH 2V3OH 4E7NA 5FXLA 1O2NA 1HXFH 2ESTE 1HJ9A 5L30H 1BMLA 1PPHE 1HAYB 1TONA 3SUEA 2WPIS 2BY9X 4ABBA 4K8YA 3NZIA 1A1RA 2SGQE 3AW1A 1C9PA 2Z7FE 3KF2A 4IN2A 6GCHF 2YNBA 1OWHA 5JDUB 5DO4H 2ZFPH 3RXJA 2W3KA 1HGTH 2BDYA 4K1EA 3DFJA 3BG4C 2O8UA 2XBXA 4HGCA 1SFQB 1GDUA 3RMNH 2ZZUH 4NSYA 1MZAA 2EA3A 2BX3A 3SU4A 2ZU3A 4CBOA 4CRBA 4ESTE 2VIDA 1ELDE 1HAVA 2FYQA 1L4DA 2PUQH 2GTBA 1TGNA 5A8ZA 1P3CA 2GT8A 3VB6A 3GCNA 1O2TA 1GCDA 3EYDA 4WF8A 3MWIU 2VVCA 4AFQA 3PWCA 2HVXA 2QAAA 4CREA 1O31A 3UQVA 2B9LA 3P6ZB 1LMWB 4R8TB 4X6OA 2XNIA 1DDJA 1K22H 5E2OA 1Y5UT 3RXKA 1AN1E 1GJ7B 2QY0B 5BPEA 3MHWU 4ZHLU 1ID5H 1GI3A 1LHDH 5F03A 4AX9H 3CENA 3TH2H 1A2CH 2PKAA 1BUIA 4R0IA 3KNXA 3DD2H 1EJAA 1SB1H 3QGJA 3U1JB 8GCHF 1PQAA 3RUOA 1O2JA 1C5LH 2SNWA 4KP0A 2NU3E 1QURH 1QBNA 4U32A 2ILNA 4AOQA 5C20A 2VWNA 4IMQA 1AVXA 1EZSC 4NIWA 2A2QH 1YPMH 4X1SU 1Y3YA 2RA3A 3OX7U 4DIIH 4ISLA 1TGTA 3UY9A 1XUIA 1WUNH 2V6NA 1TGSZ 2R3UA 2Y5FA 2ZU5A 3M3SA 1TWXB 3MU5A 1HAZB 1QL9A 1A5HA 2BD5A 4FUHA 1AB9B 1BTZA 4K3JA 5DG6A 1FV9A 1HRTH 4WXIA 1MKXK 1GPZA 3A8BA 4Y0ZE 1NFWA 2C93B 2VWLA 4UDWH 3U8OH 3KL6A 4XE4A 1SLUB 1V2OT 1FY3A 2GZ7A 1TQ7B 3ZZ8A 3DHKH 1ZLRA 1U6QA 1KIGH 1CQQA 1JRTA 3TK6A 3P8FA 3ZV8A 1K9OE 2WPMS 2VINA 3MU1A 5E8EH 2ZTYA 2HWLB 3M7QA 1P2OA 2D1JA 3SJ8A 3SV8A 2PWXA 1H1BA 1O0DH 2H5CA 5GWZA 2UWOA 3MH4A 1VITF 3PO1B 1LQEA 2ZHDA 1CU1A 1GJDB 1CT4E 1Z6JH 1NU9A 5EW1H 1Z8IB 5DKMA 3TITA 2BLWA 3TPIZ 1O5BB 4NFEA 2BLVA 1V3XA 3VXFH 1L0ZA 3TGJE 1OXGA 2XBYA 3PROA 3MNXA 4LK4A 2FP7B 1HLTH 1C2JA 1GI0A 1ZJKA 4MNXA 3ATIA 1DT2A 4ZH8A 2OBQA 1HUTH 1FAXA 4B73A 2F83A 5A2MH 1JBUH 1LHCH 1QTFA 4CH2B 2P16A 2BVSH 1C5UA 1KYNA 2FODA 3P92A 1K2I1 2FOAA 5EXLA 4IC5A 1TMUH 1EAUA 2GVFA 1RTKA 3RMOH 3SU1A 1EX3A 1ELVA 1GBFA 1EAXA 3VB7A 4B2AA 1O3MA 3A89A 4UFGH 1J15A 1A61H 1C1TA 5L6NH 2SGEE 1D3DB 1Z71A 1O38A 4INHA 2P8OC 1CGJE 2NU0E 4A6LA 3SU6A 2VGCC 1MAYA 1SGNE 1A5GH 1IHSH 1H8IH 5JBTA 2BD4A 1HFDA 3R3GB 1FAKH 1ZHPA 5EU8A 5JB8S 1C4Y2 2F9BH 4GHQA 1SGEE 2ZDAH 1ZHRA 2I6SA 3BTTE 1EP5A 1MCVA 1V6DA 1MZDA 3MH6A 1HNEE 1SHYA 1ESBA 3F68H 3SV2H 2JETB 4B74A 1GG6C 1C5SA 1VITH 3NK8A 5E0HA 3O8RA 4D76A 2XW9A 4BAMB 1GBIA 3K6YA 5E0GA 1XMNB 2VVVA 1EPTB 2O8MA 1W13U 2PSYA 2VIVA 4FVBA 3ZZ6A 1P12E 2W7UA 3TJVA 1FXYA 1L2EA 4ZROA 2Y80A 1DUEA 3QLPH 1DSTA 1SGRE 1DXPA 1L1NA 4X0WU 1F0TA 3W94A 1EPTA 1AY6H 4BXSA 1O3OA 4CBNA 3JZ1B 1F5RA 3OY6U 5DPAA 5J4SA 5IYTA 4AGJA 4NIXA 2A7JA 2R2WU 2XXLA 3P8OA 3RU4T 1GI2A 2GV6A 3BSQA 1GG6B 1ARBA 4MNWA 1BRUP 1C5MD 1PPEE 3RXQA 3RXSA 2VWMA 1TYNA 5EQQA 1ZGIA 2FOCA 1GI7B 2QGRA 4NGAH 2XCFA 3SNCA 3UNRA 4K60A 2QYIA 3HPTB 1MMJN 4WMDA 1V2KT 5A0BA 3HGNA 4U30A 2STBE 4JZIA 1AVGH 4DOQA 2SGPE 5DP6A 1GCTB 2CV3A 2R9PA 2A31A 4JK6A 2RG3A 1NRRH 3M5MA 5GDSH 1HPGA 4GUXA 1RTFB 3RMMH 6LPRA 2FTLE 1GDQA 1P03A 1YGCH 2QXIA 1CT0E 3ZZ5A 5T6GA 6CHAB 3RC6A 1V2MT 1GJ5H 3ZVDA 3GY7A 1KTSB 3P8GA 4UFDH 1PQ7A 3RLYH 4X8TH 1E0FD 1BA8B 5EXNA 1C2EA 3BEUA 4Y79A 4MPUA 1TGBA 2GP9B 2R3YA 2BLOA 1AZZA 2FOGA 1AE5A 1G3DA 1Z8JB 4AYYB 1VJ9U 3D65E 1GBCA 2J95A 2AGIX 3MI4A 5DK1A 4CRAA 3LGVA 3VXEH 2ZTZA 1GHAF 1HAXB 4X8UH 4ZXXH 1JWTA 3MU8A 3E6PH 3JZ2B 1E34B 1H9HE 1P9UA 3GCHB 2A5KA 1DITH 5JB9S 4AG1A 1TBZH 3KHVA 2A4RA 3UUZA 2A2XH 2IN2A 2A0QB 1GL1A 1ZPBA 1O35A 4B2BA 2V3HH 2CMYA 3LIWA 1BJVA 2W5EA 3OSYA 1YPJH 1T8MA 5G4BA 2ZU1A 2BY5X 3FP7E 3LOXA 2ANYA 4I8KA 5A0AE 4RKOB 3V3MA 3ZYEA 2OXSA 1EZUC 1TABE 4UFFH 1P2JA 3L6PA 1OWIA 5FPSA 1EOLA 5FX5A 3K2UA 4ZKOU 3A7TA 2OTVA 4UFEH 7GCHG 1M9UA 4ZHMU 1P3EA 1TPOA 2O9QA 4WMEA 3TH4H 3UIRA 1GHBF 3BTME 2WV5A 2OD3B 1ZMNA 2QIQA 4XSKU 4GPGA 1V2QT 2IOTA 4GLYA 2F9VA 3A85A 3PMJA 1G3CA 3RXUA 1O3EA 2OLGA 3SU3A 2G51A 1RS0A 1ANEA 3UTUH 1PPCE 4LZ1H 4THNH 1EKBB 3NCLA 1QA7A 5E0JA 5DP8A 2R0KA 3BIVH 4JYVH 1W0ZU 2P3TB 3EDXB 1O3GA 1UHBB 1NRPH 5SGAE 1SPJA 1IQMA 3GCTF 4U2WA 1FY1A 1NPMA 1SGIB 1SLXB 3HKJB 1GVLA 1J8AA 3ZVFA 3RXBA 1X7AC 4NA9H 2HPPH 2RCEA 1UVUH 2P3FH 1O3PB 3D62A 4CRCA 1FJSA 4MNYA 3BTDE 2ANWA 2G4UA 1MD8A 1Z6EA 3KQBA 3PLBA 4FVDA 2ZDMA 1WAYB 1UTLM 1J9CH 2OQUA 4K2YA 3T5FH 1O3JA 3T62A 5A0CA 7KMEH 1GBKA 2BM2A 2Y82A 3RP2A 2ULLA 2XTTB 3V0XA 3DUXH 3F9EA 1JMOH 3KEEA 5JBBS 1QR3E 4E06H 1C5VA 1FPHH 1ZTJA 1QFKH 2C90B 3C27B 4Y71A 5HGGA 1P9SA 1TBRH 2PHBA 5CMXH 2ZCKP 1BBRK 4KGAA 2UWLA 3TJOA 1QY6A 4I8GA 2BOHB 1WTGH 1ZSKA 3RM0H 1PFXC 3SOSA 1O2OA 1OOKB 1SLWB 2VU8E 4DW2U 4Y8YA 1P2KA 1A0HB 1EZXC 3PLPA 3SUDA 1BQYA 5GJ4B 1W14U 1GMCF 1O2WA 3RMLH 2AIPA 2FI4E 4LZ4B 3EE0B 2W3IA 1OP0A 5EOKA 4YT7H 4MG3A 4ABIA 2HRVA 1ZOMA 2AMQA 1FDPA 3RXHA 1CGIE 2B8OH 4OS2A 4FU9A 2ZHWH 4BANB 2BD9A 3SUGA 1HJ8A 1ZYOA 5JBCS 1YLDA 1CHOF 1GBBA 1O3DA 2ZEBA 2ZF0H 2BD3A 3DFLA 1SQTA 4DVAU 2BVXH 2BY6X 1D3QB 2ASUB 2BZ6H 1V2UT 4FXGH 2FXRA 3GDSA 1ELCA 2BD8A 2G8TA 1TOMH 2SGDE 3PLKA 5FCRA 1IOEA 4ABHA 1UTQA 2Z3CA 4NIVA 4Q2KA 1UCYH 3SI4H 2BDHA 1K1OA 4HTCH 1W8BH 1ESTA 1FY8E 1CT2E 1YC0A 4KKDA 4NZQA 3ZYDA 2FZZA 1UMAH 4GAWA 1OP8A 1GJ4H 2AEIH 2JKHA 2EI7A 3BTHE 3LH3A 3UPEA 3QO6A 1ZMLA 1A5IA 5EPYA 4AB9A 2FOBA 3BEIB 1KXBA 1TOCB 3I29A 1GHXH 2FLRH 4PROA 1P06A 1O36A 1LDTT 3EA9A 1GJAB 1HBTH 1UVPA 1ZMJA 3M35A 5TCCA 1OKXA 1YP9A 2B0FA 2FI3E 2AMDA 4Z6AH 1UTPA 2XWAA 4Y7AA 4K1TA 2A7CA 1K28D 1C1OA 3CS0A 3MFJA 2VVUA 1S83A 1YLCA 4D7FA 1V2JT 1SGFA 8LPRA 1N8OB 5ABWA 1J14A 1DANH 5DP9A 3MNBA 2BXTH 5HMAA 1O5CB 2VH6A 5C5NA 5HM9A 4IN1A 2F9OA 1THRH 4DY7B 4JZEH 3EA8A 4IBLH 1C1QA 2M5TA 1BBRH 1XUKA 1TGCA 4M7GA 3OY5U 2CXVA 1O3AA 2TGAA 1T31A 2GMTC 3HGPA 1F7ZA 2Z94A 1MTUA 3RM2H 1CSOE 1FQ3A 3TNSA 4UONA 2ZWLH 4GVUA 3KQCA 3Q3YA 3VB3A 3D49H 1AFQC 3QZQA 1TAWA 3K65B 1QRWA 1ETRH 1YPKH 3RU4E 2JH5D 1BRAA 1S6FA 1BHXB 1GI6A 5T6DA 2ZC9H 4X1NU 4NG9H 3NXPA 4CRGA 1BTHH 1PPGE 2GGVB 2VH0A 4MQAA 3O8CA 1NROH 1GWAA 3RXPA 3A86A 3GYMA 2C8WB 1K1NA 3LU9B 2ZGHA 1WQVH 3H7TA 1FUJA 3GY3A 3GDVA 2BDIA 1LPZB 4YM9A 2PR3A 4LOYH 4Y8XA 3IWMA 3A87A 3UOPA 2QF0A 1QB1A 1YPHE 2C8ZB 2THFB 2LPRA 3GCHC 1A0JA 2C3SA 1KY9A 1OYQA 1QA0A 1TNKA 2OC7A 1TNGA 4O3TA 4DJZB 1NS3A 1IQGA 2ZGJA 3KIDU 2C8YB 2ZHEH 2ZGXH 1NFXA 1ZTKA 1VR1H 1O33A 1TIOA 1C1SA 5CHAC 3W95A 4GCHG 1OP2A 1Y3VA 4B71A 2WV4A 3BG4B 3TGKE 1UTNA 2ZU4A 3FAOA 5H4IB 3GISB 2FYRA 1P10A 1BMNH 1TX7A 2PSXA 2FO9A 1O2QA 3TJUA 1MUEB 4O97A 2DE9A 1CVWH 1D3TB 1GJ9B 3VEQB 3SV7A 4AFZA 1ACBE 1CHGA 1KDQB 2VGCB 1FY4A 3ODDA 2GDDA 3C1KA 1BT7A 1N6YA 3V7TA 1FIWA 7LPRA 2Z3DA 1P04A 1AE8H 1P2IA 3HATH 2XC4A 1UTJA 1ZSLA 4WMFA 2Y7XA 1RGQA 2ZCHP 3A8DA 3Q76A 3UNSA 2XBVA 2JH0D 3A7YA 2BY7X 1AQ7A 1CBWB 1TLDA 3KGPA 1GBTA 1BMMH 4RSPA 1AIXH 2Z9GA 4D7GA 5IDKA 3Q00A 1HAGE 1HIAB 2ZQ1A 3AW0A 2Z3EA 1KXFA 1HAHH 9LPRA 1YPLH 1ZR0A 3VGCC 1QL8A 3O8BA 3SHAH 3NPSA 1BB0B 1QGFA 1HAOH 4BTUB 1O2RA 5FCKA 3LGTA 1DWEH 2XWBI 2VIOA 1T4UH 1HXEH 1IHTH 2BMGB 1G2MA 4RKJB 2HPQH 1PYTC 2PKSC 1KLTA 4H42U 1P2QA 2HNTE 1GGDB 2G5VA 3OU0A 1ANDA 2GCHG 3TJNA 4IMZA 1V2LT 4TPIZ 1Y8TA 2OUAA 3Q3XA 1Q3XA 1C5ZB 1SSXA 3F9FA 4TY6A 1YKTA 3BF6H 5K7RA 2ZGCA 1TMTH 1INCA 3FP8E 1QNJA 1ZGVA 2P94A 4SGAE 1T32A 4KTSA 1BCUH 1LTOA 5C2ZA 1EAIA 1WOFA 2Z9KA 2CHAB 1GMDF 1O30A 2FOFA 2QA9E 1A7SA 2QV1A 4LXBH 4TPYA 3E91A 2FS9A 3M61U 3SNDA 2G55A 1T8NA 1O3IA 2ZPSA 5GXPA 3CS7A 3M5NA 1B7XB 1GMHG 1Z8RA 1O2YA 2Q1JA 2QN5T 3M5LA 3UFAA 1P0SH 1UTKA 2PTNA 1A46H 3PTBA 1TFXA 2A4QA 1F0RA 4JZDH 3U9AH 2XCNA 1FN6A 2ZP0H 2KAIA 1GI1A 2QCYA 3T26A 1GHZA 2WINI 3QN7A 1TPAE 1NY22 2STAE 1O39A 1AKSB 1GBLA 4BTTB 3MH7A 1HAIH 1YCPM 5A8YA 2TRMA 1C1PA 2ZHFH 4WWYA 1O2KA 4I33A 2EC9H 5A8XA 4JZ1A 2B7DH 1TNJA 1DUAA 1TRNA 4ABFA 2PW8H 1IQLA 3LC5A 3A7ZA 1AWHB 3D23A 1SGCA 1TB6H 2H1UA 3NWUA 4AFSA 5DP3A 2A32A 1Y5AT 2K1QA 1C1WH 8KME2 1QCPA 3A81A 4YOIA 3ZZDA 3ZVAA 2ZKSA 4AG2A 3RXGA 1C2GA 2AIQA 4ZHAA 3FP6E 1O5GH 3Q77A 3F9HA 4XOJA 2Z9JA 1O3CA 3AVZA 3TIUA 1SGTA 1DLKB 3SW2B 1OWKA 1O5AB 3WY8A 1DX5M 1QJ6B 2A5AA 2H9TH 3PTNA 1CO7E 1G37A 3E8LA 4AFUA 4AGKA 1TPPA 1PPBH 1GJ8B 1K1MA 2Z9LA 4CR5A 1H4WA 1IQEA 3RC4A 6ESTA 1BOQA 5C1XA 1HJAB 1TNHA 1SQOA 2DUCA 3BIUH 2ZFQH 2QF3A 1UVSH 3RXEA 1QQ4A 3FVFB 5LPRA 3SGQE 4HFPB 1BBRE 2UWPA 2F9UA 2GT7A 1O2MA 1BHXF 1E36B 1O3LA 3IG6B 1O2SA 3LDXH
chains in the Genus database with same CATH superfamily
1XUHA 1V2WT 2BHGA 1AHTH 1THSH 1ELGA 3BTQE 1VZQH 2ZA5A 3SUFA 1UJ1A 2ZU2A 5GPIB 3FZDA 1OWDA 1EXFA 1NO9H 1V2NT 3TVJB 4OM9A 1AUJA 3ZVCA 1TA2A 1LHEH 1CBWC 1XKBC 2G5NA 1NZQH 2PGQB 3PRBA 1MU6B 1GL0E 1NC6A 4I8LA 4AB8A 1AZ8A 2H5DA 3N7OA 2RA0A 2W7SA 3ZZ7A 2D26C 1JRSA 2CJIA 4YOJA 4H6SB 1DWBH 3ZIAD 1JXPA 2ZI2H 1A3EH 1C2MA 2KM0A 1C5OH 1WBGB 5C5OA 1BRBE 4NCYA 1GBAA 2UUYA 1O2IA 5DP7A 1C5XB 3SGAE 1QHRB 1S0QA 1ETTH 1GMDG 1THPB 5EJZA 1O2ZA 1PQ5A 1N1LA 2GCTC 2PV9B 3RXFA 3SNAA 1DXWA 4AC9A 1C1MA 4FUGA 5DP4A 4YESB 3UOUA 1FMGA 4NWKA 4I7YH 4F4OC 1FY5A 1Q2WA 1WQSA 1XUGA 1L1JA 4BTIB 1AU8A 1F5LA 2O8LA 2GX4A 1A0LA 4NA7A 1SMFE 1EOJA 3PM3A 3BV9B 4UEHH 2TGDA 2GV7A 1AI8H 2AS9A 4DT4A 3SZEA 3ODFA 4YXWD 1DWDH 1VCWA 1D6WA 4JMYA 1F0UA 3LGYA 2FLBH 2P8OB 4SGBE 1QL7A 2ZPRA 1XUFA 2RDLA 3A7VA 4GCHF 3M3TA 1IQHA 1HAPH 3TU7H 1C1VH 3A83A 4X1RU 3GY4A 1O2LA 1G3EA 3ZVEA 1ELAA 1FN8A 1GHAG 4B75A 1C4V2 3MU4A 1CHOG 3RXVA 4DGJA 1TALA 4JCNA 3SHCH 2XYAA 4UD9H 2XC5A 1XVOA 1Z1IA 1ELFA 2F3CE 1V2VT 2BX4A 3F0OA 3PB1E 5C0UA 8ESTE 4FUJA 3H7OA 2WPKS 1YPHC 3PMAB 3VGCB 1S84A 1DWCH 2HNTF 5K0HA 2VIWA 2Y5GA 4Y76A 1ORFA 2TBSA 2C4FH 2WYJA 3ZZ3A 4Z0KA 1WTHD 4FUFA 3WWFA 3GY2A 1QBOA 5CHBA 3SBKA 3VB5A 1XX9A 1JIMA 4X6PA 3A88A 2OINA 3MU0A 4BNRA 1O5EH 1XVMA 1EB1H 3OE7D 4VGCB 1W7GH 4CH8B 3ZZCA 5DJ7A 1LHGH 4P02A 3ZVBA 4NZLA 2BOKA 1NRNH 3M36A 3ATMA 1KXAA 3SZNA 4E7RG 2V0BA 3PV4A 2HGTH 1YPGH 1V2TT 1EPTC 1IQJA 2J38A 2C8XB 1OS8A 4INKA 4MNVA 3E1XB 5BRRE 3SJOA 2Y81A 5AF9H 1OYTH 1GVZA 4YZUA 2EEKA 1W2KH 3ENSB 4INLA 1C5RA 1C2KA 2A45B 1HB0B 2G00A 4O9VA 4NWLA 2ALVA 4OS1A 1SGQE 3RXLA 5B6OA 4GSOA 3UWIA 3VPKA 2D8WA 1YY3A 3OEED 1MAXA 3QTOH 4X1PU 4YLQH 3TK5A 1ANCA 2ANMH 2R2MB 5CHAB 1BRCE 4FU7A 3ZVGA 1UTMA 3M7TA 2XNDD 4FUDA 1F92A 2Q6FA 3EGKH 2Z6BD 3P17H 4ASHA 1Y5BT 1IQNA 4ZAEA 2VJ1A 1CE5A 2GZ9A 4OGXA 5FX6A 2VB0A 1FNIA 1B0EA 3KN2A 4X2XA 2OCVB 1BJUA 4RT1A 1UO6A 1KTTB 2R0LA 3MOCA 4DIHH 2ZDNA 4B76A 8GCHG 1ZRBA 3SORA 1NT1A 2BD2A 3GS9A 1K1LA 4X2YA 1C5PA 4KTCA 3U1IB 5C1UA 4U01A 1EJMA 1EAWA 3U8RH 4CRFA 1VCQA 3PWBA 1BTYA 5JPMH 2WSSD 2Q6DA 1GBMA 4YTAA 1VKYA 2VNTA 5F53A 3WWBA 2BTCE 1AUTC 4X6MA 3RXDA 1GHWH 1QB6A 2AGEX 1O5FH 2ODYB 5HXFA 3ZZ9A 5JYIA 1MTSA 2CF9H 2KZ4A 4XBBA 2ZNKH 1H9IE 4X8VH 2XOKD 1DE7H 1LPGB 1HIAA 2YOLA 1QRZA 4X8SH 1DY9A 2QXJA 1WSSH 3RXIA 1DPOA 1XXFA 2IJOB 3LT3A 1BDAA 2VBCA 2ZIQH 3UR9A 1K21H 1W3CA 2H9HA 1AFQB 4I8JA 3AAUA 2ZDKA 3DT0H 2J2UA 1GHVH 4X1QU 2ZFFH 3R0FA 4XFQA 1GGDC 3BTFE 4NFFA 3F1SB 4K1SA 1WCZA 4YO9A 1QIXB 4FOUC 2H2ZA 2VIQA 1A3BH 1RIWB 1PPZA 1PYTD 1HV7A 2EI8A 3AASA 5EQSA 5FBEA 2BXUH 3TH3H 1O5DH 4MPWA 1B0FA 5EXMA 5AFYH 1C2FA 1A4WH 3A8AA 1DSUA 3RC5A 4HI3A 3ZV9A 3KQEA 4ZKNU 4O3UA 1MBMA 1C1NA 3LGUA 1P8VC 1Z8GA 1C2DA 2J97A 1ZRKA 1O3FA 2PTCE 4UE7H 4BAQB 1HCGA 1WU1A 1MABB 2PKSB 1G36A 3QZRA 2XBWA 1BIOA 2QC2A 3M37A 1DICA 1C1RA 1SBWA 3PRDA 2NWNA 5FPYA 1O32A 1ZTLA 2WV9A 3STIA 3HK3B 3SO3A 3S7HB 3BTWE 1NESE 4DURA 1SGYE 3LGWA 4F49A 2TGTA 3O8DA 3RU4D 5T6FA 1BTUA 1D4PB 2BDCA 2LP6A 3GOVB 2ZO3H 3P95A 3SGBE 1NTPA 4IW4E 1FIZA 1LCYA 5TCAA 2WHXA 4Q7ZA 1Y59T 4CHAC 3GY8A 2FM2A 3SI3H 1TMBH 4MTBA 1H9LB 1LKBA 5LPFA 2NU4E 5EJLA 2UUFB 2AHME 2BQ7B 2CF8H 3BEFB 2H9EH 5I25A 2PUXB 1C1UH 1OHHD 1T4VH 2GD4B 2WZQA 3SV9A 3MO9A 5ESTE 2A5IA 2XC0A 2D2DA 2ZTXA 4YLUA 2P93A 3QDZB 1HYLA 1C5NH 1OX1A 2B5TB 2F9PA 1SVPA 2P95A 2HOBA 4B6EA 2BDGA 2SGAA 4X2VA 3E0NB 1W0KD 2SGFE 4WH6A 1GHBG 3RXAA 2V3MA 1F5KU 2OQ5A 5HYOA 2P3UB 1W12U 2FX4A 1GBDA 5GCHF 4A7IB 1OSSA 2SNVA 2JH6D 1C5QA 1ELBA 6GCHG 2A7HA 1XM1A 3KYFA 5JBAS 1BMFD 1QQUA 2OC8A 9ESTA 5C17A 2RFKC 3SQHE 1ZJDA 2KCAA 1LVMA 1W11U 1MTNB 2WPLS 3A84A 2ODQA 3T29A 4E05H 1P09A 4ZMAH 2FI5E 2BLQA 4O03A 1CA0B 4WY3A 4WXVA 3I77A 1RRKA 1GI4A 4TWWA 1SOTA 4GHTA 3MH5A 5EODA 1VCPA 3CP7A 1S5SA 3M5OA 4DCDA 5DSFA 3ESTA 1W0YH 1ANBA 2QXGA 4K5ZA 3KCGH 1C5TA 1CGHA 3FN8A 1MKXH 3A8CA 1JIRA 4D9RA 1TE0A 2YNAA 1NU7B 1H8HD 1F0SA 5EPNA 1YCPK 4BXWA 2GCTB 3OYPA 1VGCB 3MO6A 3FFGA 4CHAB 2FEQH 3PMBB 1COWD 1GBHA 4MDSA 2ZQ2A 5FBIA 4I31A 4K69A 4VGCC 4X2WA 2TGPZ 2ZFTA 2W6JD 1AKSA 1KXCA 1WYKA 1SFIA 2PP6A 3LONA 1S6HA 2BDBA 1TX6A 4ABJA 4ABAA 1VJAU 1VGCC 2FX6A 2KAIB 4TWYA 2V35A 2FIRH 3S9BA 3E90B 2A4GA 1AMHA 3DSGA 3T27A 4B6FA 3FKSD 3G01A 2BQ6B 4JK5A 3RXRA 3GYLB 4ISHH 5L2ZH 2ALPA 1RJXB 3STJA 3A82A 2F9NA 5I46H 2RDEA 1JOUB 1P02A 4HZHA 1KLJH 5DP5A 1G30B 1TNIA 5AFZH 4ASUD 4FETA 2HALA 1J16A 1KXDA 1NN6A 1IAUA 3LPRA 2J92A 2FS8A 2IPHA 3ITIA 2P59A 2DE8A 4CR9A 3A7WA 4RI0A 1SGDE 2Y6TA 3ELAH 1BTPA 2PFEA 3MYWA 4WJG2 4NSVA 1GMCG 2G4TA 1HDTH 5DGJA 5C67A 4BOHA 1TRMA 1BTXA 4WVPE 1WDIA 1O3BA 3F6UH 1E38B 3ZZBA 4BAOB 3U8TH 1SGPE 1V2PT 4IS5A 1ABIH 3MMGA 1SQAA 2Y7ZA 4D9QA 4OS6A 1GI9B 1UK3A 1Q31A 2W26A 1O3KA 1GJ6A 2FMJA 1DS2E 4KTUA 2VWOA 3SJ9A 3SNBA 2BY8X 1FLEE 1MBQA 4Y10E 1UK4A 4FUBA 4J1YA 3PV5A 2FOEA 2OC1A 4J2YB 2FWWA 4Q7XA 2WYGA 4QT8C 1KXEA 2AERH 1AB9C 1H8ED 3UWJH 4NIYA 1P11E 1CA8B 2OC0A 5FHTA 3GICB 1UK2A 2H6MA 7GCHF 3MNCA 1ABJH 1RFNA 3SU0A 1AFEH 5EGMA 1TBQH 2ZECA 4MLFB 3MO3A 1N6XA 2AH4X 2ZPQA 1UVOA 1PJPA 3AAVA 1UCYK 3SU2A 2FESH 5LGOA 2SFAA 5GCHG 4KELA 1EP6A 2I6QA 1DOJA 4MPVA 4FU8A 1FPCH 3GY6A 3T25A 4NA8A 2HNTC 3KQDA 3S9CA 2ZG0H 1EB2A 1S81A 2J94A 4TY7A 1J17T 1YM0A 4AYVB 2BZAA 1GI5A 2OBOA 3RXMA 5DN6D 4OS5A 1OPHB 2J4IA 1UCYE 1C2LA 3ATKA 4B2CA 2BD7A 4Q80A 1GMHF 1D3PB 4H4FA 1MTWA 3S0NA 1SL3A 1GBEA 3S69A 1S0RA 2HVYB 1AO5A 4A1VA 4Y11E 5L2YH 1KDQA 1W7XH 4XBDA 2ZFRH 1LO6A 1YF4A 4ZKSU 3BTEE 1QB9A 3UREA 4FUEA 5ETXA 2NU1E 2ZDLA 1MD7A 3GCOA 4CRDA 2IJD1 1YBWA 1BZXE 2CHAC 3U69H 1E37B 1GHYH 3GY5A 2TPIZ 1MKWH 3Q3KA 3TLOA 2Z9IA 3SU5A 5AVDA 2F43B 3GCTG 4X6NA 1UTOA 2YMSD 1Y3XA 2ZGBH 4Y6DA 2XRCA 5C1YA 2A4OA 3UR6A 4XRNA 2FOHA 3IITA 1YCPH 5HM2A 1DM4B 1EASA 3NUMA 1S82A 2QXHA 1BITA 1HJAC 3FANA 4OS4A 5F6MA 1Y3WA 3UQOA 1EZQA 2G81E 1D6RA 2ANKH 3B23B 3HKIB 1C4U2 4A5TS 1LHFH 1TRYA 2AYWA 1C2IA 3A7XA 1K0HA 1ZPZA 3E16B 4Y7BA 3P8NA 2AFQB 1GJCB 2GKVE 5EQRA 1QRXA 1LVBA 1ELEE 2UUKB 3PMHB 2Y5HA 3QTVH 2PLXA 3VB4A 3SQEE 4BAHB 1RXPA 1OWEA 1AD8H 2QF4A 2LELA 1TQ0B 1L4ZA 1EQ9A 1GJBB 1MH0A 1DFPA 1YYY1 2AGGX 1SOZA 3LJJA 1C5WB 3FZZA 3VFEA 4DG4A 3F2FA 1E79D 3ZZAA 3QK1A 7ESTE 3RDZA 1YLNA 3EA7A 1E35B 3TNTA 4H6TA 3SN8A 1T8OA 3PYHA 4ISIH 2GDEH 4A92A 1P01A 1C5YB 1LPKB 3LH1A 1C2HA 3ZZ4A 3HK6B 1ZPCA 2FTMA 1KSNA 1GBJA 4A1XA 2WPJS 1G9IE 1XUJA 1PQ8A 4ZKRU 5C3NA 1IQFA 1ZSJA 1C9TA 3E0PB 1AWFH 2OP9A 1MQ5A 1BMAA 2O8WA 4ABEA 1NRSH 5F8ZA 4Y0YE 1AVWA 3LC3A 4JYUH 4Y8ZA 4ZXYH 3RXOA 2WUBA 3SNEA 5EW2H 1NFYA 1VITG 1NM6A 4OGYA 2AMPA 1O2XA 3BTKE 1FZZA 1O2PA 3ATLA 5ESBA 4B1TA 1ESAA 1RIWC 1O2GH 1Z1JA 2NU2E 4JZFH 5EG4A 2ZDVH 5E2PA 1DVAH 4XBCA 3UAIC 2KFWA 3RLWH 1XXDA 1O2UA 1O2VA 3I78A 1MKWK 4I32A 1RD3B 1O37A 1WV7H 4K8BA 4MVNA 2UUJB 4YT6H 4MPXA 1T7CA 4ZUHA 1F2SE 1TNLA 3AK5A 1MCTA 5A09A 1NFUA 1ETSH 1ARCA 4AORA 4ISOA 1DLEA 1IQKA 2LNCA 6CHAC 1QZ8A 1YPEH 3URCA 3B8JA 2GZ8A 3L3TA 2KX4A 1IQIA 3M3VA 1TPSA 4DT7B 3OTJE 2GCHF 3B9FH 1EUFA 4FUIA 1K1PA 1TX8A 3V13A 1GCTC 2KR7A 4I8HA 5F8TA 3W1EA 2CN0H 2ODPA 1Y3UA 3QX5H 4AZ2B 3K9XB 4D8NA 2GMTB 1SI5H 3BTGE 1O2HA 3S7KB 2BYAX 3EQ0H 2J34A 1B5GH 1LQDB 3SJKA 2G52A 1UVTH 1V2RT 4RN6A 2EI6A 4TYDA 5LPEA 5J4QA 1ELTA 1LKAA 1SR5C 3GDUA 3U98H 1MTNC 2J98A 1L1GA 4P00A 5HIYA 5LH8A 4IC6A 2FDAA 3BG8A 2PGBB 2A1DB 1GI8B 1SG8B 4XDEA 1PPFE 2ZFSA 1G32B 1T8LA 4FUCA 1TA6A 1QJ7B 3P70B 2ZCLP 1FI8A 3H5CB 1QJ1B 2Q6GA 1ZHMA 1ZZZA 4OS7A 1AGJA 3EAJA 1O3HA 2PKAB 4BAKB 4Q63A 3QWCH 1KLIH 2BB4A 3A80A 4AN7A 1LVYA 2CGAA 2HLCA 1SGFG 1EJNA 3S9AA 1Z7KA 1D9IA 1DY8A 1BTWA 2BQWB 1P57B 2BVRH 3ATWA 3F9GA 2ZHQH 4A1TA 4ABGA 2JETC 1CA0C 3BN9A 5T3HA 1SHHB 3H09A 1MQ6A 4ISNA 1W10U 2O8TA 2J9NA 4WH8A 3SJIA 3UNQA 1SLVB 2WPHS 3DA9B 1EATA 1S85A 4Q7YA 5FAHA 3SV6A 1OWJA 3QUMP 1FONA 1O3NA 5GIBA 3NKKA 1G3BA 5EJ1A 3MNSA 3T2NA 3RXCA 4Z1MD 3L33A 3LJOA 1EFRD 3RXTA 3E3TA 3MTYA 4ABDA 2WPDD 1O34A 2FOMB 5F8XA 1HAVB 1MTVA 3PO1C 1P2MA 5AHGH 1G2LA 4JYTA 1GVKB 3M7UA 1P2NA 1UHBA 5PTPA 4ACAA 3LKWA 3T28A 5CE1A 1H8DH 1K1IA 3URDA 3MQKC 1V2ST 1GDNA 2VIPA 1SC8U 2TIOA 3LGIA 3OAAD 3QGNB 2FPZA 1RTLA 4IGDA 1NRQH 4YOGA 3V12A 2BDAA 3K6ZA 5FPTA 3TK9A 1LVOA 1K1JA 1XKAC 1P05A 1WXRA 3TGIE 1MU8B 2WUCA 1N8OC 3U28C 4Q4LA 2F91A 5TJXA 1QBVH 2V3OH 4E7NA 5FXLA 1O2NA 1HXFH 2ESTE 1HJ9A 5L30H 1BMLA 1PPHE 1HAYB 1TONA 3SUEA 2WPIS 2BY9X 4ABBA 4K8YA 3NZIA 1A1RA 2SGQE 3AW1A 1C9PA 2Z7FE 3KF2A 4IN2A 6GCHF 2YNBA 1OWHA 5JDUB 5DO4H 2ZFPH 3RXJA 2W3KA 1HGTH 2BDYA 4K1EA 3DFJA 3BG4C 2O8UA 2XBXA 4HGCA 1SFQB 1GDUA 3RMNH 2ZZUH 3F2GA 2YMSB 1MZAA 2EA3A 2BX3A 4NSYA 5FL7D 2ZU3A 3SU4A 4CBOA 4CRBA 4ESTE 2VIDA 1ELDE 1HAVA 2FYQA 1L4DA 2PUQH 2GTBA 1TGNA 5A8ZA 1P3CA 2GT8A 3VB6A 3GCNA 1O2TA 1GCDA 3EYDA 3DSPA 4WF8A 3MWIU 2VVCA 4AFQA 3UB0A 2KCPA 3PWCA 2HVXA 2QAAA 4CREA 1O31A 3UQVA 2B9LA 3P6ZB 1LMWB 4R8TB 4X6OA 2XNIA 1DDJA 1K22H 5E2OA 1Y5UT 3RXKA 1AN1E 1GJ7B 2QY0B 5BPEA 3MHWU 4ZHLU 1ID5H 1GI3A 1LHDH 5F03A 5HIZA 3CENA 3TH2H 4AX9H 1A2CH 2PKAA 1BUIA 4R0IA 3KNXA 3DD2H 1EJAA 1KMHB 1SB1H 3QGJA 3U1JB 8GCHF 1PQAA 3RUOA 1O2JA 1C5LH 2SNWA 4KP0A 2NU3E 1QURH 1QBNA 4U32A 2ILNA 4AOQA 5C20A 2VWNA 4IMQA 1AVXA 1EZSC 3F3BA 4NIWA 2A2QH 1YPMH 4X1SU 1Y3YA 2RA3A 3OEHD 3OX7U 4DIIH 4ISLA 1TGTA 3UY9A 1XUIA 1WUNH 2V6NA 1TGSZ 2R3UA 2Y5FA 2ZU5A 3M3SA 1TWXB 3MU5A 1HAZB 1QL9A 1A5HA 2BD5A 4FUHA 1AB9B 1BTZA 4K3JA 5DG6A 1FV9A 1HRTH 2JIZD 4WXIA 1MKXK 1GPZA 3A8BA 4Y0ZE 1NFWA 2C93B 2VWLA 4UDWH 3U8OH 3KL6A 4XE4A 1SLUB 1V2OT 1FY3A 2GZ7A 1TQ7B 3ZZ8A 3DHKH 1ZLRA 1U6QA 1KIGH 1CQQA 1JRTA 3TK6A 3P8FA 3ZV8A 1K9OE 2WPMS 2VINA 3MU1A 5B6LA 5E8EH 4HG6A 2ZTYA 2HWLB 3M7QA 1P2OA 2D1JA 3SJ8A 3SV8A 2PWXA 1H1BA 1O0DH 2H5CA 5GWZA 2UWOA 3MH4A 1VITF 3PO1B 1LQEA 2ZHDA 3OTPA 1CU1A 1GJDB 1CT4E 1Z6JH 1NU9A 5EW1H 1Z8IB 5DKMA 3TITA 2BLWA 3TPIZ 1O5BB 4NFEA 2BLVA 1V3XA 3VXFH 1L0ZA 3TGJE 1OXGA 2XBYA 3PROA 3MNXA 4LK4A 2FP7B 1HLTH 5KEDA 2K8IA 1C2JA 1SKYE 5KGOA 1GI0A 1ZJKA 3PV2A 4MNXA 3ATIA 1DT2A 4ZH8A 2OBQA 4F48B 1HUTH 1FAXA 4B73A 2F83A 5A2MH 1JBUH 1LHCH 1QTFA 4CH2B 1E1RD 2P16A 2BVSH 1C5UA 1KYNA 2FODA 3P92A 1K2I1 2FOAA 5EXLA 4IC5A 1TMUH 1EAUA 2GVFA 1RTKA 3RMOH 3SU1A 1EX3A 1ELVA 1GBFA 1EAXA 3VB7A 4B2AA 1O3MA 3A89A 4UFGH 1J15A 1A61H 1C1TA 1NBME 5L6NH 2SGEE 1D3DB 1Z71A 1O38A 4INHA 2P8OC 1CGJE 2NU0E 4A6LA 3SU6A 1MAYA 1SGNE 2VGCC 1A5GH 1IHSH 1H8IH 5JBTA 2BD4A 1HFDA 3R3GB 1FAKH 3SYJA 1ZHPA 5EU8A 5JB8S 1C4Y2 2F9BH 4GHQA 1SGEE 2ZDAH 1ZHRA 2I6SA 3BTTE 1EP5A 1MCVA 1V6DA 1MZDA 3MH6A 1HNEE 1SHYA 1ESBA 3F68H 3SV2H 2JETB 4B74A 1GG6C 1C5SA 1VITH 3NK8A 5E0HA 3O8RA 4D76A 2XW9A 4BAMB 1GBIA 3K6YA 2CK3D 5E0GA 1XMNB 2VVVA 1EPTB 2O8MA 1W13U 2PSYA 2VIVA 3VG8A 4FVBA 3ZZ6A 1P12E 2W7UA 3TJVA 1FXYA 4TT3D 1L2EA 4ZROA 2Y80A 1DUEA 3QLPH 1DSTA 1SGRE 1DXPA 1L1NA 4X0WU 1F0TA 3W94A 1EPTA 1AY6H 4BXSA 1O3OA 4CBNA 3JZ1B 1F5RA 3OY6U 5DPAA 5J4SA 5IYTA 4AGJA 4NIXA 2A7JA 2R2WU 2XXLA 3P8OA 3RU4T 1GI2A 2GV6A 3BSQA 1GG6B 1ARBA 4MNWA 1BRUP 1C5MD 1PPEE 3RXQA 3RXSA 2VWMA 1TYNA 5EQQA 1ZGIA 2FOCA 1GI7B 2QGRA 4NGAH 2XCFA 3SNCA 3UNRA 4K60A 2QYIA 3HPTB 1MMJN 4WMDA 1V2KT 5A0BA 3HGNA 4U30A 2STBE 4JZIA 5GNDA 1AVGH 4DOQA 2SGPE 5DP6A 1GCTB 2CV3A 2R9PA 2A31A 4JK6A 2RG3A 1NRRH 3M5MA 5GDSH 1HPGA 4GUXA 1RTFB 3RMMH 6LPRA 2FTLE 1GDQA 1P03A 1YGCH 2QXIA 1CT0E 3ZZ5A 5T6GA 6CHAB 3RC6A 1V2MT 1GJ5H 3ZVDA 3GY7A 1KTSB 3P8GA 4UFDH 1PQ7A 3RLYH 4X8TH 1E0FD 1BA8B 5EXNA 1C2EA 3BEUA 4Y79A 4MPUA 1TGBA 2GP9B 1NBMD 2R3YA 2BLOA 1AZZA 2FOGA 1AE5A 1G3DA 1Z8JB 4AYYB 1VJ9U 3D65E 1E1QD 1GBCA 2J95A 3DSOA 2AGIX 3MI4A 5DK1A 4CRAA 3LGVA 3VXEH 2L6OA 2ZTZA 1GHAF 1HAXB 4X8UH 4ZXXH 1JWTA 3MU8A 3E6PH 3JZ2B 1E34B 1H9HE 1P9UA 3GCHB 2A5KA 1DITH 5JB9S 4AG1A 1TBZH 3KHVA 2A4RA 3UUZA 2A2XH 2IN2A 2A0QB 1GL1A 1ZPBA 1O35A 4B2BA 2V3HH 2CMYA 3LIWA 1BJVA 2W5EA 3OSYA 1YPJH 1T8MA 3NRLA 5G4BA 2ZU1A 2BY5X 3FP7E 3LOXA 2ANYA 4I8KA 5A0AE 4RKOB 3V3MA 3ZYEA 2OXSA 1EZUC 1TABE 4UFFH 1P2JA 3L6PA 1OWIA 5FPSA 1EOLA 5FX5A 3K2UA 4ZKOU 3A7TA 2OTVA 4UFEH 7GCHG 1M9UA 4ZHMU 1P3EA 1TPOA 2O9QA 4WMEA 3TH4H 3UIRA 1GHBF 3BTME 2WV5A 2OD3B 1ZMNA 2QIQA 4XSKU 4GPGA 1V2QT 2IOTA 4GLYA 4XD7D 2F9VA 3A85A 3PMJA 1G3CA 2QE7D 1O3EA 2OLGA 3RXUA 3SU3A 2G51A 1RS0A 1ANEA 3UTUH 1PPCE 4LZ1H 4THNH 1EKBB 3NCLA 1QA7A 5E0JA 5DP8A 2R0KA 3BIVH 4JYVH 1W0ZU 2P3TB 3EDXB 1O3GA 1UHBB 4ACBA 1NRPH 5SGAE 1SPJA 1IQMA 3GCTF 4U2WA 2EQNA 1FY1A 1NPMA 1SGIB 1SLXB 3HKJB 1GVLA 1J8AA 3ZVFA 3RXBA 1X7AC 4NA9H 2HPPH 2RCEA 1UVUH 2P3FH 2V7QD 1O3PB 3D62A 4CRCA 1FJSA 4MNYA 3BTDE 2ANWA 2G4UA 1MD8A 1Z6EA 3KQBA 3PLBA 4FVDA 2ZDMA 1WAYB 1UTLM 1J9CH 2OQUA 4K2YA 3T5FH 1O3JA 3T62A 5A0CA 7KMEH 1GBKA 2J5UA 2BM2A 2Y82A 3RP2A 2ULLA 2XTTB 3V0XA 3DUXH 3F9EA 1JMOH 3KEEA 5JBBS 1QR3E 4E06H 1C5VA 1FPHH 1ZTJA 1QFKH 2C90B 3C27B 4Y71A 5HGGA 1P9SA 1TBRH 2PHBA 5CMXH 2M2AA 2ZCKP 1BBRK 4KGAA 2UWLA 3TJOA 1QY6A 4I8GA 2BOHB 1WTGH 1ZSKA 3RM0H 1PFXC 3SOSA 1O2OA 1OOKB 1SLWB 2VU8E 4DW2U 4Y8YA 1P2KA 1A0HB 2KCYA 2JJ2D 1EZXC 5T1VA 3EE7A 3PLPA 3SUDA 1BQYA 5GJ4B 3N7DA 1W14U 1GMCF 1O2WA 3RMLH 2AIPA 2FI4E 4LZ4B 3EE0B 2W3IA 1OP0A 5EOKA 4YT7H 4MG3A 4ABIA 2HRVA 1ZOMA 2AMQA 1FDPA 3RXHA 1CGIE 2B8OH 4OS2A 4FU9A 2ZHWH 4BANB 2BD9A 3SUGA 1HJ8A 1YWUA 1ZYOA 1FX0B 5JBCS 1YLDA 1CHOF 1GBBA 1O3DA 2ZEBA 2ZF0H 2BD3A 3DFLA 1SQTA 4DVAU 2BVXH 2BY6X 1D3QB 2ASUB 2BZ6H 1V2UT 4FXGH 2FXRA 3GDSA 1ELCA 2BD8A 2G8TA 4F55A 1TOMH 2SGDE 3PLKA 5FCRA 1IOEA 4ABHA 1UTQA 2Z3CA 4NIVA 4Q2KA 1UCYH 3SI4H 2BDHA 1K1OA 4HTCH 1W8BH 1ESTA 1FY8E 1CT2E 1YC0A 4KKDA 4NZQA 3ZYDA 2FZZA 1UMAH 4GAWA 1OP8A 1GJ4H 2AEIH 2JKHA 2EI7A 3BTHE 3LH3A 3UPEA 3QO6A 1ZMLA 1A5IA 5EPYA 4AB9A 2FOBA 3BEIB 1KXBA 1TOCB 3I29A 1GHXH 2FLRH 4PROA 1P06A 1O36A 1LDTT 3EA9A 1GJAB 1HBTH 1UVPA 1ZMJA 3M35A 5TCCA 1OKXA 1YP9A 2B0FA 2FI3E 2AMDA 4Z6AH 1UTPA 2XWAA 4Y7AA 4K1TA 2A7CA 1K28D 1C1OA 3CS0A 3MFJA 2VVUA 1S83A 1YLCA 4D7FA 1V2JT 1SGFA 8LPRA 1N8OB 5ABWA 1J14A 1DANH 5DP9A 3MNBA 2BXTH 5HMAA 2JDID 1O5CB 2VH6A 5C5NA 5HM9A 2JJ1D 4IN1A 2F9OA 2QF5A 1THRH 4DY7B 4JZEH 3EA8A 4IBLH 1C1QA 2M5TA 1BBRH 1XUKA 1TGCA 4M7GA 3OY5U 2CXVA 1O3AA 2TGAA 1T31A 2W6ID 2GMTC 3OFND 3HGPA 1F7ZA 2Z94A 1MTUA 3RM2H 1CSOE 1FQ3A 3TNSA 4UONA 2ZWLH 4GVUA 3KQCA 3Q3YA 3VB3A 3D49H 3KQ5A 1AFQC 3QZQA 1TAWA 3K65B 3F0PA 1QRWA 1ETRH 1YPKH 3RU4E 2JH5D 1BRAA 1S6FA 1BHXB 1GI6A 5T6DA 1SQRA 2ZC9H 4X1NU 4NG9H 3NXPA 4CRGA 1BTHH 1PPGE 2GGVB 2VH0A 4MQAA 3O8CA 5C0TA 1NROH 1GWAA 3RXPA 3A86A 3GYMA 2C8WB 5KECA 1K1NA 3LU9B 2ZGHA 1WQVH 3H7TA 1FUJA 3GY3A 3GDVA 2BDIA 1LPZB 4YM9A 2PR3A 4LOYH 4Y8XA 3IWMA 3A87A 3UOPA 2QF0A 1QB1A 1YPHE 2C8ZB 2THFB 2LPRA 5EIYA 3GCHC 1A0JA 2C3SA 1KY9A 1OYQA 1QA0A 5C94A 1TNKA 2OC7A 1TNGA 2K0QA 4O3TA 4DJZB 1NS3A 1IQGA 2ZGJA 3KIDU 2C8YB 2J98B 2ZHEH 2ZGXH 1NFXA 1ZTKA 1VR1H 3N7EA 1O33A 1TIOA 1C1SA 5CHAC 3W95A 4GCHG 1OP2A 1Y3VA 4B71A 2WV4A 3BG4B 3TGKE 1UTNA 2ZU4A 3FAOA 5H4IB 3GISB 2FYRA 1P10A 1BMNH 1TX7A 2F4LA 2PSXA 2FO9A 1O2QA 3TJUA 1MUEB 4O97A 2DE9A 4ZCNA 1CVWH 1D3TB 1GJ9B 3VEQB 3SV7A 4AFZA 1ACBE 1CHGA 1KDQB 2VGCB 1FY4A 3ODDA 2GDDA 3C1KA 1BT7A 1N6YA 3V7TA 1FIWA 7LPRA 2Z3DA 1P04A 1AE8H 1P2IA 3HATH 2XC4A 1UTJA 2HLDD 5HKKD 1ZSLA 1W0JD 2Y7XA 4WMFA 1RGQA 2ZCHP 3F2HA 3A8DA 3Q76A 3UNSA 2XBVA 2JH0D 3A7YA 2BY7X 1AQ7A 1CBWB 1TLDA 3KGPA 1GBTA 1BMMH 4RSPA 1AIXH 2Z9GA 4D7GA 5IDKA 3Q00A 1HAGE 1HIAB 2EY4C 2ZQ1A 3AW0A 2Z3EA 1KXFA 1HAHH 9LPRA 1YPLH 1ZR0A 2OK5A 3VGCC 1QL8A 3O8BA 3SHAH 3NPSA 1BB0B 1QGFA 1HAOH 4BTUB 1O2RA 5FCKA 3LGTA 1DWEH 2XWBI 2VIOA 1T4UH 1HXEH 1IHTH 2BMGB 1G2MA 4RKJB 2HPQH 1PYTC 2PKSC 1KLTA 4H42U 1P2QA 2HNTE 1GGDB 2G5VA 3OU0A 1ANDA 2GCHG 3TJNA 4IMZA 1V2LT 5IK2D 4TPIZ 1Y8TA 2OUAA 3Q3XA 1Q3XA 1C5ZB 1SSXA 3F9FA 4TY6A 1YKTA 3BF6H 5K7RA 2ZGCA 1TMTH 1INCA 3FP8E 1QNJA 1ZGVA 2P94A 4SGAE 1T32A 4KTSA 1BCUH 1LTOA 5C2ZA 1EAIA 1WOFA 2KCOA 2Z9KA 2CHAB 1GMDF 3WW7A 1O30A 2FOFA 2QA9E 1A7SA 2QV1A 4LXBH 4TPYA 3E91A 2FS9A 3M61U 3SNDA 2G55A 1T8NA 1O3IA 2ZPSA 5GXPA 3CS7A 3M5NA 1B7XB 1GMHG 3CNRA 1Z8RA 1O2YA 2Q1JA 2QN5T 3M5LA 3UFAA 1P0SH 1UTKA 2PTNA 1A46H 3PTBA 1TFXA 2A4QA 1F0RA 4JZDH 3U9AH 2XCNA 1FN6A 1UW7A 2ZP0H 2KAIA 1GI1A 2QCYA 3T26A 1GHZA 2WINI 3QN7A 1TPAE 1NY22 2STAE 1O39A 1AKSB 1GBLA 4RT0A 4BTTB 3MH7A 1HAIH 1YCPM 5A8YA 2TRMA 1C1PA 2ZHFH 4WWYA 1O2KA 4I33A 2EC9H 5A8XA 4JZ1A 2B7DH 1TNJA 1DUAA 1TRNA 4ABFA 3KYGA 2PW8H 1IQLA 3LC5A 4I86A 3A7ZA 1AWHB 3D23A 1SGCA 2GJGA 1TB6H 2H1UA 1S6LA 3NWUA 4AFSA 5DP3A 2A32A 4TSFD 1Y5AT 2K1QA 1C1WH 8KME2 1QCPA 3A81A 4YOIA 3FOAA 3ZZDA 3ZVAA 2ZKSA 4AG2A 3N99A 3RXGA 5CDFE 1C2GA 2AIQA 4ZHAA 3FP6E 1O5GH 3Q77A 3F9HA 4XOJA 2Z9JA 1O3CA 3AVZA 3TIUA 1SGTA 1DLKB 3SW2B 1OWKA 1O5AB 3WY8A 1DX5M 1QJ6B 2A5AA 2H9TH 3PTNA 3DCLA 1CO7E 1G37A 3E8LA 4AFUA 4AGKA 1TPPA 1PPBH 1GJ8B 1K1MA 2Z9LA 4CR5A 1H4WA 2L74A 1IQEA 3RC4A 6ESTA 1BOQA 5C1XA 1HJAB 1TNHA 1SQOA 2DUCA 3BIUH 3FO8D 2ZFQH 2QF3A 2YMSC 1UVSH 3RXEA 1QQ4A 2IPQX 3FVFB 5LPRA 3SGQE 4HFPB 4M9FA 1BBRE 2UWPA 2F9UA 2GT7A 1O2MA 1BHXF 1E36B 1O3LA 3IG6B 1O2SA 3LDXH
chains in the Genus database with same CATH topology
1XUHA 1V2WT 2BHGA 1AHTH 1THSH 1ELGA 3BTQE 1VZQH 2ZA5A 3SUFA 1UJ1A 2ZU2A 5GPIB 3FZDA 1OWDA 1EXFA 1NO9H 1V2NT 3TVJB 1AUJA 3ZVCA 1TA2A 1LHEH 1CBWC 1XKBC 2G5NA 1NZQH 2PGQB 1MU6B 1GL0E 1NC6A 4I8LA 4AB8A 1AZ8A 2H5DA 3N7OA 2RA0A 2W7SA 3ZZ7A 2D26C 1JRSA 2CJIA 4YOJA 4H6SB 1DWBH 1JXPA 2ZI2H 1A3EH 1C2MA 1C5OH 1WBGB 5C5OA 1BRBE 4NCYA 1GBAA 2UUYA 1O2IA 5DP7A 1C5XB 3SGAE 1QHRB 1S0QA 1ETTH 1GMDG 1THPB 1O2ZA 1PQ5A 1N1LA 2GCTC 2PV9B 3RXFA 3SNAA 1DXWA 1C1MA 4FUGA 5DP4A 4YESB 3UOUA 1FMGA 4NWKA 4I7YH 4F4OC 1FY5A 1Q2WA 1WQSA 1XUGA 1L1JA 4BTIB 1AU8A 1F5LA 2O8LA 2GX4A 1A0LA 4NA7A 1SMFE 1EOJA 3PM3A 3BV9B 4UEHH 2TGDA 2GV7A 1AI8H 2AS9A 3ODFA 1DWDH 1VCWA 1D6WA 4JMYA 1F0UA 3LGYA 2FLBH 2P8OB 4SGBE 1QL7A 2ZPRA 1XUFA 2RDLA 3A7VA 4GCHF 3M3TA 1IQHA 1HAPH 3TU7H 1C1VH 3A83A 4X1RU 3GY4A 1O2LA 1G3EA 3ZVEA 1ELAA 1FN8A 1GHAG 4B75A 1C4V2 3MU4A 1CHOG 3RXVA 4DGJA 1TALA 4JCNA 3SHCH 2XYAA 4UD9H 2XC5A 1XVOA 1Z1IA 1ELFA 2F3CE 1V2VT 2BX4A 3PB1E 8ESTE 4FUJA 3H7OA 2WPKS 1YPHC 3PMAB 3VGCB 1S84A 1DWCH 2HNTF 5K0HA 2Y5GA 2VIWA 4Y76A 1ORFA 2TBSA 2C4FH 2WYJA 3ZZ3A 4Z0KA 1WTHD 4FUFA 3GY2A 1QBOA 3SBKA 3VB5A 1XX9A 1JIMA 4X6PA 3A88A 2OINA 3MU0A 4BNRA 1O5EH 1XVMA 1EB1H 4VGCB 1W7GH 4CH8B 3ZZCA 5DJ7A 1LHGH 3ZVBA 4NZLA 2BOKA 1NRNH 3M36A 3ATMA 1KXAA 3SZNA 4E7RG 2V0BA 3PV4A 2HGTH 1YPGH 1V2TT 1EPTC 1IQJA 2J38A 2C8XB 1OS8A 4INKA 4MNVA 3E1XB 5BRRE 3SJOA 2Y81A 5AF9H 1OYTH 1GVZA 4YZUA 2EEKA 1W2KH 3ENSB 4INLA 1C5RA 1C2KA 2A45B 1HB0B 2G00A 4O9VA 4NWLA 2ALVA 4OS1A 1SGQE 3RXLA 5B6OA 4GSOA 3UWIA 3VPKA 2D8WA 1MAXA 3QTOH 4X1PU 4YLQH 3TK5A 1ANCA 2ANMH 2R2MB 5CHAB 1BRCE 4FU7A 3ZVGA 1UTMA 3M7TA 4FUDA 1F92A 2Q6FA 3EGKH 2Z6BD 3P17H 4ASHA 1Y5BT 1IQNA 4ZAEA 2VJ1A 1CE5A 2GZ9A 4OGXA 5FX6A 2VB0A 1FNIA 1B0EA 3KN2A 4X2XA 2OCVB 1BJUA 1UO6A 1KTTB 2R0LA 3MOCA 4DIHH 2ZDNA 4B76A 8GCHG 1ZRBA 3SORA 1NT1A 2BD2A 1K1LA 4X2YA 1C5PA 4KTCA 3U1IB 5C1UA 4U01A 1EJMA 1EAWA 3U8RH 4CRFA 1VCQA 3PWBA 1BTYA 5JPMH 2Q6DA 1GBMA 4YTAA 2VNTA 2BTCE 1AUTC 4X6MA 3RXDA 1GHWH 1QB6A 2AGEX 1O5FH 2ODYB 5HXFA 3ZZ9A 5JYIA 1MTSA 2CF9H 4XBBA 2ZNKH 1H9IE 4X8VH 1DE7H 1LPGB 1HIAA 2YOLA 1QRZA 4X8SH 1DY9A 2QXJA 1WSSH 3RXIA 1DPOA 1XXFA 2IJOB 3LT3A 1BDAA 2ZIQH 3UR9A 1K21H 1W3CA 2H9HA 1AFQB 4I8JA 3AAUA 2ZDKA 3DT0H 2J2UA 1GHVH 4X1QU 2ZFFH 3R0FA 4XFQA 1GGDC 3BTFE 4NFFA 3F1SB 4K1SA 1WCZA 4YO9A 1QIXB 2H2ZA 2VIQA 1A3BH 1RIWB 1PPZA 1PYTD 1HV7A 2EI8A 3AASA 5EQSA 5FBEA 2BXUH 3TH3H 1O5DH 4MPWA 1B0FA 5EXMA 5AFYH 1C2FA 1A4WH 3A8AA 1DSUA 3RC5A 4HI3A 3ZV9A 3KQEA 4ZKNU 4O3UA 1MBMA 1C1NA 3LGUA 1P8VC 1Z8GA 1C2DA 1ZRKA 1O3FA 2PTCE 4UE7H 4BAQB 1HCGA 1WU1A 2PKSB 1G36A 3QZRA 2XBWA 1BIOA 2QC2A 3M37A 1DICA 1C1RA 1SBWA 5FPYA 2NWNA 1O32A 1ZTLA 3STIA 3HK3B 3SO3A 3S7HB 3BTWE 1NESE 4DURA 1SGYE 3LGWA 4F49A 2TGTA 3O8DA 3RU4D 5T6FA 1BTUA 1D4PB 2BDCA 3GOVB 2ZO3H 3P95A 3SGBE 1NTPA 4IW4E 1FIZA 1LCYA 5TCAA 4Q7ZA 1Y59T 4CHAC 3GY8A 2FM2A 3SI3H 1TMBH 4MTBA 1H9LB 1LKBA 5LPFA 2NU4E 2UUFB 2BQ7B 2CF8H 3BEFB 2H9EH 5I25A 2PUXB 1C1UH 1T4VH 2GD4B 3SV9A 3MO9A 5ESTE 2A5IA 2XC0A 2D2DA 2ZTXA 4YLUA 2P93A 3QDZB 1HYLA 1C5NH 1OX1A 2B5TB 2F9PA 1SVPA 2P95A 2HOBA 2BDGA 2SGAA 4X2VA 3E0NB 2SGFE 4WH6A 1GHBG 3RXAA 1F5KU 2OQ5A 5HYOA 2P3UB 1W12U 2FX4A 1GBDA 5GCHF 4A7IB 1OSSA 2SNVA 2JH6D 1C5QA 1ELBA 6GCHG 2A7HA 1XM1A 5JBAS 1QQUA 2OC8A 9ESTA 3SQHE 1ZJDA 2WPLS 1LVMA 1MTNB 1W11U 3A84A 2ODQA 3T29A 4E05H 1P09A 4ZMAH 2FI5E 2BLQA 4O03A 1CA0B 4WY3A 4WXVA 3I77A 1RRKA 1GI4A 4TWWA 1SOTA 4GHTA 3MH5A 5EODA 1VCPA 3CP7A 1S5SA 3M5OA 4DCDA 3ESTA 1W0YH 1ANBA 2QXGA 4K5ZA 3KCGH 1C5TA 1CGHA 1MKXH 3A8CA 1JIRA 4D9RA 1TE0A 2YNAA 1NU7B 1F0SA 5EPNA 1YCPK 4BXWA 2GCTB 3OYPA 1VGCB 3MO6A 3FFGA 4CHAB 2FEQH 3PMBB 1GBHA 4MDSA 2ZQ2A 5FBIA 4I31A 4K69A 4VGCC 4X2WA 2TGPZ 2ZFTA 1AKSA 1KXCA 1WYKA 1SFIA 3LONA 1S6HA 2BDBA 1TX6A 4ABJA 4ABAA 1VJAU 1VGCC 2FX6A 2KAIB 4TWYA 2V35A 2FIRH 3S9BA 3E90B 2A4GA 1AMHA 3T27A 3G01A 2BQ6B 4JK5A 3RXRA 3GYLB 4ISHH 5L2ZH 2ALPA 1RJXB 3STJA 3A82A 2F9NA 5I46H 1JOUB 1P02A 4HZHA 1KLJH 5DP5A 1G30B 1TNIA 5AFZH 2HALA 1J16A 1KXDA 1NN6A 1IAUA 3LPRA 2J92A 2FS8A 2IPHA 3ITIA 2P59A 2DE8A 4CR9A 3A7WA 1SGDE 2Y6TA 3ELAH 1BTPA 2PFEA 3MYWA 4WJG2 4NSVA 1GMCG 2G4TA 1HDTH 5DGJA 5C67A 4BOHA 1TRMA 1BTXA 4WVPE 1O3BA 3F6UH 1E38B 3ZZBA 4BAOB 3U8TH 1SGPE 1V2PT 4IS5A 1ABIH 3MMGA 1SQAA 2Y7ZA 4D9QA 4OS6A 1GI9B 1UK3A 1Q31A 2W26A 1O3KA 1GJ6A 2FMJA 1DS2E 4KTUA 2VWOA 3SJ9A 3SNBA 2BY8X 1FLEE 1MBQA 4Y10E 1UK4A 4FUBA 4J1YA 2FOEA 2OC1A 4J2YB 2FWWA 4Q7XA 2WYGA 4QT8C 1KXEA 2AERH 1AB9C 3UWJH 4NIYA 1P11E 1CA8B 2OC0A 5FHTA 3GICB 1UK2A 2H6MA 7GCHF 3MNCA 1ABJH 1RFNA 3SU0A 1AFEH 5EGMA 1TBQH 2ZECA 4MLFB 3MO3A 1N6XA 2AH4X 2ZPQA 1UVOA 1PJPA 3AAVA 1UCYK 3SU2A 2FESH 5LGOA 2SFAA 5GCHG 4KELA 1EP6A 2I6QA 1DOJA 4MPVA 4FU8A 1FPCH 3GY6A 3T25A 4NA8A 2HNTC 3KQDA 3S9CA 2ZG0H 1EB2A 1S81A 2J94A 4TY7A 1J17T 1YM0A 4AYVB 2BZAA 1GI5A 2OBOA 3RXMA 4OS5A 1OPHB 2J4IA 1UCYE 1C2LA 3ATKA 4B2CA 2BD7A 4Q80A 1GMHF 1D3PB 4H4FA 1MTWA 3S0NA 1SL3A 1GBEA 3S69A 1S0RA 1AO5A 4A1VA 4Y11E 5L2YH 1KDQA 1W7XH 4XBDA 2ZFRH 1LO6A 1YF4A 4ZKSU 3BTEE 1QB9A 3UREA 4FUEA 5ETXA 2NU1E 2ZDLA 1MD7A 3GCOA 4CRDA 1YBWA 1BZXE 2CHAC 3U69H 1E37B 1GHYH 3GY5A 2TPIZ 1MKWH 3Q3KA 3TLOA 2Z9IA 3SU5A 5AVDA 3GCTG 4X6NA 1UTOA 1Y3XA 2ZGBH 4Y6DA 2XRCA 5C1YA 2A4OA 3UR6A 2FOHA 3IITA 1YCPH 5HM2A 1DM4B 1EASA 3NUMA 1S82A 2QXHA 1BITA 1HJAC 3FANA 4OS4A 5F6MA 1Y3WA 3UQOA 1EZQA 2G81E 1D6RA 2ANKH 3B23B 3HKIB 1C4U2 4A5TS 1LHFH 1TRYA 2AYWA 1C2IA 3A7XA 1ZPZA 3E16B 4Y7BA 3P8NA 2AFQB 1GJCB 2GKVE 5EQRA 1QRXA 1LVBA 1ELEE 2UUKB 3PMHB 2Y5HA 3QTVH 2PLXA 3VB4A 3SQEE 4BAHB 1RXPA 1OWEA 1AD8H 1TQ0B 1L4ZA 1EQ9A 1GJBB 1MH0A 1DFPA 1YYY1 2AGGX 1SOZA 3LJJA 1C5WB 3FZZA 3VFEA 4DG4A 3ZZAA 3QK1A 7ESTE 3RDZA 3EA7A 1E35B 3TNTA 4H6TA 3SN8A 1T8OA 3PYHA 4ISIH 2GDEH 4A92A 1P01A 1C5YB 1LPKB 3LH1A 1C2HA 3ZZ4A 3HK6B 1ZPCA 2FTMA 1KSNA 1GBJA 4A1XA 2WPJS 1G9IE 1XUJA 1PQ8A 4ZKRU 5C3NA 1IQFA 1ZSJA 1C9TA 3E0PB 1AWFH 2OP9A 1MQ5A 1BMAA 2O8WA 4ABEA 1NRSH 5F8ZA 4Y0YE 1AVWA 3LC3A 4JYUH 4Y8ZA 4ZXYH 3RXOA 2WUBA 3SNEA 5EW2H 1NFYA 1VITG 1NM6A 4OGYA 2AMPA 1O2XA 3BTKE 1FZZA 1O2PA 3ATLA 5ESBA 4B1TA 1ESAA 1RIWC 1O2GH 1Z1JA 2NU2E 4JZFH 5EG4A 2ZDVH 5E2PA 1DVAH 4XBCA 3RLWH 1XXDA 1O2UA 1O2VA 3I78A 1MKWK 4I32A 1RD3B 1O37A 1WV7H 4K8BA 4MVNA 2UUJB 4YT6H 4MPXA 1T7CA 4ZUHA 1F2SE 1TNLA 1MCTA 5A09A 1NFUA 1ETSH 1ARCA 4AORA 4ISOA 1DLEA 1IQKA 2LNCA 6CHAC 1YPEH 3URCA 3B8JA 2GZ8A 3L3TA 1IQIA 3M3VA 1TPSA 4DT7B 3OTJE 2GCHF 3B9FH 1EUFA 4FUIA 1K1PA 1TX8A 3V13A 1GCTC 4I8HA 5F8TA 2CN0H 2ODPA 1Y3UA 3QX5H 4AZ2B 3K9XB 4D8NA 2GMTB 1SI5H 3BTGE 1O2HA 3S7KB 2BYAX 3EQ0H 2J34A 1B5GH 1LQDB 3SJKA 2G52A 1UVTH 1V2RT 4RN6A 2EI6A 4TYDA 5LPEA 5J4QA 1ELTA 1LKAA 1SR5C 3GDUA 3U98H 1MTNC 1L1GA 5LH8A 4IC6A 2FDAA 3BG8A 2PGBB 2A1DB 1GI8B 1SG8B 4XDEA 1PPFE 2ZFSA 1G32B 1T8LA 4FUCA 1TA6A 1QJ7B 3P70B 2ZCLP 1FI8A 3H5CB 1QJ1B 2Q6GA 1ZHMA 1ZZZA 4OS7A 1AGJA 3EAJA 1O3HA 2PKAB 4BAKB 3QWCH 1KLIH 2BB4A 3A80A 4AN7A 1LVYA 2CGAA 2HLCA 1SGFG 1EJNA 3S9AA 1Z7KA 1D9IA 1DY8A 1BTWA 2BQWB 1P57B 2BVRH 3ATWA 3F9GA 2ZHQH 4A1TA 4ABGA 2JETC 1CA0C 3BN9A 5T3HA 1SHHB 1MQ6A 4ISNA 1W10U 2O8TA 2J9NA 4WH8A 3SJIA 3UNQA 1SLVB 2WPHS 3DA9B 1EATA 1S85A 4Q7YA 5FAHA 3SV6A 1OWJA 3QUMP 1FONA 1O3NA 5GIBA 3NKKA 1G3BA 3MNSA 3T2NA 3RXCA 3L33A 3LJOA 3RXTA 3E3TA 3MTYA 4ABDA 1O34A 2FOMB 5F8XA 1HAVB 1MTVA 3PO1C 1P2MA 5AHGH 1G2LA 4JYTA 1GVKB 3M7UA 1P2NA 1UHBA 5PTPA 3LKWA 3T28A 5CE1A 1H8DH 1K1IA 3URDA 1V2ST 1GDNA 2VIPA 1SC8U 2TIOA 3LGIA 3QGNB 2FPZA 1RTLA 4IGDA 1NRQH 4YOGA 3V12A 2BDAA 3K6ZA 5FPTA 3TK9A 1LVOA 1K1JA 1XKAC 1P05A 3TGIE 1MU8B 2WUCA 1N8OC 2F91A 5TJXA 1QBVH 2V3OH 4E7NA 5FXLA 1O2NA 1HXFH 2ESTE 1HJ9A 5L30H 1BMLA 1PPHE 1HAYB 1TONA 3SUEA 2WPIS 2BY9X 4ABBA 4K8YA 3NZIA 1A1RA 2SGQE 3AW1A 1C9PA 2Z7FE 3KF2A 4IN2A 6GCHF 2YNBA 1OWHA 5JDUB 5DO4H 2ZFPH 3RXJA 2W3KA 1HGTH 2BDYA 4K1EA 3DFJA 3BG4C 2O8UA 2XBXA 4HGCA 1SFQB 1GDUA 3RMNH 2ZZUH 4NSYA 1MZAA 2EA3A 2BX3A 3SU4A 2ZU3A 4CBOA 4CRBA 4ESTE 2VIDA 1ELDE 1HAVA 2FYQA 1L4DA 2PUQH 2GTBA