2FWWA

Human beta-tryptase ii complexed with 4-piperidinebutyrate to make acylenzyme
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
243
structure length
243
Chain Sequence
IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-guided design of Peptide-based tryptase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Tryptase beta-2
total genus 49
structure length 243
sequence length 243
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2006-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fwwA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fwwA01
2O8MA 2JETB 2F9PA 4F4OC 2AS9A 3LU9B 1WOFA 3L3TA 4CR5A 4HGCA 2F91A 1V2RT 1NROH 2NWNA 3M7TA 5IDKA 1MH0A 3Q77A 1VITF 3SU5A 1SGEE 3O8DA 4Q7ZA 1MKWH 1NU7B 2AGEX 1TNHA 1C1TA 1AFQC 3E90B 1YPKH 4X1PU 3SW2B 3U1IB 2C4FH 3GOVB 1O2VA 1ZR0A 2QA9E 2BDYA 3OU0A 2W5EA 1XUHA 3ODDA 1GJ6A 1UCYH 1QNJA 3FZZA 4TYDA 1OWDA 2XC5A 1Z6JH 2ZFFH 4GSOA 2CV3A 1O3IA 9ESTA 2F9VA 3DA9B 4AYVB 1UVUH 4AG2A 5FPTA 3MH5A 2VIOA 1IHTH 4J1YA 2ZZUH 4XBDA 2THFB 3KQDA 1ESAA 1H9IE 1LHCH 1NRNH 3E0NB 3E1XB 1O3OA 2BXUH 3NUMA 3DFLA 5LH8A 3PTBA 4JZDH 4JK5A 4RSPA 2FESH 4B76A 1UTJA 2XC4A 4WXVA 5GIBA 1HPGA 1XM1A 4WVPE 1CBWC 2BLQA 2FOMB 2PHBA 4ISOA 2Y80A 1BOQA 2I6QA 5PTPA 2FP7B 2F9BH 3BTWE 1FONA 2BOHB 1QTFA 1GHXH 1NS3A 3RXBA 2W3IA 1C9PA 4MLFB 4VGCC 4M7GA 4NA9H 2G81E 1VGCC 3F6UH 1IOEA 3GCTG 3QO6A 3RMLH 2VJ1A 4SGBE 2BD8A 3T29A 1XUJA 4ABGA 3UR9A 2O8LA 1T7CA 2VWMA 2BYAX 1HJ9A 2FI5E 1HXEH 1THPB 1YCPK 1DSTA 1QA0A 1TB6H 1QCPA 2WINI 1G3BA 2J38A 1RFNA 3M36A 5TJXA 3UIRA 4Z6AH 1OWJA 1W13U 1GPZA 3U8RH 2CMYA 3RXDA 2VIWA 4RN6A 3LGWA 2ZFSA 2F3CE 4Q7XA 3MOCA 3M5MA 1NN6A 4ABEA 1AGJA 2H1UA 1O2NA 1GG6C 1ABIH 2G52A 2PKAB 3BTDE 1FUJA 2XW9A 2A45B 1LQEA 4X2XA 3TGJE 1INCA 4X2YA 1O35A 1TOCB 3CS7A 3MYWA 3F9GA 1C5NH 4HZHA 1LHGH 3HK6B 3ODFA 1UHBA 1GJ5H 1C2MA 1P2JA 2OC0A 4AN7A 2ZP0H 1C1UH 2QYIA 2IPHA 1SQOA 1SVPA 3MU1A 3PO1C 4JMYA 1TBRH 1GBFA 3BG4B 2FDAA 1T8NA 3O8RA 2Y7ZA 4INLA 3A7XA 1GL0E 1GHZA 2BOKA 3GDUA 4TPIZ 4B73A 5TCCA 4U32A 4FUFA 2SGAA 4NFFA 2AYWA 1TABE 1UO6A 1BBRH 4XSKU 1GHAG 2AGIX 1GI7B 4UFGH 2R9PA 4X8VH 3H5CB 2BY5X 5A8YA 1HBTH 5CMXH 4O03A 4XOJA 3E91A 5EODA 4WH8A 2TGDA 3FP7E 1V2LT 3TK5A 4MPVA 3SO3A 1E38B 2ODPA 2ILNA 2D8WA 1J9CH 2V3HH 2FLBH 1Z1IA 1GI1A 4K2YA 2OCVB 1VCQA 1UMAH 1O2KA 4Y0ZE 1L2EA 1NM6A 1O2XA 1O2TA 3AAVA 3QZRA 2PUQH 1GCTB 1BA8B 5F8XA 4IC6A 4D9RA 4YOIA 3HGNA 1L0ZA 1CA0C 1A7SA 4I32A 5EU8A 3RMMH 4D76A 1YM0A 4Y79A 2ZEBA 3UNQA 4ZKNU 1ARBA 4ABHA 1C2GA 1EOLA 1YCPH 1ZSLA 2G51A 1VR1H 1ANBA 1G9IE 4H6SB 3RXSA 3JZ2B 5C1XA 4YLQH 2C3SA 1G3CA 4B2BA 2FLRH 3PWCA 3UY9A 1GJ8B 1P2OA 3L6PA 5GWZA 1EZQA 2QXHA 7GCHF 2A1DB 3N7OA 1AB9C 3E8LA 4MVNA 3UNSA 4AGKA 1EQ9A 2Y5FA 3SOSA 1G30B 2FOFA 1GI2A 2BY7X 1SGNE 3K2UA 1FPHH 3W95A 3BTKE 3B9FH 1O2SA 1XUIA 1NU9A 3SN8A 2FX6A 2PGQB 1XKBC 1SLUB 2SGDE 4FUDA 2ZFQH 2ZGHA 2GT8A 2EI7A 4ZHAA 3PO1B 1C5PA 1MU6B 4NA7A 2BZ6H 3AW0A 4ZMAH 5GDSH 3QTVH 4ZHLU 4FXGH 1L1NA 1PYTD 1ZMLA 1V3XA 4Q7YA 1SGIB 3ATLA 3T27A 2ZU1A 3S0NA 2ZGBH 4B2CA 1QB6A 2XRCA 3GCNA 2ZI2H 4D7FA 2DE8A 1TNJA 1NRQH 2EI6A 1ANEA 1O3JA 4Y10E 2AH4X 3QLPH 4SGAE 3NKKA 3U8TH 3S9CA 1CQQA 2GT7A 3FP8E 5CHAC 3KQEA 3UQVA 2J92A 1WTGH 7ESTE 1P2NA 1J15A 3HKJB 3FANA 1P2QA 1GI4A 3RXIA 1NTPA 4YO9A 1MCTA 3ZZ6A 4MPXA 3PYHA 2FX4A 2FYQA 1HCGA 2ZA5A 3DT0H 3MH4A 3PV4A 1ETTH 2GTBA 2FM2A 4NIWA 1GBJA 1F5RA 4BNRA 1C1WH 1RRKA 3CENA 3TLOA 1MQ6A 1E37B 4MNYA 1SGTA 1KXBA 2ZGCA 4CRFA 2F9NA 4B1TA 5JBTA 3PLBA 1HJAB 1SFQB 1C1OA 1FY5A 1DPOA 2GMTB 2XBXA 4FUGA 3NWUA 1B0FA 3VXFH 4UE7H 1SLVB 1NZQH 5T6GA 5JBBS 3V12A 4WF8A 3PB1E 5AVDA 1L4ZA 1DT2A 1FN8A 5FCRA 4A1XA 1FNIA 3K6ZA 1BTXA 2P3FH 3SQHE 1MKXK 3P8OA 4ZH8A 2RA0A 4I33A 2Z9KA 3ZZBA 3GCTF 2W7UA 1XXDA 2OC8A 3BV9B 4Y8ZA 1O2ZA 2ZIQH 1FAXA 2WV4A 3QWCH 1PPZA 5F8TA 3A8DA 2LPRA 1IQMA 5I46H 2PTNA 1GBIA 1TGSZ 4FUHA 1ZMJA 1A61H 2FOBA 4AB9A 1H8IH 3C1KA 1UTQA 2XYAA 1HB0B 2ZPSA 4CRAA 1ARCA 1W14U 2ZF0H 3Q76A 2HPPH 1AU8A 3A83A 4RKOB 1HYLA 4X1SU 3SBKA 3A86A 1YPLH 4BAHB 2B7DH 3SUEA 1MD8A 1BHXB 3GY3A 3P8NA 4IMQA 4GCHF 2GV6A 1PPBH 3TH2H 3RXHA 1SSXA 1JMOH 1N6XA 1V2ST 2FZZA 1TFXA 2SGPE 3T26A 2GX4A 4KKDA 3S69A 4U2WA 1TYNA 3HATH 3UQOA 1W10U 2XBYA 2BD7A 3A82A 4YOJA 1YPMH 2WV5A 4INKA 5FAHA 4KTUA 2ZHQH 1P06A 1TBQH 2Z9IA 5I25A 4K1SA 2BX3A 1C5LH 3O8CA 1MBMA 4O3TA 3ELAH 1O2UA 3O8BA 4FUEA 1AY6H 4KTCA 2NU4E 3PM3A 1AQ7A 4TPYA 3RC5A 1AMHA 6GCHG 3RXMA 2WPIS 3UREA 1BJVA 4AOQA 4Y8YA 2NU1E 3T2NA 3PMJA 2HLCA 3KGPA 3ZZ8A 3RXAA 3TJUA 5C3NA 1ELAA 1C5WB 3F9HA 2CF9H 2Z7FE 1K1PA 2BD5A 1ELEE 1AE8H 1CHOF 2JETC 3RU4E 4H6TA 2GCTB 2PSYA 1GJCB 1GBAA 4NIYA 1QA7A 1GI6A 3BTFE 6LPRA 3MO9A 1YLDA 2GV7A 4UDWH 2PV9B 1WV7H 2G55A 4DURA 4NIVA 5C67A 4I8KA 1QHRB 1PPGE 2OBOA 3QUMP 2ZDMA 3MWIU 1WQSA 2O8WA 1AHTH 1BDAA 3D23A 1NT1A 1G3DA 2RCEA 5EG4A 1CO7E 1C2EA 5EPYA 3SZNA 5F03A 1ZMNA 1C2LA 1VITG 1ZOMA 2FMJA 5FPYA 1VZQH 1CGIE 1KLIH 1MQ5A 1P01A 3BTME 1N8OB 1S6FA 4Y6DA 4A7IB 1G37A 1BBRE 1C5ZB 2UWPA 1DFPA 4ABIA 2ZPRA 5EXMA 2J9NA 3MHWU 1LVYA 1B0EA 2GD4B 2PW8H 1J14A 1OOKB 2BQ7B 1V2WT 1F5LA 4B2AA 4BAKB 1RJXB 4HTCH 1Z8IB 3HK3B 1F0SA 3VB7A 2VIDA 1S0QA 2FTMA 2Y5GA 4FUCA 4IN1A 2Z6BD 3SNBA 2FYRA 2ZQ2A 2BD4A 1SGQE 4CBNA 4JK6A 4GUXA 1TMUH 2OQUA 1DDJA 2EI8A 2ANKH 5HMAA 1GBCA 1JOUB 1ZGIA 4FU8A 1EAXA 1IHSH 5DJ7A 3TU7H 3BIUH 3P8GA 2VWOA 1DLEA 1EJMA 2ASUB 1Y5AT 1KIGH 2Q6FA 1K28D 5AHGH 2VB0A 2XXLA 5A09A 1GBHA 5LGOA 4Y76A 2GP9B 4LXBH 4BXSA 1SL3A 2ZU4A 1ZSJA 1TX6A 6ESTA 1T32A 1TGTA 1TGCA 2W26A 3A7VA 1ZPCA 1NFWA 2KAIB 2Z9LA 4RKJB 3SGAE 1TIOA 3EAJA 3RMOH 4KTSA 1WUNH 2A4GA 2D1JA 4IMZA 3TNSA 4YLUA 4FUIA 1KDQB 2BY8X 3VXEH 4QT8C 3BSQA 1V2TT 3GY4A 3UOPA 4YT7H 1TMBH 5DP8A 1QFKH 1DWDH 3A81A 5SGAE 6CHAB 3ZVFA 5L6NH 1O2LA 5T3HA 5FXLA 4IW4E 1Q3XA 2HGTH 3GY7A 2V35A 1YGCH 1JIRA 3V3MA 1TGNA 1O32A 3L33A 2W3KA 4ASHA 2P93A 3A8BA 1XVOA 4O9VA 5DP3A 1P8VC 3A85A 4KGAA 3VEQB 1C5VA 5EQRA 1ELFA 1EAUA 3OYPA 1AD8H 1BTUA 1U6QA 2G5VA 1AB9B 3LGTA 5DP9A 1HXFH 1OYQA 1UK4A 2J4IA 3KEEA 8GCHG 2BTCE 1WCZA 3RXQA 1FPCH 3TITA 4BAMB 2J94A 3P70B 2BLWA 5GXPA 3UPEA 1UCYE 2A0QB 4E7NA 2HOBA 5JDUB 4Y7AA 2W7SA 5A0BA 4K5ZA 3UUZA 1FV9A 1QJ7B 3VGCC 1TQ0B 1O3CA 1S0RA 2OQ5A 4WH6A 1VITH 4IGDA 3SV8A 3VB6A 3DFJA 2YNBA 3SJIA 5AF9H 1DITH 1AUTC 4Q2KA 2NU3E 2CXVA 1W2KH 1MU8B 4IN2A 3ZZAA 3IITA 2ZU2A 1K1LA 3F9FA 1K1NA 4BTIB 1H9LB 3ATKA 4K69A 1QB1A 1SBWA 1V2OT 2R3YA 1NESE 3EGKH 1K1JA 3SNEA 4D9QA 2V0BA 1KXDA 3VFEA 2H9EH 4TWYA 3LGUA 3HGPA 1THRH 2BDAA 1C5QA 2ZDNA 3ATMA 1ZYOA 3URDA 2FOEA 2AFQB 1EATA 1EAIA 2OD3B 5E8EH 3TGIE 3MU4A 1G2MA 1HAIH 3I78A 4MNXA 2BDHA 3U69H 3LH3A 1AO5A 4HFPB 4AGJA 1MCVA 1LMWB 1QQ4A 1AFQB 4H42U 5EXLA 2B5TB 1Z8GA 1AZZA 1TX8A 1VJAU 2GCHF 3RDZA 5C2ZA 1PYTC 1V2UT 1O33A 2ALVA 3ZVAA 4NCYA 3SJOA 3CP7A 4ISNA 4Y71A 1C1NA 3LT3A 2G4UA 3UWJH 1QJ6B 3F9EA 2A2QH 4ZXXH 3IWMA 2VWNA 1QURH 1SI5H 3PMAB 2A4RA 2FPZA 3U9AH 4X2WA 2QGRA 4X6OA 1O2RA 1V2QT 1O3GA 1HFDA 4IC5A 3ZZ4A 1D3DB 2XCNA 2QXGA 2P8OC 5DP7A 1BRAA 4GPGA 1TNIA 1CU1A 1ESTA 4OS2A 4AFQA 2ZWLH 3ZVDA 4ABJA 1GMCG 3UNRA 1BMNH 1BTZA 1O5GH 3R0FA 1TRNA 2ZG0H 1PQ7A 1G36A 1GJBB 2TGAA 3RXPA 3T5FH 1GBLA 1O3PB 4DW2U 7LPRA 1JIMA 1O2OA 1UVPA 2AMDA 4FVDA 1GBDA 3BEIB 1QIXB 1O2QA 5AFZH 1DUEA 1C2JA 1QBNA 3A8CA 4NZLA 1ELVA 2ALPA 2XNIA 1RGQA 1OWHA 1P09A 3NXPA 1Z8JB 3KIDU 3SV9A 1F0UA 2OINA 1GMDF 2BLOA 3RXKA 1GI5A 3BTTE 2A5IA 1KLTA 1GBMA 2ZDKA 1C2DA 2RA3A 3SU0A 5E2OA 2Q6DA 1ETSH 2ZHWH 3ZYEA 1TX7A 2BD3A 1VGCB 1O3KA 4NWKA 1E34B 1D4PB 3ZZ9A 2ZHDA 1RIWC 4OS7A 1MAXA 2OTVA 3A87A 1DX5M 1PQ5A 1V6DA 1SGCA 4MNVA 1FLEE 4I8JA 4OS4A 1C4Y2 4YOGA 2TGPZ 2ZO3H 5T6DA 1LO6A 5TCAA 3TK9A 1SGDE 1JXPA 5J4QA 3KCGH 3SU1A 2ODYB 2BMGB 3ZVGA 2HALA 4UFEH 1D6RA 3R3GB 4CH8B 2XBVA 2XC0A 1BBRK 1N8OC 1SG8B 5F8ZA 2BB4A 5A0AE 4Z0KA 1GJ7B 2IN2A 3PLKA 3LC5A 2VNTA 2QC2A 1JRSA 4DY7B 5DP5A 3SJ9A 5EW2H 1SQTA 5L2YH 1TPPA 1W7XH 1ETRH 2C8YB 1D3TB 1HNEE 4DT7B 4NWLA 3ZVBA 2BDBA 3BEFB 3LIWA 3BF6H 3MO6A 4DIIH 4GLYA 3EQ0H 3LPRA 2PWXA 2Y82A 2ZU5A 2A4QA 3GDVA 2ZDVH 4MDSA 3BTQE 3TJNA 2V3OH 1C5TA 2VGCB 2FODA 3FVFB 1P03A 3G01A 1PPHE 1LPKB 1HJ8A 1EB2A 1ZGVA 1Y3VA 1QRWA 3ZZDA 1BTHH 1UTLM 2VGCC 1QRZA 2ZHFH 3TIUA 4OS5A 1T8OA 4J2YB 3RXFA 2NU2E 1YC0A 4THNH 3A8AA 2ZECA 1HAPH 3SV2H 1AZ8A 1KXCA 2KAIA 3S7KB 1FQ3A 1OP0A 2GDDA 3P95A 1P3EA 2AGGX 2QIQA 3SNAA 4CHAB 4BANB 3STIA 3DUXH 2ZGJA 3SJKA 1IQLA 2B8OH 1ANDA 1UTMA 5DGJA 3GY8A 1GBEA 3TJVA 4D7GA 1NY22 3ZVCA 1OKXA 1SMFE 1S5SA 4R0IA 3BIVH 1GCDA 1IQGA 4BOHA 4YESB 3QN7A 3AASA 4JZEH 3MU8A 2Y7XA 7GCHG 1TWXB 1O2YA 2PUXB 1J8AA 4OGXA 4DOQA 1OX1A 1F92A 1BRUP 1AI8H 3ESTA 1SLXB 1SGFG 3RXJA 3QX5H 4O97A 3HKIB 2H9HA 1ZHRA 1HLTH 1X7AC 1N6YA 1A0HB 2FO9A 2QV1A 4WXIA 3MU0A 2VIQA 2UUYA 1BQYA 2ZTZA 1AUJA 1ID5H 2SGQE 3I29A 4JCNA 4ZXYH 2BXTH 2C8XB 2ZCHP 3MTYA 6CHAC 1W0ZU 3FP6E 1VJ9U 5JBCS 1O3DA 4BAOB 4DJZB 6GCHF 1XUKA 1GHVH 3BEUA 2A7JA 3S9BA 1XKAC 1GI3A 1EXFA 2F83A 5J4SA 3ATWA 2Z9JA 1S85A 1P05A 1NPMA 2GZ7A 1XXFA 4AORA 2QN5T 4K1EA 1ELDE 2EA3A 2RG3A 4UD9H 2TIOA 2BDGA 2FOAA 1LKAA 1GVZA 2XTTB 4AFUA 3KQBA 2A2XH 1O2HA 1CGHA 1NRSH 3UWIA 4WWYA 1S82A 1GDUA 1Y3WA 3RLWH 1ZSKA 1LVOA 5HXFA 2OUAA 2BDCA 1BMAA 5FX5A 1K1OA 1ELTA 1TRYA 1GMHG 2TRMA 1W11U 1DXPA 7KMEH 2HNTF 1FXYA 1SOTA 1YYY1 2BVSH 1O2PA 1G32B 1TPOA 1J16A 1BMMH 2QY0B 1QB9A 2UUFB 2H5CA 2FOGA 4LZ4B 1P2MA 2V6NA 1Y3UA 3F1SB 3LJJA 1F5KU 1Y5UT 2ZCLP 4IBLH 1GJAB 1WSSH 2LNCA 1SGYE 4D8NA 1C5SA 3ENSB 1V2NT 1MTNB 3MMGA 4AYYB 4BTUB 4A5TS 3D65E 3FFGA 3RXUA 2Z9GA 3KNXA 1TA2A 1OS8A 2GCHG 2PKAA 5FHTA 3OY5U 5EQQA 3H7OA 1WYKA 2BY9X 1ZTJA 2P16A 1C1VH 2R0KA 1GMDG 3B23B 1JRTA 4ZAEA 1GHWH 3SNCA 2WYGA 3V0XA 1EPTA 3SORA 1BCUH 1MUEB 4CRBA 1DICA 1FY3A 1KY9A 4MNWA 1NFUA 1DLKB 2P95A 3D49H 1QL9A 4BAQB 3MNXA 3QTOH 4CRDA 3RXTA 1C5MD 4WY3A 1YP9A 4GVUA 3KN2A 1UK2A 4GHTA 1IQNA 2ZU3A 1T4UH 4XE4A 4X8UH 2WPHS 4GHQA 3RXVA 1EB1H 1QGFA 2FTLE 4UFFH 1C5UA 2M5TA 3FAOA 2G8TA 1TPAE 2AMPA 1P02A 3UOUA 3M5NA 1F2SE 1XUFA 3VPKA 2VWLA 3NK8A 2VH0A 1AVXA 1Q2WA 3VGCB 3GCHC 1WTHD 2G4TA 2VU8E 3MI4A 4FU7A 4ABFA 1ZJKA 2H9TH 1O31A 2UUKB 3M3TA 4X8TH 3SV7A 4NFEA 3TJOA 3AAUA 4MQAA 5AFYH 1T8LA 1GMCF 1FY8E 1LQDB 4I8GA 4GAWA 1GDNA 1GJ4H 5DK1A 3TK6A 1BRCE 5BRRE 1MTSA 1O36A 1ZPBA 4MTBA 3M5OA 1FN6A 1SC8U 3HPTB 1MKWK 2STAE 4ZKRU 2GCTC 1A0JA 1O2WA 2SFAA 4HI3A 1BHXF 1TQ7B 1NRRH 3LGYA 5DPAA 4X0WU 1O2GH 3M37A 4NSYA 2EC9H 2ZGXH 1FIWA 1T8MA 3MNCA 4FUJA 1O3BA 2BD9A 4DVAU 4IS5A 2PKSB 1C1MA 2G5NA 4CRCA 1BJUA 3T28A 2ZTYA 3I77A 1DXWA 4ZUHA 3BG8A 1DY8A 1YPHE 4I8HA 4BXWA 4ZKOU 2R2MB 1P2KA 3RMNH 4K3JA 4LOYH 1LHEH 1SOZA 2CHAC 1EUFA 5ABWA 2VIVA 1UHBB 2PGBB 2ZTXA 1Y3XA 2ULLA 1O5CB 1DWBH 1P3CA 5GJ4B 2QCYA 1TONA 4JZFH 1YPJH 5FX6A 2ZC9H 2AMQA 3KHVA 4XBBA 1LVMA 5JB8S 4CH2B 4DIHH 3TGKE 3P17H 2C90B 4YM9A 1LPGB 1UCYK 1MTUA 1A46H 3EDXB 3RXRA 1ELCA 1PFXC 1NC6A 1BTYA 1O3FA 5A8XA 5HYOA 1PPFE 2R0LA 8ESTE 3M61U 3TNTA 4INHA 1MZDA 1TRMA 2B0FA 3UFAA 4JYUH 1AN1E 3A80A 1O5DH 1A1RA 4E06H 1P10A 2NU0E 3WY8A 2A32A 1ABJH 2D26C 2A4OA 1ELBA 1FIZA 3PMBB 3MH6A 1C4V2 1K2I1 1V2PT 1S83A 2PLXA 2R2WU 3M35A 1MKXH 1MTVA 3RXEA 1HUTH 1ZHMA 4KELA 1YBWA 4CHAC 4LZ1H 2WUBA 2WUCA 1ANCA 1CVWH 2ODQA 2ZDLA 3SNDA 1IQJA 5B6OA 1V2KT 2PTCE 3E16B 5DKMA 3SQEE 4KP0A 5C5NA 1P12E 1C2FA 1P57B 2C8WB 4DG4A 5E2PA 1EPTC 2IOTA 2IJOB 4YZUA 1SGFA 1ZLRA 4X6MA 2CHAB 1ZTKA 1HRTH 1KYNA 1RXPA 3VB3A 2QF0A 1GI0A 1SGPE 3A88A 4NIXA 2ZHEH 3Q3KA 2BD2A 1Y8TA 4UFDH 1Y5BT 2TGTA 1KSNA 1BTPA 1EJAA 3E3TA 2JKHA 1JBUH 3RU4T 1Q31A 2PKSC 5F6MA 1GG6B 1TOMH 4UONA 4I7YH 2PFEA 8KME2 5L2ZH 1DY9A 1J17T 1MZAA 4ESTE 3GYLB 1O39A 2FI4E 2FWWA 1A0LA 3FZDA 1FY4A 2GDEH 2GKVE 1TMTH 1ZPZA 1EX3A 4I31A 1IQFA 3A7YA 1A5HA 2XWBI 2OC1A 4Y8XA 1PPCE 1OWIA 3KF2A 1EJNA 3BG4C 5FBEA 2J34A 2QF3A 3QGJA 4TWWA 3S9AA 1C2IA 1HAGE 1L1GA 1YKTA 5A2MH 1FY1A 2HPQH 1DWEH 1S84A 2O9QA 3KL6A 2WYJA 2JH0D 1AKSA 1HIAB 1TPSA 1QJ1B 2SNVA 2GVFA 3QZQA 1TE0A 1OWEA 4ISHH 1CT2E 5C1UA 2BVRH 1O2IA 1OP2A 3H7TA 1O3AA 1OSSA 1P11E 3GICB 3TVJB 2FI3E 1O5AB 1MMJN 1XX9A 3IG6B 2BLVA 2P3TB 4NZQA 1C5YB 5HM2A 3D62A 1GBKA 3VB5A 4B71A 4X1NU 3A7ZA 3AW1A 1Z6EA 1BUIA 1E36B 2JH5D 4XFQA 3MNSA 3MNBA 1TNGA 2AIQA 4JZ1A 4AX9H 1C9TA 4OS1A 2WPJS 1P9SA 3RXLA 1O5BB 1K21H 4MG3A 3RXOA 1CA0B 3SHCH 4ABBA 1OXGA 1UTNA 2YNAA 3RP2A 1F7ZA 1K22H 1SLWB 3PROA 4AZ2B 2J2UA 1KXAA 1PPEE 4YT6H 5CE1A 1BMLA 1V2JT 1XMNB 1K1IA 2F9UA 3E6PH 1E35B 2Y81A 2Y5HA 1EP6A 1EZUC 1DSUA 2YOLA 5DO4H 1EOJA 3T25A 2I6SA 4Y7BA 3V13A 1O5EH 3LDXH 3RUOA 3GDSA 3ZZ3A 1CT4E 3BTHE 2A5AA 4LK4A 3LJOA 1IQHA 1E0FD 1GWAA 3JZ1B 3QDZB 3PMHB 1SR5C 1FDPA 1H8DH 4Y0YE 2GGVB 2FXRA 1UJ1A 2F9OA 1W7GH 1TBZH 2J95A 1UTPA 1QY6A 2ZPQA 1XUGA 4A6LA 2CF8H 4WMFA 4AB8A 1AIXH 2PR3A 4ZHMU 4DCDA 4X8SH 1C2KA 1GJ9B 1EKBB 3K65B 3LOXA 1H9HE 5EW1H 3PLPA 1GI9B 4XDEA 5DP6A 1MD7A 3RC6A 3GY6A 1DUAA 3MO3A 2WPKS 3NZIA 2Z3EA 3OSYA 2Q1JA 3UR6A 4TY6A 5JYIA 4UEHH 3BTGE 3GY5A 4FU9A 3GCOA 3RXGA 3ZVEA 1RTLA 1IQIA 3ATIA 1ACBE 1LHFH 1O0DH 1WQVH 3RXCA 5HGGA 1BTWA 1DWCH 3P92A 1KTTB 1UVSH 1XVMA 4X2VA 1A4WH 4XBCA 1CT0E 3ZV9A 1HAYB 3F68H 1ZTLA 3A7WA 3SUFA 1WAYB 5C1YA 1HAXB 1A5GH 1O2MA 3K6YA 1QL8A 1F0TA 2WPLS 4Y11E 2STBE 2JH6D 2K1QA 3A7TA 3OTJE 3U8OH 1BITA 4VGCB 1GI8B 4NA8A 2G00A 2BM2A 1P9UA 4WMEA 1QR3E 3VB4A 2CN0H 2UUJB 2Z3CA 2A7CA 4B74A 1LDTT 5H4IB 3SU4A 1TLDA 1LVBA 3SU3A 3W94A 2UWLA 2ESTE 2HNTC 4NSVA 4WJG2 1KTSB 1G2LA 1W3CA 2O8TA 2GZ8A 3QK1A 3URCA 2VINA 2TPIZ 1V2MT 1GMHF 1KDQA 3Q3XA 1RD3B 1B7XB 2RDLA 3Q00A 3DD2H 4CR9A 4YTAA 1UTKA 1Z8RA 2B9LA 1O3EA 3EYDA 1DE7H 4NGAH 4DGJA 1O30A 5GCHG 3MFJA 1T4VH 4JYTA 1ZZZA 2PSXA 5EQSA 4X6NA 4FUBA 4X1QU 5E0HA 1BT7A 4I8LA 4K8BA 2ZFPH 3P8FA 3RM0H 1UK3A 1EZXC 1NFYA 2OXSA 1O34A 3SJ8A 1YPGH 2WPMS 1K1MA 1K9OE 1O3NA 1VCWA 8GCHF 1HAVA 3RM2H 1QBVH 1T31A 4MPUA 1W12U 3ZZ7A 1CHGA 1UVOA 1B5GH 3SUGA 1C5XB 5ESTE 5LPRA 2FOCA 2ZNKH 1TALA 2VVVA 1ZJDA 1C1PA 1ESBA 2VVCA 1FMGA 1O5FH 2ZDAH 3UTUH 4E7RG 1ZRKA 1AVWA 1RIWB 1YPHC 3LGIA 4CBOA 3SGQE 5EXNA 1LPZB 1LCYA 1EPTB 3QGNB 4PROA 1H1BA 4A1TA 3MU5A 4OGYA 1GBBA 1CBWB 5FPSA 2O8UA 5JBAS 1RS0A 2XBWA 3SU2A 1M9UA 4F49A 3U1JB 1KXFA 1CE5A 1THSH 2XCFA 3SGBE 2CJIA 1IQKA 1A3BH 1PJPA 5G4BA 1AWHB 1IQEA 1GHBG 1PQ8A 2UWOA 1GCTC 1GJDB 2QXIA 3M7QA 3V7TA 4FVBA 5ETXA 2BDIA 2A5KA 3BN9A 2BZAA 3P6ZB 4ABDA 1CGJE 3LH1A 1SQAA 1DOJA 2VH6A 2AIPA 2ANMH 1BZXE 5GCHF 2H5DA 1CHOG 3EA9A 3ZZCA 2BY6X 4CRGA 1DANH 4U30A 4CREA 3RLYH 1GDQA 8LPRA 1Z1JA 4JZIA 2P8OB 3RC4A 2ANYA 2Q6GA 1OYTH 2OBQA 1JWTA 2OP9A 3B8JA 3C27B 1YPEH 1MTWA 5LPFA 1HAVB 2D2DA 3SI4H 1HV7A 3KQCA 1Z71A 3PTNA 1AKSB 1HIAA 1C2HA 1GL1A 3SU6A 3PWBA 1GHAF 1ELGA 2Z3DA 3OY6U 1D9IA 1KXEA 2TBSA 1AVGH 4B75A 3EA8A 1HGTH 3GYMA 1QBOA 3M3VA 2BQWB 1BRBE 4R8TB 3BTEE 3NPSA 4BTTB 5EGMA 3TH3H 1MAYA 3SV6A 2GZ9A 2ANWA 5BPEA 1DM4B 1TGBA 4K60A 3EE0B 4X6PA 3NCLA 1OPHB 3CS0A 1Y3YA 3A84A 2FIRH 4ISLA 2DE9A 5T6FA 3ZZ5A 3EA7A 1FI8A 2OC7A 1C4U2 2HRVA 1H4WA 3Q3YA 1FJSA 1HAOH 1TNLA 1O3HA 2SGFE 1C5OH 5GPIB 3M5LA 3SI3H 1NRPH 4X1RU 1UVTH 1D6WA 1OWKA 2FS9A 2C93B 2Y6TA 3TPIZ 2QXJA 2SNWA 5CHAB 5LPEA 1YF4A 1L1JA 1A2CH 2C8ZB 1DVAH 3LC3A 1A5IA 1EZSC 1SGRE 1YLCA 4MPWA 1O3MA 1SFIA 1O38A 2ZFTA 4AFZA 1LHDH 3LKWA 1PQAA 3DHKH 3SUDA 5IYTA 2A7HA 1W0YH 1EP5A 2ZFRH 1C5RA 4ZROA 4A1VA 4OS6A 1SHHB 1Y59T 1CSOE 2AEIH 1UTOA 3T62A 1AWFH 3K9XB 3SHAH 4U01A 1BIOA 5JB9S 1SHYA 2DUCA 1GGDB 1NFXA 2BVXH 1BB0B 4A92A 5FBIA 1QQUA 2AERH 4Q80A 3STJA 1GBTA 3M3SA 2P94A 4ISIH 1QL7A 1LKBA 1A3EH 2QAAA 1AE5A 1GGDC 1P04A 1O37A 4AG1A 1ZRBA 1Z7KA 2OLGA 3AVZA 3ZYDA 1V2VT 2EEKA 5A0CA 2ZKSA 4WMDA 2FS8A 4ZKSU 5DG6A 2FOHA 5L30H 1MBQA 4GCHG 1HAHH 4K8YA 5K7RA 3GCHB 4TY7A 2R3UA 3M7UA 1HJAC 3TH4H 5K0HA 1WU1A 4NG9H 2HWLB 1TNKA 5E0GA 1GHYH 5JPMH 1QRXA 1RTKA 1N1LA 2SGEE 2BHGA 1GHBF 1HDTH 5FCKA 2H6MA 1FZZA 1RTFB 1YCPM 1OP8A 3S7HB 1G3EA 2A31A 4AFSA 1L4DA 1GVKB 1O3LA 5E0JA 1D3QB 1C1RA 2BX4A 1O2JA 1KLJH 1C1QA 5C5OA 3RU4D 1D3PB 3OX7U 1C1SA 5EOKA 1SB1H 1EAWA 4O3UA 5EPNA 2FEQH 5ESBA 2CGAA 3LGVA 1GVLA 1ORFA 3E0PB 4ABAA 1MTNC 1F0RA 2ZCKP 3GY2A 3U98H 5HM9A 4JYVH 5DP4A 3ZV8A 2HVXA 1S6HA 1CA8B 1VCPA 1S81A 1HAZB 2P3UB 3ITIA 1IAUA 3LONA 1FAKH 1P0SH 2BQ6B 1ZHPA 3A89A 1AFEH 1P2IA 2HNTE 1W8BH 2XWAA 4K1TA 1TA6A 2ZQ1A 1NO9H 1LTOA 2GMTC 1TAWA 3MH7A 1SPJA 2P59A 1WBGB 2VIPA 4H4FA 1DS2E 4E05H 5C20A 2VVUA 2Z94A 9LPRA 2H2ZA 1EASA 3GISB 5A8ZA
chains in the Genus database with same CATH superfamily
2O8MA 2JETB 2F9PA 3WWFA 5GNDA 2AS9A 3LU9B 5F53A 1WOFA 4F4OC 3L3TA 4CR5A 4HGCA 2F91A 1V2RT 1NROH 2NWNA 3M7TA 5IDKA 1MH0A 3Q77A 1VITF 3SU5A 1SGEE 3O8DA 4Q7ZA 2F4LA 1MKWH 1NU7B 2AGEX 1TNHA 1C1TA 1AFQC 3E90B 1YPKH 4X1PU 3SW2B 3U1IB 2C4FH 3GOVB 1O2VA 1ZR0A 2QA9E 2BDYA 3OU0A 2W5EA 1XUHA 3ODDA 1GJ6A 1UCYH 1QNJA 3FZZA 4TYDA 1OWDA 2XC5A 2J98A 1Z6JH 2ZFFH 4GSOA 2CV3A 1O3IA 9ESTA 2F9VA 3DA9B 4AYVB 1UVUH 2V3MA 4AG2A 5FPTA 3MH5A 2VIOA 1IHTH 4J1YA 2ZZUH 4XBDA 2THFB 3KQDA 1ESAA 1H9IE 1LHCH 1NRNH 3E0NB 3E1XB 1O3OA 2BXUH 3NUMA 3DFLA 5LH8A 3PTBA 1E1QD 4JZDH 4JK5A 4RSPA 2FESH 4B76A 1UTJA 2XC4A 4WXVA 5GIBA 1HPGA 1XM1A 4WVPE 1CBWC 2BLQA 2FOMB 2PHBA 4ISOA 2Y80A 1BOQA 2I6QA 5PTPA 2FP7B 2F9BH 3BTWE 1FONA 3MQKC 2BOHB 1QTFA 1GHXH 1NS3A 3RXBA 2W3IA 1C9PA 3NRLA 4MLFB 4VGCC 4M7GA 4NA9H 4TSFD 2G81E 1VGCC 3F6UH 1IOEA 3GCTG 3QO6A 3RMLH 2VJ1A 4SGBE 2BD8A 3T29A 1XUJA 4ABGA 3UR9A 2O8LA 1T7CA 2VWMA 2BYAX 1HJ9A 2FI5E 1HXEH 1THPB 1YCPK 1DSTA 1QA0A 1TB6H 1QCPA 2WINI 1G3BA 2J38A 1RFNA 3M36A 5TJXA 3UIRA 4Z6AH 1OWJA 1W13U 1GPZA 3U8RH 2CMYA 3RXDA 2VIWA 4RN6A 3LGWA 2ZFSA 2F3CE 4Q7XA 3MOCA 2VBCA 1NN6A 3M5MA 1AGJA 2H1UA 2KR7A 1O2NA 3N7DA 4ABEA 1GG6C 4B6EA 1ABIH 2G52A 2PKAB 3BTDE 1FUJA 2XW9A 2A45B 1LQEA 4X2XA 3TGJE 1INCA 4X2YA 1O35A 1TOCB 3CS7A 3MYWA 3F9GA 1C5NH 4HZHA 1LHGH 3HK6B 3ODFA 1UHBA 1GJ5H 1C2MA 1P2JA 2OC0A 4AN7A 2ZP0H 1C1UH 2QYIA 2IPHA 1SQOA 1SVPA 3MU1A 3PO1C 4JMYA 1TBRH 1GBFA 3BG4B 2FDAA 1T8NA 1NBMD 3O8RA 2Y7ZA 4INLA 3A7XA 1GL0E 1GHZA 2BOKA 3GDUA 4TPIZ 4B73A 5TCCA 4U32A 4FUFA 2SGAA 4NFFA 2AYWA 1TABE 1UO6A 1BBRH 4XSKU 1GHAG 2AGIX 1GI7B 4UFGH 2R9PA 4X8VH 3H5CB 2BY5X 5A8YA 1HBTH 5CMXH 4O03A 4XOJA 3E91A 5EODA 4WH8A 2LP6A 2TGDA 3FP7E 1V2LT 3TK5A 4MPVA 3SO3A 1E38B 2ODPA 2ILNA 2D8WA 1J9CH 2V3HH 2FLBH 1Z1IA 1GI1A 4Q4LA 4K2YA 2OCVB 1VCQA 1UMAH 1O2KA 4Y0ZE 1L2EA 1NM6A 1O2XA 1O2TA 3AAVA 3QZRA 2PUQH 1GCTB 2W6JD 1BA8B 5F8XA 4IC6A 4D9RA 4YOIA 3HGNA 1L0ZA 1CA0C 1A7SA 4I32A 2AHME 5EU8A 3RMMH 4D76A 1YM0A 4Y79A 2ZEBA 3UNQA 4ZKNU 1ARBA 4ABHA 1C2GA 1EOLA 1YCPH 1ZSLA 2G51A 1VR1H 1ANBA 1G9IE 4H6SB 3RXSA 3JZ2B 5C1XA 4YLQH 2C3SA 1G3CA 3OFND 4B2BA 2FLRH 3PWCA 3UY9A 1GJ8B 1P2OA 3L6PA 5GWZA 1EZQA 2QXHA 3N99A 7GCHF 2A1DB 3N7OA 1AB9C 3E8LA 4MVNA 3UNSA 4AGKA 1EQ9A 2Y5FA 3SOSA 1G30B 2FOFA 1GI2A 2BY7X 1SGNE 3K2UA 1FPHH 3W95A 3BTKE 3B9FH 1O2SA 1XUIA 1NU9A 3SN8A 2FX6A 2PGQB 1XKBC 1SLUB 2SGDE 4FUDA 2ZFQH 2ZGHA 2GT8A 2EI7A 4ZHAA 3PO1B 1C5PA 1MU6B 4NA7A 2BZ6H 3AW0A 5EJZA 5GDSH 3QTVH 4ZHLU 4ZMAH 5C0TA 4FXGH 1L1NA 1PYTD 1ZMLA 1V3XA 4Z1MD 4Q7YA 1SGIB 3ATLA 1YY3A 3T27A 2ZU1A 3S0NA 2ZGBH 4B2CA 1QB6A 2XRCA 3GCNA 2ZI2H 4D7FA 2DE8A 1TNJA 1NRQH 2EI6A 1ANEA 1O3JA 4Y10E 2AH4X 3QLPH 4SGAE 3NKKA 1YLNA 3U8TH 1CQQA 1MABB 2GT7A 1BMFD 3FP8E 5CHAC 3S9CA 3KQEA 3UQVA 2J92A 1WTGH 7ESTE 1P2NA 1J15A 3HKJB 3FANA 1P2QA 1GI4A 3RXIA 1NTPA 4YO9A 1MCTA 3ZZ6A 4MPXA 3PYHA 2FX4A 2FYQA 1VKYA 1HCGA 2ZA5A 3DT0H 3MH4A 3PV4A 1ETTH 2GTBA 2FM2A 4NIWA 1GBJA 1F5RA 4BNRA 1C1WH 1RRKA 3CENA 3TLOA 1MQ6A 1E37B 4MNYA 4M9FA 1SGTA 1KXBA 3DSPA 2ZGCA 4CRFA 2F9NA 4B1TA 5JBTA 3PLBA 1HJAB 1SFQB 1C1OA 1FY5A 1DPOA 2GMTB 2XBXA 4FUGA 3NWUA 1B0FA 3VXFH 4UE7H 1SLVB 1NZQH 5T6GA 5JBBS 3V12A 4WF8A 3PB1E 5AVDA 1L4ZA 1DT2A 1FN8A 5FCRA 4A1XA 1FNIA 3K6ZA 1BTXA 2P3FH 3SQHE 1MKXK 3P8OA 4ZH8A 2RA0A 4I33A 2Z9KA 3ZZBA 3GCTF 2OK5A 2W7UA 1XXDA 2OC8A 3BV9B 4Y8ZA 1O2ZA 2ZIQH 1FAXA 2WV4A 3QWCH 1PPZA 5F8TA 3F0PA 3A8DA 2LPRA 1E79D 1IQMA 5I46H 2PTNA 1GBIA 1TGSZ 4FUHA 1ZMJA 1A61H 2FOBA 4AB9A 1H8IH 3C1KA 1UTQA 2XYAA 1HB0B 2ZPSA 4CRAA 1ARCA 1W14U 2ZF0H 3Q76A 2HPPH 1AU8A 3A83A 4RKOB 1HYLA 4X1SU 3SBKA 3A86A 1YPLH 4BAHB 2B7DH 3SUEA 1MD8A 1BHXB 3GY3A 3P8NA 4IMQA 4GCHF 2GV6A 1PPBH 3TH2H 3RXHA 1SSXA 1JMOH 1N6XA 1V2ST 2FZZA 1TFXA 2SGPE 3T26A 2GX4A 4KKDA 3S69A 4U2WA 1TYNA 3HATH 3UQOA 1W10U 2XBYA 2BD7A 3A82A 2LELA 4YOJA 1YPMH 2WV5A 4INKA 5FAHA 4KTUA 2ZHQH 1P06A 1TBQH 2Z9IA 2RFKC 5I25A 4K1SA 2BX3A 1C5LH 3O8CA 3UAIC 1MBMA 4O3TA 3ELAH 1O2UA 3O8BA 4FUEA 1AY6H 4KTCA 2NU4E 3PM3A 1AQ7A 4TPYA 3RC5A 1AMHA 6GCHG 3RXMA 2WPIS 3UREA 1BJVA 4AOQA 4Y8YA 2NU1E 3T2NA 3PMJA 2HLCA 3KGPA 3ZZ8A 3RXAA 5HIYA 3TJUA 5C3NA 1ELAA 1C5WB 3F9HA 2CF9H 2Z7FE 1K1PA 2BD5A 5FL7D 1ELEE 1AE8H 1CHOF 2JETC 3RU4E 4H6TA 2GCTB 2PSYA 1GJCB 1GBAA 4NIYA 1QA7A 1GI6A 3BTFE 6LPRA 3MO9A 1YLDA 2GV7A 4UDWH 4ACBA 2PV9B 1WV7H 2G55A 4DURA 4NIVA 5C67A 4I8KA 1QHRB 1PPGE 2OBOA 3QUMP 2ZDMA 3MWIU 1WQSA 2O8WA 1AHTH 3SYJA 1BDAA 3D23A 1NT1A 1G3DA 2RCEA 5EG4A 1CO7E 4XRNA 1C2EA 5EPYA 3SZNA 5F03A 1ZMNA 1C2LA 1VITG 1ZOMA 2FMJA 5FPYA 5EJ1A 1VZQH 1CGIE 1KLIH 1MQ5A 1P01A 3BTME 1N8OB 1S6FA 4Y6DA 4A7IB 1G37A 2KZ4A 3OEED 1BBRE 1C5ZB 2UWPA 1DFPA 4ABIA 2ZPRA 5EXMA 2J9NA 3MHWU 1LVYA 2YMSD 1B0EA 2GD4B 2PW8H 1J14A 1OOKB 2BQ7B 1V2WT 1F5LA 4B2AA 4BAKB 1RJXB 4HTCH 1Z8IB 3HK3B 1F0SA 3VB7A 2VIDA 1S0QA 2FTMA 2Y5GA 4FUCA 4IN1A 2Z6BD 3SNBA 2FYRA 2ZQ2A 2BD4A 1SGQE 4CBNA 4JK6A 4GUXA 1TMUH 2OQUA 1DDJA 2EI8A 2ANKH 5HMAA 1GBCA 1JOUB 1ZGIA 4FU8A 1EAXA 1IHSH 5DJ7A 3TU7H 3BIUH 3P8GA 2VWOA 1DLEA 1EJMA 2ASUB 1Y5AT 1KIGH 2Q6FA 1K28D 5AHGH 2VB0A 2XXLA 5A09A 1GBHA 5LGOA 4Y76A 2GP9B 4LXBH 4BXSA 1SL3A 2ZU4A 1ZSJA 1TX6A 6ESTA 1T32A 1TGTA 1TGCA 2W26A 3A7VA 1ZPCA 1NFWA 2KAIB 3U28C 2Z9LA 4RKJB 3SGAE 1TIOA 3EAJA 3RMOH 4KTSA 1WUNH 2A4GA 2D1JA 4IMZA 1YWUA 4YLUA 3TNSA 4FUIA 1KDQB 2BY8X 3VXEH 4QT8C 3BSQA 1V2TT 3GY4A 3UOPA 4YT7H 1TMBH 5DP8A 1QFKH 4ASUD 1DWDH 3A81A 2JIZD 2QE7D 5SGAE 6CHAB 3ZVFA 5L6NH 1O2LA 5T3HA 5FXLA 4IW4E 1Q3XA 2HGTH 3GY7A 2V35A 1YGCH 1JIRA 3V3MA 1TGNA 1O32A 3L33A 2W3KA 4ASHA 5DSFA 2P93A 3A8BA 4DT4A 1XVOA 4O9VA 5DP3A 1P8VC 3A85A 4KGAA 3VEQB 1C5VA 5EQRA 5DN6D 1ELFA 1EAUA 3OYPA 1W0KD 1AD8H 1BTUA 1U6QA 2G5VA 2KCOA 1AB9B 3LGTA 5DP9A 1HXFH 1OYQA 1UK4A 2J4IA 3KEEA 8GCHG 2BTCE 1WCZA 3RXQA 1FPCH 3TITA 4BAMB 2J94A 2QF5A 3P70B 2BLWA 5GXPA 3UPEA 1UCYE 2A0QB 4E7NA 2HOBA 5JDUB 4Y7AA 2W7SA 5A0BA 4K5ZA 3UUZA 1FV9A 1QJ7B 2K0QA 3VGCC 1TQ0B 1O3CA 1S0RA 2OQ5A 4WH6A 2L74A 1VITH 4IGDA 3SV8A 3VB6A 3DFJA 2YNBA 3SJIA 5AF9H 1DITH 1AUTC 4Q2KA 2NU3E 2CXVA 1W2KH 1MU8B 4IN2A 3ZZAA 3IITA 2KX4A 2ZU2A 1K1LA 3F9FA 1K1NA 3PRBA 4BTIB 1H9LB 3ATKA 4K69A 2YMSB 1QB1A 1SBWA 1V2OT 2R3YA 1NESE 3EGKH 1K1JA 3SNEA 4D9QA 2V0BA 1KXDA 3VFEA 2H9EH 4TWYA 3LGUA 3HGPA 1THRH 2BDAA 1C5QA 2ZDNA 3ATMA 1ZYOA 3URDA 2FOEA 2AFQB 2KM0A 1EATA 1EAIA 2OD3B 5E8EH 3TGIE 3MU4A 1G2MA 1HAIH 3I78A 4MNXA 2BDHA 3U69H 3LH3A 1AO5A 3F3BA 4HFPB 4AGJA 4OM9A 1MCVA 1LMWB 1QQ4A 1AFQB 4H42U 5EXLA 2B5TB 1Z8GA 1AZZA 1TX8A 1VJAU 2GCHF 3RDZA 5C2ZA 1PYTC 1V2UT 1O33A 2ALVA 3ZVAA 4NCYA 3SJOA 3CP7A 4ISNA 4Y71A 1C1NA 3LT3A 2G4UA 3UWJH 1QJ6B 3F9EA 2A2QH 4ZXXH 3IWMA 2VWNA 1QURH 1SI5H 3PMAB 2A4RA 2FPZA 3U9AH 4X2WA 2QGRA 4X6OA 1O2RA 1V2QT 1O3GA 1HFDA 4IC5A 3ZZ4A 1D3DB 2XCNA 2QXGA 2P8OC 5DP7A 1BRAA 4GPGA 1TNIA 1CU1A 1ESTA 4OS2A 4AFQA 2ZWLH 3ZVDA 4ABJA 1GMCG 2WHXA 3UNRA 1BMNH 1BTZA 1O5GH 3R0FA 1TRNA 2ZG0H 1PQ7A 1G36A 1GJBB 2TGAA 3RXPA 3T5FH 1GBLA 1O3PB 4DW2U 7LPRA 1JIMA 1O2OA 1UVPA 2AMDA 4FVDA 1GBDA 3BEIB 1QIXB 1O2QA 5AFZH 1DUEA 1C2JA 1QBNA 3A8CA 4NZLA 1ELVA 2EQNA 2ALPA 2XNIA 3WW7A 1RGQA 1OWHA 1P09A 3NXPA 1Z8JB 3KIDU 3SV9A 1F0UA 2OINA 1GMDF 2BLOA 3RXKA 1GI5A 3BTTE 2A5IA 1KLTA 1GBMA 4RT0A 2ZDKA 1C2DA 2RA3A 3SU0A 5E2OA 2Q6DA 1ETSH 2ZHWH 3ZYEA 1TX7A 2BD3A 1VGCB 1O3KA 4NWKA 1E34B 1D4PB 3ZZ9A 2ZHDA 1RIWC 4OS7A 1MAXA 2OTVA 3A87A 1DX5M 1PQ5A 1V6DA 1SGCA 4MNVA 1FLEE 4I8JA 4OS4A 3DCLA 1C4Y2 4YOGA 2TGPZ 2ZO3H 5T6DA 1LO6A 5TCAA 3TK9A 1SGDE 1JXPA 2XNDD 5J4QA 2JDID 3KCGH 2KCAA 3SU1A 2ODYB 2BMGB 3ZVGA 2HALA 4UFEH 1D6RA 3R3GB 4CH8B 2XBVA 2XC0A 1BBRK 1N8OC 1SG8B 5F8ZA 4P00A 2BB4A 5A0AE 4Z0KA 1GJ7B 2IN2A 3PLKA 3LC5A 2VNTA 2QC2A 1JRSA 4DY7B 5DP5A 3SJ9A 5EW2H 1SQTA 2J5UA 1QZ8A 5L2YH 1TPPA 1W7XH 1ETRH 2C8YB 1D3TB 1HNEE 4DT7B 4NWLA 3ZVBA 2BDBA 3BEFB 1H8HD 3LIWA 3BF6H 3MO6A 4DIIH 4GLYA 3EQ0H 3LPRA 2PWXA 2Y82A 2ZU5A 2A4QA 3GDVA 2ZDVH 1K0HA 4MDSA 3BTQE 4P02A 3TJNA 2V3OH 1C5TA 2VGCB 2FODA 3FVFB 1P03A 3G01A 1PPHE 1LPKB 1HJ8A 1EB2A 1ZGVA 1Y3VA 1QRWA 3ZZDA 1BTHH 1UTLM 2VGCC 1QRZA 4HG6A 2ZHFH 3TIUA 4OS5A 1T8OA 4J2YB 3RXFA 2NU2E 1YC0A 4THNH 3A8AA 2ZECA 1HAPH 3SV2H 1AZ8A 1KXCA 2KAIA 3S7KB 1FQ3A 1OP0A 2GDDA 3P95A 1P3EA 2AGGX 2QIQA 3SNAA 4CHAB 4BANB 3STIA 3DUXH 2ZGJA 3SJKA 1IQLA 2B8OH 1ANDA 1COWD 1UTMA 2EY4C 5DGJA 4Q63A 3GY8A 1GBEA 3TJVA 4D7GA 1NY22 3ZVCA 1OKXA 1SMFE 1S5SA 4R0IA 3BIVH 1GCDA 1IQGA 4BOHA 3ZIAD 4YESB 3QN7A 3OTPA 3AASA 4JZEH 3MU8A 2Y7XA 7GCHG 1TWXB 1O2YA 2PUXB 1J8AA 4OGXA 4DOQA 1OX1A 1F92A 1BRUP 1AI8H 3VG8A 3ESTA 1SLXB 1SGFG 1UW7A 3RXJA 3QX5H 4O97A 3HKIB 2H9HA 1ZHRA 1HLTH 1X7AC 1N6YA 1A0HB 2FO9A 2QV1A 4WXIA 3MU0A 2UUYA 2VIQA 1BQYA 2ZTZA 1AUJA 1ID5H 2SGQE 3I29A 4JCNA 4ZXYH 2BXTH 2C8XB 2ZCHP 3MTYA 6CHAC 1W0ZU 3FP6E 1VJ9U 5JBCS 1O3DA 4BAOB 4DJZB 6GCHF 1XUKA 1GHVH 3BEUA 2A7JA 3S9BA 1XKAC 1GI3A 1EXFA 3F2HA 2F83A 5J4SA 3ATWA 2Z9JA 1S85A 1P05A 1NPMA 2GZ7A 1XXFA 4AORA 2QN5T 4K1EA 1ELDE 2EA3A 2J98B 2RG3A 4UD9H 2TIOA 2BDGA 2FOAA 1LKAA 1GVZA 2XTTB 4AFUA 3KQBA 2A2XH 1O2HA 1CGHA 1NRSH 3UWIA 4WWYA 1S82A 1GDUA 1Y3WA 1SKYE 3RLWH 1ZSKA 1LVOA 5HXFA 2OUAA 2BDCA 1BMAA 5FX5A 1K1OA 5KECA 1ELTA 1TRYA 1GMHG 2TRMA 1W11U 3GS9A 1DXPA 7KMEH 2HNTF 1FXYA 1SOTA 1YYY1 2BVSH 1O2PA 1G32B 1TPOA 1J16A 1BMMH 2QY0B 1QB9A 2UUFB 2H5CA 2FOGA 4LZ4B 1P2MA 2V6NA 1Y3UA 3F1SB 3LJJA 1F5KU 1Y5UT 2ZCLP 4IBLH 1GJAB 1WSSH 2LNCA 1SGYE 4D8NA 1C5SA 3ENSB 1V2NT 1MTNB 3MMGA 4AYYB 4BTUB 4A5TS 3D65E 3FFGA 3RXUA 2Z9GA 3KNXA 1TA2A 1OS8A 2GCHG 2PKAA 5FHTA 3OY5U 5EQQA 3H7OA 1WYKA 2CK3D 2BY9X 1ZTJA 2P16A 1C1VH 2R0KA 4ZCNA 1GMDG 3B23B 1JRTA 4ZAEA 1GHWH 3SNCA 2WYGA 3V0XA 1EPTA 3SORA 1BCUH 1MUEB 2KCPA 4CRBA 3EE7A 4F48B 1DICA 1FY3A 1KY9A 4MNWA 1NFUA 1DLKB 2P95A 3D49H 1QL9A 4BAQB 3MNXA 3QTOH 4CRDA 3RXTA 1C5MD 4WY3A 1YP9A 4GVUA 3KN2A 1UK2A 4GHTA 1IQNA 2ZU3A 1T4UH 4XE4A 2IJD1 4X8UH 2WPHS 4GHQA 3RXVA 1EB1H 1QGFA 2FTLE 4UFFH 1C5UA 1SQRA 2M5TA 3OAAD 3FAOA 2G8TA 1TPAE 2AMPA 1P02A 3UOUA 3M5NA 1F2SE 1XUFA 3VPKA 2VWLA 3NK8A 2VH0A 1AVXA 1Q2WA 3VGCB 3GCHC 1WTHD 2G4TA 2VU8E 3MI4A 4FU7A 4ABFA 1ZJKA 2H9TH 1O31A 2UUKB 3M3TA 4X8TH 3SV7A 4NFEA 3TJOA 3AAUA 4MQAA 5AFYH 1T8LA 1GMCF 1FY8E 1LQDB 3KQ5A 4I8GA 4GAWA 1GDNA 1GJ4H 5DK1A 3TK6A 1BRCE 5BRRE 1MTSA 1O36A 1ZPBA 2J97A 4MTBA 3M5OA 1FN6A 1SC8U 3HPTB 1MKWK 2STAE 4ZKRU 2GCTC 1A0JA 1O2WA 2SFAA 4HI3A 1BHXF 1TQ7B 3PV5A 1NRRH 3LGYA 3FN8A 4X0WU 1O2GH 3M37A 4NSYA 5DPAA 2EC9H 2ZGXH 1FIWA 1T8MA 3MNCA 2L6OA 4FUJA 1O3BA 2BD9A 4DVAU 4IS5A 2PKSB 1C1MA 2G5NA 4CRCA 1BJUA 3T28A 2ZTYA 3I77A 1DXWA 4ZUHA 3BG8A 1DY8A 5CHBA 5CDFE 1YPHE 5C0UA 4I8HA 4BXWA 4ZKOU 2R2MB 1P2KA 3RMNH 4K3JA 4LOYH 1LHEH 1SOZA 2CHAC 1EUFA 5ABWA 2VIVA 1UHBB 2PGBB 2ZTXA 1Y3XA 2ULLA 1O5CB 1DWBH 4B6FA 1P3CA 5GJ4B 2QCYA 1TONA 4JZFH 1YPJH 2PP6A 5FX6A 2ZC9H 2AMQA 3KHVA 4XBBA 1LVMA 5B6LA 5JB8S 4CH2B 4DIHH 3TGKE 1NBME 3P17H 3KYFA 2C90B 4YM9A 1LPGB 1UCYK 1MTUA 1A46H 3EDXB 3RXRA 1ELCA 1PFXC 1NC6A 1BTYA 1O3FA 5A8XA 5HYOA 1PPFE 2R0LA 4FETA 8ESTE 3M61U 3TNTA 4INHA 1MZDA 1TRMA 2B0FA 3UFAA 4JYUH 1AN1E 3A80A 1O5DH 1A1RA 4E06H 1P10A 2M2AA 2NU0E 3WY8A 2A32A 1ABJH 2D26C 2A4OA 1ELBA 1FIZA 3PMBB 3MH6A 1C4V2 1K2I1 1V2PT 1S83A 2PLXA 2R2WU 3M35A 1MKXH 1MTVA 3RXEA 1HUTH 1ZHMA 4KELA 1YBWA 4CHAC 4LZ1H 2WUBA 2WUCA 1ANCA 1CVWH 2ODQA 2ZDLA 3SNDA 1IQJA 5B6OA 1V2KT 2PTCE 3E16B 5DKMA 3SQEE 4KP0A 5C5NA 1P12E 1C2FA 1P57B 2C8WB 2RDEA 4DG4A 5E2PA 1EPTC 2IOTA 2IJOB 4YZUA 1SGFA 1ZLRA 4X6MA 2CHAB 1ZTKA 1HRTH 1KYNA 1RXPA 3VB3A 2QF0A 1GI0A 1SGPE 3A88A 4NIXA 2ZHEH 5KGOA 3Q3KA 2BD2A 1Y8TA 4UFDH 1Y5BT 2TGTA 1KSNA 1BTPA 1EJAA 3E3TA 2JKHA 1JBUH 3RU4T 1Q31A 2PKSC 5F6MA 1GG6B 5C17A 1TOMH 4UONA 4I7YH 2IPQX 2PFEA 3F2GA 8KME2 5L2ZH 1DY9A 1J17T 1MZAA 4ESTE 3GYLB 1O39A 2FI4E 2FWWA 1A0LA 3FZDA 1FY4A 2GDEH 2GKVE 1TMTH 1ZPZA 2HVYB 1EX3A 4I31A 1IQFA 3A7YA 1A5HA 2XWBI 2OC1A 4Y8XA 1PPCE 1OWIA 3KF2A 1EJNA 3BG4C 5FBEA 2J34A 2QF3A 3QGJA 4TWWA 5HIZA 3S9AA 1C2IA 1HAGE 1L1GA 1YKTA 3PRDA 5A2MH 1FY1A 2HPQH 1DWEH 1S84A 2O9QA 3KL6A 2JH0D 2WYJA 1AKSA 1HIAB 1TPSA 1QJ1B 2SNVA 2GVFA 3QZQA 1TE0A 1OWEA 2KFWA 4ISHH 1CT2E 5C1UA 2BVRH 1O2IA 1OP2A 3H7TA 1O3AA 1OSSA 4YXWD 1P11E 3GICB 3TVJB 2FI3E 1O5AB 1MMJN 1XX9A 3IG6B 2BLVA 2P3TB 4NZQA 1C5YB 5HM2A 3D62A 1GBKA 3VB5A 1H8ED 4B71A 4X1NU 1E1RD 3A7ZA 3AW1A 4RI0A 1Z6EA 1BUIA 1E36B 2JH5D 4XFQA 3KYGA 3MNSA 3MNBA 1TNGA 2AIQA 4JZ1A 4AX9H 1C9TA 4OS1A 2WPJS 1P9SA 3RXLA 1O5BB 1K21H 4MG3A 3RXOA 1CA0B 3SHCH 4ABBA 1OXGA 1UTNA 2YNAA 3RP2A 1F7ZA 1K22H 1SLWB 3PROA 1KMHB 4AZ2B 2J2UA 2GJGA 1KXAA 1PPEE 4YT6H 5CE1A 1BMLA 1V2JT 3UB0A 1XMNB 1K1IA 2F9UA 3E6PH 1E35B 2Y81A 2Y5HA 1EP6A 1EZUC 1DSUA 2YOLA 5DO4H 1EOJA 3T25A 2V7QD 2I6SA 4Y7BA 3V13A 1O5EH 3LDXH 3RUOA 1W0JD 3GDSA 3ZZ3A 1CT4E 3BTHE 2A5AA 4LK4A 3LJOA 1IQHA 1E0FD 1GWAA 3JZ1B 3QDZB 3PMHB 1SR5C 1FDPA 1H8DH 4Y0YE 2GGVB 2YMSC 2FXRA 1UJ1A 2F9OA 1W7GH 1TBZH 2J95A 1UTPA 1QY6A 2ZPQA 1XUGA 4A6LA 4ACAA 2CF8H 4WMFA 3DSGA 4AB8A 1AIXH 2PR3A 4ZHMU 4DCDA 4X8SH 1C2KA 1GJ9B 1EKBB 3K65B 3LOXA 1H9HE 5EW1H 3PLPA 1GI9B 4XDEA 5DP6A 1MD7A 3RC6A 3GY6A 1DUAA 3MO3A 2WPKS 3NZIA 2Z3EA 3OSYA 2Q1JA 3UR6A 5KEDA 4TY6A 5JYIA 4UEHH 3BTGE 3GY5A 4FU9A 3GCOA 3RXGA 3ZVEA 1RTLA 1IQIA 3ATIA 1EFRD 4I86A 1ACBE 1LHFH 1O0DH 1WQVH 3RXCA 3AK5A 5HGGA 1BTWA 1DWCH 3P92A 1KTTB 1UVSH 1XVMA 4X2VA 1A4WH 4XBCA 1CT0E 3ZV9A 1HAYB 3F68H 1ZTLA 3A7WA 3SUFA 1WAYB 5C1YA 1HAXB 1A5GH 1O2MA 3K6YA 3F0OA 1QL8A 1F0TA 2WPLS 4Y11E 2STBE 2JH6D 2K1QA 2WV9A 3A7TA 3OTJE 3U8OH 1BITA 4VGCB 1GI8B 4NA8A 2G00A 2BM2A 1P9UA 4WMEA 1QR3E 5T1VA 2CN0H 3VB4A 2UUJB 2Z3CA 5C94A 2A7CA 4B74A 1LDTT 4RT1A 5H4IB 3SU4A 1TLDA 1LVBA 3SU3A 3W94A 2UWLA 3WWBA 2ESTE 2HNTC 4NSVA 4WJG2 1KTSB 1G2LA 1W3CA 2O8TA 2GZ8A 3QK1A 3URCA 2VINA 2TPIZ 1V2MT 1GMHF 1KDQA 3OEHD 3Q3XA 1RD3B 1B7XB 2RDLA 3Q00A 3DD2H 4CR9A 4YTAA 1UTKA 1Z8RA 2B9LA 1O3EA 3EYDA 1DE7H 4NGAH 4DGJA 1O30A 5GCHG 3MFJA 1T4VH 4JYTA 1ZZZA 2PSXA 5EQSA 4X6NA 5HKKD 4FUBA 4X1QU 5E0HA 3FOAA 5IK2D 1BT7A 4I8LA 4K8BA 2ZFPH 3P8FA 3RM0H 1UK3A 1FX0B 1EZXC 1NFYA 2OXSA 1O34A 3SJ8A 1YPGH 2WPMS 4F55A 1K1MA 1K9OE 1O3NA 3F2FA 1VCWA 2QF4A 8GCHF 3FO8D 1HAVA 3RM2H 1QBVH 1T31A 4MPUA 1W12U 3SZEA 3ZZ7A 1CHGA 1UVOA 1B5GH 3SUGA 1C5XB 5ESTE 5LPRA 2FOCA 2ZNKH 1TALA 2VVVA 4XD7D 1ZJDA 1C1PA 1ESBA 2VVCA 1FMGA 1O5FH 2ZDAH 3UTUH 4E7RG 1ZRKA 1AVWA 1RIWB 1YPHC 3LGIA 4CBOA 3SGQE 5EXNA 1LPZB 1LCYA 1EPTB 2K8IA 3QGNB 4PROA 1H1BA 4A1TA 3MU5A 4OGYA 1GBBA 1CBWB 5FPSA 2O8UA 5JBAS 1RS0A 2XBWA 3SU2A 1M9UA 4F49A 3U1JB 1KXFA 1CE5A 1THSH 2XCFA 3SGBE 2CJIA 1IQKA 1A3BH 1PJPA 5G4BA 1AWHB 1IQEA 1GHBG 1PQ8A 2UWOA 1GCTC 1GJDB 2QXIA 3M7QA 3V7TA 1WDIA 4FVBA 5ETXA 2BDIA 2A5KA 3BN9A 2HLDD 2BZAA 3P6ZB 4ABDA 1CGJE 3LH1A 1SQAA 1DOJA 2VH6A 2AIPA 2ANMH 1BZXE 5GCHF 2H5DA 1CHOG 3EA9A 5EJLA 3ZZCA 2BY6X 4CRGA 1DANH 4U30A 4CREA 3RLYH 1GDQA 8LPRA 1Z1JA 4JZIA 1WXRA 2P8OB 3RC4A 2ANYA 2Q6GA 1OYTH 2OBQA 1JWTA 2OP9A 3B8JA 3C27B 1YPEH 1MTWA 5LPFA 1HAVB 2D2DA 3SI4H 3FKSD 1HV7A 3KQCA 1Z71A 3PTNA 1AKSB 1HIAA 1C2HA 5EIYA 1GL1A 3SU6A 3PWBA 1GHAF 1ELGA 2Z3DA 2WSSD 3OY6U 1D9IA 1KXEA 3CNRA 2TBSA 1AVGH 4B75A 3EA8A 1HGTH 3GYMA 1QBOA 3M3VA 2BQWB 1BRBE 4R8TB 3BTEE 3NPSA 4BTTB 5EGMA 3TH3H 1MAYA 3SV6A 2GZ9A 2ANWA 5BPEA 1DM4B 1TGBA 4K60A 3EE0B 4X6PA 1S6LA 3NCLA 4FOUC 1OPHB 4TT3D 3PV2A 3CS0A 2KCYA 1Y3YA 3A84A 2FIRH 2XOKD 4ISLA 2DE9A 5T6FA 3ZZ5A 3N7EA 3EA7A 1FI8A 2OC7A 1C4U2 2HRVA 1H4WA 3Q3YA 1FJSA 1HAOH 1TNLA 1O3HA 2SGFE 1C5OH 5GPIB 3M5LA 3SI3H 1NRPH 4X1RU 1UVTH 1D6WA 1OWKA 3W1EA 2FS9A 2C93B 2Y6TA 3TPIZ 2QXJA 2SNWA 5CHAB 5LPEA 1YF4A 1L1JA 1A2CH 2C8ZB 1DVAH 3LC3A 1OHHD 1A5IA 1EZSC 1SGRE 1YLCA 4MPWA 1O3MA 1SFIA 1O38A 2ZFTA 4AFZA 2F43B 1LHDH 3LKWA 1PQAA 3DHKH 3SUDA 5IYTA 2A7HA 3OE7D 1W0YH 1EP5A 2ZFRH 1C5RA 4ZROA 4A1VA 4OS6A 1SHHB 1Y59T 1CSOE 2AEIH 1UTOA 3T62A 1AWFH 3K9XB 3SHAH 4U01A 1BIOA 5JB9S 1SHYA 2DUCA 1GGDB 1NFXA 2BVXH 1BB0B 4A92A 5FBIA 1QQUA 2AERH 4Q80A 3STJA 1GBTA 3M3SA 2P94A 4ISIH 1QL7A 1LKBA 1A3EH 2QAAA 1AE5A 1GGDC 1P04A 1O37A 4AG1A 1ZRBA 1Z7KA 2OLGA 3AVZA 3ZYDA 1V2VT 2EEKA 5A0CA 2ZKSA 4WMDA 2FS8A 4ZKSU 5DG6A 2FOHA 5L30H 1MBQA 2W6ID 4GCHG 1HAHH 4K8YA 5K7RA 3GCHB 4TY7A 2R3UA 3M7UA 1HJAC 3TH4H 5K0HA 1WU1A 2WPDD 4NG9H 2HWLB 1TNKA 5E0GA 1GHYH 5JPMH 1QRXA 1RTKA 1N1LA 2SGEE 2BHGA 1GHBF 1HDTH 5FCKA 2H6MA 1FZZA 1RTFB 4AC9A 1YCPM 1OP8A 3S7HB 2JJ2D 1G3EA 2A31A 4AFSA 1L4DA 1GVKB 1O3LA 5E0JA 1D3QB 1C1RA 2BX4A 1O2JA 1KLJH 1C1QA 5C5OA 3RU4D 1D3PB 3OX7U 1C1SA 5EOKA 1SB1H 1EAWA 4O3UA 5EPNA 2FEQH 5ESBA 2CGAA 3LGVA 1GVLA 1ORFA 3E0PB 4ABAA 3DSOA 1MTNC 1F0RA 2ZCKP 3GY2A 3U98H 5HM9A 4JYVH 5DP4A 3ZV8A 2HVXA 1S6HA 1CA8B 1VCPA 1S81A 1HAZB 2P3UB 3ITIA 1IAUA 3LONA 2JJ1D 1FAKH 1P0SH 2BQ6B 1ZHPA 3A89A 1AFEH 1P2IA 2HNTE 1W8BH 2WZQA 2XWAA 1TA6A 3H09A 4K1TA 2ZQ1A 1NO9H 1LTOA 2GMTC 1TAWA 3MH7A 1SPJA 2P59A 1WBGB 2VIPA 4H4FA 1DS2E 4E05H 5C20A 2VVUA 2Z94A 9LPRA 2H2ZA 1EASA 3GISB 5A8ZA
chains in the Genus database with same CATH topology
2O8MA 2JETB 2F9PA 4F4OC 2AS9A 3LU9B 1WOFA 3L3TA 4CR5A 4HGCA 2F91A 1V2RT 1NROH 2NWNA 3M7TA 5IDKA 1MH0A 3Q77A 1VITF 3SU5A 1SGEE 3O8DA 4Q7ZA 1MKWH 1NU7B 2AGEX 1TNHA 1C1TA 1AFQC 3E90B 1YPKH 4X1PU 3SW2B 3U1IB 2C4FH 3GOVB 1O2VA 1ZR0A 2QA9E 2BDYA 3OU0A 2W5EA 1XUHA 3ODDA 1GJ6A 1UCYH 1QNJA 3FZZA 4TYDA 1OWDA 2XC5A 1Z6JH 2ZFFH 4GSOA 2CV3A 1O3IA 9ESTA 2F9VA 3DA9B 4AYVB 1UVUH 4AG2A 5FPTA 3MH5A 2VIOA 1IHTH 4J1YA 2ZZUH 4XBDA 2THFB 3KQDA 1ESAA 1H9IE 1LHCH 1NRNH 3E0NB 3E1XB 1O3OA 2BXUH 3NUMA 3DFLA 5LH8A 3PTBA 4JZDH 4JK5A 4RSPA 2FESH 4B76A 1UTJA 2XC4A 4WXVA 5GIBA 1HPGA 1XM1A 4WVPE 1CBWC 2BLQA 2FOMB 2PHBA 4ISOA 2Y80A 1BOQA 2I6QA 5PTPA 2FP7B 2F9BH 3BTWE 1FONA 2BOHB 1QTFA 1GHXH 1NS3A 3RXBA 2W3IA 1C9PA 4MLFB 4VGCC 4M7GA 4NA9H 2G81E 1VGCC 3F6UH 1IOEA 3GCTG 3QO6A 3RMLH 2VJ1A 4SGBE 2BD8A 3T29A 1XUJA 4ABGA 3UR9A 2O8LA 1T7CA 2VWMA 2BYAX 1HJ9A 2FI5E 1HXEH 1THPB 1YCPK 1DSTA 1QA0A 1TB6H 1QCPA 2WINI 1G3BA 2J38A 1RFNA 3M36A 5TJXA 3UIRA 4Z6AH 1OWJA 1W13U 1GPZA 3U8RH 2CMYA 3RXDA 2VIWA 4RN6A 3LGWA 2ZFSA 2F3CE 4Q7XA 3MOCA 3M5MA 1NN6A 4ABEA 1AGJA 2H1UA 1O2NA 1GG6C 1ABIH 2G52A 2PKAB 3BTDE 1FUJA 2XW9A 2A45B 1LQEA 4X2XA 3TGJE 1INCA 4X2YA 1O35A 1TOCB 3CS7A 3MYWA 3F9GA 1C5NH 4HZHA 1LHGH 3HK6B 3ODFA 1UHBA 1GJ5H 1C2MA 1P2JA 2OC0A 4AN7A 2ZP0H 1C1UH 2QYIA 2IPHA 1SQOA 1SVPA 3MU1A 3PO1C 4JMYA 1TBRH 1GBFA 3BG4B 2FDAA 1T8NA 3O8RA 2Y7ZA 4INLA 3A7XA 1GL0E 1GHZA 2BOKA 3GDUA 4TPIZ 4B73A 5TCCA 4U32A 4FUFA 2SGAA 4NFFA 2AYWA 1TABE 1UO6A 1BBRH 4XSKU 1GHAG 2AGIX 1GI7B 4UFGH 2R9PA 4X8VH 3H5CB 2BY5X 5A8YA 1HBTH 5CMXH 4O03A 4XOJA 3E91A 5EODA 4WH8A 2TGDA 3FP7E 1V2LT 3TK5A 4MPVA 3SO3A 1E38B 2ODPA 2ILNA 2D8WA 1J9CH 2V3HH 2FLBH 1Z1IA 1GI1A 4K2YA 2OCVB 1VCQA 1UMAH 1O2KA 4Y0ZE 1L2EA 1NM6A 1O2XA 1O2TA 3AAVA 3QZRA 2PUQH 1GCTB 1BA8B 5F8XA 4IC6A 4D9RA 4YOIA 3HGNA 1L0ZA 1CA0C 1A7SA 4I32A 5EU8A 3RMMH 4D76A 1YM0A 4Y79A 2ZEBA 3UNQA 4ZKNU 1ARBA 4ABHA 1C2GA 1EOLA 1YCPH 1ZSLA 2G51A 1VR1H 1ANBA 1G9IE 4H6SB 3RXSA 3JZ2B 5C1XA 4YLQH 2C3SA 1G3CA 4B2BA 2FLRH 3PWCA 3UY9A 1GJ8B 1P2OA 3L6PA 5GWZA 1EZQA 2QXHA 7GCHF 2A1DB 3N7OA 1AB9C 3E8LA 4MVNA 3UNSA 4AGKA 1EQ9A 2Y5FA 3SOSA 1G30B 2FOFA 1GI2A 2BY7X 1SGNE 3K2UA 1FPHH 3W95A 3BTKE 3B9FH 1O2SA 1XUIA 1NU9A 3SN8A 2FX6A 2PGQB 1XKBC 1SLUB 2SGDE 4FUDA 2ZFQH 2ZGHA 2GT8A 2EI7A 4ZHAA 3PO1B 1C5PA 1MU6B 4NA7A 2BZ6H 3AW0A 4ZMAH 5GDSH 3QTVH 4ZHLU 4FXGH 1L1NA 1PYTD 1ZMLA 1V3XA 4Q7YA 1SGIB 3ATLA 3T27A 2ZU1A 3S0NA 2ZGBH 4B2CA 1QB6A 2XRCA 3GCNA 2ZI2H 4D7FA 2DE8A 1TNJA 1NRQH 2EI6A 1ANEA 1O3JA 4Y10E 2AH4X 3QLPH 4SGAE 3NKKA 3U8TH 3S9CA 1CQQA 2GT7A 3FP8E 5CHAC 3KQEA 3UQVA 2J92A 1WTGH 7ESTE 1P2NA 1J15A 3HKJB 3FANA 1P2QA 1GI4A 3RXIA 1NTPA 4YO9A 1MCTA 3ZZ6A 4MPXA 3PYHA 2FX4A 2FYQA 1HCGA 2ZA5A 3DT0H 3MH4A 3PV4A 1ETTH 2GTBA 2FM2A 4NIWA 1GBJA 1F5RA 4BNRA 1C1WH 1RRKA 3CENA 3TLOA 1MQ6A 1E37B 4MNYA 1SGTA 1KXBA 2ZGCA 4CRFA 2F9NA 4B1TA 5JBTA 3PLBA 1HJAB 1SFQB 1C1OA 1FY5A 1DPOA 2GMTB 2XBXA 4FUGA 3NWUA 1B0FA 3VXFH 4UE7H 1SLVB 1NZQH 5T6GA 5JBBS 3V12A 4WF8A 3PB1E 5AVDA 1L4ZA 1DT2A 1FN8A 5FCRA 4A1XA 1FNIA 3K6ZA 1BTXA 2P3FH 3SQHE 1MKXK 3P8OA 4ZH8A 2RA0A 4I33A 2Z9KA 3ZZBA 3GCTF 2W7UA 1XXDA 2OC8A 3BV9B 4Y8ZA 1O2ZA 2ZIQH 1FAXA 2WV4A 3QWCH 1PPZA 5F8TA 3A8DA 2LPRA 1IQMA 5I46H 2PTNA 1GBIA 1TGSZ 4FUHA 1ZMJA 1A61H 2FOBA 4AB9A 1H8IH 3C1KA 1UTQA 2XYAA 1HB0B 2ZPSA 4CRAA 1ARCA 1W14U 2ZF0H 3Q76A 2HPPH 1AU8A 3A83A 4RKOB 1HYLA 4X1SU 3SBKA 3A86A 1YPLH 4BAHB 2B7DH 3SUEA 1MD8A 1BHXB 3GY3A 3P8NA 4IMQA 4GCHF 2GV6A 1PPBH 3TH2H 3RXHA 1SSXA 1JMOH 1N6XA 1V2ST 2FZZA 1TFXA 2SGPE 3T26A 2GX4A 4KKDA 3S69A 4U2WA 1TYNA 3HATH 3UQOA 1W10U 2XBYA 2BD7A 3A82A 4YOJA 1YPMH 2WV5A 4INKA 5FAHA 4KTUA 2ZHQH 1P06A 1TBQH 2Z9IA 5I25A 4K1SA 2BX3A 1C5LH 3O8CA 1MBMA 4O3TA 3ELAH 1O2UA 3O8BA 4FUEA 1AY6H 4KTCA 2NU4E 3PM3A 1AQ7A 4TPYA 3RC5A 1AMHA 6GCHG 3RXMA 2WPIS 3UREA 1BJVA 4AOQA 4Y8YA 2NU1E 3T2NA 3PMJA 2HLCA 3KGPA 3ZZ8A 3RXAA 3TJUA 5C3NA 1ELAA 1C5WB 3F9HA 2CF9H 2Z7FE 1K1PA 2BD5A 1ELEE 1AE8H 1CHOF 2JETC 3RU4E 4H6TA 2GCTB 2PSYA 1GJCB 1GBAA 4NIYA 1QA7A 1GI6A 3BTFE 6LPRA 3MO9A 1YLDA 2GV7A 4UDWH 2PV9B 1WV7H 2G55A 4DURA 4NIVA 5C67A 4I8KA 1QHRB 1PPGE 2OBOA 3QUMP 2ZDMA 3MWIU 1WQSA 2O8WA 1AHTH 1BDAA 3D23A 1NT1A 1G3DA 2RCEA 5EG4A 1CO7E 1C2EA 5EPYA 3SZNA 5F03A 1ZMNA 1C2LA 1VITG 1ZOMA 2FMJA 5FPYA 1VZQH 1CGIE 1KLIH 1MQ5A 1P01A 3BTME 1N8OB 1S6FA 4Y6DA 4A7IB 1G37A 1BBRE 1C5ZB 2UWPA 1DFPA 4ABIA 2ZPRA 5EXMA 2J9NA 3MHWU 1LVYA 1B0EA 2GD4B 2PW8H 1J14A 1OOKB 2BQ7B 1V2WT 1F5LA 4B2AA 4BAKB 1RJXB 4HTCH 1Z8IB 3HK3B 1F0SA 3VB7A 2VIDA 1S0QA 2FTMA 2Y5GA 4FUCA 4IN1A 2Z6BD 3SNBA 2FYRA 2ZQ2A 2BD4A 1SGQE 4CBNA 4JK6A 4GUXA 1TMUH 2OQUA 1DDJA 2EI8A 2ANKH 5HMAA 1GBCA 1JOUB 1ZGIA 4FU8A 1EAXA 1IHSH 5DJ7A 3TU7H 3BIUH 3P8GA 2VWOA 1DLEA 1EJMA 2ASUB 1Y5AT 1KIGH 2Q6FA 1K28D 5AHGH 2VB0A 2XXLA 5A09A 1GBHA 5LGOA 4Y76A 2GP9B 4LXBH 4BXSA 1SL3A 2ZU4A 1ZSJA 1TX6A 6ESTA 1T32A 1TGTA 1TGCA 2W26A 3A7VA 1ZPCA 1NFWA 2KAIB 2Z9LA 4RKJB 3SGAE 1TIOA 3EAJA 3RMOH 4KTSA 1WUNH 2A4GA 2D1JA 4IMZA 3TNSA 4YLUA 4FUIA 1KDQB 2BY8X 3VXEH 4QT8C 3BSQA 1V2TT 3GY4A 3UOPA 4YT7H 1TMBH 5DP8A 1QFKH 1DWDH 3A81A 5SGAE 6CHAB 3ZVFA 5L6NH 1O2LA 5T3HA 5FXLA 4IW4E 1Q3XA 2HGTH 3GY7A 2V35A 1YGCH 1JIRA 3V3MA 1TGNA 1O32A 3L33A 2W3KA 4ASHA 2P93A 3A8BA 1XVOA 4O9VA 5DP3A 1P8VC 3A85A 4KGAA 3VEQB 1C5VA 5EQRA 1ELFA 1EAUA 3OYPA 1AD8H 1BTUA 1U6QA 2G5VA 1AB9B 3LGTA 5DP9A 1HXFH 1OYQA 1UK4A 2J4IA 3KEEA 8GCHG 2BTCE 1WCZA 3RXQA 1FPCH 3TITA 4BAMB 2J94A 3P70B 2BLWA 5GXPA 3UPEA 1UCYE 2A0QB 4E7NA 2HOBA 5JDUB 4Y7AA 2W7SA 5A0BA 4K5ZA 3UUZA 1FV9A 1QJ7B 3VGCC 1TQ0B 1O3CA 1S0RA 2OQ5A 4WH6A 1VITH 4IGDA 3SV8A 3VB6A 3DFJA 2YNBA 3SJIA 5AF9H 1DITH 1AUTC 4Q2KA 2NU3E 2CXVA 1W2KH 1MU8B 4IN2A 3ZZAA 3IITA 2ZU2A 1K1LA 3F9FA 1K1NA 4BTIB 1H9LB 3ATKA 4K69A 1QB1A 1SBWA 1V2OT 2R3YA 1NESE 3EGKH 1K1JA 3SNEA 4D9QA 2V0BA 1KXDA 3VFEA 2H9EH 4TWYA 3LGUA 3HGPA 1THRH 2BDAA 1C5QA 2ZDNA 3ATMA 1ZYOA 3URDA 2FOEA 2AFQB 1EATA 1EAIA 2OD3B 5E8EH 3TGIE 3MU4A 1G2MA 1HAIH 3I78A 4MNXA 2BDHA 3U69H 3LH3A 1AO5A 4HFPB 4AGJA 1MCVA 1LMWB 1QQ4A 1AFQB 4H42U 5EXLA 2B5TB 1Z8GA 1AZZA 1TX8A 1VJAU 2GCHF 3RDZA 5C2ZA 1PYTC 1V2UT 1O33A 2ALVA 3ZVAA 4NCYA 3SJOA 3CP7A 4ISNA 4Y71A 1C1NA 3LT3A 2G4UA 3UWJH 1QJ6B 3F9EA 2A2QH 4ZXXH 3IWMA 2VWNA 1QURH 1SI5H 3PMAB 2A4RA 2FPZA 3U9AH 4X2WA 2QGRA 4X6OA 1O2RA 1V2QT 1O3GA 1HFDA 4IC5A 3ZZ4A 1D3DB 2XCNA 2QXGA 2P8OC 5DP7A 1BRAA 4GPGA 1TNIA 1CU1A 1ESTA 4OS2A 4AFQA 2ZWLH 3ZVDA 4ABJA 1GMCG 3UNRA 1BMNH 1BTZA 1O5GH 3R0FA 1TRNA 2ZG0H 1PQ7A 1G36A 1GJBB 2TGAA 3RXPA 3T5FH 1GBLA 1O3PB 4DW2U 7LPRA 1JIMA 1O2OA 1UVPA 2AMDA 4FVDA 1GBDA 3BEIB 1QIXB 1O2QA 5AFZH 1DUEA 1C2JA 1QBNA 3A8CA 4NZLA 1ELVA 2ALPA 2XNIA 1RGQA 1OWHA 1P09A 3NXPA 1Z8JB 3KIDU 3SV9A 1F0UA 2OINA 1GMDF 2BLOA 3RXKA 1GI5A 3BTTE 2A5IA 1KLTA 1GBMA 2ZDKA 1C2DA 2RA3A 3SU0A 5E2OA 2Q6DA 1ETSH 2ZHWH 3ZYEA 1TX7A 2BD3A 1VGCB 1O3KA 4NWKA 1E34B 1D4PB 3ZZ9A 2ZHDA 1RIWC 4OS7A 1MAXA 2OTVA 3A87A 1DX5M 1PQ5A 1V6DA 1SGCA 4MNVA 1FLEE 4I8JA 4OS4A 1C4Y2 4YOGA 2TGPZ 2ZO3H 5T6DA 1LO6A 5TCAA 3TK9A 1SGDE 1JXPA 5J4QA 3KCGH 3SU1A 2ODYB 2BMGB 3ZVGA 2HALA 4UFEH 1D6RA 3R3GB 4CH8B 2XBVA 2XC0A 1BBRK 1N8OC 1SG8B 5F8ZA 2BB4A 5A0AE 4Z0KA 1GJ7B 2IN2A 3PLKA 3LC5A 2VNTA 2QC2A 1JRSA 4DY7B 5DP5A 3SJ9A 5EW2H 1SQTA 5L2YH 1TPPA 1W7XH 1ETRH 2C8YB 1D3TB 1HNEE 4DT7B 4NWLA 3ZVBA 2BDBA 3BEFB 3LIWA 3BF6H 3MO6A 4DIIH 4GLYA 3EQ0H 3LPRA 2PWXA 2Y82A 2ZU5A 2A4QA 3GDVA 2ZDVH 4MDSA 3BTQE 3TJNA 2V3OH 1C5TA 2VGCB 2FODA 3FVFB 1P03A 3G01A 1PPHE 1LPKB 1HJ8A 1EB2A 1ZGVA 1Y3VA 1QRWA 3ZZDA 1BTHH 1UTLM 2VGCC 1QRZA 2ZHFH 3TIUA 4OS5A 1T8OA 4J2YB 3RXFA 2NU2E 1YC0A 4THNH 3A8AA 2ZECA 1HAPH 3SV2H 1AZ8A 1KXCA 2KAIA 3S7KB 1FQ3A 1OP0A 2GDDA 3P95A 1P3EA 2AGGX 2QIQA 3SNAA 4CHAB 4BANB 3STIA 3DUXH 2ZGJA 3SJKA 1IQLA 2B8OH 1ANDA 1UTMA 5DGJA 3GY8A 1GBEA 3TJVA 4D7GA 1NY22 3ZVCA 1OKXA 1SMFE 1S5SA 4R0IA 3BIVH 1GCDA 1IQGA 4BOHA 4YESB 3QN7A 3AASA 4JZEH 3MU8A 2Y7XA 7GCHG 1TWXB 1O2YA 2PUXB 1J8AA 4OGXA 4DOQA 1OX1A 1F92A 1BRUP 1AI8H