2FWWA

Human beta-tryptase ii complexed with 4-piperidinebutyrate to make acylenzyme
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
243
structure length
243
Chain Sequence
b'IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptase beta-2
publication title Structure-guided design of Peptide-based tryptase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 49
structure length 243
sequence length 243
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2006-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fwwA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fwwA01
2F83A 1QJ6B 4X1SU 2NU0E 1P03A 1GHAF 4X8SH 2BZAA 2FMJA 1V3XA 1NFXA 4HFPB 4MVNA 4AFZA 4K1SA 1SLXB 2VGCB 2WINI 4AX9H 4D76A 2XW9A 1KLTA 2VWNA 4MPVA 2OBQA 4TY6A 3QN7A 2STAE 4Y0ZE 2PKAB 4WY3A 3SU2A 1BQYA 1ID5H 2ZDKA 1D4PB 2FESH 2FOCA 1UVTH 1E36B 1FPCH 1K2I1 3QGNB 1DS2E 2V3OH 4MNVA 5AVDA 4F49A 2CV3A 3H7TA 1GJDB 3AVZA 2HNTE 1UTQA 1BTHH 3ZZBA 1WOFA 3SU0A 1FI8A 2QA9E 2ZHFH 2ZTXA 5FXLA 2HPQH 4JZDH 5JPMH 3QX5H 1XXFA 1C1NA 3U8TH 2FPZA 4NA7A 1UK4A 1TA2A 2FX6A 2BTCE 2BB4A 2NU2E 2ZI2H 4BTIB 2ZQ1A 3VXEH 4CRDA 3D49H 2FIRH 3TU7H 5GPIB 1YGCH 4Z6AH 4Y6DA 1NRNH 1QL8A 5F8TA 3TJOA 1AVXA 3PMBB 2OXSA 1T4VH 2VB0A 4D9QA 1S0QA 2UUKB 3CENA 5CHAC 1ELDE 4Q7XA 3RU4E 1GJ7B 1TPSA 4I8JA 2AIPA 1AUTC 2Z6BD 2BX3A 1TGSZ 2SNVA 4MTBA 2W3KA 5A8XA 2ILNA 3T28A 1HAVB 1XKAC 1BTWA 1FQ3A 3K6YA 1T8NA 1GMCF 1HBTH 1HLTH 2PGBB 2XNIA 2VVUA 1G30B 1QCPA 1Z6EA 1RXPA 2ZHEH 1NROH 2BQWB 2G81E 5HGGA 3GDSA 1DVAH 3S7KB 5A0CA 2F9OA 4CRFA 4K60A 1QQ4A 3U9AH 1QL9A 3RLWH 3LU9B 1A61H 1T8LA 3RXIA 1JIMA 3RXHA 4AGJA 1TPOA 1O5CB 3KNXA 4KGAA 1A7SA 3SU1A 3ENSB 3UR9A 2BDIA 1GI8B 3KQEA 4RKOB 5B6OA 3T27A 1H4WA 1C5VA 1O3CA 1Y8TA 3UUZA 1FN6A 1P06A 3PM3A 2FM2A 4NSYA 4ABJA 5GIBA 1NN6A 3S7HB 1F5LA 2OINA 2DUCA 4IN1A 1BIOA 1SG8B 3SORA 2FYRA 4X0WU 2W5EA 4KTCA 4X2WA 5ABWA 4AGKA 2GMTB 1ZHPA 2CF8H 1BHXF 1DITH 3EAJA 1S0RA 3MFJA 5G4BA 1AZZA 1A46H 2ZGHA 2Y7XA 2WV5A 1BBRK 1P3EA 1MAYA 1TMUH 1HDTH 3TK9A 1B5GH 2JKHA 2TGDA 1TGNA 1QBNA 3PLBA 3EA8A 1O38A 3RXCA 4D7FA 4BOHA 1O2XA 2J92A 3RXJA 2J94A 1DE7H 2Y6TA 1OP8A 1DWBH 3LPRA 2FXRA 1O3LA 1AY6H 4H6TA 1FPHH 3P8FA 1TPPA 3LGIA 1RJXB 1JMOH 1RRKA 2G4TA 2GCTB 2RA0A 4AB8A 1UJ1A 1B0EA 2G00A 9LPRA 1ARBA 1CHOG 1EP5A 3E1XB 1GCTC 1NY22 2BXUH 3ZZ7A 3SV2H 3RXLA 1EAWA 2BLOA 1Z7KA 3BN9A 2HLCA 1VITG 1MH0A 2GZ7A 2BY8X 1TB6H 1C4V2 1KXDA 1OYQA 2B8OH 2WPMS 4OS1A 4Y7BA 4GVUA 2ZWLH 2ZQ2A 3ZZ8A 4SGAE 2A0QB 2UUYA 2XC5A 3PROA 5DP8A 1P2MA 4ZXXH 1IQIA 1CO7E 3UQVA 3L3TA 2GDEH 7ESTE 1DWEH 3CP7A 4XDEA 1TQ0B 1KSNA 1FV9A 1WBGB 2NWNA 1A3BH 1V2RT 2CHAC 2W26A 5J4SA 3M5MA 3Q3XA 2D26C 1C2FA 4FUEA 3QZQA 3P92A 2J4IA 3KQDA 4AB9A 1CVWH 2ZDMA 1VCPA 3FZDA 4Q7YA 1W3CA 2Q6DA 3G01A 1N8OC 2ALPA 3SNEA 3RC5A 2F91A 2WPHS 3RXKA 3FVFB 1E35B 3T2NA 4CHAB 3MYWA 1ETRH 2PLXA 1V2MT 1G2MA 5EXMA 4BNRA 1L4DA 2IOTA 2ZCKP 1QRXA 3LIWA 1GBIA 3HK3B 1O35A 5PTPA 1GI4A 1HIAA 1BJVA 2Z9KA 3QUMP 1K1NA 3GCNA 1YCPM 1VGCC 1MKXK 1UTKA 1OWEA 2FOMB 4UD9H 2W7UA 1GBKA 1GL1A 1CA0C 3P8NA 3TVJB 3S69A 2AGEX 3F9EA 3MU5A 3NCLA 1IQJA 1O3FA 5ESBA 1Z1JA 3K65B 4X8TH 1V2WT 3KIDU 5L30H 4NCYA 2Z3CA 1O3DA 3A8CA 2VIQA 1TIOA 4KP0A 2P93A 2C8XB 2R3UA 1NU9A 2VIWA 5T6DA 4MNYA 1O36A 1PPZA 1GBCA 1L0ZA 6CHAB 1T32A 3FP6E 5JBAS 1GHXH 1NM6A 3QDZB 1AFQC 3HK6B 1GI3A 4CRCA 1ZRBA 2QXJA 2P3TB 2Y5GA 4D9RA 1V2LT 1BBRE 1FXYA 3SN8A 5DP6A 1QA0A 2CGAA 5FAHA 1F0RA 3RXSA 4UDWH 2OLGA 4X1RU 2BY7X 4ZH8A 3AW0A 4IGDA 2P8OB 1WU1A 2Q6FA 1BBRH 3P70B 2WPLS 1KDQB 3ZV9A 2FI3E 4K3JA 1SGEE 1U6QA 3IG6B 5FX6A 1XUIA 3OYPA 3PMJA 2H1UA 3HGNA 2SGDE 4YO9A 4O3UA 3B23B 3RLYH 5K7RA 3ZYEA 3SJIA 3QWCH 2GV6A 5H4IB 3RMLH 3T26A 4ABIA 1THRH 2P95A 3GICB 1AIXH 1FZZA 1F5KU 1DWCH 5ESTE 1SLUB 5EXLA 4E7RG 3A7XA 2V0BA 1XUJA 1D6WA 1RD3B 1C5WB 1W14U 4Y10E 4H6SB 3UPEA 2F3CE 4OGXA 1OP2A 4YLUA 1XMNB 1QJ7B 3T25A 5EODA 1RGQA 3C1KA 1L2EA 2AGIX 1BZXE 4XFQA 2UWLA 1NPMA 2ZTZA 5DP7A 2C8ZB 1F5RA 1TFXA 4MPUA 3AW1A 3UNSA 1PQ7A 3LDXH 5F8XA 2H9TH 1P05A 1EPTA 4DURA 2FWWA 3QZRA 1TGCA 4FUBA 4OGYA 4CR9A 1V2VT 2PWXA 1VITF 1SR5C 4WJG2 2BDYA 5EPNA 1QRZA 4CH2B 2AH4X 4Y8ZA 1RTLA 1SQAA 3T5FH 1W0YH 1AVGH 2GX4A 2GD4B 3LGYA 2Z9JA 2PGQB 4MPXA 3A89A 3O8DA 3A87A 2BDBA 1TBZH 1GMDG 3V0XA 4LOYH 1HXFH 4YOIA 1OYTH 3M5OA 3VFEA 1HAYB 1HGTH 1ETTH 4ISNA 3SHCH 1H8IH 2ZNKH 3MH5A 4QT8C 1XUHA 5DKMA 1ELFA 1CBWB 2VWMA 1TOCB 1JBUH 3DT0H 5CMXH 3ZV8A 2ZU5A 1Q31A 1HPGA 1YF4A 2C8WB 2XC4A 1LPZB 1RIWC 2Y7ZA 5JB9S 2BY5X 4B2AA 2A4OA 1CGJE 3ZZ5A 4IC5A 1MKXH 3A8AA 1IQLA 1OKXA 1SSXA 3HGPA 3KN2A 1Y3YA 2ANMH 1S81A 2PSXA 1PJPA 1C1OA 1DLEA 4I33A 2PKAA 1HCGA 1SL3A 1EPTC 1T31A 1DUEA 1P12E 2BZ6H 4ZUHA 2BMGB 1C5YB 4IC6A 5AHGH 1GI0A 5TJXA 4TPIZ 3SJOA 1C2KA 2W3IA 2TGPZ 4HTCH 1WCZA 1A0LA 1BJUA 3A81A 1P8VC 1G32B 1Y5UT 1LPKB 1T4UH 4THNH 1FMGA 4XBCA 5FPSA 1KIGH 4MNWA 2TPIZ 2GCHG 1C2DA 4R0IA 2SGEE 1DANH 1QGFA 5LPRA 1Y59T 5JBCS 1F2SE 3OX7U 2J9NA 3M5NA 4NFEA 4B2BA 1EX3A 1T7CA 2C90B 1K1IA 3DFJA 4YTAA 2ZDVH 6GCHG 1TRMA 1LVOA 3MNXA 4NSVA 4ZROA 4B71A 1ANBA 1ELVA 3BF6H 3B8JA 2XTTB 4JK5A 5JBBS 3VPKA 2FZZA 4GLYA 3OU0A 3E90B 1IQEA 1BTUA 1K9OE 1TOMH 1GI2A 2GZ8A 3M36A 3SW2B 3TITA 3LT3A 5FBIA 1HJ8A 1ORFA 1ESBA 4E05H 3FP7E 5EU8A 1ZTKA 1GMHG 2VGCC 1O32A 3LH1A 2BD7A 2LNCA 4AYVB 1K1OA 2OD3B 1MTUA 2G5NA 2VH6A 2Z94A 3MO6A 1SGTA 4E06H 4BAKB 1HAVA 1SPJA 4IS5A 3PLKA 2XYAA 2XWBI 4NA9H 4AORA 4ABBA 3K6ZA 1S84A 4JZIA 3SI3H 1HAIH 2OC0A 4B74A 1VCWA 4LK4A 5A2MH 1G2LA 2WUCA 3MOCA 3UR6A 5EQRA 1EJNA 3GY7A 1EATA 1GHZA 3F1SB 3TH2H 2ZPQA 1W8BH 3MH7A 2GVFA 1BA8B 4UFGH 2GGVB 3C27B 1GI6A 2ZKSA 8GCHF 4JK6A 3LGUA 1GHYH 1A5IA 3RUOA 2XCFA 1TPAE 4DG4A 3BG4C 1GJCB 3A85A 4JYUH 1RS0A 1ZOMA 2AYWA 4HGCA 5HM2A 4UFEH 1HUTH 3BTKE 3MHWU 2UUFB 1CU1A 1GJ4H 3CS0A 4FVDA 5J4QA 2BLVA 1W12U 2O8TA 1S6HA 1SGRE 1YKTA 1TNGA 2FS9A 3MH6A 4WMEA 1EAUA 5C5OA 1IHTH 4FVBA 1OX1A 1QB6A 2F9UA 3FZZA 1F0UA 5E0JA 3GCHB 3RMOH 2TRMA 3QGJA 3VB3A 1YP9A 2V35A 1WQVH 3H7OA 1O34A 4JZ1A 1CQQA 4A92A 5DP9A 4I32A 7KMEH 1TNJA 3VEQB 1P3CA 1TBRH 3EGKH 4CRAA 1BRCE 1J9CH 4E7NA 1OXGA 1ZGIA 1GMDF 2J2UA 1BTZA 4I8KA 1LO6A 2FOFA 1ELEE 2VH0A 1GHWH 1ZJKA 4Y71A 1AWHB 3UQOA 3LC5A 3BG4B 3U69H 2BDHA 2Y5HA 4ESTE 2HNTF 1PPBH 1O2VA 1G36A 1UK2A 1V2TT 3S0NA 2ZDLA 3RXAA 3F9FA 4F4OC 3ZVGA 1EUFA 1GVZA 1TNHA 2ZGJA 3A82A 2R0LA 3SGQE 1HAOH 5C20A 2VIPA 1H9IE 1ANCA 1YPHE 3NZIA 1O2KA 4CBNA 2GMTC 3A83A 5FCKA 3UOUA 1Z71A 2C4FH 1EJMA 1QBVH 1SC8U 2R3YA 1N1LA 3M35A 3BTME 4CRBA 1NRSH 2AS9A 2VNTA 3BTEE 1GG6B 4DGJA 3F68H 1BRBE 1FONA 1GHBF 4RN6A 4I8GA 4FUJA 4AFSA 1FIZA 4KTUA 4MLFB 3RXQA 1ANEA 4GCHG 3W94A 4YOGA 4I31A 1A2CH 2BM2A 5AF9H 3BEIB 4LZ1H 4X6PA 2G5VA 3OY6U 5ETXA 3SGAE 1ZLRA 2J38A 3TIUA 2A2XH 1EB2A 2WPIS 3LGVA 1E34B 1W0ZU 1DSTA 4R8TB 2GCTC 3B9FH 2GCHF 4O97A 1OP0A 1LVYA 1EXFA 1YBWA 4MPWA 4MQAA 1F0SA 1C4U2 2ZGBH 3A84A 1C5PA 2QXHA 4X1PU 6GCHF 4Y0YE 2XBVA 1TRNA 1SGFG 2R2MB 6LPRA 4GHTA 2WYJA 3RC4A 1V2OT 5FPYA 1WQSA 2H6MA 1C5RA 4J1YA 1G3BA 2BLQA 2ZFTA 1LHFH 2JH5D 3W95A 1MQ5A 2VU8E 3T29A 3SNCA 1GMHF 1TX6A 2K1QA 1QL7A 1F92A 2IJOB 1A5HA 1BMLA 1P11E 5DP5A 2G51A 1O2GH 1GDQA 1LTOA 1MCVA 2QF3A 1ZPCA 4XSKU 3D62A 1V2JT 2XC0A 1TONA 4O9VA 3TLOA 1C1SA 2PTNA 1EZQA 2BD5A 4O3TA 1Z6JH 1P57B 2FLBH 1W7XH 4ZXYH 4MNXA 1QB9A 1L1NA 3M7QA 4Y8YA 2EI7A 3HPTB 1A3EH 1C2LA 5C2ZA 4CHAC 3S9BA 5EW1H 1W10U 1Y5BT 3M7TA 4ZHLU 2A7JA 2ZU4A 3EDXB 1CT2E 3ELAH 1K28D 1H1BA 1TNIA 4WWYA 3SUEA 2HRVA 3BV9B 1IQHA 3K2UA 2ULLA 1LHGH 1XX9A 1YCPK 2BYAX 4DY7B 3LJJA 4ABFA 1CT4E 1MKWK 2FODA 3EQ0H 1XUGA 1C2IA 1XUKA 2AGGX 1SOZA 1O30A 1QRWA 3RXMA 2D8WA 3TNSA 1DXWA 1KDQA 4LZ4B 1AQ7A 2FDAA 4WH6A 5T6FA 4GPGA 2F9NA 1BB0B 1XUFA 2STBE 4OS5A 2IN2A 2G55A 3KF2A 1ZSKA 5JYIA 5F03A 2XBWA 2CN0H 2QGRA 1MTSA 1SMFE 2PTCE 4NWKA 1Y3XA 2BVRH 1O2UA 1EOJA 1C2JA 2ZEBA 1BUIA 1CGIE 2Z3DA 1XXDA 4Q2KA 3ZVEA 2WPJS 1V2ST 2QV1A 3UNRA 2ODQA 2BD2A 2ALVA 3E8LA 1Z8IB 1GBAA 1LHCH 3PYHA 4YZUA 4DIHH 3IWMA 3ODFA 6CHAC 2EI6A 2VVVA 1GBBA 3MU0A 1DSUA 2AMQA 4U32A 2M5TA 2B5TB 1D3DB 3BSQA 1VJ9U 2A4GA 3OTJE 7LPRA 1J8AA 1YPLH 1EOLA 1O33A 4DT7B 4ZHAA 1C9PA 1NZQH 3D23A 1BTXA 2GP9B 1T8OA 3GY3A 4I7YH 1P2OA 1VZQH 1FY5A 1D6RA 1KTSB 2FYQA 2G4UA 3T62A 1TX7A 2P8OC 1O2LA 1O5BB 1SQTA 2CXVA 2ASUB 3TK5A 3PWCA 1S6FA 2ZHWH 2ESTE 3P95A 2JH0D 2FOBA 3ZVDA 3ZZ3A 2QY0B 4X2VA 3SOSA 1YPKH 1HYLA 1AVWA 2B0FA 1C5SA 3HATH 1P01A 1GBDA 1UO6A 2FO9A 1TGTA 1LVMA 3BG8A 2SGFE 4ABEA 3I78A 2HNTC 3A8BA 4B2CA 1ZTJA 2FP7B 1BDAA 1BRUP 2YNBA 1JWTA 1HAHH 1NC6A 3R3GB 1L1GA 3LKWA 1VJAU 5DPAA 1FLEE 5A8ZA 1TMTH 3E16B 4GCHF 1ARCA 2SGQE 2J95A 2Z3EA 3UFAA 1PYTC 1TNKA 3V13A 1NFYA 1JXPA 3TPIZ 2P3UB 1SBWA 1AFEH 4B1TA 4CH8B 3IITA 1JOUB 4JZEH 1Y3VA 2BOKA 1ELCA 4GAWA 3VB7A 1LMWB 1MMJN 1UCYK 3PWBA 4SGBE 1WTHD 2O8UA 3SV8A 1C1WH 2Z7FE 1EP6A 1MTNC 2ZPSA 1SGNE 1GDNA 1TALA 1THPB 1P09A 1WAYB 3M3SA 4NA8A 5T3HA 4U2WA 3SGBE 4BTTB 1G37A 2H9EH 4WMDA 1O3JA 2P3FH 3H5CB 1E0FD 1TA6A 1O5FH 2BOHB 4M7GA 2Y5FA 1S83A 1O2MA 1C5NH 4NWLA 1MBQA 4FU7A 1KYNA 5E2PA 1A5GH 1GBEA 3RXEA 1BCUH 4YOJA 2Y82A 1TLDA 4TWWA 1JIRA 2PKSB 1OWJA 1SVPA 1CBWC 3GYLB 1IQKA 1ANDA 1ELAA 2QIQA 3MTYA 4ISOA 2Q1JA 1AE8H 2BX4A 2CF9H 2ZDNA 3RXUA 1YCPH 3MNBA 1OWKA 5C1UA 3SU4A 3TK6A 5C1XA 1JRTA 1CHOF 1J15A 1MKWH 1LHDH 5C3NA 1GI1A 2A31A 1DOJA 3O8RA 3SUDA 3VB6A 1QIXB 1AHTH 2D1JA 5AFZH 1SI5H 1DFPA 3TH4H 2A45B 1G3EA 4HZHA 1C2GA 1MTNB 2KAIB 1A1RA 1P10A 5SGAE 2O9QA 1F0TA 5EGMA 1V2NT 1HXEH 1O2SA 1FAXA 1ZHRA 5F8ZA 3U98H 4AG1A 5L2ZH 1KLJH 1TE0A 1XM1A 1D9IA 1MCTA 1UHBA 4B76A 1DXPA 4FXGH 5LGOA 4XBBA 1MZAA 3AAVA 1GI5A 1ZPZA 3Q77A 5LPEA 4BANB 2I6SA 3E6PH 3UWJH 1YLDA 2VIVA 4D8NA 3FAOA 3NWUA 4GHQA 2J34A 3EE0B 1P2NA 1J17T 2GDDA 1SHYA 2SGAA 3AASA 5EQSA 4TPYA 2QN5T 4Q80A 4OS2A 4A6LA 3SI4H 1GBLA 4XOJA 3DFLA 4K69A 5EXNA 4UFDH 3SUGA 2OC7A 4VGCB 1HJAB 2ZO3H 2BQ6B 4ISIH 4ZHMU 2ZU2A 4LXBH 4Y76A 1TABE 1TQ7B 1TX8A 1V2QT 2DE9A 1K1PA 2F9VA 3EA7A 3P6ZB 2HALA 2O8WA 2TGAA 3ZZ4A 1SGPE 1OWIA 1GJBB 3MU8A 3DHKH 1Z8JB 4A1XA 1C2MA 1C4Y2 2BLWA 4KELA 2RCEA 3KHVA 1GJ9B 1GBJA 2BD4A 1TYNA 2ZF0H 3M3VA 3UY9A 3NKKA 4A5TS 5HMAA 3VXFH 1O2ZA 2XRCA 2O8LA 1O5EH 4AN7A 4YT7H 3A88A 2QF0A 3FFGA 5JB8S 1J16A 1SOTA 3Q00A 4AFQA 1NRPH 2JH6D 3Q3YA 5L6NH 3SJKA 1B7XB 1SFQB 2ZCHP 1O3NA 1O2IA 5C67A 3GY5A 1UTOA 1UCYE 1W2KH 2P59A 3F9GA 2EI8A 3SNBA 1SGFA 1IQMA 3S9CA 2BVSH 1MTWA 3NUMA 2JETB 3D65E 1SGDE 1P2QA 1EASA 1UVUH 1QY6A 3TNTA 1UCYH 4FUGA 2AMPA 3PO1B 1P9SA 5HM9A 1ZMJA 4MDSA 2ZDAH 3P8OA 1PPGE 1GVLA 3MWIU 1JRSA 2D2DA 1GJ8B 3SNDA 2FOGA 4AOQA 4UONA 1C2EA 1C5LH 3VB5A 3A8DA 1UHBB 1GPZA 1SGYE 1HB0B 4ZAEA 3URCA 1AB9B 5JDUB 2QC2A 5GJ4B 1HAPH 3GCHC 1CE5A 1RTKA 3UNQA 2PSYA 3NXPA 3RXPA 1W11U 2SNWA 1FY8E 4CBOA 4OS7A 4X8UH 1ZJDA 3M3TA 5HXFA 5I25A 3VGCB 2P94A 3MU1A 1ETSH 1IOEA 2GKVE 2FX4A 1GJ6A 4I8HA 1D3QB 1ELBA 5GCHG 1SB1H 3V7TA 1Y3WA 4ZMAH 1YPJH 1EAXA 2LPRA 3UIRA 1AKSB 1RTFB 4YESB 1OSSA 2Z9IA 3RU4T 1L1JA 4AYYB 3ATKA 2OC1A 1MD7A 2SGPE 3FP8E 4A1TA 1SHHB 1C1TA 1IQGA 5L2YH 1SGQE 3BTDE 1DY8A 1C5ZB 1MQ6A 3SBKA 4O03A 2Y80A 1VR1H 3KGPA 2FS8A 1V6DA 3MH4A 1FIWA 1KXCA 2I6QA 3SU3A 5FPTA 4TYDA 4UEHH 2QYIA 3ODDA 2EEKA 3PTBA 1DICA 3RMMH 2XXLA 3SQEE 2XCNA 2FTMA 1GJ5H 3RP2A 5C1YA 2FTLE 3MO3A 1GG6C 3GY6A 1O3OA 2H5CA 1QR3E 3DA9B 1DM4B 5DJ7A 4B73A 3MI4A 5DO4H 1C5OH 3GY8A 2SFAA 1Z8RA 1P02A 1KXBA 1DPOA 4YT6H 4UFFH 5EQQA 1O2TA 2A5AA 2GV7A 4NIWA 3URDA 1KLIH 1NESE 3EYDA 1WYKA 1FUJA 3M61U 1AZ8A 4ISHH 1C1MA 1C5MD 1CA8B 3ZVAA 2HGTH 1GGDB 2UWPA 3U8OH 1OWDA 4XBDA 1BMAA 1UTPA 1ZPBA 2A32A 2EA3A 2PUQH 2A1DB 3A86A 3ITIA 4ASHA 2EC9H 1K1MA 1C5TA 3GDUA 4KKDA 2H5DA 3SJ8A 2Z9LA 2Q6GA 4I8LA 5DG6A 4ABAA 4NIYA 1HRTH 1N6XA 1UVSH 3O8BA 3PMAB 5GDSH 1V2KT 1FAKH 4NGAH 2HOBA 2ZC9H 1MAXA 2OQ5A 1GBMA 2WPKS 1WUNH 1BRAA 1NS3A 1E38B 1AE5A 2ZFFH 4IW4E 1UTNA 1O2WA 2RA3A 3QTVH 2WYGA 1O37A 4GSOA 1L4ZA 3U1JB 2A7HA 3N7OA 3JZ1B 1CSOE 2A4RA 3BEFB 2ZA5A 1M9UA 2B7DH 3GDVA 1SFIA 1RFNA 3GY4A 3BTHE 1H9HE 1K1JA 1KXFA 1ZTLA 3PMHB 3RC6A 3P17H 4ZKOU 2FI5E 5A0BA 4FU8A 1BMNH 4WVPE 1X7AC 2HVXA 2VWOA 1F7ZA 2RDLA 1P9UA 1ZR0A 1A4WH 4FUCA 1AO5A 3ATMA 2BDAA 2BD3A 3WY8A 2ZP0H 8LPRA 4DIIH 3BTTE 1Y5AT 1LCYA 2BDGA 1ZMNA 1NFWA 2A5IA 5CHAB 1OWHA 2VIOA 4BAMB 1GCDA 2ZHDA 3SO3A 3PV4A 2R9PA 4NG9H 3O8CA 1YPGH 1QA7A 1O3BA 3L6PA 4ABDA 1LPGB 4Y79A 3SU6A 3DD2H 2O8MA 4U01A 3A7WA 1KY9A 3ATIA 5CE1A 1W13U 1TWXB 5E0GA 3MO9A 3OY5U 1SLWB 1W7GH 1AUJA 1AU8A 3LJOA 2ZU3A 4X6NA 2FOEA 5FHTA 7GCHG 1CGHA 1AI8H 2BXTH 5IDKA 4Y11E 4K8YA 1XKBC 2THFB 1XVOA 1S82A 4OS6A 3ZYDA 1HV7A 2ZCLP 4MG3A 5E0HA 2F9PA 1TNLA 3BTFE 5DP3A 5GCHF 1K22H 2BD9A 1TAWA 4CRGA 3BIUH 4U30A 2QCYA 3AAUA 5BRRE 3TGKE 1PPEE 2OTVA 4IN2A 2VINA 1J14A 5T6GA 1INCA 3ATLA 4JCNA 1VCQA 3UREA 1B0FA 5TCCA 2QXGA 3NPSA 3R0FA 4OS4A 3SJ9A 1A0JA 3Q3KA 1FY1A 4BXWA 2GTBA 1AMHA 1QHRB 3MU4A 3F9HA 2XWAA 3RXRA 3RMNH 2OUAA 1SGCA 5JBTA 2ANWA 3UOPA 3KL6A 3GY2A 1H9LB 4K1EA 4Z0KA 3RXGA 4IMQA 3V3MA 4HI3A 4YM9A 3NK8A 1D3TB 2R0KA 1MTVA 3ZVBA 1PPHE 1O5AB 5A09A 5IYTA 1N6YA 1NRQH 4X2XA 1O5DH 2XBXA 1FJSA 3GOVB 2GT8A 2PHBA 3ZZ9A 2ZGCA 3UWIA 2B9LA 3F6UH 1GBHA 3ZVFA 1C1VH 4GUXA 3A7VA 2FLRH 3KQCA 3RXDA 4X1NU 1LKBA 3RM2H 1GCTB 2AFQB 1MZDA 2KAIA 1UTJA 2AIQA 4WXVA 1O3GA 4NIXA 1O2QA 4RSPA 4CREA 2BD8A 4NZLA 1BOQA 4DJZB 5E8EH 3KCGH 1AD8H 1QFKH 2A7CA 1D3PB 2H9HA 1P2IA 4ZKSU 4FUIA 3M5LA 1O2NA 4WF8A 3STJA 3BIVH 1GJAB 1H8DH 4NZQA 1GBFA 4X6OA 2C8YB 3TJNA 2V3HH 5A0AE 1EB1H 2Z9GA 4XE4A 2ZG0H 3MNCA 4JMYA 5A8YA 3LOXA 3OSYA 1C5UA 4INHA 1AGJA 3SUFA 3ZZAA 1O2OA 1LHEH 4WXIA 2GT7A 1O2PA 3E3TA 2CHAB 1WV7H 3RXVA 2WUBA 3S9AA 1A0HB 1QJ1B 2PKSC 3PLPA 1IQNA 1N8OB 2OQUA 3SNAA 1BT7A 5AFYH 4TY7A 1MBMA 3L33A 3QK1A 3I77A 1ZGVA 5FBEA 2AMDA 1UVPA 1UTLM 5DGJA 4DW2U 1LVBA 1UVOA 3HKJB 1O3HA 1OOKB 2VWLA 4AZ2B 5EOKA 3A80A 1Q3XA 3LGTA 5GXPA 3LC3A 1DY9A 4J2YB 2ODYB 4BTUB 1QNJA 1EZSC 2PUXB 1O2JA 1PPCE 2FOAA 5LH8A 3KEEA 2H2ZA 5I46H 3HKIB 1ACBE 1VGCB 4BXSA 4JYVH 4ISLA 3RXFA 4KTSA 4NIVA 3JZ2B 1CA0B 3A7ZA 3EA9A 3QLPH 1ZSJA 2IPHA 1T8MA 1YPHC 2R2WU 3P8GA 3RDZA 3STIA 1AWFH 1IQFA 6ESTA 1PFXC 2AERH 1PQAA 2NU1E 3GCTG 4ABGA 4A1VA 5GWZA 3ATWA 2QXIA 2P16A 1ABJH 1MD8A 4ZKNU 4ZKRU 1ZZZA 1EJAA 4FU9A 2YOLA 1DDJA 4NFFA 3UTUH 4K2YA 1YPMH 4A7IB 1UMAH 2TGTA 1QBOA 2RG3A 1MU8B 4DVAU 1HAXB 2BQ7B 3MNSA 2DE8A 4JYTA 3KQBA 3ESTA 2UWOA 5EG4A 1CHGA 2ZZUH 4VGCC 1HJAC 8GCHG 3TH3H 1CT0E 7GCHF 2A2QH 1P04A 9ESTA 1ESTA 3LONA 1FY4A 1GHAG 2OBOA 5EW2H 3E91A 1AFQB 5K0HA 4INLA 2HWLB 5EPYA 1S85A 2BDCA 4WH8A 3RXBA 3BEUA 4Q7ZA 3V12A 2NU4E 4ABHA 1HIAB 3K9XB 1DX5M 1OS8A 3U8RH 1EKBB 2UUJB 3GISB 1GWAA 4INKA 2TBSA 2VJ1A 1QB1A 2OCVB 1DLKB 1K1LA 1VITH 1LKAA 1LQEA 1YYY1 2NU3E 1O5GH 3LGWA 1QTFA 1WSSH 1FNIA 3GYMA 2TIOA 3RM0H 3E0PB 1THSH 2PV9B 4PROA 4X1QU 2ZGXH 2CMYA 1EQ9A 1KXAA 2OP9A 2QAAA 5C5NA 1AN1E 5HYOA 4FUFA 1ABIH 4X8VH 4DOQA 3VB4A 1IHSH 1O3MA 4YLQH 1AKSA 1PYTD 1YPEH 3CS7A 1C1UH 1HAGE 1Z8GA 3ZZDA 4H4FA 2G8TA 1NO9H 4H42U 1S5SA 2JETC 1C1QA 1O3AA 1EZUC 2ZPRA 3TJUA 2V6NA 2F9BH 1P2KA 2ZFSA 1HAZB 2PR3A 2ZFQH 3PO1C 1UTMA 2ZFPH 4B75A 2GZ9A 1BHXB 1G3CA 2ODPA 3RU4D 3A7YA 1DWDH 2FOHA 2VIDA 4CR5A 3LH3A 4K5ZA 2PFEA 1PQ8A 1MU6B 3I29A 1GL0E 4FUHA 1FN8A 1GMCG 1AB9C 1SQOA 2VVCA 1BITA 4AFUA 4Y8XA 4BAHB 1ZHMA 1TGBA 1LDTT 1OPHB 1GHBG 3RXOA 1O2YA 1HJ9A 1BMMH 3PTNA 4BAQB 2BHGA 3M37A 3SZNA 2C93B 1QURH 1NT1A 1SLVB 3A7TA 3VGCC 1GI7B 1HNEE 2AEIH 3MMGA 1FDPA 1GHVH 1Z1IA 3TJVA 3SV6A 1UK3A 2BY6X 1NTPA 2XBYA 1MUEB 1ELGA 3E0NB 1ESAA 2CJIA 1O3IA 5FCRA 3SV9A 2A4QA 4TWYA 5DP4A 5E2OA 1YM0A 1NRRH 1KXEA 2ANYA 3SU5A 1ELTA 3PB1E 3RXTA 1GVKB 1O2RA 1O39A 2PW8H 1C1RA 1O3PB 1RIWB 1ZSLA 1YC0A 3SV7A 2YNAA 1O31A 3DUXH 1YLCA 3Q76A 4DCDA 1V2PT 1LQDB 3BTQE 2ZTYA 2HPPH 1TBQH 1Y3UA 4IBLH 1P0SH 1IAUA 1C5QA 1ZYOA 1WTGH 1G9IE 2WV4A 4FUDA 1TRYA 1ZRKA 5FX5A 5LPFA 1NFUA 4X2YA 4K8BA 2FEQH 1EPTB 2FI4E 3GCOA 5TCAA 3U1IB 1EAIA 1SGIB 1O3EA 1ZMLA 1BTPA 3BTGE 1TMBH 4X6MA 1E37B 3ZVCA 1DT2A 1GBTA 2ZECA 3QTOH 1C1PA 5DK1A 8ESTE 3BTWE 1BTYA 2ZFRH 1XVMA 4RKJB 1G3DA 3GCTF 1C2HA 1QQUA 2BVXH 2ZU1A 1DUAA 2OC8A 1PPFE 2ANKH 2Y81A 1O2HA 2BY9X 4UE7H 1EZXC 1NU7B 2ZIQH 4WMFA 1HFDA 4AG2A 1O3KA 3M7UA 3TGJE 1GGDC 5F6MA 2A5KA 3FANA 1P2JA 3TGIE 1Q2WA 1FY3A 2ZHQH 4BAOB 1C5XB 3QO6A 4JZFH 3ZZ6A 2G52A 4Y7AA 5BPEA 4D7GA 3SHAH 1GI9B 1PQ5A 2W7SA 4K1TA 1GDUA 3SQHE 1KTTB 1K21H 8KME2 4IMZA 2C3SA 1O0DH 1C9TA 1V2UT 3ZZCA
chains in the Genus database with same CATH superfamily
2F83A 1QJ6B 4X1SU 2NU0E 1P03A 1GHAF 4X8SH 2BZAA 2FMJA 1V3XA 1NFXA 3GS9A 4HFPB 4MVNA 4AFZA 4K1SA 1SLXB 2VGCB 2WINI 4AX9H 4D76A 2XW9A 1KLTA 2VWNA 4MPVA 2M2AA 2OBQA 4TY6A 3QN7A 2STAE 4I86A 2PKAB 4WY3A 4Y0ZE 3SU2A 1QZ8A 2JIZD 1BQYA 3FOAA 1ID5H 2ZDKA 1D4PB 2FESH 2FOCA 1UVTH 1E36B 1FPCH 1K2I1 2J98A 1DS2E 2V3OH 3QGNB 4MNVA 5AVDA 3F2GA 4F49A 2CV3A 3H7TA 1GJDB 2WSSD 3AVZA 2HNTE 1UTQA 1BTHH 3ZZBA 1WOFA 3SU0A 1FI8A 2QA9E 2ZHFH 2ZTXA 5FXLA 2HPQH 4JZDH 5JPMH 1EFRD 3QX5H 2IPQX 1XXFA 1C1NA 4B6FA 3U8TH 2FPZA 4NA7A 1UK4A 1TA2A 2FX6A 2BTCE 2BB4A 2NU2E 2ZI2H 4BTIB 2ZQ1A 3VXEH 4CRDA 3D49H 2FIRH 3TU7H 5GPIB 1YGCH 4Z6AH 4Y6DA 1NRNH 1QL8A 5F8TA 3TJOA 2F4LA 1AVXA 3PMBB 2OXSA 1T4VH 2VB0A 4Q4LA 4D9QA 1S0QA 3F0PA 2UUKB 4P02A 3CENA 5CHAC 1ELDE 4Q7XA 3RU4E 1GJ7B 1TPSA 2QF4A 4I8JA 2AIPA 1AUTC 2Z6BD 2BX3A 1TGSZ 2SNVA 4MTBA 2W3KA 5A8XA 2ILNA 3T28A 1HAVB 1XKAC 1BTWA 1FQ3A 3K6YA 1T8NA 1GMCF 1HBTH 1HLTH 2PGBB 2XNIA 2VVUA 1G30B 1QCPA 1Z6EA 1RXPA 2ZHEH 1NROH 2BQWB 2G81E 5HGGA 2LP6A 3GDSA 1DVAH 3S7KB 5A0CA 2F9OA 4CRFA 4K60A 1QQ4A 3U9AH 1QL9A 3RLWH 3LU9B 1A61H 1T8LA 3RXIA 1JIMA 3RXHA 4AGJA 1TPOA 1O5CB 3KNXA 4KGAA 1A7SA 3SU1A 3ENSB 3UR9A 2BDIA 1GI8B 3KQEA 4RKOB 5B6OA 3T27A 1H4WA 1C5VA 1O3CA 1Y8TA 3UUZA 1FN6A 1P06A 3PM3A 2FM2A 4NSYA 4ABJA 5GIBA 1NN6A 3S7HB 1F5LA 2OINA 2DUCA 4IN1A 1BIOA 1SG8B 3SORA 2FYRA 4X0WU 2W5EA 4KTCA 4X2WA 5ABWA 4AGKA 2GMTB 1ZHPA 2CF8H 1BHXF 1DITH 3EAJA 1S0RA 3MFJA 5G4BA 1AZZA 1A46H 2ZGHA 2Y7XA 2WV5A 1BBRK 1P3EA 1MAYA 1TMUH 1HDTH 3TK9A 1B5GH 2JKHA 2TGDA 1TGNA 1QBNA 3PLBA 3EA8A 1O38A 3RXCA 4D7FA 4BOHA 1O2XA 2J92A 3RXJA 2PP6A 2J94A 1DE7H 2Y6TA 1OP8A 1DWBH 3LPRA 1H8HD 2FXRA 1O3LA 1AY6H 4H6TA 1FPHH 3P8FA 1TPPA 3LGIA 1RJXB 1JMOH 1RRKA 2G4TA 2GCTB 2RA0A 4AB8A 1UJ1A 1B0EA 2G00A 9LPRA 1ARBA 1CHOG 1EP5A 3E1XB 1GCTC 1NY22 2BXUH 3ZZ7A 3SV2H 3RXLA 1EAWA 2BLOA 1Z7KA 3BN9A 2HLCA 1VITG 1MH0A 2GZ7A 2BY8X 1TB6H 1C4V2 1KXDA 1OYQA 5DSFA 2B8OH 2WPMS 4OS1A 4Y7BA 4GVUA 2ZWLH 2ZQ2A 3ZZ8A 4SGAE 2A0QB 2UUYA 2XC5A 3PROA 5DP8A 1P2MA 4ZXXH 1IQIA 1CO7E 3UQVA 3L3TA 2GDEH 7ESTE 1DWEH 3CP7A 4XDEA 1TQ0B 1KSNA 1FV9A 1WBGB 2NWNA 1A3BH 1V2RT 2CHAC 2W26A 5J4SA 3M5MA 3Q3XA 2D26C 2VBCA 1C2FA 4FUEA 3QZQA 3P92A 2J4IA 3KQDA 4AB9A 1CVWH 2ZDMA 1VCPA 3FZDA 4Q7YA 1W3CA 2Q6DA 3G01A 1N8OC 2ALPA 3SNEA 3RC5A 2F91A 2WPHS 3RXKA 3FVFB 1E35B 3T2NA 4CHAB 3MYWA 1ETRH 2PLXA 1V2MT 4FOUC 1G2MA 5EXMA 4BNRA 1L4DA 2IOTA 2ZCKP 1QRXA 3LIWA 1GBIA 3HK3B 1O35A 2HVYB 3PRDA 5PTPA 1GI4A 1HIAA 1BJVA 3EE7A 2Z9KA 3QUMP 1K1NA 3OTPA 1W0JD 3GCNA 1YCPM 1VGCC 1MKXK 1UTKA 1OWEA 2FOMB 4UD9H 2W7UA 1GBKA 1GL1A 1CA0C 3P8NA 3TVJB 3S69A 2AGEX 3F9EA 3MU5A 3NCLA 1IQJA 1O3FA 5ESBA 2JDID 1Z1JA 3K65B 4X8TH 1V2WT 3KIDU 5L30H 4NCYA 2Z3CA 1O3DA 3A8CA 2VIQA 1TIOA 4KP0A 2P93A 2C8XB 2R3UA 1NU9A 2VIWA 3WW7A 5T6DA 4MNYA 4YXWD 1O36A 2L74A 1PPZA 1GBCA 1L0ZA 6CHAB 1T32A 3FP6E 5JBAS 1GHXH 1NM6A 3QDZB 1AFQC 3HK6B 1GI3A 4CRCA 1ZRBA 2QXJA 2P3TB 2Y5GA 4D9RA 1V2LT 5HKKD 1BBRE 2KR7A 1FXYA 3SN8A 5DP6A 1QA0A 2CGAA 5FAHA 1F0RA 3RXSA 4UDWH 2OLGA 4X1RU 2BY7X 2LELA 4ZH8A 3AW0A 4IGDA 2P8OB 1WU1A 2Q6FA 1BBRH 3P70B 2WPLS 1KDQB 3ZV9A 2FI3E 4K3JA 1SGEE 1U6QA 3IG6B 5FX6A 1XUIA 3OYPA 2WZQA 2H1UA 3PMJA 3HGNA 2SGDE 4YO9A 4O3UA 3B23B 3RLYH 5K7RA 1NBMD 3ZYEA 3SJIA 3FKSD 3QWCH 4Q63A 2GV6A 5H4IB 3RMLH 3T26A 4ABIA 1THRH 2P95A 3GICB 1AIXH 1FZZA 1F5KU 3MQKC 1DWCH 5ESTE 5KEDA 1SLUB 5EXLA 4E7RG 3A7XA 2V0BA 1XUJA 1D6WA 1RD3B 1C5WB 1W14U 4Y10E 4H6SB 3UPEA 2F3CE 4OGXA 3N7DA 1OP2A 4YLUA 1XMNB 1QJ7B 3T25A 1UW7A 5EODA 1RGQA 3C1KA 5HIYA 1L2EA 2AGIX 1BZXE 4XFQA 2UWLA 1NPMA 2ZTZA 5DP7A 2C8ZB 1F5RA 1TFXA 4MPUA 3AW1A 3UNSA 1PQ7A 3LDXH 5F8XA 2H9TH 1P05A 1EPTA 4DURA 2FWWA 3QZRA 2K0QA 1TGCA 4FUBA 4OGYA 4CR9A 1V2VT 2PWXA 5T1VA 1VITF 1SR5C 4WJG2 2BDYA 5EPNA 1QRZA 4CH2B 2AH4X 4Y8ZA 2IJD1 1RTLA 1SQAA 3T5FH 1W0YH 1AVGH 2GX4A 2GD4B 3LGYA 2Z9JA 2PGQB 4MPXA 3A89A 3O8DA 3A87A 2BDBA 1TBZH 1GMDG 3V0XA 4LOYH 1HXFH 4YOIA 1OYTH 3M5OA 3VFEA 1HAYB 3FO8D 1HGTH 1ETTH 4ISNA 3SHCH 1H8IH 2ZNKH 3MH5A 4QT8C 1XUHA 5DKMA 1ELFA 1CBWB 2VWMA 1TOCB 1JBUH 3DT0H 5CMXH 3ZV8A 2ZU5A 1Q31A 1HPGA 1YF4A 2L6OA 2C8WB 2XC4A 1LPZB 1RIWC 2Y7ZA 5JB9S 2BY5X 4B2AA 2A4OA 1CGJE 3ZZ5A 4IC5A 1MKXH 3A8AA 1IQLA 1OKXA 1SSXA 3HGPA 3KN2A 1Y3YA 2ANMH 1S81A 2PSXA 1PJPA 1C1OA 1DLEA 2WV9A 4I33A 2PKAA 1HCGA 1SL3A 1EPTC 1T31A 1DUEA 1P12E 2BZ6H 4ZUHA 2BMGB 4B6EA 1C5YB 4IC6A 5AHGH 1GI0A 5TJXA 4TPIZ 3SJOA 1C2KA 2W3IA 2TGPZ 4HTCH 2RFKC 1WCZA 1A0LA 1BJUA 3A81A 3OEED 1P8VC 1G32B 1Y5UT 1LPKB 1T4UH 4THNH 1FMGA 4XBCA 5FPSA 1KIGH 4MNWA 2TPIZ 2GCHG 1C2DA 4R0IA 2SGEE 1DANH 1QGFA 5LPRA 1Y59T 5JBCS 1F2SE 3OX7U 2J9NA 3M5NA 4NFEA 4B2BA 1EX3A 1T7CA 2C90B 1K1IA 3DFJA 4YTAA 2ZDVH 6GCHG 1TRMA 1LVOA 3MNXA 4NSVA 4ZROA 4B71A 1ANBA 1ELVA 3BF6H 3B8JA 2XTTB 4JK5A 5JBBS 3VPKA 2FZZA 4GLYA 3OU0A 3WWFA 3E90B 1IQEA 1BTUA 1K9OE 1TOMH 1GI2A 2GZ8A 3M36A 3SW2B 4XD7D 3TITA 3LT3A 5FBIA 1HJ8A 1ORFA 1ESBA 4E05H 3FP7E 5EU8A 1ZTKA 1GMHG 2VGCC 1O32A 3LH1A 2BD7A 2LNCA 4AYVB 1K1OA 2OD3B 1MTUA 1FX0B 2G5NA 2VH6A 2Z94A 1SGTA 3MO6A 4E06H 4BAKB 1HAVA 1SPJA 4IS5A 3PLKA 2XYAA 2XWBI 4NA9H 4AORA 4ABBA 3K6ZA 1S84A 4JZIA 3SI3H 1HAIH 2OC0A 4B74A 1VCWA 4LK4A 5A2MH 1G2LA 2YMSB 2AHME 2WUCA 3MOCA 3UR6A 5EQRA 1EJNA 1NBME 3GY7A 1EATA 1GHZA 3F1SB 3TH2H 2ZPQA 1W8BH 3MH7A 2GVFA 1BA8B 4UFGH 2GGVB 3C27B 1GI6A 2ZKSA 8GCHF 4JK6A 3LGUA 1GHYH 1A5IA 3RUOA 2XCFA 1TPAE 4DG4A 3BG4C 1GJCB 3A85A 4JYUH 1RS0A 1ZOMA 2AYWA 4HGCA 5HM2A 4UFEH 1HUTH 3BTKE 3MHWU 2UUFB 1CU1A 1GJ4H 3CS0A 4FVDA 5J4QA 2BLVA 1W12U 2O8TA 1K0HA 1S6HA 1SGRE 1YKTA 1TNGA 2FS9A 3MH6A 4WMEA 1EAUA 5C5OA 1IHTH 4FVBA 1OX1A 1QB6A 2F9UA 3FZZA 1F0UA 5E0JA 3GCHB 3RMOH 2TRMA 3QGJA 3VB3A 1YP9A 2V35A 1WQVH 3H7OA 1O34A 4JZ1A 1CQQA 4A92A 5KECA 5DP9A 4I32A 7KMEH 1TNJA 1MABB 3VEQB 1P3CA 1TBRH 3EGKH 4CRAA 1BRCE 1J9CH 4E7NA 1OXGA 1ZGIA 1GMDF 2J2UA 1BTZA 4I8KA 1LO6A 2KCPA 2FOFA 1ELEE 2VH0A 1GHWH 1WXRA 1ZJKA 4Y71A 1AWHB 3UQOA 3LC5A 3BG4B 3U69H 2BDHA 2Y5HA 4ESTE 2HNTF 1PPBH 3UB0A 1O2VA 1G36A 1UK2A 1V2TT 3S0NA 2ZDLA 3RXAA 3F9FA 4F4OC 3ZVGA 1EUFA 1GVZA 1TNHA 2ZGJA 3A82A 2R0LA 3SGQE 1HAOH 5C20A 2VIPA 1H9IE 1ANCA 1YPHE 3NZIA 1O2KA 4CBNA 2GMTC 3A83A 5FCKA 3UOUA 1Z71A 2C4FH 1EJMA 1QBVH 1SC8U 2R3YA 1N1LA 3M35A 3BTME 4CRBA 1NRSH 2AS9A 2VNTA 3BTEE 1GG6B 4DGJA 3F68H 1BRBE 1FONA 1GHBF 4RN6A 4I8GA 4FUJA 4AFSA 1FIZA 4KTUA 4MLFB 3RXQA 1ANEA 3SZEA 4GCHG 3W94A 4YOGA 4I31A 1A2CH 2BM2A 5AF9H 3BEIB 4LZ1H 4X6PA 2G5VA 2XOKD 3OY6U 5ETXA 3SGAE 1ZLRA 2J38A 3TIUA 2A2XH 2JJ2D 1EB2A 2WPIS 3LGVA 1E34B 1W0ZU 1DSTA 4R8TB 2GCTC 3B9FH 2GCHF 4O97A 1OP0A 5B6LA 2V7QD 1LVYA 1EXFA 1YBWA 4MPWA 4MQAA 3AK5A 1F0SA 1C4U2 2ZGBH 3A84A 1C5PA 2QXHA 4X1PU 6GCHF 4Y0YE 1E1RD 2XBVA 1TRNA 1SGFG 2R2MB 6LPRA 2KCOA 4GHTA 2WYJA 3RC4A 5HIZA 1V2OT 5FPYA 1WQSA 2H6MA 1C5RA 4J1YA 1G3BA 2BLQA 2ZFTA 1LHFH 2JH5D 3W95A 1MQ5A 2VU8E 3T29A 3SNCA 2KCYA 1GMHF 1TX6A 2K1QA 1QL7A 1F92A 2IJOB 1A5HA 1BMLA 1P11E 5DP5A 2G51A 1O2GH 1GDQA 1LTOA 1MCVA 2QF3A 1ZPCA 4XSKU 3D62A 1V2JT 2XC0A 1TONA 4O9VA 3TLOA 1C1SA 2PTNA 1EZQA 1VKYA 2BD5A 4O3TA 1Z6JH 1P57B 2FLBH 1W7XH 4ZXYH 4MNXA 1QB9A 1L1NA 3M7QA 4Y8YA 2EI7A 3HPTB 1A3EH 1C2LA 1E79D 5C2ZA 4CHAC 3S9BA 5EW1H 1W10U 1Y5BT 4AC9A 3M7TA 4ZHLU 2A7JA 2ZU4A 3EDXB 1CT2E 3ELAH 1K28D 1H1BA 1TNIA 4WWYA 3SUEA 2HRVA 3BV9B 1IQHA 3K2UA 2ULLA 1LHGH 1XX9A 3N99A 1YCPK 2BYAX 4DY7B 3LJJA 2HLDD 4ABFA 1CT4E 1MKWK 2FODA 3EQ0H 1XUGA 1C2IA 1XUKA 2AGGX 1SOZA 1O30A 1QRWA 3RXMA 2D8WA 3TNSA 1DXWA 1KDQA 4LZ4B 1AQ7A 2FDAA 4WH6A 5T6FA 4GPGA 2F9NA 1BB0B 1XUFA 2STBE 4OS5A 2IN2A 2G55A 3KF2A 1ZSKA 5GNDA 5F03A 5JYIA 2XBWA 2CN0H 5IK2D 2QGRA 1MTSA 1SMFE 2PTCE 4NWKA 1Y3XA 3NRLA 2BVRH 1O2UA 1EOJA 1C2JA 2ZEBA 1BUIA 1CGIE 2Z3DA 1XXDA 4Q2KA 3ZVEA 2WPJS 5C0TA 1V2ST 2QV1A 3UNRA 2ODQA 2BD2A 2ALVA 5DN6D 3E8LA 1Z8IB 1GBAA 1LHCH 3DSGA 3PYHA 4YZUA 4DIHH 3IWMA 3ODFA 6CHAC 2EI6A 2VVVA 3F3BA 1GBBA 3MU0A 1DSUA 2AMQA 3KYGA 4U32A 2M5TA 4F55A 2B5TB 1D3DB 3BSQA 1VJ9U 2A4GA 3OTJE 7LPRA 1J8AA 1YPLH 1EOLA 1O33A 4DT7B 4ZHAA 1C9PA 1NZQH 3D23A 3W1EA 1BTXA 2GP9B 1S6LA 1T8OA 3GY3A 4I7YH 1P2OA 1VZQH 1FY5A 1D6RA 1KTSB 2FYQA 2G4UA 3T62A 1TX7A 1O2LA 1SQTA 1O5BB 2CXVA 2P8OC 2ASUB 3TK5A 3PWCA 1S6FA 2ZHWH 2ESTE 3P95A 2JH0D 2FOBA 3ZVDA 3ZZ3A 4M9FA 2QY0B 4X2VA 3SOSA 1YPKH 1HYLA 1AVWA 2B0FA 1C5SA 3HATH 1P01A 1KMHB 1GBDA 1E1QD 1UO6A 1YY3A 2FO9A 1TGTA 5EJZA 2EQNA 1LVMA 3BG8A 3OE7D 2SGFE 4ABEA 3I78A 2HNTC 3A8BA 4B2CA 1ZTJA 2FP7B 1BDAA 1BRUP 2YNBA 1JWTA 5FL7D 1HAHH 1NC6A 3R3GB 1L1GA 1SQRA 3LKWA 1VJAU 5DPAA 1FLEE 5A8ZA 1TMTH 3E16B 4GCHF 1ARCA 2SGQE 2J95A 2Z3EA 3UFAA 1PYTC 1TNKA 3V13A 1NFYA 1JXPA 1COWD 2QF5A 3TPIZ 2P3UB 1SBWA 1AFEH 4B1TA 4CH8B 3IITA 1JOUB 4JZEH 1Y3VA 2BOKA 1ELCA 4GAWA 3VB7A 1LMWB 3OFND 1MMJN 1UCYK 3PWBA 4SGBE 1WTHD 2O8UA 3SV8A 1C1WH 2Z7FE 1EP6A 1MTNC 2ZPSA 1SGNE 1GDNA 1TALA 1THPB 1P09A 1WAYB 3M3SA 4NA8A 5T3HA 4U2WA 3SGBE 4BTTB 1G37A 2H9EH 4WMDA 1O3JA 2P3FH 3H5CB 1E0FD 5F53A 1TA6A 1O5FH 2BOHB 4M7GA 2Y5FA 1S83A 1O2MA 1C5NH 4NWLA 1MBQA 4FU7A 1KYNA 5E2PA 1A5GH 1GBEA 3RXEA 1BCUH 2CK3D 4YOJA 4RT1A 2Y82A 1TLDA 3PV2A 4TWWA 1JIRA 2PKSB 1OWJA 1SVPA 1CBWC 3GYLB 1IQKA 1ANDA 1ELAA 2QIQA 3MTYA 4ISOA 2Q1JA 1AE8H 2BX4A 2CF9H 2ZDNA 3RXUA 1YCPH 3MNBA 1OWKA 4FETA 5C1UA 3SU4A 3TK6A 5C1XA 1JRTA 1CHOF 1J15A 1MKWH 2K8IA 1LHDH 5C3NA 1GI1A 2A31A 1DOJA 3O8RA 3SUDA 3VB6A 1QIXB 1AHTH 2D1JA 5AFZH 1SI5H 1DFPA 2EY4C 2A45B 1G3EA 4HZHA 1C2GA 3TH4H 1MTNB 2KAIB 1A1RA 1P10A 5SGAE 2O9QA 1F0TA 5EGMA 1V2NT 1HXEH 1O2SA 1FAXA 1ZHRA 5F8ZA 3U98H 4AG1A 5L2ZH 1KLJH 1TE0A 1XM1A 1D9IA 1MCTA 1UHBA 4B76A 1DXPA 2KZ4A 4FXGH 5LGOA 4XBBA 1MZAA 3AAVA 1GI5A 1ZPZA 3Q77A 5LPEA 4BANB 2I6SA 3E6PH 3PV5A 3UWJH 1YLDA 2VIVA 4D8NA 3FAOA 4F48B 3NWUA 4GHQA 2J34A 3EE0B 1P2NA 4DT4A 1J17T 2GDDA 1SHYA 2SGAA 3AASA 5EQSA 4TPYA 2QN5T 4Q80A 4OS2A 4A6LA 3SI4H 1GBLA 4XOJA 3DFLA 4K69A 5EXNA 4UFDH 3SUGA 2OC7A 4VGCB 1HJAB 2ZO3H 2BQ6B 4ISIH 4ZHMU 2ZU2A 4LXBH 4Y76A 1TABE 1TQ7B 1TX8A 1V2QT 2DE9A 1K1PA 2F9VA 3EA7A 4HG6A 3OAAD 3P6ZB 2HALA 5CDFE 2O8WA 2TGAA 3ZZ4A 1SGPE 1OWIA 1GJBB 3WWBA 3MU8A 3DHKH 1Z8JB 4A1XA 1C2MA 1C4Y2 2BLWA 4KELA 2RCEA 3KHVA 1GJ9B 1GBJA 2BD4A 1TYNA 2ZF0H 3M3VA 3UY9A 3NKKA 4A5TS 5HMAA 3VXFH 1O2ZA 2XRCA 2O8LA 1O5EH 4RT0A 4AN7A 4YT7H 2YMSC 2QF0A 3A88A 3FFGA 5JB8S 3CNRA 1J16A 1SOTA 3Q00A 4AFQA 1NRPH 2JH6D 3Q3YA 5L6NH 3SJKA 4P00A 1B7XB 1SFQB 2ZCHP 1O3NA 1O2IA 5C67A 3GY5A 1UTOA 1UCYE 1W2KH 2P59A 3F9GA 2EI8A 3SNBA 3SYJA 1SGFA 1IQMA 3S9CA 2BVSH 1MTWA 1W0KD 3NUMA 2JETB 3D65E 1SGDE 1P2QA 1EASA 1UVUH 1QY6A 3TNTA 1UCYH 4FUGA 2AMPA 3PO1B 1P9SA 5HM9A 1ZMJA 4MDSA 2ZDAH 3P8OA 1PPGE 1GVLA 2WHXA 3MWIU 1JRSA 2D2DA 1GJ8B 3H09A 3SNDA 2FOGA 5C17A 4AOQA 4UONA 1C2EA 1C5LH 3VB5A 2KM0A 3A8DA 1UHBB 1GPZA 1SGYE 1H8ED 1HB0B 4ZAEA 3URCA 1AB9B 5JDUB 2QC2A 5GJ4B 1HAPH 3GCHC 1CE5A 1RTKA 3UNQA 2PSYA 3NXPA 3RXPA 1W11U 2SNWA 1BMFD 1FY8E 4CBOA 4OS7A 4X8UH 1ZJDA 3M3TA 5HXFA 5I25A 3VGCB 2P94A 3MU1A 1ETSH 1IOEA 2GKVE 5EJ1A 2FX4A 1GJ6A 4I8HA 1D3QB 1ELBA 5GCHG 1SB1H 3V7TA 1Y3WA 4ZMAH 1YPJH 1EAXA 2LPRA 3UIRA 1AKSB 1RTFB 2QE7D 4YESB 1OSSA 2Z9IA 3RU4T 1L1JA 4AYYB 3ATKA 2OC1A 1MD7A 2SGPE 3FP8E 4A1TA 1SHHB 1C1TA 1IQGA 5L2YH 1SGQE 3BTDE 1DY8A 1C5ZB 1MQ6A 3SBKA 4O03A 2Y80A 1VR1H 3KGPA 2FS8A 1V6DA 3MH4A 1FIWA 1KXCA 3F2HA 2I6QA 3SU3A 1YWUA 5FPTA 4TYDA 4UEHH 2QYIA 3ODDA 2EEKA 3PTBA 1DICA 3RMMH 2XXLA 3SQEE 2XCNA 2FTMA 1GJ5H 3RP2A 5C1YA 2FTLE 3MO3A 1GG6C 3GY6A 1O3OA 5EJLA 2H5CA 1QR3E 3DA9B 1DM4B 5DJ7A 4B73A 2YMSD 3MI4A 5DO4H 1C5OH 3GY8A 2SFAA 1Z8RA 1P02A 1KXBA 1DPOA 4YT6H 4UFFH 5EQQA 1O2TA 2A5AA 2GV7A 4NIWA 3URDA 1KLIH 1NESE 3EYDA 1WYKA 2J97A 1FUJA 3M61U 1AZ8A 4ISHH 1C1MA 1C5MD 1CA8B 3ZVAA 2HGTH 1GGDB 2UWPA 3U8OH 1OWDA 4XBDA 1BMAA 1UTPA 1ZPBA 2A32A 2EA3A 2PUQH 2A1DB 3A86A 3ITIA 4ASHA 2EC9H 1K1MA 1C5TA 3GDUA 4KKDA 2H5DA 3SJ8A 2Z9LA 2Q6GA 4I8LA 5DG6A 4ABAA 4NIYA 1HRTH 1N6XA 1UVSH 3O8BA 2JJ1D 3PMAB 5GDSH 1V2KT 1FAKH 4NGAH 5EIYA 2HOBA 2ZC9H 1MAXA 2OQ5A 1GBMA 2WPKS 1WUNH 1BRAA 1SKYE 1NS3A 1E38B 1AE5A 2ZFFH 4IW4E 1UTNA 1O2WA 2RA3A 3QTVH 3KYFA 2WYGA 1O37A 4GSOA 1L4ZA 3U1JB 2A7HA 3N7OA 3JZ1B 1CSOE 2A4RA 5C94A 3BEFB 2ZA5A 1M9UA 2B7DH 3GDVA 3F0OA 1SFIA 1RFNA 4TSFD 3GY4A 3BTHE 1H9HE 1K1JA 1KXFA 1ZTLA 3PMHB 3RC6A 3P17H 4ZKOU 2FI5E 5A0BA 4FU8A 1BMNH 4WVPE 4ACBA 2WPDD 1X7AC 2HVXA 2VWOA 1F7ZA 2RDLA 1P9UA 1ZR0A 1A4WH 4FUCA 1AO5A 3ATMA 2BDAA 2BD3A 3WY8A 2ZP0H 8LPRA 4DIIH 3BTTE 1Y5AT 1LCYA 2BDGA 3DSPA 1ZMNA 1NFWA 2A5IA 5CHAB 1OWHA 2VIOA 4Z1MD 4BAMB 1GCDA 2ZHDA 3SO3A 3PV4A 2R9PA 4NG9H 3O8CA 1YPGH 1QA7A 1O3BA 3L6PA 4ABDA 1LPGB 4Y79A 3SU6A 3DD2H 2O8MA 4U01A 2J5UA 3A7WA 1KY9A 3ATIA 5CE1A 1W13U 1TWXB 5E0GA 3U28C 3MO9A 3OY5U 1SLWB 2J98B 1W7GH 1AUJA 1AU8A 3LJOA 2ZU3A 4X6NA 2FOEA 5FHTA 7GCHG 1CGHA 1AI8H 2BXTH 5IDKA 4Y11E 4K8YA 1XKBC 2V3MA 2THFB 1XVOA 1S82A 4OS6A 3ZYDA 1HV7A 2ZCLP 4MG3A 5E0HA 2F9PA 1TNLA 3BTFE 5DP3A 5GCHF 1K22H 2BD9A 1TAWA 4CRGA 3BIUH 4U30A 2QCYA 3AAUA 5BRRE 3TGKE 1PPEE 2OTVA 4IN2A 2VINA 1J14A 5T6GA 1INCA 3ATLA 4JCNA 1VCQA 3UREA 1B0FA 5TCCA 2QXGA 3NPSA 3R0FA 4OS4A 3SJ9A 1A0JA 3Q3KA 1FY1A 4BXWA 2GTBA 1AMHA 1QHRB 3MU4A 3F9HA 2XWAA 3RXRA 3RMNH 2OUAA 1SGCA 5JBTA 2W6ID 1OHHD 2ANWA 3UOPA 3KL6A 3GY2A 1H9LB 4K1EA 4Z0KA 3RXGA 1WDIA 4IMQA 3V3MA 4HI3A 4YM9A 3N7EA 3NK8A 1D3TB 2R0KA 1MTVA 3ZVBA 1PPHE 1O5AB 5A09A 5IYTA 1N6YA 1NRQH 4X2XA 1O5DH 2XBXA 1FJSA 3GOVB 2GT8A 2PHBA 3ZZ9A 2ZGCA 3UWIA 2B9LA 3F6UH 1GBHA 3ZVFA 1C1VH 4GUXA 3A7VA 2FLRH 3KQCA 3RXDA 4X1NU 1LKBA 3RM2H 1GCTB 2AFQB 1MZDA 2KAIA 1UTJA 2AIQA 4WXVA 1O3GA 4NIXA 1O2QA 4RSPA 4CREA 2BD8A 4NZLA 1BOQA 4DJZB 5E8EH 3KCGH 1AD8H 1QFKH 4TT3D 2A7CA 1D3PB 2H9HA 1P2IA 4ZKSU 4FUIA 3M5LA 1O2NA 4WF8A 3STJA 3BIVH 1GJAB 1H8DH 4NZQA 1GBFA 4X6OA 2C8YB 3TJNA 2V3HH 4ZCNA 5A0AE 1EB1H 2Z9GA 4XE4A 2ZG0H 3MNCA 4JMYA 5A8YA 3LOXA 3OSYA 1C5UA 4INHA 1AGJA 3SUFA 3ZZAA 1O2OA 1LHEH 4WXIA 2GT7A 1O2PA 3E3TA 2CHAB 1WV7H 3RXVA 2WUBA 3S9AA 1A0HB 1QJ1B 2PKSC 3DSOA 3PLPA 1IQNA 1N8OB 2OQUA 3SNAA 1BT7A 5AFYH 4TY7A 1MBMA 3L33A 3QK1A 3I77A 1ZGVA 5FBEA 2AMDA 1UVPA 1UTLM 5DGJA 4DW2U 1LVBA 1UVOA 3HKJB 1O3HA 1OOKB 2VWLA 4AZ2B 5EOKA 3A80A 1Q3XA 3LGTA 3OEHD 5GXPA 3LC3A 1DY9A 4J2YB 2ODYB 4BTUB 1QNJA 1EZSC 2PUXB 1O2JA 1PPCE 2FOAA 5LH8A 2GJGA 3KEEA 2H2ZA 5I46H 3HKIB 1ACBE 1VGCB 4BXSA 4JYVH 2KX4A 4ISLA 3RXFA 4KTSA 4NIVA 3JZ2B 1CA0B 3A7ZA 3EA9A 3QLPH 1ZSJA 2IPHA 1T8MA 1YPHC 2R2WU 3P8GA 3RDZA 3STIA 1AWFH 1IQFA 6ESTA 1PFXC 2AERH 1PQAA 2NU1E 3GCTG 4ABGA 4A1VA 5GWZA 3ATWA 2QXIA 2P16A 1ABJH 1MD8A 4ZKNU 4ZKRU 1ZZZA 1EJAA 4ASUD 5KGOA 4FU9A 4ACAA 2YOLA 1DDJA 4NFFA 3UTUH 4K2YA 1YPMH 4A7IB 1UMAH 2TGTA 1QBOA 2RG3A 1MU8B 4DVAU 1HAXB 2BQ7B 3MNSA 2DE8A 4JYTA 3KQBA 3ESTA 2UWOA 5EG4A 3F2FA 1CHGA 2ZZUH 4VGCC 1HJAC 8GCHG 3TH3H 1CT0E 7GCHF 2A2QH 1P04A 9ESTA 1ESTA 3LONA 1FY4A 1GHAG 2OBOA 2F43B 5EW2H 2OK5A 3E91A 1AFQB 5K0HA 4INLA 2HWLB 5EPYA 1S85A 2BDCA 4WH8A 3RXBA 3BEUA 4Q7ZA 3V12A 2NU4E 4ABHA 1HIAB 3K9XB 1DX5M 1OS8A 3U8RH 1EKBB 2UUJB 3GISB 1GWAA 4INKA 2TBSA 2VJ1A 1QB1A 1DLKB 1K1LA 1VITH 2OCVB 1LKAA 1LQEA 1YYY1 2NU3E 1O5GH 3LGWA 1QTFA 1WSSH 1FNIA 3GYMA 5CHBA 2TIOA 3RM0H 3E0PB 1THSH 2PV9B 2KFWA 2W6JD 4PROA 4X1QU 2ZGXH 2CMYA 1EQ9A 1KXAA 2OP9A 2QAAA 5C5NA 1AN1E 5HYOA 4FUFA 1ABIH 4X8VH 4DOQA 3DCLA 3VB4A 1IHSH 1O3MA 4YLQH 1AKSA 1PYTD 1YPEH 3CS7A 1C1UH 1HAGE 1Z8GA 3ZZDA 4H4FA 2G8TA 1NO9H 1YLNA 3PRBA 4H42U 1S5SA 2JETC 1C1QA 1O3AA 1EZUC 2ZPRA 3TJUA 2V6NA 2F9BH 1P2KA 2ZFSA 1HAZB 2PR3A 2ZFQH 3PO1C 4RI0A 1UTMA 2ZFPH 4B75A 2GZ9A 1BHXB 1G3CA 2ODPA 3RU4D 3A7YA 1DWDH 2FOHA 2VIDA 4CR5A 3LH3A 4K5ZA 2PFEA 1PQ8A 1MU6B 3I29A 1GL0E 4FUHA 1FN8A 1GMCG 1AB9C 1SQOA 2VVCA 1BITA 4AFUA 4Y8XA 4BAHB 1ZHMA 1TGBA 1LDTT 1OPHB 1GHBG 3RXOA 1O2YA 1HJ9A 1BMMH 3PTNA 4BAQB 2BHGA 3M37A 3SZNA 2C93B 1QURH 1NT1A 1SLVB 3A7TA 3VGCC 1GI7B 1HNEE 2AEIH 3MMGA 1FDPA 1GHVH 1Z1IA 3TJVA 3SV6A 1UK3A 2BY6X 1NTPA 2XBYA 1MUEB 1ELGA 3E0NB 1ESAA 2CJIA 1O3IA 5FCRA 3KQ5A 2A4QA 4OM9A 4TWYA 5DP4A 5E2OA 3SV9A 1YM0A 1NRRH 1KXEA 2ANYA 3SU5A 1ELTA 3PB1E 3RXTA 1GVKB 1O2RA 1O39A 2PW8H 1C1RA 1O3PB 1RIWB 1ZSLA 1YC0A 3SV7A 2YNAA 1O31A 3DUXH 1YLCA 3Q76A 4DCDA 1V2PT 1LQDB 3BTQE 2ZTYA 2HPPH 1TBQH 1Y3UA 2RDEA 4IBLH 1P0SH 1IAUA 1C5QA 1ZYOA 1WTGH 1G9IE 2WV4A 2XNDD 4FUDA 1TRYA 1ZRKA 5FX5A 5LPFA 1NFUA 2KCAA 4X2YA 4K8BA 2FEQH 1EPTB 2FI4E 3GCOA 5TCAA 4XRNA 5C0UA 3U1IB 1EAIA 1SGIB 1O3EA 1ZMLA 1BTPA 3BTGE 1TMBH 4X6MA 1E37B 3ZVCA 1DT2A 1GBTA 2ZECA 3UAIC 3QTOH 1C1PA 5DK1A 8ESTE 3BTWE 1BTYA 2ZFRH 1XVMA 4RKJB 1G3DA 3GCTF 1C2HA 1QQUA 2BVXH 2ZU1A 1DUAA 2OC8A 1PPFE 2ANKH 2Y81A 1O2HA 2BY9X 4UE7H 1EZXC 1NU7B 2ZIQH 4WMFA 1HFDA 4AG2A 1O3KA 3M7UA 3VG8A 1GGDC 5F6MA 2A5KA 3TGJE 3FANA 1P2JA 3TGIE 1Q2WA 1FY3A 2ZHQH 4BAOB 1C5XB 3QO6A 4JZFH 3ZZ6A 2G52A 4Y7AA 5BPEA 4D7GA 3SHAH 1GI9B 1PQ5A 2W7SA 4K1TA 1GDUA 3SQHE 1KTTB 3ZIAD 1K21H 8KME2 4IMZA 2C3SA 1O0DH 1C9TA 1V2UT 3FN8A 3ZZCA
chains in the Genus database with same CATH topology
2F83A 1QJ6B 4X1SU 2NU0E 1P03A 1GHAF 4X8SH 2BZAA 2FMJA 1V3XA 1NFXA 4HFPB 4MVNA 4AFZA 4K1SA 1SLXB 2VGCB 2WINI 4AX9H 4D76A 2XW9A 1KLTA 2VWNA 4MPVA 2OBQA 4TY6A 3QN7A 2STAE 4Y0ZE 2PKAB 4WY3A 3SU2A 1BQYA 1ID5H 2ZDKA 1D4PB 2FESH 2FOCA 1UVTH 1E36B 1FPCH 1K2I1 3QGNB 1DS2E 2V3OH 4MNVA 5AVDA 4F49A 2CV3A 3H7TA 1GJDB 3AVZA 2HNTE 1UTQA 1BTHH 3ZZBA 1WOFA 3SU0A 1FI8A 2QA9E 2ZHFH 2ZTXA 5FXLA 2HPQH 4JZDH 5JPMH 3QX5H 1XXFA 1C1NA 3U8TH 2FPZA 4NA7A 1UK4A 1TA2A 2FX6A 2BTCE 2BB4A 2NU2E 2ZI2H 4BTIB 2ZQ1A 3VXEH 4CRDA 3D49H 2FIRH 3TU7H 5GPIB 1YGCH 4Z6AH 4Y6DA 1NRNH 1QL8A 5F8TA 3TJOA 1AVXA 3PMBB 2OXSA 1T4VH 2VB0A 4D9QA 1S0QA 2UUKB 3CENA 5CHAC 1ELDE 4Q7XA 3RU4E 1GJ7B 1TPSA 4I8JA 2AIPA 1AUTC 2Z6BD 2BX3A 1TGSZ 2SNVA 4MTBA 2W3KA 5A8XA 2ILNA 3T28A 1HAVB 1XKAC 1BTWA 1FQ3A 3K6YA 1T8NA 1GMCF 1HBTH 1HLTH 2PGBB 2XNIA 2VVUA 1G30B 1QCPA 1Z6EA 1RXPA 2ZHEH 1NROH 2BQWB 2G81E 5HGGA 3GDSA 1DVAH 3S7KB 5A0CA 2F9OA 4CRFA 4K60A 1QQ4A 3U9AH 1QL9A 3RLWH 3LU9B 1A61H 1T8LA 3RXIA 1JIMA 3RXHA 4AGJA 1TPOA 1O5CB 3KNXA 4KGAA 1A7SA 3SU1A 3ENSB 3UR9A 2BDIA 1GI8B 3KQEA 4RKOB 5B6OA 3T27A 1H4WA 1C5VA 1O3CA 1Y8TA 3UUZA 1FN6A 1P06A 3PM3A 2FM2A 4NSYA 4ABJA 5GIBA 1NN6A 3S7HB 1F5LA 2OINA 2DUCA 4IN1A 1BIOA 1SG8B 3SORA 2FYRA 4X0WU 2W5EA 4KTCA 4X2WA 5ABWA 4AGKA 2GMTB 1ZHPA 2CF8H 1BHXF 1DITH 3EAJA 1S0RA 3MFJA 5G4BA 1AZZA 1A46H 2ZGHA 2Y7XA 2WV5A 1BBRK 1P3EA 1MAYA 1TMUH 1HDTH 3TK9A 1B5GH 2JKHA 2TGDA 1TGNA 1QBNA 3PLBA 3EA8A 1O38A 3RXCA 4D7FA 4BOHA 1O2XA 2J92A 3RXJA 2J94A 1DE7H 2Y6TA 1OP8A 1DWBH 3LPRA 2FXRA 1O3LA 1AY6H 4H6TA 1FPHH 3P8FA 1TPPA 3LGIA 1RJXB 1JMOH 1RRKA 2G4TA 2GCTB 2RA0A 4AB8A 1UJ1A 1B0EA 2G00A 9LPRA 1ARBA 1CHOG 1EP5A 3E1XB 1GCTC 1NY22 2BXUH 3ZZ7A 3SV2H 3RXLA 1EAWA 2BLOA 1Z7KA 3BN9A 2HLCA 1VITG 1MH0A 2GZ7A 2BY8X 1TB6H 1C4V2 1KXDA 1OYQA 2B8OH 2WPMS 4OS1A 4Y7BA 4GVUA 2ZWLH 2ZQ2A 3ZZ8A 4SGAE 2A0QB 2UUYA 2XC5A 3PROA 5DP8A 1P2MA 4ZXXH 1IQIA 1CO7E 3UQVA 3L3TA 2GDEH 7ESTE 1DWEH 3CP7A 4XDEA 1TQ0B 1KSNA 1FV9A 1WBGB 2NWNA 1A3BH 1V2RT 2CHAC 2W26A 5J4SA 3M5MA 3Q3XA 2D26C 1C2FA 4FUEA 3QZQA 3P92A 2J4IA 3KQDA 4AB9A 1CVWH 2ZDMA 1VCPA 3FZDA 4Q7YA 1W3CA 2Q6DA 3G01A 1N8OC 2ALPA 3SNEA 3RC5A 2F91A 2WPHS 3RXKA 3FVFB 1E35B 3T2NA 4CHAB 3MYWA 1ETRH 2PLXA 1V2MT 1G2MA 5EXMA 4BNRA 1L4DA 2IOTA 2ZCKP 1QRXA 3LIWA 1GBIA 3HK3B 1O35A 5PTPA 1GI4A 1HIAA 1BJVA 2Z9KA 3QUMP 1K1NA 3GCNA 1YCPM 1VGCC 1MKXK 1UTKA 1OWEA 2FOMB 4UD9H 2W7UA 1GBKA 1GL1A 1CA0C 3P8NA 3TVJB 3S69A 2AGEX 3F9EA 3MU5A 3NCLA 1IQJA 1O3FA 5ESBA 1Z1JA 3K65B 4X8TH 1V2WT 3KIDU 5L30H 4NCYA 2Z3CA 1O3DA 3A8CA 2VIQA 1TIOA 4KP0A 2P93A 2C8XB 2R3UA 1NU9A 2VIWA 5T6DA 4MNYA 1O36A 1PPZA 1GBCA 1L0ZA 6CHAB 1T32A 3FP6E 5JBAS 1GHXH 1NM6A 3QDZB 1AFQC 3HK6B 1GI3A 4CRCA 1ZRBA 2QXJA 2P3TB 2Y5GA 4D9RA 1V2LT 1BBRE 1FXYA 3SN8A 5DP6A 1QA0A 2CGAA 5FAHA 1F0RA 3RXSA 4UDWH 2OLGA 4X1RU 2BY7X 4ZH8A 3AW0A 4IGDA 2P8OB 1WU1A 2Q6FA 1BBRH 3P70B 2WPLS 1KDQB 3ZV9A 2FI3E 4K3JA 1SGEE 1U6QA 3IG6B 5FX6A 1XUIA 3OYPA 3PMJA 2H1UA 3HGNA 2SGDE 4YO9A 4O3UA 3B23B 3RLYH 5K7RA 3ZYEA 3SJIA 3QWCH 2GV6A 5H4IB 3RMLH 3T26A 4ABIA 1THRH 2P95A 3GICB 1AIXH 1FZZA 1F5KU 1DWCH 5ESTE 1SLUB 5EXLA 4E7RG 3A7XA 2V0BA 1XUJA 1D6WA 1RD3B 1C5WB 1W14U 4Y10E 4H6SB 3UPEA 2F3CE 4OGXA 1OP2A 4YLUA 1XMNB 1QJ7B 3T25A 5EODA 1RGQA 3C1KA 1L2EA 2AGIX 1BZXE 4XFQA 2UWLA 1NPMA 2ZTZA 5DP7A 2C8ZB 1F5RA 1TFXA 4MPUA 3AW1A 3UNSA 1PQ7A 3LDXH 5F8XA 2H9TH 1P05A 1EPTA 4DURA 2FWWA 3QZRA 1TGCA 4FUBA 4OGYA 4CR9A 1V2VT 2PWXA 1VITF 1SR5C 4WJG2 2BDYA 5EPNA 1QRZA 4CH2B 2AH4X 4Y8ZA 1RTLA 1SQAA 3T5FH 1W0YH 1AVGH 2GX4A 2GD4B 3LGYA 2Z9JA 2PGQB 4MPXA 3A89A 3O8DA 3A87A 2BDBA 1TBZH 1GMDG 3V0XA 4LOYH 1HXFH 4YOIA 1OYTH 3M5OA 3VFEA 1HAYB 1HGTH 1ETTH 4ISNA 3SHCH 1H8IH 2ZNKH 3MH5A 4QT8C 1XUHA 5DKMA 1ELFA 1CBWB 2VWMA 1TOCB 1JBUH 3DT0H 5CMXH 3ZV8A 2ZU5A 1Q31A 1HPGA 1YF4A 2C8WB 2XC4A 1LPZB 1RIWC 2Y7ZA 5JB9S 2BY5X 4B2AA 2A4OA 1CGJE 3ZZ5A 4IC5A 1MKXH 3A8AA 1IQLA 1OKXA 1SSXA 3HGPA 3KN2A 1Y3YA 2ANMH 1S81A 2PSXA 1PJPA 1C1OA 1DLEA 4I33A 2PKAA 1HCGA 1SL3A 1EPTC 1T31A 1DUEA 1P12E 2BZ6H 4ZUHA 2BMGB 1C5YB 4IC6A 5AHGH 1GI0A 5TJXA 4TPIZ 3SJOA 1C2KA 2W3IA 2TGPZ 4HTCH 1WCZA 1A0LA 1BJUA 3A81A 1P8VC 1G32B 1Y5UT 1LPKB 1T4UH 4THNH 1FMGA 4XBCA 5FPSA 1KIGH 4MNWA 2TPIZ 2GCHG 1C2DA 4R0IA 2SGEE 1DANH 1QGFA 5LPRA 1Y59T 5JBCS 1F2SE 3OX7U 2J9NA 3M5NA 4NFEA 4B2BA 1EX3A 1T7CA 2C90B 1K1IA 3DFJA 4YTAA 2ZDVH 6GCHG 1TRMA 1LVOA 3MNXA 4NSVA 4ZROA 4B71A 1ANBA 1ELVA 3BF6H 3B8JA 2XTTB 4JK5A 5JBBS 3VPKA 2FZZA 4GLYA 3OU0A 3E90B 1IQEA 1BTUA 1K9OE 1TOMH 1GI2A 2GZ8A 3M36A 3SW2B 3TITA 3LT3A 5FBIA 1HJ8A 1ORFA 1ESBA 4E05H 3FP7E 5EU8A 1ZTKA 1GMHG 2VGCC 1O32A 3LH1A 2BD7A 2LNCA 4AYVB 1K1OA 2OD3B 1MTUA 2G5NA 2VH6A 2Z94A 3MO6A 1SGTA 4E06H 4BAKB 1HAVA 1SPJA 4IS5A 3PLKA 2XYAA 2XWBI 4NA9H 4AORA 4ABBA 3K6ZA 1S84A 4JZIA 3SI3H 1HAIH 2OC0A 4B74A 1VCWA 4LK4A 5A2MH 1G2LA 2WUCA 3MOCA 3UR6A 5EQRA 1EJNA 3GY7A 1EATA 1GHZA 3F1SB 3TH2H 2ZPQA 1W8BH 3MH7A 2GVFA 1BA8B 4UFGH 2GGVB 3C27B 1GI6A 2ZKSA 8GCHF 4JK6A 3LGUA 1GHYH 1A5IA 3RUOA 2XCFA 1TPAE 4DG4A 3BG4C 1GJCB 3A85A 4JYUH 1RS0A 1ZOMA 2AYWA 4HGCA 5HM2A 4UFEH 1HUTH 3BTKE 3MHWU 2UUFB 1CU1A 1GJ4H 3CS0A 4FVDA 5J4QA 2BLVA 1W12U 2O8TA 1S6HA 1SGRE 1YKTA 1TNGA 2FS9A 3MH6A 4WMEA 1EAUA 5C5OA 1IHTH 4FVBA 1OX1A 1QB6A 2F9UA 3FZZA 1F0UA 5E0JA 3GCHB 3RMOH 2TRMA 3QGJA 3VB3A 1YP9A 2V35A 1WQVH 3H7OA 1O34A 4JZ1A 1CQQA 4A92A 5DP9A 4I32A 7KMEH 1TNJA 3VEQB 1P3CA 1TBRH 3EGKH 4CRAA 1BRCE 1J9CH 4E7NA 1OXGA 1ZGIA 1GMDF 2J2UA 1BTZA 4I8KA 1LO6A 2FOFA 1ELEE 2VH0A 1GHWH 1ZJKA 4Y71A 1AWHB 3UQOA 3LC5A 3BG4B 3U69H 2BDHA 2Y5HA 4ESTE 2HNTF 1PPBH 1O2VA 1G36A 1UK2A 1V2TT 3S0NA 2ZDLA 3RXAA 3F9FA 4F4OC 3ZVGA 1EUFA 1GVZA 1TNHA 2ZGJA 3A82A 2R0LA 3SGQE 1HAOH 5C20A 2VIPA 1H9IE 1ANCA 1YPHE 3NZIA 1O2KA 4CBNA 2GMTC 3A83A 5FCKA 3UOUA 1Z71A 2C4FH 1EJMA 1QBVH 1SC8U 2R3YA 1N1LA 3M35A 3BTME 4CRBA 1NRSH 2AS9A 2VNTA 3BTEE 1GG6B 4DGJA 3F68H 1BRBE 1FONA 1GHBF 4RN6A 4I8GA 4FUJA 4AFSA 1FIZA 4KTUA 4MLFB 3RXQA 1ANEA 4GCHG 3W94A 4YOGA 4I31A 1A2CH 2BM2A 5AF9H 3BEIB 4LZ1H 4X6PA 2G5VA 3OY6U 5ETXA 3SGAE 1ZLRA 2J38A 3TIUA 2A2XH 1EB2A 2WPIS 3LGVA 1E34B 1W0ZU 1DSTA 4R8TB 2GCTC 3B9FH 2GCHF 4O97A 1OP0A 1LVYA 1EXFA 1YBWA 4MPWA 4MQAA 1F0SA 1C4U2 2ZGBH 3A84A 1C5PA 2QXHA 4X1PU 6GCHF 4Y0YE 2XBVA 1TRNA 1SGFG 2R2MB 6LPRA 4GHTA 2WYJA 3RC4A 1V2OT 5FPYA 1WQSA 2H6MA 1C5RA 4J1YA 1G3BA 2BLQA 2ZFTA 1LHFH 2JH5D 3W95A 1MQ5A 2VU8E 3T29A 3SNCA 1GMHF 1TX6A 2K1QA 1QL7A 1F92A 2IJOB 1A5HA 1BMLA 1P11E 5DP5A 2G51A 1O2GH 1GDQA 1LTOA 1MCVA 2QF3A 1ZPCA 4XSKU 3D62A 1V2JT 2XC0A 1TONA 4O9VA 3TLOA 1C1SA 2PTNA 1EZQA 2BD5A 4O3TA 1Z6JH 1P57B 2FLBH 1W7XH 4ZXYH 4MNXA 1QB9A 1L1NA 3M7QA 4Y8YA 2EI7A 3HPTB 1A3EH 1C2LA 5C2ZA 4CHAC 3S9BA 5EW1H 1W10U 1Y5BT 3M7TA 4ZHLU 2A7JA 2ZU4A 3EDXB 1CT2E 3ELAH 1K28D 1H1BA 1TNIA 4WWYA 3SUEA 2HRVA 3BV9B 1IQHA 3K2UA 2ULLA 1LHGH 1XX9A 1YCPK 2BYAX 4DY7B 3LJJA 4ABFA 1CT4E 1MKWK 2FODA 3EQ0H 1XUGA 1C2IA 1XUKA 2AGGX 1SOZA 1O30A 1QRWA 3RXMA 2D8WA 3TNSA 1DXWA 1KDQA 4LZ4B 1AQ7A 2FDAA 4WH6A 5T6FA 4GPGA 2F9NA 1BB0B 1XUFA 2STBE 4OS5A 2IN2A 2G55A 3KF2A 1ZSKA 5JYIA 5F03A 2XBWA 2CN0H 2QGRA 1MTSA 1SMFE 2PTCE 4NWKA 1Y3XA 2BVRH 1O2UA 1EOJA 1C2JA 2ZEBA 1BUIA 1CGIE 2Z3DA 1XXDA 4Q2KA 3ZVEA 2WPJS 1V2ST 2QV1A 3UNRA 2ODQA 2BD2A 2ALVA 3E8LA 1Z8IB 1GBAA 1LHCH 3PYHA 4YZUA 4DIHH 3IWMA 3ODFA 6CHAC 2EI6A 2VVVA 1GBBA 3MU0A 1DSUA 2AMQA 4U32A 2M5TA 2B5TB 1D3DB 3BSQA 1VJ9U 2A4GA 3OTJE 7LPRA 1J8AA 1YPLH 1EOLA 1O33A 4DT7B 4ZHAA 1C9PA 1NZQH 3D23A 1BTXA 2GP9B 1T8OA 3GY3A 4I7YH 1P2OA 1VZQH 1FY5A 1D6RA 1KTSB 2FYQA 2G4UA 3T62A 1TX7A 2P8OC 1O2LA 1O5BB 1SQTA 2CXVA 2ASUB 3TK5A 3PWCA 1S6FA 2ZHWH 2ESTE 3P95A 2JH0D 2FOBA 3ZVDA 3ZZ3A 2QY0B 4X2VA 3SOSA 1YPKH 1HYLA 1AVWA 2B0FA 1C5SA 3HATH 1P01A 1GBDA 1UO6A 2FO9A 1TGTA 1LVMA 3BG8A 2SGFE 4ABEA 3I78A 2HNTC 3A8BA 4B2CA 1ZTJA 2FP7B 1BDAA 1BRUP 2YNBA 1JWTA 1HAHH 1NC6A 3R3GB 1L1GA 3LKWA 1VJAU 5DPAA 1FLEE 5A8ZA 1TMTH 3E16B 4GCHF 1ARCA 2SGQE 2J95A 2Z3EA 3UFAA 1PYTC 1TNKA 3V13A 1NFYA