3PB1E

Crystal structure of a michaelis complex between plasminogen activator inhibitor-1 and urokinase-type plasminogen activator
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDAGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plasminogen activator inhibitor 1
publication title Structural basis for recognition of urokinase-type plasminogen activator by plasminogen activator inhibitor-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor/hydrolase
total genus 54
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2010-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3pb1E02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3pb1E01
1A7SA 1C5WB 1O3PB 2SGFE 3B23B 1XVMA 4XBCA 4Z6AH 1Z7KA 3IITA 2AS9A 2VB0A 2A4RA 2QCYA 3SNAA 2Y5HA 3GCHB 1UMAH 4IS5A 1LKBA 1WAYB 2Y5FA 4JZFH 5DPAA 3TLOA 3TGIE 4UFFH 2B0FA 4Y8XA 4ZHLU 1DPOA 1FY4A 3M5OA 2BLOA 1GHAF 3UIRA 3PMAB 5E2PA 2WPHS 1BTYA 2HGTH 1P12E 1BTUA 2KAIB 1BBRK 1C9TA 4BANB 1BOQA 3LU9B 4ZKOU 2Z9JA 2VIOA 2C4FH 3M5MA 5EXMA 2O8WA 2H9TH 4H6TA 1GL0E 3SNDA 1MTWA 2GZ7A 2Q6FA 1IQIA 2KAIA 3SU0A 4ABIA 2FYRA 3D49H 4BNRA 1Y5BT 2FXRA 3LC5A 3A7WA 2FPZA 1VJ9U 1Y5AT 1T4UH 1ZYOA 1B0FA 3NPSA 3SHAH 4FVDA 1C1SA 4AYYB 1P04A 2ZPSA 1EAUA 4AB9A 1A0LA 1TOCB 3K6YA 1O35A 4ISHH 1GI8B 2O8MA 1UTOA 3MU5A 1SGFA 1TNLA 3TJOA 1P2QA 3O8CA 3SUEA 5EW1H 2ZC9H 1ZHPA 1GI7B 1C9PA 1LVMA 2QN5T 1D3QB 4LZ4B 2ANWA 1NRRH 3ZVBA 2J92A 1QL9A 4NSVA 2VGCC 2G5NA 2UWPA 4TPYA 3RXHA 2D26C 1O0DH 4X2YA 2D8WA 1GI0A 5LPFA 2IOTA 2BVXH 3UY9A 4M7GA 5FX5A 1TALA 2G8TA 1P9SA 3MH4A 1CT2E 4JYUH 3TH4H 2F83A 2J4IA 2BYAX 1DM4B 2BD5A 6CHAB 3ZVDA 4UONA 3E1XB 3DFLA 4WMDA 3AW0A 2EA3A 4X1NU 3TK5A 1IQEA 1JXPA 3V3MA 1O2PA 1SQTA 2ANMH 4DCDA 1J9CH 2ILNA 2BD8A 1O2HA 1SOZA 4FXGH 2ZO3H 3E6PH 1MTNC 3SU3A 1C1UH 1K1LA 3M7UA 2THFB 2ZFPH 3A85A 1UHBA 1FNIA 4U01A 3UOPA 4A1VA 3OX7U 3GYMA 4NWLA 2ASUB 3MOCA 5EOKA 1FONA 4HFPB 3GICB 1C2JA 3I77A 3MMGA 1GHXH 2VIVA 3BTHE 4OS5A 5DGJA 1BRCE 1HCGA 4X6NA 3QZRA 3T26A 2YNBA 4AFUA 1YPMH 5GXPA 4CH2B 1V2PT 3P8OA 4BXWA 2BZAA 2CF8H 2GT8A 3GCOA 3GCHC 4NFEA 1TGBA 2GVFA 1O2UA 1ANBA 2FLRH 4FUFA 4CHAC 1K1PA 3BIUH 4AORA 1DLEA 5EU8A 2HNTC 1XUHA 2VVUA 2XBWA 2Z3CA 1VGCB 1XKBC 1GJ7B 1DVAH 3KCGH 1HXEH 4NA8A 1SPJA 2Y5GA 1H9IE 1LCYA 2TGAA 3F9FA 3GY5A 3OYPA 1C5LH 2K1QA 1ELFA 1GVLA 1XM1A 1FUJA 3I78A 1FQ3A 5JPMH 3NK8A 2ZI2H 2H5CA 2OD3B 1PPCE 3BTQE 1MKWH 1V3XA 2ZDKA 3UFAA 3MHWU 2BY8X 1SC8U 3M37A 4FUHA 1QJ1B 1B0EA 2OINA 1P3CA 3A82A 2XC4A 1VITF 1K1NA 3SGBE 1OSSA 4DY7B 2UWLA 5LH8A 1NFUA 3NCLA 1O2OA 1GMDG 4K1TA 3ZVAA 2BD3A 2OTVA 3SI3H 1G37A 1C5NH 4B1TA 1RXPA 2IN2A 1THPB 1GMCF 1ESAA 3SV8A 2H9HA 2BXUH 1PQ7A 4I33A 5GJ4B 3IG6B 3SGAE 1FIWA 1GBDA 3BTME 3LGYA 2VIDA 1ZSJA 2BDGA 2A31A 3P6ZB 1TPPA 1W3CA 3MO6A 2WPLS 2B7DH 1KTSB 4JYTA 1XKAC 1YPJH 4Q2KA 1DT2A 1VJAU 3MU1A 1MKXH 2ZZUH 3RM2H 6CHAC 1C2HA 3ZZCA 4A5TS 1CU1A 2ZNKH 3RXVA 1WV7H 5LPEA 1UVOA 2BY9X 1ESTA 4YZUA 5HMAA 1DICA 2D2DA 3MU4A 1SGIB 4B75A 4U32A 1GBAA 2CMYA 3Q3YA 1J17T 2ZU1A 1HBTH 1O2YA 3UNRA 1EB2A 1NRPH 3QZQA 1YPEH 4WF8A 5DP6A 2RDLA 3GY2A 1SVPA 1TMBH 1PPZA 5T6GA 1HFDA 2P3UB 4ZHAA 1D3TB 1BTHH 3VB4A 1EPTA 4ASHA 3M36A 2Z3EA 1T32A 1N8OB 4HZHA 7ESTE 3PTBA 2FP7B 3KQBA 1E35B 1RRKA 3S7KB 3QUMP 1HAZB 3TGKE 4Y7AA 1SB1H 1QL7A 4MNWA 1FV9A 4O9VA 1DWDH 3A87A 4A7IB 1OP2A 1PYTC 2F9NA 1AE8H 1Z8JB 3ZZ9A 1VGCC 1LHFH 4FUEA 2FOHA 1QIXB 2A5IA 5FBIA 2FTLE 2FOMB 2JETC 2PKSB 1SR5C 2F9BH 4BTUB 5LPRA 4NIYA 3RXGA 1JBUH 1S6HA 1ANDA 4XBBA 4TY6A 1GBEA 3EQ0H 1W2KH 5FXLA 3U1JB 5GCHG 4AG2A 1CE5A 1ZMJA 3NXPA 4SGAE 4DVAU 1NPMA 3BTEE 1Y8TA 3KN2A 4YT6H 1EASA 2AIPA 3F9GA 3KGPA 1OPHB 2FESH 4K60A 3T29A 1AO5A 3W95A 2GDDA 2STBE 2BVRH 5BRRE 5DP3A 3SUFA 4O03A 3MNCA 1GBLA 1MQ5A 4D9RA 1ZPZA 2VU8E 3FAOA 1YPHE 3V0XA 4KTCA 1GJ6A 1MU6B 1Z8IB 2XRCA 1WUNH 1O2WA 2HPQH 1KTTB 2ZU3A 2CXVA 3S9CA 3AVZA 5L6NH 3URDA 1E34B 1SGRE 1SLVB 1YF4A 2ESTE 4AFZA 4ZKRU 1ARBA 4ZROA 1YP9A 1TRYA 8GCHF 1NO9H 3TIUA 1RJXB 2GKVE 3O8BA 4NG9H 2W7SA 3V12A 1TGSZ 3VGCB 1SFQB 4ISOA 1TNGA 3T27A 1OWEA 2DE9A 3Q77A 3RXJA 2BXTH 4B73A 1FY8E 4X6PA 1MKWK 3GY8A 1FI8A 3EA9A 3RU4D 1BBRH 1H8DH 2BDIA 1LPGB 1IQKA 1C5PA 2V3OH 2ZFTA 3A81A 3TH2H 3T62A 1KIGH 3QTOH 3A7ZA 2WPJS 1V2OT 3SORA 1KXDA 1HXFH 2BQ6B 1KXEA 1A5HA 1S83A 1ZSLA 3LONA 3RMNH 5LGOA 2OC1A 4LOYH 1A1RA 1QB6A 3SU6A 3PLBA 4WY3A 1T8LA 1MU8B 5FX6A 3RM0H 1T8MA 4JZIA 1KXAA 1RTLA 2BM2A 3L33A 3RXAA 3UUZA 3ZZ4A 1IQJA 2RA3A 1HUTH 3LKWA 2FDAA 2VIPA 4INHA 1EP6A 1MQ6A 2B8OH 2NU2E 5EGMA 5A0AE 3TK6A 1N6YA 4FVBA 4WH6A 1K1OA 4I32A 3K6ZA 1ELBA 1GMDF 3UR9A 1Z6JH 1PQ5A 4ABEA 1QBNA 2UUFB 2A0QB 3ZVGA 3PMHB 1O5GH 2QXJA 2FOBA 4JYVH 4BAHB 1TBQH 1BMAA 2A7CA 2R0KA 2ZF0H 1ELTA 1W13U 2NU4E 3M35A 1MKXK 4CRDA 5K0HA 4FUBA 3GDUA 4ZMAH 1F2SE 4JZEH 3A86A 3RXLA 3LT3A 1GBKA 3URCA 4GVUA 1EOJA 3TK9A 2FOEA 3HATH 5A8YA 1O2QA 2CHAB 3RXOA 3DA9B 3B9FH 1ZGIA 1PJPA 1QRXA 3HK3B 3P92A 1MZDA 5F8TA 1UO6A 2A45B 4GUXA 1SG8B 1XX9A 1XXFA 1OXGA 3M5NA 3PROA 1SI5H 3GDVA 1DUEA 1W8BH 1G2LA 1RIWB 3FVFB 1TGCA 3RXEA 4X2VA 2H2ZA 2XWBI 1EX3A 4MDSA 2F9PA 1BMNH 4XBDA 3BG8A 1P03A 1O3OA 2PSYA 2UUKB 2ZHWH 1GDNA 4ZKSU 4DW2U 1UK4A 4ZXXH 4BAKB 2XYAA 4X2XA 3MH5A 1O33A 3C27B 5HM9A 1EAIA 1A46H 3MNBA 2J9NA 3TITA 1FLEE 1EZQA 3A8AA 1C5QA 1IHSH 2A2QH 1LQEA 1NROH 3RXKA 4CBOA 1UCYK 1FPCH 4Z0KA 1PPFE 3HPTB 3L6PA 1CGJE 2A4GA 2TGDA 3KL6A 3TU7H 3GOVB 1C2MA 2A5AA 5AFYH 5DKMA 4X6MA 3RC6A 1NFXA 5FCRA 4KKDA 1P0SH 1EZSC 1BTPA 1LHCH 1OX1A 1TMTH 4IN2A 3F1SB 1QBOA 2GGVB 1PPBH 3QN7A 4YTAA 2A32A 2F9VA 5L30H 5E0JA 4OS1A 1FN6A 1CBWB 1SGDE 5GCHF 2PTNA 1UTPA 1O2ZA 1TBRH 1OWHA 1DS2E 2AMPA 1P57B 1ZSKA 1MZAA 1XUJA 4XE4A 4JZDH 4JMYA 1QY6A 3ZZBA 5A0CA 2GT7A 1LVYA 3PO1B 3VPKA 1ANEA 1DSUA 2V6NA 1MBQA 2VWMA 1DWCH 4A92A 1JRTA 5EG4A 1V2WT 3TVJB 1K2I1 3A8BA 2J34A 4Y8ZA 1TGNA 1MH0A 1P06A 2PGQB 3OTJE 1HAYB 2O8TA 4D9QA 4B76A 2GV7A 3ZVCA 1D6WA 3KIDU 4BTTB 3RU4E 1TLDA 3JZ1B 3ENSB 3N7OA 4ABHA 2C8XB 2V0BA 1TAWA 2BD2A 2QV1A 3MNSA 4NSYA 1YLDA 2ZPRA 5EQSA 4ESTE 1BTWA 4DJZB 4X1QU 2A4QA 2SGQE 1L0ZA 1SGTA 2NU3E 4I8LA 1WCZA 4R0IA 3EGKH 2VIQA 1OWKA 2V3HH 1O3AA 2AIQA 4ZUHA 6GCHF 1P09A 1F0TA 1BRAA 1FMGA 1K9OE 4B71A 3GCTF 1GI9B 1EJMA 1C5MD 1AGJA 4FU9A 1ZRBA 3LGTA 1AVXA 1GJ5H 1TMUH 1KXFA 1O3HA 1HJ8A 1Y3VA 1HGTH 4LXBH 3SJ8A 2A7JA 2PTCE 1O3NA 1A5GH 1Z8GA 1EXFA 3STIA 3SQEE 1ZJKA 2A7HA 1E0FD 3D65E 3M7QA 1AHTH 3M3VA 3DD2H 3EA8A 2XC0A 1SGYE 3RXBA 1P2OA 1FN8A 3VB5A 5GWZA 1XMNB 3E16B 1W11U 1CT0E 3SV6A 1O2TA 3VEQB 5DP9A 2XBXA 3M61U 4ZKNU 1GCTC 4UDWH 4DURA 1EAXA 1MAXA 3QO6A 5JBBS 1P10A 2BY5X 1BJVA 2Y81A 1O3LA 4NA7A 4A6LA 1W10U 1QTFA 1IAUA 1C5SA 2ZHEH 1GHBG 1A61H 2PV9B 1FXYA 1O2NA 1EZXC 2ZWLH 4TWYA 4AFQA 1H1BA 4JK5A 2Y6TA 2I6SA 1BT7A 1NRSH 5EPYA 2TRMA 3FP7E 1G3CA 6LPRA 1DFPA 1S84A 2IPHA 1C5XB 3HKJB 1DITH 1P2JA 3MNXA 1F92A 4IMZA 4PROA 2XXLA 3RU4T 5C67A 2VH0A 1UHBB 2BTCE 1L4DA 1HAXB 2VINA 1O3JA 2GMTB 4GHTA 2YOLA 5JYIA 4YM9A 1NRNH 1G32B 1CBWC 3FZDA 1G30B 1OWJA 1KXCA 4UFEH 1ZMLA 5FHTA 1AWHB 1CHOF 2FIRH 3RXCA 1Q31A 9LPRA 1ETTH 3DUXH 2P95A 1YPGH 3SW2B 1YM0A 4R8TB 1A2CH 4Y10E 2QYIA 1QFKH 3KQEA 1QURH 3SV2H 5FPSA 3Q3KA 1WQVH 5J4SA 3TJVA 2ODYB 1KSNA 4IW4E 5IDKA 3KEEA 2GV6A 1TNIA 1QQUA 3ZVFA 3I29A 2TGTA 3LOXA 2ZU5A 3GDSA 2BLVA 1OP8A 1YGCH 3HK6B 4INLA 3U8RH 1BIOA 2R3YA 5JB9S 3SZNA 1OS8A 1C1QA 2R2WU 3U8TH 5HXFA 2F9UA 2H6MA 3VB3A 3E0PB 4YOJA 4ISNA 1ZGVA 4Y0ZE 1UVUH 4NZLA 1QA7A 3GY6A 1FAXA 1T4VH 1K22H 3AAVA 1SGPE 3EE0B 2M5TA 2Y82A 3T2NA 2A2XH 1QL8A 1AI8H 1K1JA 2OUAA 2HPPH 3VFEA 5DP7A 4IC5A 4OGXA 1TQ7B 3PMJA 4CR9A 4LZ1H 1O2VA 9ESTA 1Z8RA 2BDBA 1ELDE 2AMDA 1C2GA 2ZGJA 3LJOA 1TGTA 1D6RA 1AQ7A 3QTVH 3MU8A 1BA8B 4JZ1A 1GBHA 1VR1H 3FP6E 1YC0A 3MH6A 2ODPA 1A5IA 3PLKA 4F4OC 1XUGA 4Y79A 2UUJB 4IN1A 4ZHMU 2XNIA 1GHWH 4Y8YA 1T8NA 1PFXC 1T7CA 5AF9H 2VVCA 3RP2A 1SFIA 3EDXB 1V2ST 4MTBA 1MUEB 3VXEH 2J95A 1QBVH 1PQAA 2CV3A 2J94A 1BBRE 1TBZH 2EI8A 2QXGA 2XCFA 2FOFA 4YLUA 1GVZA 1GBIA 3UR6A 2BLQA 5G4BA 2BD7A 3H7TA 3BF6H 2P94A 3SOSA 1TPOA 2PFEA 2GMTC 1GHYH 2A5KA 1F0UA 3SUDA 1XUIA 2ALVA 1GG6B 1HB0B 4VGCB 1GHZA 1EPTB 1V2MT 3RLYH 1E37B 1MCTA 1LTOA 3LIWA 1KDQB 3EA7A 3UWIA 1ZTJA 2C3SA 5FAHA 2J38A 1CHGA 1JRSA 1ZR0A 1TIOA 3UTUH 1DDJA 3STJA 4Q80A 5HGGA 3BG4B 3H5CB 3P70B 4GPGA 1KDQA 1YKTA 1D9IA 1FPHH 1SGFG 3L3TA 4KTSA 3Q76A 4UEHH 1HAVB 3ZZ3A 1UTQA 5C1YA 2BDCA 3UOUA 1ZPCA 1UJ1A 2W5EA 1H4WA 1CQQA 1M9UA 4CRAA 4H6SB 3WY8A 1D3DB 2P16A 1XUKA 1P8VC 2OC7A 1EJNA 1AU8A 1O5CB 2WINI 1HAVA 1ZRKA 1E38B 4KP0A 4X8SH 1UK2A 4KTUA 3EYDA 1UCYH 2OBOA 1V2NT 1OYQA 4MPXA 4YOIA 4E06H 4AGJA 2GCTB 1S82A 1QHRB 1O3GA 4SGBE 3PLPA 4TPIZ 3KNXA 1FDPA 3KQDA 3DFJA 1Z6EA 3ZZAA 2FS8A 3SU2A 3OY6U 3GY4A 1SGCA 3PM3A 2FMJA 5A09A 4UE7H 1J14A 3NUMA 4HTCH 4CRFA 4ISIH 1PYTD 1GMHG 2FEQH 1H9HE 4JCNA 2FOAA 1GBCA 1VCQA 1GBMA 1P2IA 1TABE 1O3EA 4FUJA 4I8KA 4ABAA 3RXSA 1CT4E 1GI1A 2GZ9A 2P3FH 1EZUC 5K7RA 1GBBA 1NM6A 2AERH 3RDZA 1MCVA 2ZHDA 5GDSH 1XVOA 1C1WH 4X0WU 1F5KU 4D7GA 5HYOA 3E3TA 1ACBE 3UREA 1BRUP 1MD8A 1THRH 4UFGH 1O3KA 1X7AC 4LK4A 1RGQA 1Q3XA 3GY7A 4XSKU 1B5GH 3ZZDA 2EEKA 2FX4A 1HAGE 1QA0A 2PW8H 2OQUA 1EQ9A 4OGYA 5JBCS 4MNXA 1TPSA 3E91A 1BITA 1AB9B 2ZPQA 1W12U 1AUTC 4X8UH 4X1SU 3TNTA 2FI5E 1HNEE 3TNSA 3SJ9A 2G4TA 1GHAG 4I8JA 1TRMA 3BN9A 1C1VH 2AGIX 1S0RA 4NIXA 2ZCKP 1ELVA 2ZDNA 2Z6BD 4NCYA 8KME2 1L1GA 1LPZB 1A3BH 1CGHA 1GJ9B 3PWCA 3O8RA 2WPIS 1GBFA 5DK1A 1GG6C 4BAOB 2OC8A 1IHTH 1PPHE 2BD4A 3CENA 3R3GB 3UQOA 1EPTC 1GCDA 1K1MA 2VVVA 2WYJA 3BSQA 2C90B 4Y71A 2HLCA 4ZXYH 3TPIZ 1HIAB 2VJ1A 1NFYA 5DG6A 1Z71A 3ZVEA 2ZHQH 4D7FA 2QXHA 1NT1A 3A8DA 1MTUA 1LVOA 4DGJA 1AWFH 3RMMH 2BY7X 1O34A 2C8YB 2GCHG 4AGKA 1BB0B 1HIAA 1N8OC 1W0YH 1SHHB 2FX6A 3T25A 4TY7A 1C2EA 1WBGB 4NA9H 1LMWB 1T31A 1GPZA 1NFWA 1V2VT 4IC6A 5E8EH 2FOCA 4WXIA 1GJDB 1C2DA 1FIZA 4U2WA 1DXWA 3V13A 3C1KA 1ZZZA 1B7XB 1NZQH 5ETXA 1CO7E 3GCNA 1CA0B 1DSTA 5JDUB 1RFNA 2FTMA 1J8AA 2WUCA 2QA9E 2ZP0H 2F91A 1CSOE 4X8TH 3QLPH 5FPYA 1RD3B 3F68H 5EQRA 3RXFA 3ZZ8A 2PKSC 1GVKB 1UK3A 2QF3A 2GCTC 1TE0A 1GDQA 2ALPA 5AHGH 3HKIB 1SQOA 1SL3A 3A8CA 1S81A 1RS0A 4A1TA 3UQVA 1P2KA 3FANA 1FAKH 1GI6A 3ZV9A 4CRCA 3RUOA 3F6UH 4NZQA 4GCHG 1G3EA 3NWUA 2BY6X 1TPAE 2HVXA 1ARCA 3SNBA 2VNTA 1Z1JA 3ATIA 2ZTYA 1YPKH 3M3SA 1AFQB 1EOLA 1C1RA 1L1NA 2HNTF 3S9AA 1NTPA 1AMHA 1O36A 4YESB 3RC5A 2OCVB 2SGPE 4E05H 1C5RA 1GGDB 1FY3A 2C93B 1XUFA 2CF9H 2G00A 3F9HA 1YCPM 2AGGX 1GJAB 3D23A 1P2NA 3QK1A 4I8GA 5CHAB 1SGQE 2WUBA 1D4PB 4K1EA 1O37A 2Q6GA 1EB1H 1ELAA 2CN0H 1LQDB 4FUIA 4UD9H 1TA2A 4CBNA 2LPRA 3R0FA 1WQSA 2AGEX 3VGCC 1S6FA 1TNJA 2Q1JA 3S69A 2BOKA 2J2UA 4OS7A 5EQQA 1AB9C 3RMLH 3UWJH 3BTWE 1S0QA 2CGAA 3P95A 4DG4A 1ZTKA 2GZ8A 5TJXA 2R2MB 1K21H 4I8HA 1O3DA 3QX5H 5H4IB 3ESTA 5DJ7A 1JMOH 3H7OA 2P93A 1O3BA 4B2CA 1C1TA 3CP7A 1TNHA 1MD7A 3LGIA 4DIHH 1AVWA 2LNCA 1GI2A 3P8FA 4CREA 1ZHRA 4K69A 1HAHH 4GAWA 4AN7A 1W14U 3SGQE 1P11E 3A7XA 3SQHE 1GMHF 1QJ7B 4FU8A 2R9PA 5SGAE 5CE1A 3E90B 2TBSA 4AX9H 5C5NA 2PLXA 1BTZA 3PMBB 2PSXA 7GCHG 4YO9A 1MTNB 1P2MA 5ABWA 1GI5A 4Y6DA 4GSOA 4O3TA 3LH3A 1EATA 1ELEE 1UTKA 2BDYA 1AE5A 1GMCG 2EI6A 2BB4A 4ABGA 1GBJA 4ZAEA 3ZZ6A 1AZ8A 2OQ5A 2ZGHA 1JIMA 1IQNA 5EXNA 4H42U 4AYVB 1C1MA 4WH8A 1O5DH 4J2YB 3LH1A 3P8GA 1AN1E 2ZDMA 1AVGH 2CHAC 2ZU4A 2BD9A 3FFGA 4E7NA 1F5LA 1INCA 4CHAB 1LHGH 1BHXF 5L2YH 2QY0B 1KLTA 1SLUB 1GI3A 2F3CE 1DXPA 2ZCHP 1L2EA 1Y3UA 1O2LA 1RIWC 3NZIA 1LHEH 1HLTH 1F7ZA 1L4ZA 1AFQC 1EP5A 2ZKSA 1OOKB 5F8XA 4J1YA 1QJ6B 3BTTE 1LPKB 1O2RA 2Y7XA 4K2YA 2QC2A 1CA8B 1CGIE 3ZZ7A 1GGDC 2AYWA 4Y76A 1A3EH 1V2LT 1LDTT 1PPEE 4K8BA 3A7YA 3RXTA 3K65B 1JOUB 2P8OB 1SQAA 2H5DA 5CHAC 1V6DA 2FWWA 4MNYA 1LVBA 2GCHF 3CS0A 3BEIB 3TGJE 1DANH 5E0HA 5T6DA 2FM2A 3KHVA 1QNJA 1V2UT 5F03A 1TWXB 1ANCA 1YPLH 5IYTA 4XDEA 1NN6A 1ID5H 2ZGBH 5A0BA 2ANKH 2SNVA 1O2GH 4MG3A 4X2WA 3Q00A 2BX3A 7KMEH 4IGDA 5C5OA 3AW1A 4BAQB 1DY9A 4X1RU 1P02A 3DT0H 1G36A 3A84A 1MTSA 1W7GH 1G3DA 1MAYA 4DT7B 4DOQA 2G52A 3T28A 1TOMH 1DUAA 2P3TB 5E2OA 2ZU2A 1AUJA 1O3FA 2BZ6H 3AAUA 3MU0A 1AIXH 2BLWA 3K2UA 4KGAA 1V2QT 1UTLM 3ITIA 2XCNA 3SI4H 2GP9B 3GYLB 4GCHF 2OC0A 3TH3H 2GX4A 4X1PU 2SGEE 2WPKS 1C4Y2 3A7VA 3G01A 1GL1A 2PKAB 4UFDH 1QGFA 3PO1C 1DWEH 3E8LA 4AG1A 2PUXB 2ZFRH 3FP8E 2ZA5A 3IWMA 3QWCH 1RTFB 2PR3A 1HPGA 2OP9A 3SBKA 3TJNA 5B6OA 1DE7H 1KY9A 1SSXA 1YPHC 3A80A 4TWWA 1NESE 3SU5A 1SBWA 2PKAA 4HGCA 8ESTE 2FS9A 4MPUA 1SMFE 1C1NA 4FU7A 3ZZ5A 1YBWA 1OKXA 1ELCA 3SU4A 1HAOH 1P9UA 3LGVA 1WTGH 3LDXH 3OU0A 1UCYE 1CVWH 4XOJA 3LC3A 1AKSB 2FOGA 1O5AB 2XWAA 1O2IA 3QGNB 3ODFA 1BQYA 1ABIH 4OS2A 4ABDA 8GCHG 1PPGE 1BHXB 4Q7YA 2QXIA 3P17H 1OYTH 1DOJA 1IQGA 2AH4X 1AY6H 3VB7A 5I25A 1AKSA 2G4UA 3SJOA 1K28D 2ZGXH 4NIWA 2ZQ1A 2B5TB 4WMEA 5EODA 1HYLA 5FCKA 4OS4A 1GI4A 1KLJH 1NC6A 2QIQA 3SUGA 3HGNA 1O32A 1C2IA 1W7XH 2Y80A 3PV4A 1HAPH 1UTJA 2JETB 3RXRA 2VIWA 1O5FH 1GWAA 2A1DB 1O5BB 1FY1A 2BVSH 4CRBA 3RXMA 1C2FA 1HJAB 7LPRA 4F49A 2R0LA 4H4FA 1C5ZB 3ODDA 4ABFA 1GJ4H 1DWBH 4NGAH 1NU7B 2D1JA 1TNKA 2ZFFH 3ELAH 4FUGA 4RN6A 4WVPE 2G5VA 5EXLA 1K1IA 1GJBB 2P8OC 3BTDE 3RXDA 2HALA 5J4QA 1S5SA 2DE8A 3Q3XA 4D8NA 3SJIA 4JK6A 4Y0YE 3MO3A 4Q7ZA 4QT8C 2SNWA 1MBMA 5F8ZA 1NS3A 2GD4B 3O8DA 4BOHA 1TX8A 2HWLB 7GCHF 3S9BA 3MFJA 1C5OH 3UNQA 2ZDVH 3ATLA 4OS6A 1VCWA 5L2ZH 1N1LA 2VWLA 4THNH 4X6OA 3SU1A 2JKHA 2PHBA 1KXBA 4MQAA 3V7TA 2XC5A 4K1SA 3BIVH 1WTHD 4A1XA 2QGRA 1ZJDA 2TGPZ 1H8IH 1J16A 4O97A 2XBVA 2BQWB 2ZHFH 2O9QA 4Q7XA 1ZOMA 1U6QA 1OWIA 4RKOB 3VXFH 5ESTE 3SHCH 1G9IE 3MI4A 3RXIA 3SJKA 2F9OA 2BX4A 1JWTA 1A0JA 2Y7ZA 3MO9A 4NIVA 5JBAS 1GJCB 1XXDA 1W0ZU 4CR5A 2Z3DA 1ETRH 1L1JA 1A4WH 1VITH 5I46H 1FZZA 2FLBH 3KQCA 4ISLA 5CMXH 1IOEA 1QR3E 4CRGA 5ESBA 3RLWH 2ZG0H 1KYNA 3KF2A 2Z94A 3T5FH 4ZH8A 4B2AA 4AFSA 1MMJN 2R3UA 4NWKA 2STAE 4Y7BA 1G3BA 1NY22 3MH7A 5PTPA 3SNEA 2ZTZA 1UVTH 2EC9H 4WMFA 1O2XA 2H1UA 2CJIA 3LJJA 3BEFB 2DUCA 2IJOB 1G2MA 1C5UA 1VZQH 4MVNA 1IQMA 1HAIH 1GHBF 2AFQB 1PQ8A 2SGDE 8LPRA 2G51A 4IMQA 5FBEA 3ATWA 2YNAA 3OY5U 4I31A 1SLXB 1GJ8B 2G55A 3AASA 2Z9GA 4IBLH 3MYWA 5GIBA 1Y59T 1O30A 3F9EA 4GHQA 1V2JT 3U9AH 2XTTB 1BJUA 2QF0A 1O3IA 1O38A 1P01A 3U1IB 2RCEA 1YCPH 1Y3WA 3ATKA 3PWBA 6ESTA 2PGBB 5C20A 2PUQH 1ZLRA 3K9XB 4O3UA 3PYHA 1BCUH 1AZZA 1HJAC 2Z9LA 5A8XA 1Z1IA 4MPWA 2ZFSA 4NFFA 4XFQA 2WYGA 4MPVA 4AZ2B 3SV7A 2ZEBA 1SOTA 4MNVA 2TPIZ 2W3KA 5BPEA 1IQFA 1AD8H 2ZIQH 3SNCA 5C1UA 1WU1A 1BZXE 1C5VA 1F5RA 1ELGA 2GDEH 2JH0D 1H9LB 5A8ZA 3BTKE 1Y3YA 2OXSA 3BV9B 4BAMB 4FUDA 4YOGA 4K8YA 2BOHB 3RMOH 1C2KA 5AVDA 4INKA 3BTFE 2NU0E 1ZMNA 1T8OA 3RXQA 2B9LA 4FUCA 5C2ZA 1O3CA 3MTYA 4TYDA 2W7UA 3PTNA 3M5LA 2VWNA 3W94A 1WOFA 1JIRA 2O8UA 5DP8A 3ZYEA 4RSPA 1O2JA 4BXSA 5E0GA 1O2MA 4WXVA 1GHVH 1HDTH 1V2TT 2VH6A 2HNTE 2ZTXA 2PWXA 2ZQ2A 3QDZB 3BTGE 5T3HA 6GCHG 3DHKH 3LGWA 1FY5A 1Q2WA 2HRVA 2ZFQH 1SLWB 3A83A 4VGCC 1ORFA 3GCTG 2UWOA 2Z9IA 3A89A 2AMQA 1QB9A 1J15A 3FZZA 1O39A 1UVSH 1P3EA 3SN8A 2NWNA 1EKBB 1QB1A 1UVPA 3D62A 1O31A 1EAWA 3BG4C 2JH5D 5DP4A 5JB8S 1TFXA 2FYQA 3S7HB 1C5TA 1LHDH 1TYNA 1YLCA 3P8NA 1NU9A 2BDHA 2C8WB 1FJSA 2Z7FE 5DO4H 3GY3A 5HM2A 1UTNA 1F0RA 3UNSA 2BDAA 4AB8A 1SGNE 1THSH 1ZPBA 4YLQH 5TCCA 2Z9KA 1C5YB 4I7YH 5TCAA 1GDUA 2FZZA 1NRQH 2W26A 4KELA 1C1OA 3U98H 3LPRA 2ULLA 2EI7A 2VWOA 5C3NA 1V2KT 2XBYA 1BUIA 2GTBA 3SO3A 4DIIH 3UPEA 1HV7A 4B2BA 1E36B 2OBQA 1C4U2 1P05A 2NU1E 3VB6A 2Q6DA 3A88A 2JH6D 2SFAA 1BMLA 1C4V2 4WJG2 2V35A 1TB6H 2W3IA 1YYY1 1TQ0B 5GPIB 4AOQA 3RXPA 1ABJH 3M3TA 2OLGA 5EPNA 2SGAA 5A2MH 3ZYDA 1QRWA 5FPTA 3RXUA 1TRNA 2HOBA 5JBTA 1VCPA 1RTKA 3ATMA 4ABJA 4ABBA 2A4OA 1O2SA 1O2KA 1SHYA 3E0NB 3EAJA 1O3MA 3OSYA 5DP5A 3B8JA 2O8LA 2ZCLP 1GBTA 5AFZH 1CHOG 1DLKB 2BMGB 5EW2H 1C2LA 1BRBE 1O5EH 3TJUA 2XW9A 5C1XA 4MLFB 1ZTLA 1SGEE 1TX6A 2P59A 1AFEH 1QQ4A 2BQ7B 1TX7A 1LO6A 1V2RT 3ZV8A 4RKJB 3GISB 5F6MA 1KLIH 4GLYA 1BTXA 2TIOA 2ZDAH 1DY8A 3U8OH 4U30A 2WPMS 2ZGCA 4Y11E 4YT7H 2FO9A 4WWYA 1GCTB 2VGCB 3NKKA 1N6XA 3PB1E 1HRTH 5T6FA 2ZECA 3M7TA 2G81E 3S0NA 1C1PA 1OWDA 1YCPK 1IQLA 3U69H 1LKAA 2WV4A 1WSSH 3A7TA 2QAAA 1ESBA 1S85A 1Y5UT 1BMMH 3SV9A 3RC4A 2RG3A 1UTMA 4B74A 1D3PB 1WYKA 1TA6A 1OP0A 3HGPA 2FI4E 2ODQA 1VITG 2WV5A 3JZ2B 4CH8B 1EJAA 3MWIU 3CS7A 1IQHA 2H9EH 1BDAA 2FI3E 2ZDLA 1A0HB 2RA0A 2UUYA 4D76A 4X8VH 1QRZA 2I6QA 3LGUA 2BHGA 4K3JA 4E7RG 1CA0C 1QCPA 1DX5M 2ANYA 1ETSH 2C8ZB 4BTIB 4HI3A 1Y3XA 1HJ9A 2AEIH 1EUFA 3BEUA 1F0SA 1ZHMA 2FODA 3QGJA 1TONA 1MTVA 4K5ZA
chains in the Genus database with same CATH superfamily
1A7SA 1C5WB 1O3PB 2SGFE 3B23B 1XVMA 4XBCA 4Z6AH 1Z7KA 3IITA 5FL7D 2AS9A 2VB0A 2A4RA 2QCYA 3SNAA 4YXWD 1YWUA 2AHME 2Y5HA 3GCHB 1UMAH 4IS5A 1LKBA 1WAYB 2Y5FA 4JZFH 5DPAA 3TLOA 3TGIE 4UFFH 2B0FA 4Y8XA 4ZHLU 1DPOA 1FY4A 3M5OA 2BLOA 1GHAF 3FOAA 3UIRA 3PMAB 5E2PA 2WPHS 1BTYA 2HGTH 1P12E 1BTUA 2KAIB 1BBRK 1C9TA 4BANB 1BOQA 3LU9B 4ZKOU 2Z9JA 2VIOA 3TPIZ 2C4FH 3M5MA 5EXMA 2O8WA 2H9TH 4H6TA 1GL0E 3SNDA 1MTWA 2GZ7A 2Q6FA 1IQIA 2KAIA 3SU0A 4ABIA 2HLDD 2FYRA 3D49H 4BNRA 1Y5BT 2FXRA 3LC5A 3A7WA 2FPZA 1VJ9U 1Y5AT 1T4UH 1ZYOA 1B0FA 3NPSA 3SHAH 4FVDA 1C1SA 4AYYB 1P04A 2ZPSA 1EAUA 4AB9A 1A0LA 1TOCB 3K6YA 1O35A 4ISHH 2IPQX 1GI8B 2HVYB 1KMHB 2O8MA 1UTOA 3MU5A 1SGFA 1TNLA 3TJOA 1P2QA 3O8CA 3SUEA 2V3MA 5EW1H 2EY4C 2ZC9H 1ZHPA 1GI7B 1C9PA 1LVMA 2QN5T 2K0QA 1D3QB 4LZ4B 2ANWA 1NRRH 3ZVBA 2J92A 1QL9A 4NSVA 2VGCC 2G5NA 2UWPA 4TPYA 3RXHA 2D26C 1O0DH 4X2YA 2D8WA 1GI0A 5LPFA 2IOTA 2BVXH 3UY9A 4M7GA 5FX5A 1TALA 2G8TA 1P9SA 3MH4A 1CT2E 4JYUH 3TH4H 2F83A 2J4IA 1E1RD 2BYAX 1DM4B 2BD5A 6CHAB 3ZVDA 4UONA 3E1XB 3DFLA 4WMDA 3AW0A 2EA3A 4X1NU 3TK5A 1IQEA 1JXPA 3V3MA 1O2PA 1SQTA 2ANMH 3EE7A 4DCDA 1J9CH 2ILNA 2BD8A 1O2HA 1SOZA 4FXGH 2ZO3H 3E6PH 1MTNC 3SU3A 1C1UH 1K1LA 3M7UA 2THFB 2ZFPH 3A85A 1UHBA 1FNIA 4U01A 3UOPA 4A1VA 3OX7U 3GYMA 4RT1A 4NWLA 2ASUB 3MOCA 5EOKA 1FONA 4HFPB 3GICB 1C2JA 3I77A 3MMGA 1GHXH 2VIVA 3BTHE 4OS5A 5DGJA 1BRCE 1HCGA 4X6NA 3QZRA 3WW7A 3T26A 3CNRA 2YNBA 4AFUA 1YPMH 5GXPA 4CH2B 4ACBA 1V2PT 3GS9A 3P8OA 4BXWA 2BZAA 2CF8H 2GT8A 3GCOA 3GCHC 4NFEA 1TGBA 2GVFA 1O2UA 1ANBA 2FLRH 4FUFA 4CHAC 1K1PA 3BIUH 4AORA 1DLEA 5EU8A 2HNTC 1XUHA 2VVUA 2XBWA 2Z3CA 1VGCB 1XKBC 1GJ7B 1DVAH 3KCGH 1HXEH 4NA8A 1SPJA 2Y5GA 1H9IE 1LCYA 2TGAA 3SZEA 3U28C 3F9FA 3GY5A 3OYPA 1C5LH 2K1QA 1ELFA 1GVLA 1XM1A 1FUJA 3I78A 1FQ3A 5JPMH 3NK8A 2ZI2H 2H5CA 2OD3B 1PPCE 3BTQE 1MKWH 1V3XA 2ZDKA 3UFAA 3MHWU 2BY8X 1SC8U 3M37A 1FX0B 4FUHA 1QJ1B 1B0EA 2OINA 1P3CA 3A82A 2XC4A 1VITF 1K1NA 4RT0A 3SGBE 1OSSA 4DY7B 2UWLA 5LH8A 1NFUA 3NCLA 1O2OA 1GMDG 2QE7D 4K1TA 3ZVAA 2KCPA 2BD3A 2OTVA 3SI3H 1G37A 1C5NH 4B1TA 1RXPA 2IN2A 1THPB 2PP6A 1GMCF 1ESAA 3SV8A 3F2HA 2H9HA 2BXUH 1PQ7A 4I33A 5GJ4B 3IG6B 3SGAE 1FIWA 1GBDA 3BTME 3LGYA 2VIDA 1ZSJA 2BDGA 2A31A 3P6ZB 1TPPA 1W3CA 3MO6A 2WPLS 2B7DH 1KTSB 4JYTA 1XKAC 1YPJH 4Q2KA 1DT2A 1VJAU 3MU1A 1MKXH 2ZZUH 3RM2H 6CHAC 1C2HA 3ZZCA 4A5TS 1CU1A 2ZNKH 3RXVA 1WV7H 5LPEA 1UVOA 2BY9X 1ESTA 4YZUA 5HMAA 1DICA 2RFKC 2D2DA 3MU4A 1SGIB 4B75A 4U32A 1GBAA 2CMYA 3Q3YA 1J17T 2ZU1A 1HBTH 1O2YA 3UNRA 1EB2A 1NRPH 3QZQA 1YPEH 4WF8A 5DP6A 2RDLA 3GY2A 1SVPA 1TMBH 1PPZA 5T6GA 5KEDA 1HFDA 2P3UB 4ZHAA 1D3TB 1BTHH 3VB4A 1EPTA 4ASHA 3M36A 2Z3EA 1T32A 1N8OB 4HZHA 7ESTE 3PTBA 2FP7B 3KQBA 1E35B 1RRKA 3S7KB 3QUMP 1HAZB 3TGKE 4Y7AA 1SB1H 1QL7A 2JDID 4MNWA 1FV9A 4O9VA 1DWDH 1VKYA 3A87A 4A7IB 1OP2A 1PYTC 2F9NA 1AE8H 1Z8JB 3ZZ9A 1VGCC 1COWD 1LHFH 4FUEA 2FOHA 1QIXB 2KM0A 2A5IA 2LELA 5FBIA 2FTLE 2FOMB 2JETC 2PKSB 1SR5C 2F9BH 4BTUB 5LPRA 4NIYA 3RXGA 1JBUH 1S6HA 1ANDA 4XBBA 4TY6A 1GBEA 3EQ0H 1W2KH 5FXLA 3U1JB 5GCHG 4AG2A 1CE5A 1ZMJA 3NXPA 4SGAE 4DVAU 1NPMA 3BTEE 1Y8TA 3KN2A 4YT6H 1EASA 2AIPA 3F9GA 3KGPA 1OPHB 2FESH 4K60A 3T29A 1AO5A 3W95A 2GDDA 2STBE 2BVRH 5BRRE 5DP3A 3SUFA 4O03A 3MNCA 1GBLA 1MQ5A 4D9RA 1ZPZA 2VU8E 3FAOA 1YPHE 1BMFD 3V0XA 4KTCA 1GJ6A 1MU6B 1Z8IB 2XRCA 1WUNH 1O2WA 2HPQH 1KTTB 2ZU3A 2CXVA 3S9CA 3AVZA 5L6NH 2QF4A 3URDA 1E34B 1SGRE 1SLVB 1YF4A 2ESTE 4AFZA 4ZKRU 1ARBA 4ZROA 1YP9A 1TRYA 8GCHF 1NO9H 3TIUA 3PRBA 1RJXB 2GKVE 3O8BA 4NG9H 2W7SA 3V12A 1TGSZ 3VGCB 1SFQB 4ISOA 5GNDA 1TNGA 3T27A 1OWEA 2XOKD 2DE9A 3Q77A 3RXJA 2BXTH 1OHHD 4B73A 1FY8E 4X6PA 1MKWK 3GY8A 1FI8A 3EA9A 3RU4D 3FO8D 1BBRH 1H8DH 2YMSB 2BDIA 1LPGB 1IQKA 1C5PA 2V3OH 2ZFTA 4HG6A 3A81A 3VG8A 3TH2H 5CHBA 3T62A 1KIGH 3QTOH 3A7ZA 2WPJS 1V2OT 5KGOA 3SORA 1KXDA 1HXFH 2BQ6B 1KXEA 1A5HA 1S83A 1ZSLA 3LONA 3RMNH 5LGOA 2OC1A 4LOYH 1A1RA 1QB6A 3SU6A 3PLBA 4WY3A 1T8LA 1MU8B 5FX6A 3RM0H 1T8MA 4JZIA 1KXAA 1RTLA 2BM2A 3L33A 3RXAA 3UUZA 3ZZ4A 1IQJA 2RA3A 1HUTH 3LKWA 2FDAA 2VIPA 4INHA 1EP6A 1MQ6A 2B8OH 2NU2E 5EGMA 5A0AE 3TK6A 1N6YA 4FVBA 4WH6A 1K1OA 4I32A 3K6ZA 1ELBA 1GMDF 3UR9A 1Z6JH 1PQ5A 4ABEA 1QBNA 2UUFB 3F0OA 2A0QB 3ZVGA 3PMHB 1O5GH 2QXJA 2FOBA 4JYVH 4BAHB 1TBQH 1BMAA 2A7CA 2R0KA 2ZF0H 1ELTA 4ASUD 1W13U 2NU4E 3M35A 1MKXK 2WZQA 4CRDA 5K0HA 4FUBA 3GDUA 4ZMAH 1F2SE 4JZEH 3A86A 3RXLA 3LT3A 1GBKA 3URCA 4GVUA 1EOJA 3TK9A 2FOEA 3HATH 5A8YA 1O2QA 2W6ID 2CHAB 3RXOA 3DA9B 3B9FH 1ZGIA 2JIZD 1PJPA 1QRXA 3HK3B 3P92A 1MZDA 5F8TA 1UO6A 2A45B 4GUXA 1SG8B 1XX9A 1XXFA 1OXGA 3M5NA 3PROA 1SI5H 3GDVA 1DUEA 1W8BH 1G2LA 1RIWB 3FVFB 1TGCA 3RXEA 4X2VA 2H2ZA 2XWBI 1EX3A 4MDSA 3FN8A 2F9PA 1BMNH 4XBDA 3BG8A 1P03A 1O3OA 2PSYA 2UUKB 2ZHWH 1GDNA 4ZKSU 4DW2U 1UK4A 4ZXXH 4BAKB 2XYAA 3F3BA 4X2XA 3MH5A 1O33A 3C27B 5HM9A 1EAIA 1A46H 2L6OA 3MNBA 2J9NA 3TITA 1FLEE 1EZQA 3A8AA 1C5QA 1IHSH 2A2QH 1LQEA 1NROH 3RXKA 4CBOA 2CK3D 1UCYK 1FPCH 4Z0KA 1PPFE 3HPTB 3L6PA 1CGJE 2A4GA 2TGDA 3KL6A 3TU7H 3GOVB 1C2MA 2A5AA 5AFYH 5DKMA 4X6MA 3RC6A 1NFXA 5FCRA 4KKDA 1P0SH 1EZSC 1BTPA 1LHCH 1OX1A 1TMTH 4IN2A 3F1SB 1QBOA 2GGVB 1PPBH 2KCAA 3QN7A 2A32A 2F9VA 4YTAA 5L30H 5E0JA 4OS1A 1FN6A 3MQKC 1CBWB 1SGDE 5GCHF 2PTNA 1UTPA 1O2ZA 1TBRH 1OWHA 1DS2E 2AMPA 1P57B 1ZSKA 1MZAA 1XUJA 4XE4A 4JZDH 4JMYA 1QY6A 3ZZBA 5A0CA 2GT7A 1LVYA 3PO1B 3VPKA 1ANEA 1DSUA 2V6NA 1MBQA 2VWMA 1DWCH 4A92A 1JRTA 5EG4A 1V2WT 3TVJB 1K2I1 3A8BA 2J34A 4Y8ZA 1TGNA 2WPDD 1MH0A 1P06A 2PGQB 3OTJE 1HAYB 2O8TA 4D9QA 4B76A 2GV7A 3ZVCA 1D6WA 3KIDU 1W0JD 4BTTB 3RU4E 1TLDA 1YLNA 3ENSB 3JZ1B 3N7OA 4ABHA 2C8XB 2V0BA 4ZCNA 3N7EA 1TAWA 2BD2A 2QV1A 3MNSA 5C17A 4NSYA 1YLDA 2ZPRA 5EQSA 4ESTE 1BTWA 4DJZB 4X1QU 2A4QA 2SGQE 1L0ZA 1SGTA 2NU3E 4I8LA 1WCZA 4R0IA 3EGKH 2VIQA 5EIYA 1OWKA 2V3HH 1O3AA 2AIQA 4ZUHA 6GCHF 1P09A 1F0TA 1BRAA 4Z1MD 1FMGA 1K9OE 4B71A 3GCTF 1GI9B 1EJMA 1C5MD 1AGJA 4FU9A 1ZRBA 3LGTA 3KQ5A 1AVXA 1GJ5H 1TMUH 1KXFA 1O3HA 1HJ8A 1Y3VA 1HGTH 4LXBH 3SJ8A 2A7JA 2PTCE 1O3NA 1A5GH 1Z8GA 1EXFA 3STIA 3SQEE 1ZJKA 2A7HA 1E0FD 3D65E 3M7QA 1AHTH 3M3VA 3DD2H 3EA8A 2XC0A 1SGYE 3RXBA 1P2OA 1FN8A 3VB5A 5GWZA 1XMNB 3E16B 1W11U 1CT0E 3SV6A 1O2TA 3VEQB 5DP9A 2XBXA 3M61U 4ZKNU 1GCTC 4UDWH 4DURA 1EAXA 1MAXA 3QO6A 5JBBS 1P10A 2BY5X 1BJVA 2Y81A 1O3LA 4NA7A 4A6LA 1W10U 1QTFA 1IAUA 1C5SA 2ZHEH 1GHBG 1MABB 1A61H 2PV9B 3H09A 1FXYA 1O2NA 1EZXC 2ZWLH 4TWYA 1SQRA 4AFQA 1H1BA 4JK5A 2Y6TA 2I6SA 1BT7A 1NRSH 5EPYA 2TRMA 3FP7E 1G3CA 3WWFA 6LPRA 1DFPA 1S84A 2IPHA 1C5XB 3HKJB 1DITH 1P2JA 3MNXA 1F92A 4IMZA 4PROA 2XXLA 3RU4T 5C67A 2VH0A 1UHBB 2BTCE 1L4DA 1HAXB 2VINA 1O3JA 2GMTB 4GHTA 2YOLA 5CDFE 4F48B 5JYIA 4YM9A 5EJ1A 1NRNH 1G32B 1CBWC 3FZDA 1G30B 1OWJA 1KXCA 4UFEH 1ZMLA 5FHTA 1AWHB 1CHOF 1W0KD 2FIRH 1Q31A 3RXCA 9LPRA 1ETTH 3DUXH 2P95A 1YPGH 3SW2B 1YM0A 4R8TB 1A2CH 4Y10E 2QYIA 1QFKH 3KQEA 1QURH 3SV2H 5FPSA 3Q3KA 1WQVH 5J4SA 3TJVA 2ODYB 1KSNA 4IW4E 5IDKA 3KEEA 5F53A 2GV6A 1TNIA 1QQUA 3ZVFA 2J97A 2TGTA 3I29A 3LOXA 2ZU5A 3GDSA 2BLVA 1OP8A 1YGCH 3HK6B 4INLA 5HIZA 3U8RH 1BIOA 2R3YA 5JB9S 3SZNA 1OS8A 1C1QA 2R2WU 3U8TH 5HXFA 2F9UA 2H6MA 3VB3A 3E0PB 4YOJA 2KR7A 4ISNA 1ZGVA 4Y0ZE 1UVUH 4NZLA 1QA7A 3GY6A 1FAXA 1T4VH 1K22H 3AAVA 1SGPE 3EE0B 2M5TA 2Y82A 3T2NA 2A2XH 4RI0A 1QL8A 1AI8H 1K1JA 2OUAA 2HPPH 3VFEA 5DP7A 4IC5A 4OGXA 1TQ7B 3PMJA 4CR9A 4XRNA 1O2VA 9ESTA 4LZ1H 1Z8RA 2BDBA 1ELDE 1H8HD 2AMDA 1C2GA 2ZGJA 3LJOA 1TGTA 1D6RA 1AQ7A 3QTVH 3MU8A 1BA8B 4JZ1A 1GBHA 1VR1H 3FP6E 1YC0A 3ZIAD 3MH6A 2ODPA 1A5IA 4OM9A 3PLKA 4F4OC 2F43B 1XUGA 4Y79A 2UUJB 4IN1A 4ZHMU 2XNIA 1GHWH 4Y8YA 1T8NA 1PFXC 1T7CA 5AF9H 2VVCA 3RP2A 1SFIA 3EDXB 1V2ST 4MTBA 1MUEB 3VXEH 2J95A 3DSOA 1QBVH 1PQAA 2CV3A 2J94A 1BBRE 1TBZH 2EI8A 2QXGA 2XCFA 2FOFA 2V7QD 4YLUA 1GVZA 1GBIA 3UR6A 4XD7D 2BLQA 5G4BA 2BD7A 3H7TA 3BF6H 2P94A 3SOSA 1TPOA 2PFEA 2GMTC 1GHYH 2A5KA 1F0UA 3SUDA 1XUIA 2ALVA 1GG6B 2KFWA 1HB0B 4VGCB 1GHZA 1EPTB 2QF5A 1V2MT 3RLYH 1E37B 1MCTA 1LTOA 3LIWA 1KDQB 3EA7A 3UWIA 1ZTJA 2C3SA 5FAHA 2J38A 1CHGA 1JRSA 3FKSD 1ZR0A 1TIOA 3UTUH 1DDJA 3STJA 4Q80A 5HGGA 3BG4B 2M2AA 3H5CB 3P70B 4GPGA 1KDQA 1YKTA 1D9IA 1FPHH 1SGFG 3L3TA 4KTSA 3Q76A 4UEHH 1HAVB 3ZZ3A 1UTQA 5C1YA 2BDCA 3UOUA 1ZPCA 1UJ1A 2W5EA 1H4WA 1CQQA 1M9UA 4CRAA 4H6SB 3WY8A 1D3DB 2P16A 1XUKA 1P8VC 2OC7A 1EJNA 1AU8A 1O5CB 2WINI 1HAVA 1ZRKA 1E38B 4KP0A 4X8SH 1UK2A 4KTUA 3EYDA 1UCYH 2OBOA 1V2NT 1OYQA 4MPXA 4YOIA 4E06H 4AGJA 2GCTB 1S82A 1QHRB 1O3GA 4SGBE 3PLPA 4TPIZ 3KNXA 1FDPA 3KQDA 3DFJA 1Z6EA 3ZZAA 2FS8A 3SU2A 3OY6U 3GY4A 4F55A 1SGCA 3PM3A 1YY3A 2FMJA 2WV9A 5A09A 4UE7H 1J14A 3NUMA 4HTCH 4CRFA 4ISIH 1PYTD 1GMHG 2FEQH 2KZ4A 1H9HE 4JCNA 2FOAA 1GBCA 1VCQA 4TT3D 4TSFD 1GBMA 1P2IA 1TABE 1O3EA 4FUJA 4I8KA 4ABAA 3RXSA 1CT4E 1GI1A 2GZ9A 2P3FH 1EZUC 5K7RA 1GBBA 1NM6A 2AERH 1SKYE 3RDZA 1MCVA 2ZHDA 5GDSH 2J98B 1XVOA 1C1WH 4X0WU 1F5KU 4D7GA 5HYOA 3E3TA 1ACBE 3UREA 1BRUP 1MD8A 1THRH 4UFGH 1O3KA 1X7AC 4LK4A 1RGQA 2J98A 1Q3XA 3GY7A 4XSKU 4FETA 1B5GH 3ZZDA 2EEKA 2FX4A 1HAGE 1QA0A 2PW8H 2OQUA 1EQ9A 4OGYA 5JBCS 4MNXA 1TPSA 3E91A 3OEED 1BITA 1AB9B 2ZPQA 1W12U 1AUTC 4X8UH 4X1SU 3TNTA 2FI5E 1HNEE 3TNSA 3SJ9A 2G4TA 1GHAG 4I8JA 1TRMA 4Q4LA 3BN9A 1C1VH 2AGIX 5T1VA 1S0RA 4NIXA 2ZCKP 1ELVA 2ZDNA 2Z6BD 4NCYA 2VBCA 8KME2 1L1GA 1LPZB 1A3BH 1CGHA 1GJ9B 3PWCA 3O8RA 2WPIS 1GBFA 5DK1A 1GG6C 4BAOB 2OC8A 1IHTH 1PPHE 2BD4A 3CENA 3R3GB 3UQOA 1EPTC 1GCDA 1K1MA 2VVVA 2WYJA 3BSQA 2C90B 4Y71A 2HLCA 4ZXYH 5HIYA 1HIAB 2VJ1A 1NFYA 5DG6A 1Z71A 3ZVEA 2ZHQH 4D7FA 2QXHA 1NT1A 3A8DA 1MTUA 1LVOA 4DGJA 1AWFH 3RMMH 2BY7X 1O34A 2C8YB 2GCHG 4AGKA 1BB0B 1HIAA 1N8OC 1W0YH 1SHHB 2FX6A 3T25A 4TY7A 1C2EA 1WBGB 4NA9H 2GJGA 1LMWB 1T31A 1GPZA 1NFWA 4P00A 1V2VT 4IC6A 5E8EH 2FOCA 4WXIA 1GJDB 1C2DA 1FIZA 4U2WA 1DXWA 3V13A 3C1KA 1ZZZA 1B7XB 3KYGA 1NZQH 5ETXA 1CO7E 3GCNA 1CA0B 1DSTA 2L74A 5JDUB 1RFNA 2FTMA 1J8AA 2WUCA 2QA9E 2ZP0H 2F91A 1CSOE 4X8TH 3QLPH 5FPYA 1RD3B 3F68H 3OE7D 5EQRA 3RXFA 3ZZ8A 2PKSC 1GVKB 1UK3A 1WDIA 2QF3A 2GCTC 1TE0A 1GDQA 2ALPA 2F4LA 5AHGH 2WHXA 3HKIB 1SQOA 1SL3A 3A8CA 1S81A 4AC9A 1RS0A 4A1TA 3UQVA 1P2KA 3FANA 1FAKH 1GI6A 3ZV9A 4CRCA 3RUOA 3F6UH 4NZQA 4GCHG 1G3EA 3NWUA 2BY6X 1E79D 1TPAE 2HVXA 1ARCA 3SNBA 2VNTA 1Z1JA 3ATIA 2ZTYA 1YPKH 3M3SA 1AFQB 1EOLA 1C1RA 1L1NA 2HNTF 3S9AA 1NTPA 1AMHA 1O36A 4YESB 3RC5A 2OCVB 2SGPE 4E05H 1C5RA 5IK2D 1GGDB 1FY3A 2C93B 1XUFA 2CF9H 2G00A 3F9HA 1YCPM 2AGGX 1GJAB 3D23A 1P2NA 3QK1A 4I8GA 5CHAB 1SGQE 2WUBA 1D4PB 4ACAA 4K1EA 1O37A 2Q6GA 1EB1H 1ELAA 2CN0H 1LQDB 3PRDA 4FUIA 4UD9H 1TA2A 4CBNA 2LPRA 3R0FA 1WQSA 2AGEX 2K8IA 3VGCC 1S6FA 1TNJA 2Q1JA 3S69A 2BOKA 2J2UA 4OS7A 5EQQA 1AB9C 3RMLH 3UWJH 3BTWE 1S0QA 2CGAA 3P95A 4DG4A 1ZTKA 2GZ8A 5TJXA 2R2MB 1K21H 4I8HA 1O3DA 3QX5H 2YMSC 5H4IB 3ESTA 5DJ7A 1JMOH 3H7OA 2P93A 1O3BA 4B2CA 1C1TA 3CP7A 1TNHA 1MD7A 3LGIA 4DIHH 1AVWA 2LNCA 4B6EA 1GI2A 3P8FA 4CREA 1ZHRA 4K69A 1HAHH 4GAWA 4AN7A 1W14U 3SGQE 1P11E 3A7XA 3SQHE 1GMHF 1QJ7B 4FU8A 2R9PA 5SGAE 5CE1A 3E90B 2TBSA 4AX9H 5C5NA 1QZ8A 2PLXA 1BTZA 3PMBB 2PSXA 7GCHG 4YO9A 1MTNB 1P2MA 5ABWA 1GI5A 4Y6DA 4GSOA 4O3TA 3LH3A 1EATA 1ELEE 1UTKA 2BDYA 1AE5A 1GMCG 2EI6A 2BB4A 4ABGA 1GBJA 4ZAEA 3ZZ6A 1AZ8A 2OQ5A 2ZGHA 1JIMA 1IQNA 5EXNA 4H42U 4AYVB 1C1MA 4WH8A 1O5DH 4J2YB 3LH1A 3P8GA 1AN1E 2ZDMA 1AVGH 2CHAC 2ZU4A 2BD9A 3FFGA 4E7NA 1F5LA 1INCA 4CHAB 1LHGH 1BHXF 5L2YH 2QY0B 1KLTA 1SLUB 1GI3A 2F3CE 1DXPA 2ZCHP 1L2EA 1Y3UA 1O2LA 1RIWC 3NZIA 1LHEH 1HLTH 1F7ZA 1L4ZA 1AFQC 1EP5A 2ZKSA 1OOKB 5F8XA 4J1YA 1QJ6B 3BTTE 5C94A 1LPKB 1O2RA 2Y7XA 4K2YA 2QC2A 1CA8B 1CGIE 3ZZ7A 1GGDC 2AYWA 4Y76A 1A3EH 1V2LT 1LDTT 1PPEE 4K8BA 2EQNA 3A7YA 3RXTA 1EFRD 3K65B 1JOUB 2P8OB 1SQAA 2H5DA 5CHAC 1V6DA 2FWWA 4MNYA 1LVBA 2GCHF 3CS0A 3BEIB 3TGJE 1DANH 5E0HA 5T6DA 2FM2A 3KHVA 1QNJA 1V2UT 5F03A 1TWXB 1ANCA 1YPLH 5IYTA 4XDEA 1NN6A 1ID5H 2ZGBH 5A0BA 2ANKH 2SNVA 1O2GH 4MG3A 4X2WA 3Q00A 2BX3A 5KECA 7KMEH 4IGDA 5C5OA 3AW1A 2RDEA 4BAQB 1DY9A 4X1RU 1P02A 3DT0H 1G36A 3A84A 1MTSA 1W7GH 1G3DA 1MAYA 4DT7B 4DOQA 2G52A 3T28A 1TOMH 1DUAA 2P3TB 5E2OA 5EJZA 2ZU2A 1AUJA 1O3FA 2BZ6H 3AAUA 3MU0A 1AIXH 2BLWA 3K2UA 4KGAA 1V2QT 1UTLM 3ITIA 2XCNA 3SI4H 2GP9B 3GYLB 4GCHF 2OC0A 3TH3H 2GX4A 3PV2A 4X1PU 2SGEE 2WPKS 1C4Y2 3A7VA 3G01A 1GL1A 2PKAB 4UFDH 1QGFA 3PO1C 1DWEH 3E8LA 4AG1A 2PUXB 2ZFRH 3FP8E 2ZA5A 3IWMA 3QWCH 1RTFB 2PR3A 1HPGA 2OP9A 3SBKA 3TJNA 5B6OA 1DE7H 1KY9A 1SSXA 1YPHC 3A80A 4TWWA 1NESE 3SU5A 1K0HA 1SBWA 2PKAA 4HGCA 8ESTE 4DT4A 2FS9A 4MPUA 1SMFE 1C1NA 3WWBA 4FU7A 3ZZ5A 1YBWA 1OKXA 1ELCA 3SU4A 1HAOH 1P9UA 3LGVA 1WTGH 3LDXH 3OU0A 1UCYE 1CVWH 4XOJA 3LC3A 1AKSB 2FOGA 1O5AB 2XWAA 1O2IA 3QGNB 3ODFA 2KX4A 1BQYA 1ABIH 4OS2A 4ABDA 8GCHG 1PPGE 1BHXB 4Q7YA 2QXIA 3P17H 1OYTH 1DOJA 1IQGA 2AH4X 1AY6H 5EJLA 3VB7A 5I25A 1AKSA 2G4UA 3SJOA 2JJ2D 1K28D 2ZGXH 2J5UA 4NIWA 2ZQ1A 2B5TB 4WMEA 5EODA 4FOUC 1HYLA 5FCKA 3OFND 4OS4A 1GI4A 1KLJH 1NC6A 2QIQA 3SUGA 3HGNA 1O32A 1C2IA 1W7XH 2Y80A 3PV4A 1HAPH 1UTJA 2IJD1 2JETB 3RXRA 2VIWA 1O5FH 1GWAA 2A1DB 1O5BB 1FY1A 2BVSH 4CRBA 3RXMA 1C2FA 1HJAB 7LPRA 4F49A 2R0LA 4H4FA 1C5ZB 3ODDA 4ABFA 1GJ4H 1NBMD 1DWBH 4NGAH 1NU7B 2D1JA 1TNKA 2ZFFH 3ELAH 4FUGA 4RN6A 4WVPE 2G5VA 5EXLA 1K1IA 1GJBB 2P8OC 3BTDE 3RXDA 2HALA 5J4QA 1S5SA 2DE8A 3Q3XA 4D8NA 3SJIA 4JK6A 4Y0YE 4P02A 3MO3A 4B6FA 4Q7ZA 4QT8C 2SNWA 1MBMA 5F8ZA 1NS3A 2GD4B 3O8DA 4BOHA 1TX8A 2HWLB 7GCHF 3S9BA 3MFJA 1C5OH 3UNQA 2ZDVH 3ATLA 4OS6A 3DSGA 1VCWA 5L2ZH 1N1LA 2VWLA 4THNH 2OK5A 4X6OA 3SU1A 2JKHA 2PHBA 1KXBA 3DCLA 5DSFA 4MQAA 3V7TA 2XC5A 4K1SA 3BIVH 1WTHD 4A1XA 2QGRA 1ZJDA 2TGPZ 1H8IH 1J16A 4O97A 2XBVA 2BQWB 2ZHFH 2O9QA 4Q7XA 1ZOMA 1U6QA 1OWIA 4RKOB 3VXFH 5ESTE 3SHCH 1G9IE 3MI4A 3RXIA 3SJKA 2F9OA 2BX4A 1JWTA 1A0JA 2Y7ZA 3MO9A 4NIVA 5JBAS 1GJCB 1XXDA 1W0ZU 4CR5A 2Z3DA 1ETRH 1L1JA 1A4WH 1VITH 5I46H 1FZZA 2FLBH 3KQCA 4ISLA 5CMXH 1IOEA 1QR3E 4CRGA 5ESBA 3RLWH 2ZG0H 1KYNA 3KF2A 2Z94A 3T5FH 4ZH8A 4B2AA 4AFSA 1MMJN 2R3UA 4NWKA 2STAE 4Y7BA 1G3BA 1NY22 3MH7A 5C0UA 5PTPA 3SNEA 2ZTZA 1UVTH 2EC9H 4WMFA 1O2XA 2H1UA 1S6LA 2CJIA 3LJJA 3BEFB 2DUCA 2IJOB 1G2MA 1C5UA 1VZQH 4MVNA 1IQMA 1HAIH 1GHBF 2AFQB 1PQ8A 2SGDE 8LPRA 2G51A 4IMQA 5FBEA 3ATWA 2YNAA 3OY5U 4I31A 1SLXB 1GJ8B 2G55A 3AASA 3OEHD 2Z9GA 4IBLH 3MYWA 5GIBA 1Y59T 1O30A 3F9EA 2JJ1D 4GHQA 1V2JT 3U9AH 2XTTB 1BJUA 2QF0A 1O3IA 1O38A 1P01A 3U1IB 2RCEA 1YCPH 1Y3WA 3ATKA 2KCYA 3PWBA 6ESTA 2PGBB 5HKKD 5C20A 2PUQH 1ZLRA 3K9XB 4O3UA 3PYHA 1BCUH 1AZZA 1HJAC 2Z9LA 5A8XA 2LP6A 1Z1IA 1WXRA 4MPWA 2ZFSA 4NFFA 4XFQA 2WYGA 4MPVA 4AZ2B 3SV7A 2ZEBA 1SOTA 4MNVA 2TPIZ 2W3KA 5BPEA 1IQFA 1AD8H 2ZIQH 3SNCA 5C1UA 1WU1A 4I86A 1BZXE 1C5VA 5C0TA 1F5RA 1ELGA 2GDEH 2JH0D 1H9LB 5A8ZA 3BTKE 3AK5A 1Y3YA 2OXSA 3BV9B 4BAMB 4FUDA 4YOGA 4K8YA 2BOHB 3RMOH 1C2KA 5AVDA 4INKA 3BTFE 2NU0E 1ZMNA 1T8OA 3RXQA 2B9LA 4FUCA 5C2ZA 1O3CA 3MTYA 4TYDA 2W7UA 3PTNA 3M5LA 4Q63A 2VWNA 3W94A 1WOFA 1JIRA 2O8UA 5DP8A 3ZYEA 4RSPA 3F2FA 1O2JA 4BXSA 5E0GA 1O2MA 3UAIC 4WXVA 1GHVH 1HDTH 1V2TT 3NRLA 2VH6A 2HNTE 2ZTXA 2PWXA 2ZQ2A 3QDZB 3BTGE 5T3HA 6GCHG 3DHKH 3LGWA 1FY5A 1Q2WA 2HRVA 1NBME 2ZFQH 1SLWB 3A83A 4VGCC 1ORFA 3GCTG 2UWOA 2Z9IA 3A89A 2AMQA 1QB9A 1J15A 3FZZA 1O39A 1UVSH 1P3EA 2W6JD 3SN8A 2NWNA 5DN6D 1EKBB 1QB1A 1UVPA 3D62A 1O31A 1EAWA 3BG4C 2JH5D 5DP4A 5JB8S 1TFXA 2FYQA 3S7HB 1C5TA 1LHDH 1TYNA 1YLCA 3P8NA 1NU9A 2BDHA 2C8WB 1FJSA 2Z7FE 5DO4H 3GY3A 5HM2A 1UTNA 3N99A 1F0RA 3UNSA 2BDAA 4AB8A 1SGNE 1THSH 1ZPBA 4YLQH 3W1EA 5TCCA 2Z9KA 1C5YB 1UW7A 4I7YH 2KCOA 5TCAA 1GDUA 2FZZA 3KYFA 1NRQH 2W26A 1H8ED 4KELA 1C1OA 3U98H 3LPRA 2ULLA 2EI7A 2VWOA 5C3NA 1V2KT 2XBYA 2XNDD 1BUIA 2GTBA 3SO3A 4DIIH 3UPEA 1HV7A 4B2BA 1E36B 2OBQA 1C4U2 1P05A 2NU1E 3VB6A 2Q6DA 3A88A 2JH6D 2SFAA 1BMLA 1C4V2 4WJG2 2V35A 3OAAD 1TB6H 2W3IA 1YYY1 1TQ0B 5GPIB 4AOQA 3RXPA 1ABJH 3M3TA 2OLGA 5B6LA 5EPNA 2SGAA 5A2MH 3ZYDA 1QRWA 5FPTA 3RXUA 1TRNA 2HOBA 5JBTA 1VCPA 1RTKA 3ATMA 4ABJA 4ABBA 2A4OA 1O2SA 1O2KA 1SHYA 3E0NB 3EAJA 1O3MA 3OSYA 1E1QD 3B8JA 5DP5A 2O8LA 2ZCLP 1GBTA 5AFZH 1CHOG 1DLKB 2BMGB 5EW2H 1C2LA 1BRBE 1O5EH 3TJUA 2XW9A 2WSSD 5C1XA 4MLFB 1ZTLA 1SGEE 1TX6A 2P59A 1AFEH 1QQ4A 2BQ7B 1TX7A 1LO6A 1V2RT 3ZV8A 3DSPA 4RKJB 3GISB 3UB0A 5F6MA 1KLIH 4GLYA 1BTXA 2TIOA 2ZDAH 1DY8A 3U8OH 4U30A 2WPMS 2ZGCA 4Y11E 4YT7H 2FO9A 4WWYA 1GCTB 2VGCB 3NKKA 1N6XA 3PB1E 1HRTH 5T6FA 3SYJA 2ZECA 3M7TA 2G81E 3S0NA 1C1PA 1OWDA 1YCPK 3F2GA 1IQLA 3U69H 3PV5A 1LKAA 2WV4A 1WSSH 3A7TA 2QAAA 1ESBA 1S85A 1Y5UT 1BMMH 3OTPA 3SV9A 3RC4A 2RG3A 1UTMA 4B74A 1D3PB 1WYKA 4M9FA 1TA6A 1OP0A 3HGPA 2FI4E 2ODQA 1VITG 2WV5A 3JZ2B 4CH8B 1EJAA 3MWIU 3CS7A 1IQHA 2H9EH 3N7DA 1BDAA 2FI3E 2ZDLA 2YMSD 1A0HB 2RA0A 2UUYA 4D76A 4X8VH 1QRZA 2I6QA 3F0PA 3LGUA 2BHGA 4K3JA 4E7RG 1CA0C 1QCPA 1DX5M 2ANYA 1ETSH 2C8ZB 4BTIB 4HI3A 1Y3XA 1HJ9A 2AEIH 1EUFA 3BEUA 1F0SA 1ZHMA 2FODA 3QGJA 1TONA 1MTVA 4K5ZA
chains in the Genus database with same CATH topology
1A7SA 1C5WB 1O3PB 2SGFE 3B23B 1XVMA 4XBCA 4Z6AH 1Z7KA 3IITA 2AS9A 2VB0A 2A4RA 2QCYA 3SNAA 2Y5HA 3GCHB 1UMAH 4IS5A 1LKBA 1WAYB 2Y5FA 4JZFH 5DPAA 3TLOA 3TGIE 4UFFH 2B0FA 4Y8XA 4ZHLU 1DPOA 1FY4A 3M5OA 2BLOA 1GHAF 3UIRA 3PMAB 5E2PA 2WPHS 1BTYA 2HGTH 1P12E 1BTUA 2KAIB 1BBRK 1C9TA 4BANB 1BOQA 3LU9B 4ZKOU 2Z9JA 2VIOA 2C4FH 3M5MA 5EXMA 2O8WA 2H9TH 4H6TA 1GL0E 3SNDA 1MTWA 2GZ7A 2Q6FA 1IQIA 2KAIA 3SU0A 4ABIA 2FYRA 3D49H 4BNRA 1Y5BT 2FXRA 3LC5A 3A7WA 2FPZA 1VJ9U 1Y5AT 1T4UH 1ZYOA 1B0FA 3NPSA 3SHAH 4FVDA 1C1SA 4AYYB 1P04A 2ZPSA 1EAUA 4AB9A 1A0LA 1TOCB 3K6YA 1O35A 4ISHH 1GI8B 2O8MA 1UTOA 3MU5A 1SGFA 1TNLA 3TJOA 1P2QA 3O8CA 3SUEA 5EW1H 2ZC9H 1ZHPA 1GI7B 1C9PA 1LVMA 2QN5T 1D3QB 4LZ4B 2ANWA 1NRRH 3ZVBA 2J92A 1QL9A 4NSVA 2VGCC 2G5NA 2UWPA 4TPYA 3RXHA 2D26C 1O0DH 4X2YA 2D8WA 1GI0A 5LPFA 2IOTA 2BVXH 3UY9A 4M7GA 5FX5A 1TALA 2G8TA 1P9SA 3MH4A 1CT2E 4JYUH 3TH4H 2F83A 2J4IA 2BYAX 1DM4B 2BD5A 6CHAB 3ZVDA 4UONA 3E1XB 3DFLA 4WMDA 3AW0A 2EA3A 4X1NU 3TK5A 1IQEA 1JXPA 3V3MA 1O2PA 1SQTA 2ANMH 4DCDA 1J9CH 2ILNA 2BD8A 1O2HA 1SOZA 4FXGH 2ZO3H 3E6PH 1MTNC 3SU3A 1C1UH 1K1LA 3M7UA 2THFB 2ZFPH 3A85A 1UHBA 1FNIA 4U01A 3UOPA 4A1VA 3OX7U 3GYMA 4NWLA 2ASUB 3MOCA 5EOKA 1FONA 4HFPB 3GICB 1C2JA 3I77A 3MMGA 1GHXH 2VIVA 3BTHE 4OS5A 5DGJA 1BRCE 1HCGA 4X6NA 3QZRA 3T26A 2YNBA 4AFUA 1YPMH 5GXPA 4CH2B 1V2PT 3P8OA 4BXWA 2BZAA 2CF8H 2GT8A 3GCOA 3GCHC 4NFEA 1TGBA 2GVFA 1O2UA 1ANBA 2FLRH 4FUFA 4CHAC 1K1PA 3BIUH 4AORA 1DLEA 5EU8A 2HNTC 1XUHA 2VVUA 2XBWA 2Z3CA 1VGCB 1XKBC 1GJ7B 1DVAH 3KCGH 1HXEH 4NA8A 1SPJA 2Y5GA 1H9IE 1LCYA 2TGAA 3F9FA 3GY5A 3OYPA 1C5LH 2K1QA 1ELFA 1GVLA 1XM1A 1FUJA 3I78A 1FQ3A 5JPMH 3NK8A 2ZI2H 2H5CA 2OD3B 1PPCE 3BTQE 1MKWH 1V3XA 2ZDKA 3UFAA 3MHWU 2BY8X 1SC8U 3M37A 4FUHA 1QJ1B 1B0EA 2OINA 1P3CA 3A82A 2XC4A 1VITF 1K1NA 3SGBE 1OSSA 4DY7B 2UWLA 5LH8A 1NFUA 3NCLA 1O2OA 1GMDG 4K1TA 3ZVAA 2BD3A 2OTVA 3SI3H 1G37A 1C5NH 4B1TA 1RXPA 2IN2A 1THPB 1GMCF 1ESAA 3SV8A 2H9HA 2BXUH 1PQ7A 4I33A 5GJ4B 3IG6B 3SGAE 1FIWA 1GBDA 3BTME 3LGYA 2VIDA 1ZSJA 2BDGA 2A31A 3P6ZB 1TPPA 1W3CA 3MO6A 2WPLS 2B7DH 1KTSB 4JYTA 1XKAC 1YPJH 4Q2KA 1DT2A 1VJAU 3MU1A 1MKXH 2ZZUH 3RM2H 6CHAC 1C2HA 3ZZCA 4A5TS 1CU1A 2ZNKH 3RXVA 1WV7H 5LPEA 1UVOA 2BY9X 1ESTA 4YZUA 5HMAA 1DICA 2D2DA 3MU4A 1SGIB 4B75A 4U32A 1GBAA 2CMYA 3Q3YA 1J17T 2ZU1A 1HBTH 1O2YA 3UNRA 1EB2A 1NRPH 3QZQA 1YPEH 4WF8A 5DP6A 2RDLA 3GY2A 1SVPA 1TMBH 1PPZA 5T6GA 1HFDA 2P3UB 4ZHAA 1D3TB 1BTHH 3VB4A 1EPTA 4ASHA 3M36A 2Z3EA 1T32A 1N8OB 4HZHA 7ESTE 3PTBA 2FP7B 3KQBA 1E35B 1RRKA 3S7KB 3QUMP 1HAZB 3TGKE 4Y7AA 1SB1H 1QL7A 4MNWA 1FV9A 4O9VA 1DWDH 3A87A 4A7IB 1OP2A 1PYTC 2F9NA 1AE8H 1Z8JB 3ZZ9A 1VGCC 1LHFH 4FUEA 2FOHA 1QIXB 2A5IA 5FBIA 2FTLE 2FOMB 2JETC 2PKSB 1SR5C 2F9BH 4BTUB 5LPRA 4NIYA 3RXGA 1JBUH 1S6HA 1ANDA 4XBBA 4TY6A 1GBEA 3EQ0H 1W2KH 5FXLA 3U1JB 5GCHG 4AG2A 1CE5A 1ZMJA 3NXPA 4SGAE 4DVAU 1NPMA 3BTEE 1Y8TA 3KN2A 4YT6H 1EASA 2AIPA 3F9GA 3KGPA 1OPHB 2FESH 4K60A 3T29A 1AO5A 3W95A 2GDDA 2STBE 2BVRH 5BRRE 5DP3A 3SUFA 4O03A 3MNCA 1GBLA 1MQ5A 4D9RA 1ZPZA 2VU8E 3FAOA 1YPHE 3V0XA 4KTCA 1GJ6A 1MU6B 1Z8IB 2XRCA 1WUNH 1O2WA 2HPQH 1KTTB 2ZU3A 2CXVA 3S9CA 3AVZA 5L6NH 3URDA 1E34B 1SGRE 1SLVB 1YF4A 2ESTE 4AFZA 4ZKRU 1ARBA 4ZROA 1YP9A 1TRYA 8GCHF 1NO9H 3TIUA 1RJXB 2GKVE 3O8BA 4NG9H 2W7SA 3V12A 1TGSZ 3VGCB 1SFQB 4ISOA 1TNGA 3T27A 1OWEA 2DE9A 3Q77A 3RXJA 2BXTH 4B73A 1FY8E 4X6PA 1MKWK 3GY8A 1FI8A 3EA9A 3RU4D 1BBRH 1H8DH 2BDIA 1LPGB 1IQKA 1C5PA 2V3OH 2ZFTA 3A81A 3TH2H 3T62A 1KIGH 3QTOH 3A7ZA 2WPJS 1V2OT 3SORA 1KXDA 1HXFH 2BQ6B 1KXEA 1A5HA 1S83A 1ZSLA 3LONA 3RMNH 5LGOA 2OC1A 4LOYH 1A1RA 1QB6A 3SU6A 3PLBA 4WY3A 1T8LA 1MU8B 5FX6A 3RM0H 1T8MA 4JZIA 1KXAA 1RTLA 2BM2A 3L33A 3RXAA 3UUZA 3ZZ4A 1IQJA 2RA3A 1HUTH 3LKWA 2FDAA 2VIPA 4INHA 1EP6A 1MQ6A 2B8OH 2NU2E 5EGMA 5A0AE 3TK6A 1N6YA 4FVBA 4WH6A 1K1OA 4I32A 3K6ZA 1ELBA 1GMDF 3UR9A 1Z6JH 1PQ5A 4ABEA 1QBNA 2UUFB 2A0QB 3ZVGA 3PMHB 1O5GH 2QXJA 2FOBA 4JYVH 4BAHB 1TBQH 1BMAA 2A7CA 2R0KA 2ZF0H 1ELTA 1W13U 2NU4E 3M35A 1MKXK 4CRDA 5K0HA 4FUBA 3GDUA 4ZMAH 1F2SE 4JZEH 3A86A 3RXLA 3LT3A 1GBKA 3URCA 4GVUA 1EOJA 3TK9A 2FOEA 3HATH 5A8YA 1O2QA 2CHAB 3RXOA 3DA9B 3B9FH 1ZGIA 1PJPA 1QRXA 3HK3B 3P92A 1MZDA 5F8TA 1UO6A 2A45B 4GUXA 1SG8B 1XX9A 1XXFA 1OXGA 3M5NA 3PROA 1SI5H 3GDVA 1DUEA 1W8BH 1G2LA 1RIWB 3FVFB 1TGCA 3RXEA 4X2VA 2H2ZA 2XWBI 1EX3A 4MDSA 2F9PA 1BMNH 4XBDA 3BG8A 1P03A 1O3OA 2PSYA 2UUKB 2ZHWH 1GDNA 4ZKSU 4DW2U 1UK4A 4ZXXH 4BAKB 2XYAA 4X2XA 3MH5A 1O33A 3C27B 5HM9A 1EAIA 1A46H 3MNBA 2J9NA 3TITA 1FLEE 1EZQA 3A8AA 1C5QA 1IHSH 2A2QH 1LQEA 1NROH 3RXKA 4CBOA 1UCYK 1FPCH 4Z0KA 1PPFE 3HPTB 3L6PA 1CGJE 2A4GA 2TGDA 3KL6A 3TU7H 3GOVB 1C2MA 2A5AA 5AFYH 5DKMA 4X6MA 3RC6A 1NFXA 5FCRA 4KKDA 1P0SH 1EZSC 1BTPA 1LHCH 1OX1A 1TMTH 4IN2A 3F1SB 1QBOA 2GGVB 1PPBH 3QN7A 4YTAA 2A32A 2F9VA 5L30H 5E0JA 4OS1A 1FN6A 1CBWB 1SGDE 5GCHF 2PTNA 1UTPA 1O2ZA 1TBRH 1OWHA 1DS2E 2AMPA 1P57B 1ZSKA 1MZAA 1XUJA 4XE4A 4JZDH 4JMYA 1QY6A 3ZZBA 5A0CA 2GT7A 1LVYA 3PO1B 3VPKA 1ANEA 1DSUA 2V6NA 1MBQA 2VWMA 1DWCH 4A92A 1JRTA 5EG4A 1V2WT 3TVJB 1K2I1 3A8BA 2J34A 4Y8ZA 1TGNA 1MH0A 1P06A 2PGQB 3OTJE 1HAYB 2O8TA 4D9QA 4B76A 2GV7A 3ZVCA 1D6WA 3KIDU 4BTTB 3RU4E 1TLDA 3JZ1B 3ENSB 3N7OA 4ABHA 2C8XB 2V0BA 1TAWA 2BD2A 2QV1A 3MNSA 4NSYA 1YLDA 2ZPRA 5EQSA 4ESTE 1BTWA 4DJZB 4X1QU 2A4QA 2SGQE 1L0ZA 1SGTA 2NU3E 4I8LA 1WCZA 4R0IA 3EGKH 2VIQA 1OWKA 2V3HH 1O3AA 2AIQA 4ZUHA 6GCHF 1P09A 1F0TA 1BRAA 1FMGA 1K9OE 4B71A 3GCTF 1GI9B 1EJMA 1C5MD 1AGJA 4FU9A 1ZRBA 3LGTA 1AVXA 1GJ5H 1TMUH 1KXFA 1O3HA 1HJ8A 1Y3VA 1HGTH 4LXBH 3SJ8A 2A7JA 2PTCE 1O3NA 1A5GH 1Z8GA 1EXFA 3STIA 3SQEE 1ZJKA 2A7HA 1E0FD 3D65E 3M7QA 1AHTH 3M3VA 3DD2H 3EA8A 2XC0A 1SGYE 3RXBA 1P2OA 1FN8A 3VB5A 5GWZA 1XMNB 3E16B 1W11U 1CT0E 3SV6A 1O2TA 3VEQB 5DP9A 2XBXA 3M61U 4ZKNU 1GCTC 4UDWH 4DURA 1EAXA 1MAXA 3QO6A 5JBBS 1P10A 2BY5X 1BJVA 2Y81A 1O3LA 4NA7A 4A6LA 1W10U 1QTFA 1IAUA 1C5SA 2ZHEH 1GHBG 1A61H 2PV9B 1FXYA 1O2NA 1EZXC 2ZWLH 4TWYA 4AFQA 1H1BA 4JK5A 2Y6TA 2I6SA 1BT7A 1NRSH 5EPYA 2TRMA 3FP7E 1G3CA 6LPRA 1DFPA 1S84A 2IPHA 1C5XB 3HKJB 1DITH 1P2JA 3MNXA 1F92A 4IMZA 4PROA 2XXLA 3RU4T 5C67A 2VH0A 1UHBB 2BTCE 1L4DA 1HAXB 2VINA 1O3JA 2GMTB 4GHTA 2YOLA 5JYIA 4YM9A 1NRNH 1G32B 1CBWC 3FZDA 1G30B 1OWJA 1KXCA 4UFEH 1ZMLA 5FHTA 1AWHB 1CHOF 2FIRH 3RXCA 1Q31A 9LPRA 1ETTH 3DUXH 2P95A 1YPGH 3SW2B 1YM0A 4R8TB 1A2CH 4Y10E 2QYIA 1QFKH 3KQEA 1QURH 3SV2H 5FPSA 3Q3KA 1WQVH 5J4SA 3TJVA 2ODYB 1KSNA 4IW4E 5IDKA 3KEEA 2GV6A 1TNIA 1QQUA 3ZVFA 3I29A 2TGTA 3LOXA 2ZU5A 3GDSA 2BLVA 1OP8A 1YGCH 3HK6B 4INLA 3U8RH 1BIOA 2R3YA 5JB9S 3SZNA 1OS8A 1C1QA 2R2WU 3U8TH 5HXFA 2F9UA 2H6MA 3VB3A 3E0PB 4YOJA 4ISNA 1ZGVA 4Y0ZE 1UVUH 4NZLA 1QA7A 3GY6A 1FAXA 1T4VH 1K22H 3AAVA 1SGPE 3EE0B 2M5TA 2Y82A 3T2NA 2A2XH 1QL8A 1AI8H 1K1JA 2OUAA 2HPPH 3VFEA 5DP7A 4IC5A 4OGXA 1TQ7B 3PMJA 4CR9A 4LZ1H 1O2VA 9ESTA 1Z8RA 2BDBA 1ELDE 2AMDA 1C2GA 2ZGJA 3LJOA 1TGTA 1D6RA 1AQ7A 3QTVH 3MU8A 1BA8B 4JZ1A 1GBHA 1VR1H 3FP6E 1YC0A 3MH6A 2ODPA 1A5IA 3PLKA 4F4OC 1XUGA 4Y79A 2UUJB 4IN1A 4ZHMU 2XNIA 1GHWH 4Y8YA 1T8NA 1PFXC 1T7CA 5AF9H 2VVCA 3RP2A 1SFIA 3EDXB 1V2ST 4MTBA 1MUEB 3VXEH 2J95A 1QBVH 1PQAA 2CV3A 2J94A 1BBRE 1TBZH 2EI8A 2QXGA 2XCFA 2FOFA 4YLUA 1GVZA 1GBIA 3UR6A 2BLQA 5G4BA 2BD7A 3H7TA 3BF6H 2P94A 3SOSA 1TPOA 2PFEA 2GMTC 1GHYH 2A5KA 1F0UA 3SUDA 1XUIA 2ALVA 1GG6B 1HB0B 4VGCB 1GHZA 1EPTB 1V2MT 3RLYH 1E37B 1MCTA 1LTOA 3LIWA 1KDQB 3EA7A 3UWIA 1ZTJA 2C3SA 5FAHA 2J38A 1CHGA 1JRSA 1ZR0A 1TIOA 3UTUH 1DDJA 3STJA 4Q80A 5HGGA 3BG4B 3H5CB 3P70B 4GPGA 1KDQA 1YKTA 1D9IA 1FPHH 1SGFG 3L3TA 4KTSA 3Q76A 4UEHH 1HAVB 3ZZ3A 1UTQA 5C1YA 2BDCA 3UOUA 1ZPCA 1UJ1A 2W5EA 1H4WA 1CQQA 1M9UA 4CRAA 4H6SB 3WY8A 1D3DB 2P16A 1XUKA 1P8VC 2OC7A 1EJNA 1AU8A 1O5CB 2WINI 1HAVA 1ZRKA 1E38B 4KP0A 4X8SH 1UK2A 4KTUA 3EYDA 1UCYH 2OBOA 1V2NT 1OYQA 4MPXA 4YOIA 4E06H 4AGJA 2GCTB 1S82A 1QHRB 1O3GA 4SGBE 3PLPA 4TPIZ 3KNXA 1FDPA 3KQDA 3DFJA 1Z6EA 3ZZAA 2FS8A 3SU2A 3OY6U 3GY4A 1SGCA 3PM3A 2FMJA 5A09A