2FWWA

Human beta-tryptase ii complexed with 4-piperidinebutyrate to make acylenzyme
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
243
structure length
243
Chain Sequence
IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-guided design of Peptide-based tryptase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Tryptase beta-2
total genus 49
structure length 243
sequence length 243
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2006-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fwwA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fwwA01
4YTAA 1GI0A 1QGFA 2PTNA 4LK4A 3NK8A 2F3CE 2V0BA 1O3PB 1KXAA 1RD3B 4GVUA 3HGNA 1SGRE 1ZMLA 3TK5A 1A5HA 2AFQB 2FODA 1HAVA 2GKVE 3C1KA 2QAAA 4KP0A 2BB4A 2JETC 4CHAB 1CA0C 4X2VA 3LC5A 3M3VA 2FPZA 2O8UA 4X1PU 4Y7AA 2HRVA 3RMMH 4B76A 1AN1E 1P2MA 1UVOA 3BN9A 1Y8TA 2A31A 1O3LA 1P10A 2A7CA 4KELA 1ETTH 1SLXB 1P11E 4AGJA 1HAHH 2ZU3A 1TX7A 1GMCG 1QRWA 3RMLH 3GY5A 2B9LA 3PWCA 5DJ7A 2BVRH 1FN6A 2HPQH 4UFDH 2P3TB 3LDXH 1T8NA 3P70B 2TIOA 5JBBS 1AHTH 1O2SA 1ZZZA 2CHAC 2ZHDA 1RTFB 3GCNA 3LPRA 3M3SA 4X6NA 3ZZ9A 3NPSA 1CBWB 3BG4B 3I77A 5AFYH 1PJPA 2OC8A 2BLVA 4GCHG 3SV2H 4XBBA 1UO6A 2VWOA 1GBMA 3ATMA 1PQ8A 1N8OC 3A84A 3M61U 3L33A 1V2LT 1ZJDA 3GICB 1O5BB 1ARBA 2GT7A 2STBE 3VB4A 1HJAC 4B1TA 1EKBB 1T4VH 1LVOA 1VCQA 2Y81A 1MKWK 3NXPA 1O3NA 1GHBF 1NU9A 2VU8E 1O39A 4WH8A 5FCRA 5FCKA 5A0CA 3K6ZA 1G3DA 4A5TS 1GI3A 2XXLA 1L1JA 1C9PA 1UHBA 1GBFA 4DJZB 3ZV8A 5DP6A 1MMJN 2HGTH 3A7ZA 1GI8B 3MTYA 4UFFH 1L4ZA 1ID5H 3TGJE 2ZDKA 2BVXH 4X0WU 2PR3A 1VGCB 3L3TA 1KXFA 2JH5D 3QGJA 4AYVB 4DVAU 1TPAE 5CHAC 3VXFH 5EQQA 3SOSA 4FUDA 1EX3A 1DWCH 1BTZA 2PUXB 2TGDA 2BQWB 5C20A 1GVZA 4ZXYH 4K5ZA 4NZQA 4TY7A 4B73A 5DGJA 1AE5A 1ESTA 4D9RA 1WV7H 1C2FA 2FOEA 4RKJB 3BTKE 1W0ZU 4I8HA 2Z3CA 1ZPBA 3LGIA 2BLOA 1BTYA 1WQSA 1SGIB 3SU3A 4WF8A 1ELCA 3RXBA 1IQEA 3RXSA 2DUCA 1QBNA 1O0DH 1C9TA 4U2WA 2XC5A 1UVUH 2ZDMA 1GHWH 3PLPA 1KYNA 2FP7B 3ODFA 2W3IA 1RGQA 4NIVA 4AORA 2GVFA 1GVKB 1MKXH 2H6MA 1XX9A 1QB9A 1GL1A 3ZVAA 2VWLA 3A81A 2I6QA 1Z8RA 3SJ9A 3BEFB 3QWCH 1C1OA 3RU4D 1VCWA 2GV6A 3BTDE 3QK1A 1MKXK 3SJ8A 2V3HH 3SU0A 1CA0B 1EOLA 1V3XA 3LGYA 1ZRBA 2Y7XA 5C1XA 2WPIS 1GBJA 5H4IB 8KME2 2ILNA 3MU0A 2D8WA 1Y5UT 1C2GA 1QL8A 1CO7E 2BDAA 4Q7ZA 2QY0B 1F0TA 1TNIA 3RXUA 3EA7A 1ZTKA 2A45B 2ZHQH 3EDXB 4WWYA 1V2UT 1P04A 2BXUH 3ELAH 3LH3A 5JDUB 1Z71A 2EI7A 1O36A 1MTVA 2WPKS 4JZEH 1CBWC 4TPIZ 1BTXA 5FXLA 4YT7H 3TIUA 3A8BA 2F9BH 1GL0E 3P92A 1LKBA 2FI3E 3S9BA 3MH7A 3AW1A 3E90B 3M5LA 1LVYA 1HJ8A 2GZ9A 2Z9IA 4HI3A 4LZ4B 5A0BA 1S81A 3SUDA 2B7DH 3VXEH 1BZXE 1AQ7A 4FU8A 1GJ4H 1VCPA 3JZ1B 3MI4A 4H6SB 4U01A 2ZPRA 3RU4E 3RMOH 1WUNH 1P3EA 3QUMP 1BT7A 6GCHG 1XUHA 4UEHH 2C93B 1WSSH 2BY7X 1GI2A 2OTVA 4Q2KA 1GJ5H 3PYHA 4NG9H 4FUBA 3PROA 1HAPH 2BM2A 1FXYA 2CJIA 1UK3A 1DWDH 3U9AH 1Z1JA 3ZVBA 2XBYA 4Z0KA 3AW0A 1GCTC 1O31A 1SOZA 1YCPH 3A7VA 2JH6D 3SI3H 2C90B 2R3UA 4K2YA 1LPZB 4I8LA 1G37A 4O97A 5LGOA 4IN2A 2OQ5A 2RA0A 2J34A 2PSXA 2VINA 1C1VH 4MPVA 1GI7B 1E36B 3VGCC 1GGDC 1O2GH 1KY9A 4FUCA 4CRGA 1ZTLA 1TYNA 1MQ6A 1D3QB 1PPGE 2WPLS 1Q2WA 4GSOA 3RU4T 2XRCA 1O5AB 4MLFB 4CBOA 1O38A 4GCHF 4NA7A 2TBSA 1O32A 1MZDA 3RC5A 4BOHA 4XBCA 1ELFA 1GI5A 3BIVH 1HAOH 2W7SA 3SNBA 3RC4A 1P2JA 2A1DB 1BTUA 3PLKA 1O2TA 5A8XA 3CENA 3SV6A 1A3EH 1P09A 1TB6H 2TPIZ 1TNLA 1F5LA 1C5NH 2ZGBH 4ISHH 3A8CA 1Y3VA 4H4FA 4DG4A 3SU1A 1YPKH 1Q31A 5E8EH 1YF4A 2R2WU 3FANA 1HAYB 1YLDA 4TYDA 3VB5A 1THPB 5E2PA 3VB6A 2Z9GA 5GCHG 2VNTA 1GJCB 1FAXA 4YM9A 2SGDE 5FPSA 1AKSB 4QT8C 1TPSA 3RXKA 3QDZB 3T5FH 2VJ1A 1UVSH 4GHTA 2OCVB 3O8BA 2H9EH 1FI8A 1ESBA 2PGQB 1K1OA 1NESE 4ASHA 2GMTC 1Z8IB 4K1TA 2ZU4A 2G5VA 1WAYB 1C5ZB 1O33A 1VJ9U 3HK6B 1NC6A 2WPJS 4X1NU 3U1IB 1C2MA 3UR6A 2XNIA 1O2PA 2QXGA 2BDIA 3Q3XA 4FXGH 3V7TA 1LQDB 1DUAA 1K2I1 3TH3H 2NU2E 2B0FA 2PKSB 5K7RA 5EU8A 5FX5A 1W13U 1KIGH 3HKIB 3KHVA 3SO3A 1K1MA 1B0FA 4K60A 1LO6A 3MO3A 2OD3B 2AGGX 3MO6A 4Y7BA 3RXAA 2ALPA 3SV9A 3NWUA 1C1MA 1S5SA 2ZPSA 2GTBA 1WTHD 1GBKA 4AFUA 1TMTH 2ZPQA 2TGTA 1FMGA 1LCYA 2ZTZA 1S84A 1MCTA 2QGRA 3AAVA 1CHGA 4FU7A 1LHFH 5DPAA 4DW2U 3RXEA 3SUFA 1N1LA 3E8LA 1FN8A 5JB8S 1THSH 1VZQH 2AS9A 3RXGA 2O8MA 2YNBA 1P9UA 1TQ0B 4UDWH 3EAJA 3RM2H 4FU9A 1J8AA 4H6TA 1W10U 2VH0A 2A4OA 2QXHA 1UCYE 5FBIA 4BAKB 4NFEA 3E16B 1C1TA 3HATH 1H8IH 2GV7A 2PUQH 3RXCA 2G00A 3W94A 1TA6A 1LMWB 4BXSA 5LPEA 1UTNA 2CN0H 4I8KA 2SGFE 2ZA5A 3VEQB 3LIWA 2ZIQH 1DWEH 1GDQA 1DY9A 4MG3A 4JZFH 2OXSA 2FS8A 1QR3E 2EI8A 2ZWLH 3BG4C 3MHWU 4WMFA 3JZ2B 1C5MD 1G2LA 1O3KA 5C1UA 2FLBH 3MO9A 3A85A 1C5UA 1OWKA 1L1GA 4Y0ZE 2AERH 4O03A 3A7WA 1F7ZA 5IYTA 2G8TA 1LVBA 1CGJE 1EJNA 1V2JT 1JBUH 3S9CA 1ELBA 1P8VC 1FNIA 2GCTC 2Z7FE 1BMAA 3CP7A 3PM3A 5LH8A 1NS3A 4KTCA 1K21H 1CSOE 2ZFPH 1O35A 1TMBH 1XUKA 1TNGA 1DUEA 1WTGH 1J15A 1HJAB 1FY3A 2F9NA 3ZZAA 1QFKH 3K9XB 1SQTA 1DANH 2Z9LA 2G52A 3SBKA 5LPFA 1BRAA 2G81E 1BUIA 3BTQE 3DHKH 2R2MB 3HK3B 4ZKRU 4X1SU 5CE1A 4ABHA 2Z94A 1WYKA 2FOGA 1BTHH 1PQ7A 3RXDA 1Z6JH 4JZ1A 4OGXA 1O3MA 4B71A 1E34B 1BDAA 3WY8A 1MBMA 4OS4A 1V6DA 4A1VA 3T25A 8LPRA 2ZO3H 5JBTA 2WYJA 1YC0A 3SGQE 1W7XH 4B2CA 2J4IA 4GLYA 1NFXA 1JRTA 4Y8XA 1EAIA 4VGCB 3PTNA 5J4SA 3MU8A 1GBLA 1O2OA 4ZHLU 1IHTH 1SGFG 1XM1A 2QV1A 4JMYA 1SMFE 1W0YH 1GMHG 3ATIA 3SUEA 1UHBB 2Z6BD 1VJAU 3BTGE 1DPOA 1ZYOA 1IOEA 4MQAA 2FEQH 2FTMA 1S0RA 4ZH8A 1O2XA 1KXEA 1NRRH 2CMYA 1HXFH 1HXEH 4IN1A 3EE0B 1O2IA 4X6PA 2ESTE 3QX5H 1XXFA 5GPIB 3A8DA 5DK1A 1JOUB 1L0ZA 1EQ9A 1A2CH 4MNYA 1XVOA 1ZHRA 2SNVA 2ZNKH 3SQEE 1T7CA 3M7UA 4D9QA 1C2DA 4E7RG 1AZ8A 3G01A 1V2TT 2VWMA 3RXIA 4X2WA 4AB8A 1Y3YA 1Y3XA 4ABBA 4BNRA 1E37B 1VR1H 2QCYA 2ZDNA 2AIPA 1M9UA 1OWDA 4JYUH 3LT3A 4MNWA 3U1JB 4DIIH 1ORFA 1C5QA 2EEKA 1F0UA 3A86A 4MPXA 2HNTC 2FDAA 5JBCS 3TNTA 4CHAC 2ODPA 4WVPE 3K65B 4RKOB 1H8DH 1GI1A 1E38B 1O2WA 3A87A 5L6NH 4JK6A 3LU9B 4U32A 4M7GA 4Q80A 3DUXH 1FV9A 1RFNA 1GHXH 4WH6A 1GDNA 1C4U2 2GP9B 1W3CA 5T6GA 1SGFA 2BYAX 1Y5AT 5HGGA 1ESAA 1KDQA 1HCGA 1MTUA 1DFPA 2FZZA 1EXFA 3V13A 2UWLA 5DP5A 2BX3A 1O5CB 2ZU2A 4CH8B 1OWEA 1ANBA 1EP6A 1O34A 1HV7A 2ZQ2A 3M5MA 5EGMA 4X1RU 4ZAEA 3IITA 5C2ZA 1C1PA 3P8OA 4BAMB 3U98H 3VB3A 3OX7U 1T31A 4RN6A 2J92A 1KXBA 3MNSA 4BAOB 1NPMA 5JBAS 1V2OT 2VIQA 1A3BH 1L2EA 1TA2A 1T8OA 1LQEA 1TX6A 3KQCA 5EW2H 1FONA 1SGQE 2BQ7B 2C8WB 3KL6A 1OXGA 5DP8A 4OS5A 2ANMH 1U6QA 2O8LA 5TCCA 3TITA 3R0FA 1FJSA 1G3CA 3HPTB 1A1RA 3Q3KA 1J9CH 2FTLE 1JIMA 1DOJA 1DM4B 2D26C 3UNRA 2XCFA 6CHAC 2BDGA 4KTUA 1CT4E 3RXOA 1O2NA 4J2YB 1UK2A 3M37A 3NUMA 1WCZA 5A8YA 1SSXA 4MPWA 1SI5H 1O3EA 3LH1A 1VGCC 2Y82A 2H9HA 1BRBE 2G51A 3LKWA 4Y11E 3F9FA 3PB1E 1NTPA 2XC4A 1V2QT 2JKHA 1O3BA 2ZHWH 5E0JA 2BVSH 3P6ZB 2FI4E 2ZKSA 2C8ZB 1QJ1B 5JYIA 2J94A 5AF9H 2BD2A 4ISOA 1O5FH 1SGEE 1MCVA 1NRNH 4GHQA 2XTTB 2YOLA 1E35B 2FYQA 5DP7A 4K8BA 3UREA 4XDEA 2V35A 1EB2A 3UQOA 1GBIA 2FOAA 2UWPA 1GBDA 1UTJA 4NSVA 3E0NB 1CQQA 4X8UH 2A4QA 3TJNA 2GDEH 3LGWA 4HFPB 4MNVA 1AFQB 2G5NA 4AGKA 4A6LA 1FAKH 3NZIA 4XBDA 1HRTH 2ZDLA 4JZDH 1TWXB 1IQNA 1GBAA 1SHHB 4D8NA 3HGPA 4ZKNU 1BBRH 2KAIA 2A7JA 1QNJA 1THRH 5E0GA 1O3FA 3SV7A 2W7UA 6LPRA 1S6FA 1YP9A 1TRYA 2ZFFH 2ZF0H 3LGVA 1DWBH 2A4RA 3PMAB 1O5DH 2VIVA 3SV8A 1OP8A 3C27B 2H2ZA 3SNCA 1O2KA 2OC1A 5FPYA 1LHDH 3OTJE 1IQLA 2BX4A 2CF8H 2ZFTA 2HWLB 5F8TA 1FLEE 3GCHB 1G3BA 2CGAA 4FUIA 2FXRA 4Q7XA 1K1LA 2FX6A 2OINA 3PO1B 1MTNB 1SGTA 1SFQB 1FDPA 1B0EA 1GWAA 4XOJA 2F91A 4AZ2B 1O3OA 1PPCE 1MU8B 2J95A 5JB9S 1YM0A 2QC2A 2WPMS 1GMDF 3RUOA 1W12U 4LOYH 1SG8B 3GY6A 4KKDA 3TLOA 2NU3E 1QURH 2Z3DA 1SVPA 3BEUA 3V0XA 2VIPA 1RXPA 1Z7KA 4YOGA 4NIYA 1NFUA 2OC7A 2TGAA 3R3GB 1G32B 3TH2H 1TRNA 2AMDA 3FP7E 4FVBA 2Z9JA 2GX4A 1C2LA 3PTBA 3STJA 2A5KA 3DFLA 1HYLA 1MUEB 2B5TB 1O3DA 1F0SA 3FVFB 3RXLA 3SHCH 4IBLH 4WMDA 1YKTA 1K22H 1D6WA 5BRRE 1NZQH 3T27A 2ZP0H 4HTCH 1GBEA 3PMHB 1QQ4A 1RTLA 4JYVH 3QO6A 3T29A 2NU1E 2NU0E 1KSNA 2YNAA 1HGTH 6CHAB 2BY8X 1DY8A 4O3TA 3TGIE 1FPCH 3A8AA 1O5EH 1QHRB 2BY6X 2ZCLP 1GPZA 4JYTA 2THFB 1HIAB 1ZR0A 4BTUB 2JH0D 2RDLA 2Y5FA 5I25A 1C2HA 2PHBA 1C5WB 3LGUA 2P8OC 2I6SA 1P2NA 1EPTB 1ZPZA 1H9LB 1RTKA 3ATLA 5C3NA 2NWNA 2GD4B 5DP3A 4ZKSU 3PMJA 3F68H 2Y7ZA 3QGNB 4IC6A 1O3JA 4ABFA 2BD4A 5EPYA 4X2YA 3D65E 3E0PB 5LPRA 3EYDA 4UFGH 3T2NA 2ZGHA 1C2IA 1GHAF 3D23A 1OYTH 3F9HA 3PO1C 1C5TA 2FESH 5JPMH 2R3YA 3E1XB 3RC6A 1EAWA 2FIRH 3GCHC 3W95A 4Y79A 1N6XA 3RMNH 3MU5A 1TGNA 1EZXC 4K1EA 2GCHG 1BBRE 2F9VA 4DGJA 1EPTA 1GG6B 1X7AC 1MD8A 4TPYA 3GCOA 3UWJH 1D9IA 1H9HE 3ZZ6A 4UD9H 3PWBA 3DA9B 2OUAA 1HAIH 4FVDA 5T3HA 3A83A 1ZMNA 4E06H 1XUIA 2W3KA 4I7YH 4B2AA 1G3EA 2QF3A 4YOJA 5DP9A 1ELDE 5F03A 2A0QB 4AYYB 1BBRK 1UTKA 1Y59T 5DKMA 3TNSA 4WY3A 3KIDU 1GJAB 1FQ3A 3GY4A 1CHOF 3TVJB 5CHAB 2BQ6B 1UMAH 5PTPA 2QF0A 1OS8A 1ELVA 1YPEH 3MFJA 7LPRA 3SNEA 1KLJH 3F9EA 1IQGA 1HAXB 2BD7A 2BLQA 2ZZUH 1Y5BT 2UUKB 2ZECA 3AAUA 2QIQA 4VGCC 1V2ST 3SZNA 1HIAA 3EA9A 2BD8A 1K1IA 3BTEE 5ABWA 2VVCA 1ELEE 2TRMA 3TK6A 3SJOA 3AVZA 2PLXA 3UY9A 1D3PB 4JK5A 2VIOA 1SLWB 3K6YA 4OGYA 5EOKA 1F92A 4Y8ZA 1BMNH 1A5GH 4A7IB 1GCDA 4CRBA 1FY5A 2A5AA 1GHVH 3E91A 8ESTE 2OBQA 3SU2A 3P8FA 1UTQA 3KQBA 1NO9H 2K1QA 2IPHA 3ZVDA 1RRKA 1SLUB 4AX9H 4F49A 1P3CA 1TPOA 1QBVH 4NWKA 2FOFA 1LVMA 3SNAA 1P2QA 1O2ZA 2CXVA 2Z9KA 3MNXA 7ESTE 3P8NA 2BD9A 1V2WT 4NIWA 2AEIH 3EA8A 1GVLA 3E6PH 5K0HA 3QN7A 4ISIH 5ESTE 4J1YA 3VGCB 2HALA 1BA8B 1ZPCA 1YLCA 1HAGE 2C3SA 1QB1A 1SGDE 2ZTXA 1GMCF 1NFWA 2PTCE 2RG3A 3FZZA 4ABEA 2G4UA 1D3TB 3BF6H 1W7GH 3GY8A 4NA9H 3P17H 1PPZA 2BDBA 4CRDA 3RLWH 5EPNA 4O3UA 1LHGH 3GY2A 2H5DA 1SHYA 4I31A 2O8TA 4E05H 3KGPA 1BCUH 1YPGH 1DITH 1LKAA 2A2QH 1WU1A 3RXHA 4MPUA 2PKAB 1VITH 4WJG2 1CE5A 1HBTH 1QB6A 1GBCA 3EQ0H 2Y5HA 1SQOA 3ESTA 1C5YB 2ZU1A 1UJ1A 1QY6A 1N8OB 2B8OH 2CHAB 5EXNA 1GMDG 2PSYA 4KGAA 3M5OA 2F9OA 1FZZA 1MTWA 3H5CB 1Z1IA 1DSTA 1N6YA 1C5SA 1UCYK 3GCTG 4INLA 4HZHA 4U30A 1PQAA 1CGHA 2DE9A 1J16A 1GHBG 1W14U 3BTFE 1QRXA 3TK9A 1FY1A 5GJ4B 1FY8E 1XKBC 9LPRA 3U8RH 1O2RA 2F9UA 1O5GH 3UQVA 3S7KB 2GMTB 4X1QU 1EUFA 4FUGA 2SFAA 4ISLA 4IC5A 4JCNA 1C1QA 4ZHMU 1NRQH 1QTFA 4NIXA 5EQSA 3FFGA 4DOQA 5HXFA 3ZVCA 4NWLA 3QZQA 3F9GA 1MZAA 2W26A 4TWYA 3M35A 1QL7A 1C2EA 3MWIU 3A89A 3FP6E 1LTOA 1DVAH 3ZZ5A 2FYRA 3MU1A 5EXLA 1B7XB 2ASUB 4B2BA 1H4WA 1BJUA 4R8TB 1KTTB 1AB9B 1BOQA 1UTMA 1TGBA 3UNSA 2PGBB 2ZEBA 1HDTH 4NA8A 1C4V2 3NCLA 1K1PA 5C1YA 1AFEH 2BD3A 1QCPA 2RA3A 3RXRA 3CS0A 2A2XH 2UWOA 1AWFH 2AMQA 2QXJA 4BAQB 6GCHF 2ZGCA 1QA7A 1EZSC 3TJUA 1EAXA 1ELTA 3KCGH 4AG2A 2H9TH 1HUTH 2UUJB 1D4PB 1SLVB 3KF2A 4HGCA 1C5RA 1TE0A 3UUZA 5HM9A 4YZUA 5HM2A 2UUFB 2VIWA 2Y80A 1WQVH 1S0QA 1EOJA 1P01A 4JZIA 2VWNA 3SU6A 4ABIA 1BIOA 4KTSA 5BPEA 4YO9A 1KDQB 1O3CA 5T6DA 2PFEA 2BMGB 3GYLB 3ATKA 3B9FH 1L1NA 3TJVA 3D49H 4B75A 1P2KA 2ZQ1A 3DT0H 2R0LA 9ESTA 3MNBA 2XW9A 4B74A 1MTSA 4WXIA 1KXCA 1WBGB 2Z3EA 2M5TA 3S0NA 3H7OA 2WPHS 1YPHE 4ABGA 2HOBA 1FY4A 3OY6U 4NCYA 3SHAH 1NY22 1G36A 3ZZ3A 1O2JA 3A7XA 1SGNE 5AFZH 1A0HB 1BMMH 4CRCA 4AB9A 1P2IA 3T26A 3KEEA 3S69A 1XXDA 1H9IE 1BHXB 3Q3YA 3SQHE 1XUGA 3OU0A 1AE8H 4IW4E 3BG8A 2RCEA 5F8XA 3VPKA 4CR9A 2P59A 2VVUA 2P93A 4YOIA 1DS2E 1TONA 3SU4A 5L30H 3BIUH 2GGVB 1P57B 4DIHH 1W8BH 2PKSC 1Z8JB 1ACBE 4ISNA 2FOCA 2ZI2H 2ODQA 1W2KH 3U8OH 1GBBA 4GAWA 4LZ1H 5FPTA 3UFAA 3BEIB 2HNTE 4Y6DA 2ZDVH 2AGIX 3TU7H 2BDCA 4D7GA 5FAHA 1EATA 4BAHB 2BTCE 1OKXA 3SORA 5DG6A 3DD2H 4Q7YA 2SGAA 1TIOA 4FUJA 4I32A 1GGDB 1S83A 1TGSZ 2GDDA 4FUEA 2EC9H 1S85A 1ARCA 1IHSH 2VVVA 1MAYA 1OX1A 1HLTH 3A80A 2XCNA 3A7TA 1GDUA 1BMLA 4DT7B 5A8ZA 2ZCHP 3F1SB 3IG6B 2XWBI 1NU7B 3IWMA 3M3TA 2PW8H 3EGKH 2ZFRH 2FO9A 1SOTA 4GUXA 3RXFA 1EASA 1AFQC 4PROA 2ZG0H 4OS7A 2C4FH 2P8OB 4NFFA 2Y6TA 1A61H 1ANDA 1GCTB 3MYWA 2AMPA 1EAUA 5GDSH 1TQ7B 2ZHEH 2Y5GA 1NT1A 2XBVA 2GCHF 4OS1A 2C8YB 1MQ5A 4X2XA 1KLIH 1ZHMA 1ANEA 1F5KU 1TAWA 2V6NA 1NN6A 1AZZA 5L2YH 3L6PA 1Q3XA 2SGPE 1OP0A 3TJOA 5L2ZH 1TGTA 4SGBE 2GCTB 2GT8A 1EZUC 1K9OE 5GXPA 1V2VT 2ALVA 1TOMH 1E0FD 5B6OA 2HPPH 1F5RA 1SR5C 1K28D 5F8ZA 5HYOA 1GG6C 5SGAE 1FPHH 5DP4A 1PPEE 3M7TA 2BOKA 1T4UH 3GDSA 2J2UA 4THNH 3MNCA 1DLKB 2BZ6H 3M36A 1A0LA 3RDZA 1YYY1 2FOHA 3QTOH 4NZLA 5FBEA 1QRZA 3UOUA 3LGTA 1OWJA 3RXTA 3SJKA 1ZOMA 1ELGA 4IMZA 1WOFA 1EJAA 1IAUA 3SUGA 3S7HB 1OPHB 1D6RA 1SGYE 1UK4A 3MH6A 1BRUP 1MH0A 3BV9B 1K1NA 2HLCA 4ZHAA 3SW2B 2O9QA 2OBOA 1RS0A 1TBRH 1C5OH 2DE8A 1OOKB 1W11U 1XKAC 2GZ8A 3LJOA 1FIWA 1DLEA 1YBWA 4X6MA 1AVWA 1LHCH 1AUJA 4DCDA 1EP5A 5EW1H 1PYTD 4MDSA 3ZZ8A 1ABIH 3Q00A 4XSKU 4I33A 1MU6B 1UCYH 1Y3UA 1HAZB 2P95A 4UE7H 4X6OA 5ESBA 1O2QA 1P06A 4Y0YE 2BD5A 1AB9C 4IS5A 2ZHFH 2BY9X 5TJXA 2FI5E 1CGIE 3MH5A 1CT0E 1G9IE 1AUTC 4A1TA 5EQRA 2FMJA 3UOPA 5AVDA 1G30B 4YLUA 3O8DA 4CH2B 1DDJA 3ZZ7A 1EB1H 1GBTA 2PKAA 1V2NT 2P16A 4ZUHA 5J4QA 2A5IA 2OQUA 4OS6A 1TBZH 1MD7A 2D1JA 2FLRH 4H42U 4CRFA 1V2PT 1QQUA 2WINI 1O3AA 1ZSJA 1JMOH 7KMEH 4IGDA 3E3TA 3ODDA 4I8GA 1QIXB 4K3JA 2BDHA 1UTLM 5T6FA 4UONA 1F0RA 1AD8H 1ELAA 3BTWE 3LC3A 3GISB 5GWZA 1JXPA 1O2YA 2IJOB 3GOVB 2ODYB 3LONA 1Z6EA 1KTSB 4INKA 5A0AE 3FP8E 1SPJA 2LNCA 2F9PA 1J17T 1BRCE 1YCPM 3UNQA 4D76A 1BITA 1SQAA 2ANWA 2V3OH 1SB1H 1UTPA 1PPFE 3MOCA 3RXQA 4LXBH 3ZYDA 2HNTF 4Y71A 1XUFA 2Q6DA 3GDUA 4MNXA 2Q6GA 3RLYH 1NRPH 3ZZDA 3UWIA 2R0KA 1C5LH 3A82A 4Y76A 1ZGVA 1V2KT 1ETSH 1IQHA 1AGJA 1BQYA 1MBQA 1GI9B 1SGPE 2SNWA 5GCHF 1INCA 3Q77A 3OYPA 4ZXXH 3SI4H 2H1UA 2P3FH 1TOCB 2WV4A 2ULLA 3FAOA 4BXWA 3MMGA 4SGAE 3LJJA 1P0SH 1XVMA 2VH6A 1AY6H 4R0IA 4TWWA 3O8CA 2BHGA 2ZCKP 1YPLH 1A7SA 1ZGIA 4Y10E 1DXPA 2ZGXH 1Y3WA 1JWTA 4ESTE 2FX4A 4X8SH 2BXTH 2SGQE 3QZRA 1S6HA 1AU8A 1ZRKA 1ZLRA 1C5VA 1TABE 3KQDA 1ETRH 1Z8GA 3TPIZ 3TGKE 2G4TA 1P03A 2BY5X 1O2MA 2VGCB 3U8TH 1IQFA 4XFQA 4MTBA 3VB7A 1AVXA 3FZDA 2J38A 1RJXB 2AIQA 4YESB 3S9AA 4BTTB 1DE7H 4CREA 6ESTA 3O8RA 3BTTE 2ZGJA 1BJVA 4WMEA 3B23B 1O3GA 3ZZ4A 1VITG 4GPGA 2J9NA 1D3DB 2VB0A 3BTME 5TCAA 1HB0B 3T62A 1KXDA 1LPKB 3RXVA 2FOMB 2IN2A 3K2UA 2H5CA 2P94A 1TRMA 4A92A 3GYMA 3QTVH 3BTHE 2FOBA 3U69H 7GCHF 4OS2A 1P05A 3BSQA 1TALA 4FUFA 5HMAA 3ZZBA 4A1XA 1G2MA 1V2RT 1UVPA 4AFQA 2ANKH 5E2OA 1C1SA 1JRSA 5C5OA 1QL9A 1T32A 2XWAA 4BANB 4ABAA 1JIRA 1NRSH 3A7YA 1DT2A 1IQJA 1AMHA 1HFDA 1GHYH 4BTIB 1ZTJA 3B8JA 2XBWA 3ZVGA 2OLGA 3SNDA 1H1BA 2W5EA 3MU4A 1AKSA 1FIZA 8GCHF 1FUJA 4CR5A 5C67A 2WUBA 3ZZCA 1ZSLA 1IQIA 2WUCA 2EI6A 1TFXA 1IQKA 1C4Y2 1GJ6A 1HNEE 2AYWA 1P9SA 3SU5A 2ZFQH 2ZFSA 1CA8B 1O2HA 5FX6A 5IDKA 1CVWH 3A88A 4TY6A 2NU4E 1TX8A 3URCA 1QBOA 1RIWB 3ZVEA 8GCHG 4F4OC 3SJIA 3RM0H 1QJ7B 3GDVA 3H7TA 1QJ6B 4K69A 5ETXA 3RXPA 1NROH 4O9VA 3I78A 3ATWA 1AVGH 1DX5M 2R9PA 1GHAG 4DY7B 1YPHC 3OSYA 1GJ8B 2O8WA 3DFJA 4Y8YA 3RP2A 4FUHA 1GI6A 2HVXA 4DURA 3URDA 1BTWA 1TBQH 2BLWA 3UPEA 2BDYA 1TNHA 1SC8U 2ZDAH 2D2DA 1T8MA 2A7HA 3TH4H 1DSUA 2SGEE 3GY3A 3SN8A 5CMXH 3VFEA 1L4DA 4AFSA 1AIXH 1O2UA 1BB0B 2Q6FA 5AHGH 2FM2A 1TMUH 1K1JA 3SGBE 1AI8H 1C5XB 2A4GA 1EZQA 2WYGA 2XC0A 3GY7A 2Q1JA 3ZV9A 2XBXA 2FWWA 5A2MH 1DXWA 1PYTC 3RXMA 2A32A 1NFYA 1F2SE 2GZ7A 1MAXA 2QYIA 1OWHA 3M5NA 2AGEX 1P12E 1KLTA 3KQEA 1OP2A 1C1NA 3CS7A 1PPHE 1ZMJA 1P2OA 3UR9A 2CV3A 1BHXF 1XUJA 1ZHPA 5EG4A 3UTUH 2ZC9H 1A5IA 1CU1A 1C5PA 1GI4A 5A09A 1ZSKA 2VIDA 2BOHB 1T8LA 2TGPZ 5EXMA 1GJ9B 1GJBB 5G4BA 2QA9E 1YPJH 2PV9B 1A0JA 2PWXA 2STAE 5F6MA 1ANCA 1PQ5A 1GJDB 3QLPH 2QN5T 1OSSA 1EJMA 3D62A 5C5NA 1XMNB 1A4WH 5E0HA 3KNXA 1MKWH 2ANYA 1MTNC 2JETB 3PV4A 1PFXC 1HPGA 1EPTC 1TLDA 4YLQH 5FHTA 5DO4H 1O3IA 1TPPA 1BTPA 1GJ7B 4D7FA 1YPMH 1TGCA 3OY5U 1C1WH 2BZAA 1O30A 4YT6H 1A46H 1C1RA 3AASA 3M7QA 1TNKA 2CF9H 2C8XB 1SL3A 2KAIB 1YGCH 4ZKOU 1C1UH 3LOXA 4XE4A 2F83A 1ABJH 3Q76A 1DICA 5GIBA 1GMHF 1LDTT 2G55A 4ZMAH 4ABJA 1UTOA 3RXJA 2QXIA 3P8GA 3ZYEA 4Z6AH 1HJ9A 3N7OA 1NM6A 1O3HA 3I29A 2EA3A 2OC0A 1QA0A 4RSPA 4ABDA 4CBNA 3V12A 3ENSB 4WXVA 7GCHG 1GHZA 1PPBH 2LPRA 4NGAH 1ZJKA 4NSYA 3V3MA 4UFEH 5I46H 1UVTH 3PMBB 4X8TH 4INHA 1IQMA 1C2KA 2ZU5A 3HKJB 4E7NA 2WV5A 2IOTA 4K8YA 1SBWA 1RIWC 1TNJA 3P95A 1O37A 3STIA 4AG1A 1SFIA 1S82A 1GBHA 1C2JA 4AOQA 3MH4A 4IMQA 1CT2E 1HAVB 4I8JA 1OWIA 1VITF 3PLBA 3NKKA 4X8VH 3T28A 1LHEH 3ZVFA 3KN2A 1OYQA 4ZROA 1AWHB 3ITIA 1O2LA 2FS9A 3UIRA 4K1SA 2OP9A 1V2MT 5EODA 2AH4X 1CHOG 1SGCA 3GCTF 1YCPK 2P3UB 4MVNA 4AFZA 2VGCC 2UUYA 1J14A 2XYAA 1P02A 3SGAE 4AN7A 1AO5A 1O2VA 1LPGB 4CRAA 2ZTYA 3F6UH 1B5GH
chains in the Genus database with same CATH superfamily
4YTAA 1GI0A 1QGFA 2PTNA 4LK4A 3NK8A 2F3CE 2V0BA 1O3PB 1KXAA 1RD3B 4GVUA 3HGNA 1SGRE 1ZMLA 3TK5A 1A5HA 3OAAD 2AFQB 2FODA 1HAVA 2GKVE 3C1KA 2QAAA 4KP0A 2BB4A 2JETC 4CHAB 1CA0C 4X2VA 3LC5A 3M3VA 2FPZA 2O8UA 4X1PU 4Y7AA 2HRVA 3RMMH 4B76A 3PRBA 1AN1E 1P2MA 1UVOA 3BN9A 1Y8TA 2A31A 1O3LA 1P10A 2A7CA 4KELA 1ETTH 1SLXB 1P11E 4AGJA 1HAHH 2ZU3A 1TX7A 1GMCG 1S6LA 1QRWA 3RMLH 3GY5A 2B9LA 5C94A 3PWCA 5DJ7A 2BVRH 1FN6A 2HPQH 4UFDH 2P3TB 3LDXH 1T8NA 3P70B 2TIOA 5JBBS 1AHTH 1O2SA 1ZZZA 2CHAC 2W6ID 2ZHDA 1RTFB 3GCNA 3LPRA 3M3SA 4X6NA 3ZZ9A 3NPSA 1CBWB 3BG4B 3I77A 5AFYH 1PJPA 2OC8A 2BLVA 4GCHG 3SV2H 4XBBA 1UO6A 2VWOA 1GBMA 3ATMA 1PQ8A 1N8OC 3A84A 3M61U 3L33A 1V2LT 1ZJDA 2YMSC 3GICB 1O5BB 4RI0A 1ARBA 2GT7A 2STBE 3VB4A 1HJAC 4B1TA 1EKBB 1T4VH 1LVOA 1VCQA 2Y81A 1MKWK 5HIYA 3NXPA 1O3NA 1GHBF 1NU9A 1QZ8A 2VU8E 1O39A 4WH8A 5FCRA 5FCKA 5A0CA 3K6ZA 1G3DA 4A5TS 4XD7D 1GI3A 2XXLA 1L1JA 1C9PA 1UHBA 1GBFA 4DJZB 3ZV8A 5DP6A 1MMJN 2HGTH 3A7ZA 1GI8B 3MTYA 4UFFH 1L4ZA 1ID5H 3TGJE 2ZDKA 2BVXH 4X0WU 2PR3A 1VGCB 3L3TA 1KXFA 2JH5D 1WDIA 3QGJA 4AYVB 4DVAU 1TPAE 5CHAC 3VXFH 5EQQA 3SOSA 4FUDA 1EX3A 1DWCH 1BTZA 2PUXB 2TGDA 2BQWB 5C20A 1GVZA 4ZXYH 4K5ZA 4NZQA 4TY7A 4B73A 5DGJA 1AE5A 1ESTA 4D9RA 1WV7H 1C2FA 2FOEA 4RKJB 3BTKE 1W0ZU 4I8HA 2Z3CA 1ZPBA 3LGIA 2BLOA 1BTYA 1WQSA 1SGIB 3SU3A 4WF8A 1ELCA 3RXBA 1IQEA 3RXSA 2DUCA 1QBNA 1O0DH 1C9TA 4U2WA 2XC5A 1UVUH 2ZDMA 1GHWH 3PLPA 1KYNA 5GNDA 2FP7B 3ODFA 2W3IA 1RGQA 4NIVA 4AORA 2GVFA 1GVKB 1MKXH 2H6MA 2KM0A 1XX9A 4TT3D 1QB9A 1GL1A 5T1VA 3ZVAA 5CHBA 2VWLA 3A81A 2I6QA 1Z8RA 3SJ9A 3BEFB 3QWCH 1C1OA 3RU4D 1VCWA 2GV6A 3BTDE 3QK1A 1MKXK 3SJ8A 2V3HH 3SU0A 4P00A 2YMSD 1CA0B 1EOLA 1V3XA 3LGYA 1VKYA 1ZRBA 2Y7XA 5C1XA 2WPIS 1GBJA 5H4IB 8KME2 2ILNA 3MU0A 2D8WA 1Y5UT 1C2GA 1QL8A 1CO7E 3DCLA 2BDAA 4Q7ZA 2QY0B 1F0TA 1TNIA 3RXUA 3EA7A 1ZTKA 2A45B 2ZHQH 3EDXB 4WWYA 1V2UT 1P04A 2BXUH 3ELAH 3LH3A 5JDUB 1Z71A 2EI7A 1O36A 1MTVA 2WPKS 4JZEH 3OEHD 1CBWC 4TPIZ 1BTXA 5FXLA 4YT7H 3TIUA 3A8BA 2F9BH 1GL0E 3P92A 1LKBA 2FI3E 3S9BA 3MH7A 3AW1A 3E90B 3M5LA 1LVYA 1HJ8A 2GZ9A 2Z9IA 4HI3A 4LZ4B 5A0BA 1S81A 3SUDA 2B7DH 3VXEH 1BZXE 1AQ7A 4FU8A 1GJ4H 1VCPA 3JZ1B 3MI4A 4H6SB 2JDID 2V3MA 4U01A 2ZPRA 3RU4E 3RMOH 1WUNH 1P3EA 3QUMP 5HKKD 1BT7A 6GCHG 1XUHA 2KX4A 4UEHH 2C93B 1WSSH 2BY7X 1GI2A 2OTVA 4Q2KA 1GJ5H 3PYHA 4NG9H 4FUBA 3PROA 1HAPH 2BM2A 1FXYA 2CJIA 1UK3A 1DWDH 3U9AH 1Z1JA 3ZVBA 2XBYA 4Z0KA 3AW0A 1GCTC 1O31A 1SOZA 5IK2D 1YCPH 3A7VA 2JH6D 4P02A 3SI3H 2C90B 2R3UA 4K2YA 1LPZB 4I8LA 1G37A 4O97A 5LGOA 4IN2A 2OQ5A 2RA0A 2J34A 2PSXA 2VINA 1C1VH 4MPVA 5C0UA 1GI7B 1E36B 3VGCC 1GGDC 1O2GH 1KY9A 4FUCA 3DSPA 4CRGA 1ZTLA 1TYNA 1MQ6A 1D3QB 1PPGE 2WPLS 1Q2WA 4GSOA 2W6JD 2XRCA 3RU4T 1O5AB 4MLFB 4CBOA 1O38A 4GCHF 4NA7A 2TBSA 1O32A 1MZDA 3RC5A 4BOHA 4XBCA 1ELFA 1GI5A 3BIVH 1HAOH 2W7SA 3SNBA 2K0QA 3RC4A 1P2JA 2A1DB 1BTUA 3PLKA 4ASUD 1O2TA 5A8XA 3CENA 3SV6A 1A3EH 1P09A 1TB6H 2TPIZ 1TNLA 1F5LA 2XNDD 1C5NH 2ZGBH 4ISHH 3A8CA 1Y3VA 4H4FA 4DG4A 3SU1A 1YPKH 1Q31A 2V7QD 5E8EH 4F48B 1YF4A 2R2WU 3FANA 1HAYB 1YLDA 4TYDA 3VB5A 1THPB 5E2PA 3UAIC 3VB6A 2Z9GA 5GCHG 2VNTA 1UW7A 1GJCB 1FAXA 1YLNA 4YM9A 2SGDE 5FPSA 1AKSB 4QT8C 1TPSA 3RXKA 3QDZB 3T5FH 2VJ1A 1UVSH 4GHTA 2OCVB 3O8BA 2H9EH 1FI8A 1ESBA 2PGQB 1K1OA 1NESE 4ASHA 2GMTC 1Z8IB 4K1TA 2ZU4A 2G5VA 1WAYB 1C5ZB 1O33A 1VJ9U 3HK6B 5EJZA 1NC6A 2WPJS 4X1NU 3U1IB 1C2MA 3UR6A 2XNIA 1O2PA 2QXGA 2BDIA 3Q3XA 4FXGH 4Q63A 1LQDB 1DUAA 1K2I1 3TH3H 3V7TA 2NU2E 2B0FA 2PKSB 3NRLA 5K7RA 5EU8A 5FX5A 1W13U 1KIGH 3HKIB 3KHVA 3SO3A 1K1MA 1B0FA 4K60A 1LO6A 3MO3A 2OD3B 2AGGX 1OHHD 3MO6A 4Y7BA 3RXAA 2ALPA 3SV9A 3NWUA 1C1MA 1S5SA 2ZPSA 2GTBA 1WTHD 1GBKA 4AFUA 1TMTH 2ZPQA 2TGTA 1FMGA 1LCYA 2ZTZA 1S84A 1MCTA 2QGRA 3AAVA 1CHGA 4FU7A 1LHFH 5DPAA 4DW2U 3RXEA 3SUFA 1N1LA 3E8LA 1FN8A 5JB8S 1THSH 1VZQH 1H8HD 2AS9A 3RXGA 2O8MA 2YNBA 1P9UA 1TQ0B 4UDWH 1WXRA 3EAJA 3RM2H 2XOKD 4FU9A 1J8AA 4H6TA 1W10U 2VH0A 2QF5A 2A4OA 2QXHA 1UCYE 5FBIA 4BAKB 4NFEA 3E16B 1C1TA 3HATH 1H8IH 2GV7A 2PUQH 3RXCA 2G00A 3W94A 1TA6A 1LMWB 4BXSA 5LPEA 1UTNA 2CN0H 4I8KA 2SGFE 2ZA5A 5EJLA 3VEQB 3LIWA 5C0TA 2ZIQH 1DWEH 1GDQA 1DY9A 4MG3A 4JZFH 2OXSA 2FS8A 1QR3E 2EI8A 2ZWLH 3BG4C 3MHWU 4WMFA 3JZ2B 1C5MD 1G2LA 1O3KA 5C1UA 2FLBH 3MO9A 3A85A 1C5UA 4RT1A 1OWKA 1L1GA 4Y0ZE 2AERH 4O03A 3A7WA 1F7ZA 5IYTA 2G8TA 1LVBA 2WV9A 1CGJE 1EJNA 1V2JT 1JBUH 3S9CA 1ELBA 1P8VC 1FNIA 2GCTC 2Z7FE 1BMAA 3CP7A 3PM3A 5LH8A 1NS3A 4KTCA 1K21H 1CSOE 2ZFPH 1O35A 1TMBH 1XUKA 1TNGA 1DUEA 1WTGH 1J15A 1FX0B 1HJAB 1FY3A 2F9NA 3ZZAA 1QFKH 3K9XB 1SQTA 1DANH 2Z9LA 2G52A 3SBKA 5LPFA 1BRAA 2G81E 1BUIA 3BTQE 3DHKH 2R2MB 3HK3B 4ZKRU 4X1SU 5CE1A 4ABHA 2Z94A 1WYKA 2FOGA 1BTHH 1PQ7A 3RXDA 1Z6JH 4JZ1A 4OGXA 1O3MA 4B71A 1E34B 1BDAA 3WY8A 1MBMA 4OS4A 1V6DA 4A1VA 3T25A 8LPRA 2ZO3H 5JBTA 2WYJA 3N99A 1YC0A 3SGQE 1W7XH 4B2CA 2J4IA 4GLYA 1NFXA 1JRTA 4Y8XA 1EAIA 4VGCB 3PTNA 5J4SA 3MU8A 1GBLA 1O2OA 4ZHLU 1IHTH 1SGFG 1XM1A 2QV1A 4JMYA 3ZIAD 1SMFE 1W0YH 1GMHG 3ATIA 3SUEA 1UHBB 2Z6BD 1VJAU 3BTGE 1DPOA 1ZYOA 1IOEA 4MQAA 2FEQH 2FTMA 1S0RA 4ZH8A 1O2XA 1KXEA 1NRRH 2CMYA 1HXFH 1HXEH 4IN1A 3EE0B 1O2IA 4X6PA 2ESTE 3QX5H 1XXFA 5GPIB 3A8DA 5DK1A 1JOUB 1L0ZA 1EQ9A 1A2CH 1COWD 4MNYA 1XVOA 1ZHRA 2J98B 2SNVA 2ZNKH 3SQEE 1T7CA 3M7UA 4D9QA 1C2DA 4E7RG 1AZ8A 1YY3A 5EJ1A 3G01A 1V2TT 2VWMA 3RXIA 4X2WA 4AB8A 1Y3YA 1Y3XA 4ABBA 4BNRA 1E37B 1VR1H 2QCYA 2ZDNA 2AIPA 1M9UA 1OWDA 4JYUH 3LT3A 4MNWA 3U1JB 4DIIH 1ORFA 1C5QA 2EEKA 1F0UA 3A86A 4MPXA 2HNTC 2FDAA 5JBCS 3TNTA 4CHAC 2ODPA 4WVPE 3K65B 4RKOB 1H8DH 1GI1A 1E38B 1O2WA 3A87A 5L6NH 4JK6A 3LU9B 4U32A 4M7GA 2YMSB 4Q80A 3DUXH 1FV9A 1RFNA 1GHXH 4WH6A 1GDNA 1C4U2 2JJ2D 2GP9B 1W3CA 5T6GA 1SGFA 2BYAX 1Y5AT 5HGGA 1ESAA 1KDQA 1HCGA 1MTUA 2WSSD 1DFPA 2FZZA 1EXFA 3V13A 2UWLA 5DP5A 2BX3A 1O5CB 2ZU2A 4CH8B 1OWEA 1ANBA 1EP6A 1O34A 1HV7A 2ZQ2A 3M5MA 5EGMA 4X1RU 4ZAEA 3IITA 3OEED 5C2ZA 1C1PA 3P8OA 4BAMB 3U98H 5KGOA 3VB3A 3OX7U 1T31A 4RN6A 2J92A 1KXBA 3MNSA 4BAOB 1NPMA 5JBAS 1V2OT 2VIQA 1A3BH 1L2EA 1TA2A 1T8OA 1LQEA 1TX6A 3KQCA 5EW2H 1FONA 1KMHB 1SGQE 2BQ7B 2C8WB 3KL6A 1OXGA 5DP8A 4OS5A 2ANMH 1U6QA 2O8LA 3F0PA 5TCCA 3TITA 3R0FA 1FJSA 1G3CA 3HPTB 1A1RA 3Q3KA 1J9CH 2FTLE 1JIMA 1DOJA 1DM4B 2D26C 3UNRA 2XCFA 6CHAC 2BDGA 3DSOA 4KTUA 1CT4E 3RXOA 1O2NA 4J2YB 1UK2A 3M37A 3NUMA 1WCZA 5A8YA 1SSXA 2J98A 4F55A 4MPWA 1SI5H 1O3EA 3LH1A 1VGCC 2Y82A 2H9HA 1BRBE 2G51A 3LKWA 1YWUA 4Y11E 3F9FA 3PB1E 1NTPA 2XC4A 1V2QT 2JKHA 1O3BA 2ZHWH 5E0JA 2BVSH 3P6ZB 2FI4E 2ZKSA 2C8ZB 1QJ1B 3F2GA 2J94A 5AF9H 2BD2A 4ISOA 1O5FH 1SGEE 5JYIA 1MCVA 1NRNH 4GHQA 3UB0A 2XTTB 2YOLA 1E35B 2FYQA 5DP7A 3U28C 4K8BA 3UREA 4XDEA 2V35A 1EB2A 3UQOA 1GBIA 2FOAA 2UWPA 4XRNA 1GBDA 1UTJA 4NSVA 3E0NB 1CQQA 4X8UH 2A4QA 3TJNA 2GDEH 3LGWA 4HFPB 4MNVA 1AFQB 2G5NA 4AGKA 4A6LA 1FAKH 3NZIA 4XBDA 1HRTH 2ZDLA 4JZDH 4B6EA 1TWXB 1IQNA 1GBAA 1SHHB 4D8NA 3HGPA 4ZKNU 1BBRH 2KAIA 2A7JA 1QNJA 1THRH 5E0GA 3PV2A 1O3FA 3SV7A 2W7UA 2KCPA 2OK5A 6LPRA 1S6FA 1YP9A 1TRYA 2ZFFH 2ZF0H 3LGVA 1DWBH 2A4RA 3PMAB 1O5DH 2VIVA 3SV8A 1OP8A 3C27B 2H2ZA 3SNCA 1O2KA 2OC1A 3SYJA 5FPYA 1LHDH 3OTJE 1IQLA 2BX4A 2CF8H 2ZFTA 3GS9A 4YXWD 2HWLB 5F8TA 1FLEE 3GCHB 1G3BA 2CGAA 4FUIA 2FXRA 4Q7XA 5HIZA 1K1LA 2FX6A 2OINA 3PO1B 1MTNB 1SGTA 1SFQB 1FDPA 1B0EA 1GWAA 2J97A 4XOJA 2F91A 4AZ2B 1O3OA 1PPCE 3WW7A 1MU8B 2J95A 5JB9S 1YM0A 2QC2A 2WPMS 1GMDF 3RUOA 1W12U 4LOYH 1SG8B 3GY6A 2K8IA 4KKDA 3TLOA 2NU3E 1QURH 2Z3DA 1SVPA 3BEUA 3V0XA 2VIPA 1RXPA 1Z7KA 4YOGA 4NIYA 2LP6A 1NFUA 2TGAA 2OC7A 3R3GB 1G32B 3TH2H 1TRNA 2AMDA 3FP7E 4FVBA 2Z9JA 2GX4A 1C2LA 3PTBA 3STJA 2A5KA 3DFLA 1HYLA 1MUEB 2B5TB 1O3DA 1F0SA 3FVFB 3RXLA 3SHCH 4IBLH 4WMDA 3KQ5A 1SKYE 1YKTA 1K22H 3AK5A 1D6WA 5BRRE 1NZQH 2EY4C 3T27A 2ZP0H 4HTCH 1GBEA 2KFWA 3PMHB 1QQ4A 1RTLA 4JYVH 3QO6A 3T29A 2NU1E 2NU0E 1KSNA 2YNAA 1HGTH 6CHAB 2LELA 2BY8X 1DY8A 4O3TA 3TGIE 1FPCH 3A8AA 1O5EH 1QHRB 2BY6X 2ZCLP 1GPZA 4JYTA 3FN8A 2THFB 1HIAB 1ZR0A 4BTUB 2JH0D 2RDLA 2Y5FA 5I25A 1C2HA 2PHBA 1C5WB 3LGUA 2P8OC 2I6SA 4ZCNA 1P2NA 1EPTB 1ZPZA 1H9LB 1RTKA 3ATLA 5C3NA 2NWNA 3MQKC 2GD4B 5DP3A 4ZKSU 4Q4LA 3PMJA 3F68H 1E79D 2Y7ZA 3QGNB 4IC6A 1O3JA 4ABFA 2BD4A 5EPYA 2HLDD 4X2YA 3D65E 3E0PB 5LPRA 3EYDA 4UFGH 3T2NA 2ZGHA 1C2IA 1GHAF 3D23A 1OYTH 3F9HA 3PO1C 3FO8D 1C5TA 5F53A 2FESH 5JPMH 2R3YA 3E1XB 3RC6A 1EAWA 2FIRH 3GCHC 4B6FA 5DSFA 3W95A 4Y79A 1N6XA 3RMNH 3MU5A 1TGNA 1EZXC 4K1EA 2GCHG 1BBRE 2F9VA 4DGJA 1EPTA 1GG6B 1X7AC 1MD8A 4TPYA 3GCOA 3UWJH 1D9IA 1H9HE 3ZZ6A 4UD9H 3PWBA 3DA9B 2OUAA 1HAIH 4FVDA 2F4LA 5T3HA 3A83A 1ZMNA 4E06H 1XUIA 2W3KA 4I7YH 4B2AA 1G3EA 2QF3A 4YOJA 5DP9A 1ELDE 4HG6A 5F03A 2A0QB 4AYYB 1BBRK 1UTKA 1Y59T 5DKMA 3TNSA 4WY3A 3KIDU 1GJAB 1FQ3A 3GY4A 1CHOF 3TVJB 5CHAB 2BQ6B 1UMAH 5PTPA 2GJGA 2QF0A 1OS8A 1ELVA 1YPEH 3MFJA 7LPRA 3SNEA 1KLJH 2L74A 3F9EA 2IPQX 1IQGA 1HAXB 2BD7A 2BLQA 2ZZUH 1Y5BT 2UUKB 2ZECA 3AAUA 2QIQA 4VGCC 1V2ST 3SZNA 1HIAA 3EA9A 2BD8A 1K1IA 3BTEE 5ABWA 2VVCA 1ELEE 2TRMA 3TK6A 3SJOA 3AVZA 2PLXA 3UY9A 1D3PB 4JK5A 2VIOA 1SLWB 3K6YA 4OGYA 5EOKA 5CDFE 1F92A 4Y8ZA 1BMNH 1A5GH 4A7IB 1GCDA 4CRBA 1FY5A 2A5AA 1GHVH 4Z1MD 3E91A 8ESTE 2OBQA 3SU2A 2WPDD 3P8FA 1UTQA 3KQBA 1NO9H 2K1QA 2IPHA 3ZVDA 1RRKA 1SLUB 4AX9H 4F49A 1P3CA 1TPOA 1QBVH 4NWKA 2FOFA 1LVMA 3SNAA 1P2QA 1O2ZA 2CXVA 2Z9KA 3MNXA 7ESTE 3P8NA 2BD9A 1V2WT 4NIWA 2AEIH 3EA8A 1GVLA 1SQRA 3E6PH 5K0HA 3QN7A 4ISIH 5ESTE 4J1YA 3VG8A 3VGCB 2HALA 1BA8B 1ZPCA 1YLCA 1HAGE 2C3SA 1QB1A 1SGDE 2ZTXA 1GMCF 1NFWA 2PTCE 2RG3A 3FZZA 4ABEA 2G4UA 1D3TB 3BF6H 1W7GH 3GY8A 4NA9H 1W0KD 3P17H 1PPZA 2BDBA 4CRDA 3RLWH 5EPNA 4O3UA 3KYGA 1LHGH 3GY2A 2H5DA 1SHYA 4I31A 2WHXA 2O8TA 4E05H 3KGPA 1BCUH 1YPGH 1DITH 1LKAA 5EIYA 2A2QH 1WU1A 3FOAA 3RXHA 5KECA 4MPUA 2PKAB 1VITH 4WJG2 1CE5A 1HBTH 1QB6A 1GBCA 3EQ0H 2Y5HA 1SQOA 3ESTA 1C5YB 2ZU1A 1EFRD 1UJ1A 1QY6A 1N8OB 2B8OH 2CHAB 5EXNA 1GMDG 2PSYA 4KGAA 3M5OA 2F9OA 1FZZA 1MTWA 3F2HA 3H5CB 1Z1IA 1DSTA 1N6YA 1C5SA 1UCYK 3GCTG 4INLA 4HZHA 4U30A 1PQAA 1CGHA 2DE9A 1J16A 1GHBG 1W14U 3BTFE 1QRXA 2RDEA 3TK9A 1FY1A 5GJ4B 1FY8E 1XKBC 9LPRA 3U8RH 1O2RA 2F9UA 1O5GH 3UQVA 3S7KB 2GMTB 4X1QU 1EUFA 4FUGA 2M2AA 2SFAA 4ISLA 4IC5A 4JCNA 1C1QA 4ZHMU 4DT4A 1NRQH 1QTFA 4NIXA 5EQSA 3FFGA 4DOQA 5HXFA 3ZVCA 4NWLA 3QZQA 3F9GA 1MZAA 2W26A 4TWYA 3M35A 1QL7A 1E1QD 1C2EA 3MWIU 3A89A 3FP6E 1LTOA 1DVAH 2KCYA 3ZZ5A 3H09A 1E1RD 2FYRA 3MU1A 3DSGA 5EXLA 1B7XB 2ASUB 4B2BA 1H4WA 1BJUA 4R8TB 1KTTB 1AB9B 1BOQA 1UTMA 1TGBA 3UNSA 2PGBB 3F3BA 2ZEBA 1HDTH 4NA8A 1C4V2 4ACBA 3NCLA 1K1PA 5C1YA 1AFEH 2BD3A 1QCPA 2RA3A 3RXRA 3CS0A 2A2XH 2UWOA 3PV5A 1AWFH 2AMQA 2QXJA 4BAQB 6GCHF 2ZGCA 1QA7A 1EZSC 3TJUA 1EAXA 1ELTA 3KCGH 4AG2A 2H9TH 1HUTH 2UUJB 1D4PB 1SLVB 3KF2A 4HGCA 1C5RA 1TE0A 3UUZA 3N7DA 4YZUA 5HM9A 5HM2A 2UUFB 2VIWA 2Y80A 1WQVH 1S0QA 1EOJA 1P01A 4JZIA 2VWNA 3SU6A 4ABIA 1BIOA 4KTSA 5BPEA 4YO9A 1KDQB 1O3CA 5T6DA 2PFEA 2BMGB 3GYLB 3ATKA 3B9FH 1L1NA 3TJVA 3D49H 4TSFD 4B75A 1P2KA 2ZQ1A 3DT0H 2R0LA 9ESTA 3MNBA 2XW9A 4B74A 1MTSA 4WXIA 1KXCA 1WBGB 2Z3EA 2M5TA 3S0NA 3H7OA 2WPHS 1YPHE 4ABGA 2HOBA 1FY4A 3OY6U 4NCYA 3SHAH 1NY22 1G36A 3ZZ3A 1O2JA 3A7XA 1SGNE 5AFZH 1A0HB 1BMMH 4CRCA 4AB9A 1P2IA 3T26A 3KEEA 3S69A 1XXDA 1H9IE 1BHXB 3Q3YA 3SQHE 1XUGA 3OU0A 1AE8H 4IW4E 3BG8A 2RCEA 5F8XA 3VPKA 4CR9A 2P59A 2VVUA 2P93A 2WZQA 4YOIA 1DS2E 1TONA 3SU4A 5L30H 3BIUH 2GGVB 1P57B 4DIHH 1W8BH 2PKSC 1Z8JB 1ACBE 4ISNA 2FOCA 2ZI2H 2ODQA 1W2KH 3WWBA 3U8OH 2CK3D 1GBBA 4GAWA 4LZ1H 5FPTA 3UFAA 3BEIB 2HNTE 4Y6DA 2ZDVH 2AGIX 3TU7H 2BDCA 4D7GA 5FAHA 1EATA 5B6LA 4BAHB 2BTCE 1OKXA 3SORA 5DG6A 3DD2H 4Q7YA 2SGAA 1TIOA 4FUJA 4I32A 1GGDB 1S83A 1TGSZ 2GDDA 4FUEA 2EC9H 1S85A 1ARCA 1IHSH 2VVVA 1MAYA 1OX1A 1HLTH 3A80A 2XCNA 3A7TA 1GDUA 1BMLA 4DT7B 5A8ZA 2ZCHP 3F1SB 3IG6B 2XWBI 1NU7B 3IWMA 3M3TA 2PW8H 3EGKH 2ZFRH 2FO9A 1SOTA 4GUXA 3RXFA 1EASA 1AFQC 4PROA 2ZG0H 4OS7A 2C4FH 2P8OB 4NFFA 2Y6TA 1A61H 1ANDA 1GCTB 3MYWA 2AMPA 1EAUA 5GDSH 1TQ7B 2ZHEH 2Y5GA 1NT1A 2XBVA 2GCHF 4OS1A 2C8YB 1MQ5A 4X2XA 1KLIH 1ZHMA 1ANEA 1F5KU 1TAWA 2V6NA 1NN6A 1AZZA 5L2YH 3L6PA 1Q3XA 2SGPE 1OP0A 3TJOA 1NBMD 5L2ZH 1TGTA 4SGBE 3F2FA 2GCTB 2GT8A 1EZUC 1K9OE 5GXPA 1V2VT 2ALVA 1TOMH 1E0FD 5B6OA 2HPPH 1F5RA 1SR5C 1K28D 5F8ZA 5HYOA 1GG6C 5SGAE 1FPHH 5DP4A 1PPEE 3M7TA 2BOKA 2KR7A 1T4UH 3GDSA 2J2UA 4THNH 3PRDA 3MNCA 1DLKB 2BZ6H 3M36A 1A0LA 3RDZA 1YYY1 4FOUC 2FOHA 3QTOH 4NZLA 5FBEA 1QRZA 3OTPA 3UOUA 3LGTA 1OWJA 3RXTA 3SJKA 1ZOMA 1ELGA 4IMZA 1WOFA 1EJAA 2JJ1D 1IAUA 3SUGA 3S7HB 1OPHB 1D6RA 3KYFA 1SGYE 1UK4A 3MH6A 1BRUP 1MH0A 3BV9B 1K1NA 2HLCA 4ZHAA 3SW2B 2O9QA 2OBOA 1RS0A 1TBRH 1C5OH 2DE8A 1OOKB 1W11U 1XKAC 2GZ8A 3LJOA 1FIWA 1DLEA 1YBWA 4X6MA 1AVWA 1LHCH 1AUJA 3W1EA 4DCDA 1EP5A 5EW1H 1PYTD 4MDSA 3ZZ8A 1ABIH 3Q00A 3F0OA 4XSKU 4I33A 1MU6B 1UCYH 1Y3UA 1HAZB 2P95A 4UE7H 4X6OA 5ESBA 1O2QA 1P06A 4Y0YE 2BD5A 1AB9C 4IS5A 2ZHFH 2BY9X 5TJXA 2FI5E 1CGIE 3MH5A 1CT0E 1G9IE 1AUTC 4A1TA 5EQRA 2FMJA 5FL7D 3UOPA 5AVDA 4AC9A 1G30B 4YLUA 3O8DA 4CH2B 1DDJA 3ZZ7A 1EB1H 1GBTA 2PKAA 1V2NT 2P16A 4ZUHA 5J4QA 5KEDA 2A5IA 2OQUA 4OS6A 1TBZH 1MD7A 2D1JA 2FLRH 4H42U 4CRFA 1V2PT 1QQUA 2WINI 1O3AA 1ZSJA 1JMOH 7KMEH 4IGDA 3E3TA 3ODDA 2L6OA 4I8GA 1QIXB 4K3JA 2BDHA 1UTLM 5T6FA 3EE7A 4UONA 1F0RA 2QF4A 1AD8H 1ELAA 3BTWE 3CNRA 3LC3A 3GISB 5GWZA 2QE7D 1JXPA 1O2YA 2IJOB 3GOVB 3OE7D 2ODYB 3LONA 1Z6EA 1KTSB 4INKA 5A0AE 2AHME 3FP8E 1SPJA 2LNCA 2F9PA 1J17T 1BRCE 1YCPM 3UNQA 4D76A 1BITA 1SQAA 2ANWA 2V3OH 1SB1H 1UTPA 1PPFE 2KCAA 3MOCA 3RXQA 4LXBH 3ZYDA 2HNTF 4Y71A 1XUFA 2Q6DA 3GDUA 4MNXA 2Q6GA 3RLYH 1NRPH 3ZZDA 3UWIA 2R0KA 1C5LH 3A82A 4Y76A 3WWFA 1ZGVA 1V2KT 1ETSH 1IQHA 1AGJA 1BQYA 1MBQA 1GI9B 1SGPE 2SNWA 5GCHF 1INCA 3Q77A 3OYPA 4ZXXH 3SI4H 2H1UA 2P3FH 1TOCB 2WV4A 2ULLA 3FAOA 4BXWA 3MMGA 4SGAE 3LJJA 1P0SH 1XVMA 2VH6A 1AY6H 4R0IA 4TWWA 3O8CA 2BHGA 2ZCKP 1YPLH 1A7SA 1ZGIA 4Y10E 1DXPA 2ZGXH 1Y3WA 1JWTA 4ESTE 2FX4A 4X8SH 2BXTH 4OM9A 2SGQE 3QZRA 1S6HA 1AU8A 1ZRKA 1ZLRA 1C5VA 1TABE 3KQDA 1ETRH 1Z8GA 3TPIZ 3TGKE 2G4TA 1P03A 2BY5X 1O2MA 2KCOA 2VGCB 3U8TH 1IQFA 4XFQA 4MTBA 3VB7A 1AVXA 3FZDA 2J38A 1RJXB 2AIQA 4YESB 3S9AA 4BTTB 1DE7H 4CREA 6ESTA 3O8RA 3BTTE 2ZGJA 1BJVA 4WMEA 3B23B 1O3GA 3ZZ4A 1VITG 4GPGA 2J9NA 1D3DB 2VB0A 3N7EA 3BTME 5TCAA 1HB0B 3T62A 1KXDA 1LPKB 3RXVA 2FOMB 2IN2A 3K2UA 2H5CA 2P94A 1TRMA 4A92A 3GYMA 3QTVH 3BTHE 2FOBA 3U69H 7GCHF 4OS2A 1P05A 3BSQA 1TALA 4FUFA 5HMAA 3ZZBA 4A1XA 1G2MA 1V2RT 1UVPA 4AFQA 3SZEA 2ANKH 5E2OA 1C1SA 1JRSA 5C5OA 2HVYB 1QL9A 1T32A 2XWAA 4BANB 4ABAA 1JIRA 1NRSH 3A7YA 1DT2A 1IQJA 1AMHA 1HFDA 1GHYH 4M9FA 1ZTJA 4BTIB 3B8JA 2XBWA 4RT0A 3ZVGA 2OLGA 3SNDA 1H1BA 2PP6A 2W5EA 3MU4A 1AKSA 1FIZA 4I86A 8GCHF 1FUJA 4CR5A 5C67A 2WUBA 3ZZCA 1ZSLA 1IQIA 2WUCA 2EI6A 1TFXA 1W0JD 1IQKA 1C4Y2 1GJ6A 1HNEE 2AYWA 1P9SA 3SU5A 2ZFQH 3FKSD 2ZFSA 1CA8B 4FETA 1O2HA 5FX6A 5IDKA 1CVWH 3A88A 4TY6A 2NU4E 1TX8A 3URCA 1QBOA 1RIWB 3ZVEA 8GCHG 4F4OC 3SJIA 3RM0H 1QJ7B 3GDVA 3H7TA 1QJ6B 4K69A 5ETXA 3RXPA 1NROH 4O9VA 3I78A 3ATWA 1AVGH 1DX5M 2R9PA 1GHAG 2IJD1 4DY7B 1YPHC 3OSYA 1GJ8B 2O8WA 3DFJA 4Y8YA 3RP2A 4FUHA 1GI6A 2HVXA 4DURA 3URDA 1BTWA 1TBQH 2BLWA 2J5UA 3UPEA 2BDYA 1TNHA 1SC8U 4ACAA 2ZDAH 2D2DA 1T8MA 2A7HA 3TH4H 1DSUA 2SGEE 3GY3A 3SN8A 5CMXH 3VFEA 1L4DA 4AFSA 1AIXH 1O2UA 1BB0B 2F43B 2Q6FA 2KZ4A 5AHGH 2FM2A 1TMUH 1K1JA 3SGBE 1AI8H 2RFKC 1C5XB 2EQNA 2A4GA 1EZQA 2WYGA 1BMFD 2XC0A 3GY7A 2Q1JA 3ZV9A 2XBXA 2FWWA 5A2MH 1DXWA 1PYTC 3RXMA 2A32A 1NFYA 1F2SE 2GZ7A 1MAXA 2QYIA 1OWHA 3M5NA 2AGEX 1P12E 1KLTA 3KQEA 1OP2A 1C1NA 3CS7A 1PPHE 1ZMJA 1P2OA 3UR9A 2CV3A 1BHXF 1XUJA 1ZHPA 5EG4A 3UTUH 2ZC9H 1A5IA 1CU1A 1C5PA 1GI4A 5A09A 1ZSKA 2VIDA 2BOHB 1T8LA 2TGPZ 5EXMA 1GJ9B 1GJBB 5G4BA 2QA9E 2VBCA 1YPJH 2PV9B 1A0JA 2PWXA 2STAE 5F6MA 1ANCA 1PQ5A 5DN6D 1GJDB 2JIZD 3QLPH 2QN5T 1OSSA 1EJMA 3D62A 5C5NA 1XMNB 1A4WH 5E0HA 3KNXA 1MKWH 2ANYA 1MTNC 2JETB 3PV4A 1PFXC 1HPGA 1EPTC 1TLDA 4YLQH 5FHTA 5DO4H 1K0HA 1O3IA 1TPPA 1BTPA 1GJ7B 4D7FA 1YPMH 1TGCA 1MABB 1C1WH 2BZAA 3OY5U 1O30A 4YT6H 1A46H 1C1RA 3AASA 3M7QA 1TNKA 2CF9H 2C8XB 1SL3A 2KAIB 1YGCH 4ZKOU 1C1UH 3LOXA 4XE4A 2F83A 1ABJH 3Q76A 1DICA 5GIBA 1GMHF 1LDTT 2G55A 4ZMAH 4ABJA 5C17A 1UTOA 3RXJA 2QXIA 3P8GA 3ZYEA 4Z6AH 1HJ9A 3N7OA 1NM6A 1O3HA 3I29A 2EA3A 2OC0A 1QA0A 4RSPA 4ABDA 4CBNA 3V12A 3ENSB 4WXVA 7GCHG 1GHZA 1PPBH 2LPRA 4NGAH 1ZJKA 4NSYA 3V3MA 4UFEH 5I46H 1H8ED 1UVTH 3OFND 3PMBB 4X8TH 4INHA 1IQMA 1C2KA 2ZU5A 3HKJB 4E7NA 2WV5A 2IOTA 4K8YA 1SBWA 1RIWC 1TNJA 3P95A 1O37A 3STIA 4AG1A 1SFIA 1S82A 1GBHA 1C2JA 4AOQA 3MH4A 4IMQA 1CT2E 1HAVB 4I8JA 1OWIA 1VITF 3PLBA 3NKKA 1NBME 4X8VH 3T28A 1LHEH 3ZVFA 3KN2A 1OYQA 4ZROA 1AWHB 3ITIA 1O2LA 2FS9A 3UIRA 4K1SA 2OP9A 1V2MT 5EODA 2AH4X 1CHOG 1SGCA 3GCTF 1YCPK 2P3UB 4MVNA 4AFZA 2VGCC 2UUYA 1J14A 2XYAA 1P02A 3SGAE 4AN7A 1AO5A 1O2VA 1LPGB 4CRAA 2ZTYA 3F6UH 1B5GH
chains in the Genus database with same CATH topology
4YTAA 1GI0A 1QGFA 2PTNA 4LK4A 3NK8A 2F3CE 2V0BA 1O3PB 1KXAA 1RD3B 4GVUA 3HGNA 1SGRE 1ZMLA 3TK5A 1A5HA 2AFQB 2FODA 1HAVA 2GKVE 3C1KA 2QAAA 4KP0A 2BB4A 2JETC 4CHAB 1CA0C 4X2VA 3LC5A 3M3VA 2FPZA 2O8UA 4X1PU 4Y7AA 2HRVA 3RMMH 4B76A 1AN1E 1P2MA 1UVOA 3BN9A 1Y8TA 2A31A 1O3LA 1P10A 2A7CA 4KELA 1ETTH 1SLXB 1P11E 4AGJA 1HAHH 2ZU3A 1TX7A 1GMCG 1QRWA 3RMLH 3GY5A 2B9LA 3PWCA 5DJ7A 2BVRH 1FN6A 2HPQH 4UFDH 2P3TB 3LDXH 1T8NA 3P70B 2TIOA 5JBBS 1AHTH 1O2SA 1ZZZA 2CHAC 2ZHDA 1RTFB 3GCNA 3LPRA 3M3SA 4X6NA 3ZZ9A 3NPSA 1CBWB 3BG4B 3I77A 5AFYH 1PJPA 2OC8A 2BLVA 4GCHG 3SV2H 4XBBA 1UO6A 2VWOA 1GBMA 3ATMA 1PQ8A 1N8OC 3A84A 3M61U 3L33A 1V2LT 1ZJDA 3GICB 1O5BB 1ARBA 2GT7A 2STBE 3VB4A 1HJAC 4B1TA 1EKBB 1T4VH 1LVOA 1VCQA 2Y81A 1MKWK 3NXPA 1O3NA 1GHBF 1NU9A 2VU8E 1O39A 4WH8A 5FCRA 5FCKA 5A0CA 3K6ZA 1G3DA 4A5TS 1GI3A 2XXLA 1L1JA 1C9PA 1UHBA 1GBFA 4DJZB 3ZV8A 5DP6A 1MMJN 2HGTH 3A7ZA 1GI8B 3MTYA 4UFFH 1L4ZA 1ID5H 3TGJE 2ZDKA 2BVXH 4X0WU 2PR3A 1VGCB 3L3TA 1KXFA 2JH5D 3QGJA 4AYVB 4DVAU 1TPAE 5CHAC 3VXFH 5EQQA 3SOSA 4FUDA 1EX3A 1DWCH 1BTZA 2PUXB 2TGDA 2BQWB 5C20A 1GVZA 4ZXYH 4K5ZA 4NZQA 4TY7A 4B73A 5DGJA 1AE5A 1ESTA 4D9RA 1WV7H 1C2FA 2FOEA 4RKJB 3BTKE 1W0ZU 4I8HA 2Z3CA 1ZPBA 3LGIA 2BLOA 1BTYA 1WQSA 1SGIB 3SU3A 4WF8A 1ELCA 3RXBA 1IQEA 3RXSA 2DUCA 1QBNA 1O0DH 1C9TA 4U2WA 2XC5A 1UVUH 2ZDMA 1GHWH 3PLPA 1KYNA 2FP7B 3ODFA 2W3IA 1RGQA 4NIVA 4AORA 2GVFA 1GVKB 1MKXH 2H6MA 1XX9A 1QB9A 1GL1A 3ZVAA 2VWLA 3A81A 2I6QA 1Z8RA 3SJ9A 3BEFB 3QWCH 1C1OA 3RU4D 1VCWA 2GV6A 3BTDE 3QK1A 1MKXK 3SJ8A 2V3HH 3SU0A 1CA0B 1EOLA 1V3XA 3LGYA 1ZRBA 2Y7XA 5C1XA 2WPIS 1GBJA 5H4IB 8KME2 2ILNA 3MU0A 2D8WA 1Y5UT 1C2GA 1QL8A 1CO7E 2BDAA 4Q7ZA 2QY0B 1F0TA 1TNIA 3RXUA 3EA7A 1ZTKA 2A45B 2ZHQH 3EDXB 4WWYA 1V2UT 1P04A 2BXUH 3ELAH 3LH3A 5JDUB 1Z71A 2EI7A 1O36A 1MTVA 2WPKS 4JZEH 1CBWC 4TPIZ 1BTXA 5FXLA 4YT7H 3TIUA 3A8BA 2F9BH 1GL0E 3P92A 1LKBA 2FI3E 3S9BA 3MH7A 3AW1A 3E90B 3M5LA 1LVYA 1HJ8A 2GZ9A 2Z9IA 4HI3A 4LZ4B 5A0BA 1S81A 3SUDA 2B7DH 3VXEH 1BZXE 1AQ7A 4FU8A 1GJ4H 1VCPA 3JZ1B 3MI4A 4H6SB 4U01A 2ZPRA 3RU4E 3RMOH 1WUNH 1P3EA 3QUMP 1BT7A 6GCHG 1XUHA 4UEHH 2C93B 1WSSH 2BY7X 1GI2A 2OTVA 4Q2KA 1GJ5H 3PYHA 4NG9H 4FUBA 3PROA 1HAPH 2BM2A 1FXYA 2CJIA 1UK3A 1DWDH 3U9AH 1Z1JA 3ZVBA 2XBYA 4Z0KA 3AW0A 1GCTC 1O31A 1SOZA 1YCPH 3A7VA 2JH6D 3SI3H 2C90B 2R3UA 4K2YA 1LPZB 4I8LA 1G37A 4O97A 5LGOA 4IN2A 2OQ5A 2RA0A 2J34A 2PSXA 2VINA 1C1VH 4MPVA 1GI7B 1E36B 3VGCC 1GGDC 1O2GH 1KY9A 4FUCA 4CRGA 1ZTLA 1TYNA 1MQ6A 1D3QB 1PPGE 2WPLS 1Q2WA 4GSOA 3RU4T 2XRCA 1O5AB 4MLFB 4CBOA 1O38A 4GCHF 4NA7A 2TBSA 1O32A 1MZDA 3RC5A 4BOHA 4XBCA 1ELFA 1GI5A 3BIVH 1HAOH 2W7SA 3SNBA 3RC4A 1P2JA 2A1DB 1BTUA 3PLKA 1O2TA 5A8XA 3CENA 3SV6A 1A3EH 1P09A 1TB6H 2TPIZ 1TNLA 1F5LA 1C5NH 2ZGBH 4ISHH 3A8CA 1Y3VA 4H4FA 4DG4A 3SU1A 1YPKH 1Q31A 5E8EH 1YF4A 2R2WU 3FANA 1HAYB 1YLDA 4TYDA 3VB5A 1THPB 5E2PA 3VB6A 2Z9GA 5GCHG 2VNTA 1GJCB 1FAXA 4YM9A 2SGDE 5FPSA 1AKSB 4QT8C 1TPSA 3RXKA 3QDZB 3T5FH 2VJ1A 1UVSH 4GHTA 2OCVB 3O8BA 2H9EH 1FI8A 1ESBA 2PGQB 1K1OA 1NESE 4ASHA 2GMTC 1Z8IB 4K1TA 2ZU4A 2G5VA 1WAYB 1C5ZB 1O33A 1VJ9U 3HK6B 1NC6A 2WPJS 4X1NU 3U1IB 1C2MA 3UR6A 2XNIA 1O2PA 2QXGA 2BDIA 3Q3XA 4FXGH 3V7TA 1LQDB 1DUAA 1K2I1 3TH3H 2NU2E 2B0FA 2PKSB 5K7RA 5EU8A 5FX5A 1W13U 1KIGH 3HKIB 3KHVA 3SO3A 1K1MA 1B0FA 4K60A 1LO6A 3MO3A 2OD3B 2AGGX 3MO6A 4Y7BA 3RXAA 2ALPA 3SV9A 3NWUA 1C1MA 1S5SA 2ZPSA 2GTBA 1WTHD 1GBKA 4AFUA 1TMTH 2ZPQA 2TGTA 1FMGA 1LCYA 2ZTZA 1S84A 1MCTA 2QGRA 3AAVA 1CHGA 4FU7A 1LHFH 5DPAA 4DW2U 3RXEA 3SUFA 1N1LA 3E8LA 1FN8A 5JB8S 1THSH 1VZQH 2AS9A 3RXGA 2O8MA 2YNBA 1P9UA 1TQ0B 4UDWH 3EAJA 3RM2H 4FU9A 1J8AA 4H6TA 1W10U 2VH0A 2A4OA 2QXHA 1UCYE 5FBIA 4BAKB 4NFEA 3E16B 1C1TA 3HATH 1H8IH 2GV7A 2PUQH 3RXCA 2G00A 3W94A 1TA6A 1LMWB 4BXSA 5LPEA 1UTNA 2CN0H 4I8KA 2SGFE 2ZA5A 3VEQB 3LIWA 2ZIQH 1DWEH 1GDQA 1DY9A 4MG3A 4JZFH 2OXSA 2FS8A 1QR3E 2EI8A 2ZWLH 3BG4C 3MHWU 4WMFA 3JZ2B 1C5MD 1G2LA 1O3KA 5C1UA 2FLBH 3MO9A 3A85A 1C5UA 1OWKA 1L1GA 4Y0ZE 2AERH 4O03A 3A7WA 1F7ZA 5IYTA 2G8TA 1LVBA 1CGJE 1EJNA 1V2JT 1JBUH 3S9CA 1ELBA 1P8VC 1FNIA 2GCTC 2Z7FE 1BMAA 3CP7A 3PM3A 5LH8A 1NS3A 4KTCA 1K21H 1CSOE 2ZFPH 1O35A 1TMBH 1XUKA 1TNGA 1DUEA 1WTGH 1J15A 1HJAB 1FY3A 2F9NA 3ZZAA 1QFKH 3K9XB 1SQTA 1DANH 2Z9LA 2G52A 3SBKA 5LPFA 1BRAA 2G81E 1BUIA 3BTQE 3DHKH 2R2MB 3HK3B 4ZKRU 4X1SU 5CE1A 4ABHA 2Z94A 1WYKA 2FOGA 1BTHH 1PQ7A 3RXDA 1Z6JH 4JZ1A 4OGXA 1O3MA 4B71A 1E34B 1BDAA 3WY8A 1MBMA 4OS4A 1V6DA 4A1VA 3T25A 8LPRA 2ZO3H 5JBTA 2WYJA 1YC0A 3SGQE 1W7XH 4B2CA 2J4IA 4GLYA 1NFXA 1JRTA 4Y8XA 1EAIA 4VGCB 3PTNA 5J4SA 3MU8A 1GBLA 1O2OA 4ZHLU 1IHTH 1SGFG 1XM1A 2QV1A 4JMYA 1SMFE 1W0YH 1GMHG 3ATIA 3SUEA 1UHBB 2Z6BD 1VJAU 3BTGE 1DPOA 1ZYOA 1IOEA 4MQAA 2FEQH 2FTMA 1S0RA 4ZH8A 1O2XA 1KXEA 1NRRH 2CMYA 1HXFH 1HXEH 4IN1A 3EE0B 1O2IA 4X6PA 2ESTE 3QX5H 1XXFA 5GPIB 3A8DA 5DK1A 1JOUB 1L0ZA 1EQ9A 1A2CH 4MNYA 1XVOA 1ZHRA 2SNVA 2ZNKH 3SQEE 1T7CA 3M7UA 4D9QA 1C2DA 4E7RG 1AZ8A 3G01A 1V2TT 2VWMA 3RXIA 4X2WA 4AB8A 1Y3YA 1Y3XA 4ABBA 4BNRA 1E37B 1VR1H 2QCYA 2ZDNA 2AIPA 1M9UA 1OWDA 4JYUH 3LT3A 4MNWA 3U1JB 4DIIH 1ORFA 1C5QA 2EEKA 1F0UA 3A86A 4MPXA 2HNTC 2FDAA 5JBCS 3TNTA 4CHAC 2ODPA 4WVPE 3K65B 4RKOB 1H8DH 1GI1A 1E38B 1O2WA 3A87A 5L6NH 4JK6A 3LU9B 4U32A 4M7GA 4Q80A 3DUXH 1FV9A 1RFNA 1GHXH 4WH6A 1GDNA 1C4U2 2GP9B 1W3CA 5T6GA 1SGFA 2BYAX 1Y5AT 5HGGA 1ESAA 1KDQA 1HCGA 1MTUA 1DFPA 2FZZA 1EXFA 3V13A 2UWLA 5DP5A 2BX3A 1O5CB 2ZU2A 4CH8B 1OWEA 1ANBA 1EP6A 1O34A 1HV7A 2ZQ2A 3M5MA 5EGMA 4X1RU 4ZAEA 3IITA 5C2ZA 1C1PA 3P8OA 4BAMB 3U98H 3VB3A 3OX7U 1T31A 4RN6A 2J92A 1KXBA 3MNSA 4BAOB 1NPMA 5JBAS 1V2OT 2VIQA 1A3BH 1L2EA 1TA2A 1T8OA 1LQEA 1TX6A 3KQCA 5EW2H 1FONA 1SGQE 2BQ7B 2C8WB 3KL6A 1OXGA 5DP8A 4OS5A 2ANMH 1U6QA 2O8LA 5TCCA 3TITA 3R0FA 1FJSA 1G3CA 3HPTB 1A1RA 3Q3KA 1J9CH 2FTLE 1JIMA 1DOJA 1DM4B 2D26C 3UNRA 2XCFA 6CHAC 2BDGA 4KTUA 1CT4E 3RXOA 1O2NA 4J2YB 1UK2A 3M37A 3NUMA 1WCZA 5A8YA 1SSXA 4MPWA 1SI5H 1O3EA 3LH1A 1VGCC 2Y82A 2H9HA 1BRBE 2G51A 3LKWA 4Y11E 3F9FA 3PB1E 1NTPA 2XC4A 1V2QT 2JKHA 1O3BA 2ZHWH 5E0JA 2BVSH 3P6ZB 2FI4E 2ZKSA 2C8ZB 1QJ1B 5JYIA 2J94A 5AF9H 2BD2A 4ISOA 1O5FH 1SGEE 1MCVA 1NRNH 4GHQA 2XTTB 2YOLA 1E35B 2FYQA 5DP7A 4K8BA 3UREA 4XDEA 2V35A 1EB2A 3UQOA 1GBIA 2FOAA 2UWPA 1GBDA 1UTJA 4NSVA 3E0NB 1CQQA 4X8UH 2A4QA 3TJNA 2GDEH 3LGWA 4HFPB 4MNVA 1AFQB 2G5NA 4AGKA 4A6LA 1FAKH 3NZIA 4XBDA 1HRTH 2ZDLA 4JZDH 1TWXB 1IQNA 1GBAA 1SHHB 4D8NA 3HGPA 4ZKNU 1BBRH 2KAIA 2A7JA 1QNJA 1THRH 5E0GA 1O3FA 3SV7A 2W7UA 6LPRA 1S6FA 1YP9A 1TRYA 2ZFFH 2ZF0H 3LGVA 1DWBH 2A4RA 3PMAB 1O5DH 2VIVA 3SV8A 1OP8A 3C27B 2H2ZA 3SNCA 1O2KA 2OC1A 5FPYA 1LHDH 3OTJE 1IQLA 2BX4A 2CF8H 2ZFTA 2HWLB 5F8TA 1FLEE 3GCHB 1G3BA 2CGAA 4FUIA 2FXRA 4Q7XA 1K1LA 2FX6A 2OINA 3PO1B 1MTNB 1SGTA 1SFQB 1FDPA 1B0EA 1GWAA 4XOJA 2F91A 4AZ2B 1O3OA 1PPCE 1MU8B 2J95A 5JB9S 1YM0A 2QC2A 2WPMS 1GMDF 3RUOA 1W12U 4LOYH 1SG8B 3GY6A 4KKDA 3TLOA 2NU3E 1QURH 2Z3DA 1SVPA 3BEUA 3V0XA 2VIPA 1RXPA 1Z7KA 4YOGA 4NIYA 1NFUA 2OC7A 2TGAA 3R3GB 1G32B 3TH2H 1TRNA 2AMDA 3FP7E 4FVBA 2Z9JA 2GX4A 1C2LA 3PTBA 3STJA 2A5KA 3DFLA 1HYLA 1MUEB 2B5TB 1O3DA 1F0SA 3FVFB 3RXLA 3SHCH 4IBLH 4WMDA 1YKTA 1K22H 1D6WA 5BRRE 1NZQH 3T27A 2ZP0H 4HTCH 1GBEA 3PMHB 1QQ4A 1RTLA 4JYVH 3QO6A 3T29A 2NU1E 2NU0E 1KSNA 2YNAA 1HGTH 6CHAB 2BY8X 1DY8A 4O3TA 3TGIE 1FPCH 3A8AA 1O5EH 1QHRB 2BY6X 2ZCLP 1GPZA 4JYTA 2THFB 1HIAB 1ZR0A 4BTUB 2JH0D 2RDLA 2Y5FA 5I25A 1C2HA 2PHBA 1C5WB 3LGUA 2P8OC 2I6SA 1P2NA 1EPTB 1ZPZA 1H9LB 1RTKA 3ATLA 5C3NA 2NWNA 2GD4B 5DP3A 4ZKSU 3PMJA 3F68H 2Y7ZA 3QGNB 4IC6A 1O3JA 4ABFA 2BD4A 5EPYA 4X2YA 3D65E 3E0PB 5LPRA 3EYDA 4UFGH 3T2NA 2ZGHA 1C2IA 1GHAF 3D23A 1OYTH 3F9HA 3PO1C 1C5TA 2FESH 5JPMH 2R3YA 3E1XB 3RC6A 1EAWA 2FIRH 3GCHC 3W95A 4Y79A 1N6XA 3RMNH 3MU5A 1TGNA 1EZXC 4K1EA 2GCHG 1BBRE 2F9VA 4DGJA 1EPTA 1GG6B 1X7AC 1MD8A 4TPYA 3GCOA 3UWJH 1D9IA 1H9HE 3ZZ6A 4UD9H 3PWBA 3DA9B 2OUAA 1HAIH 4FVDA 5T3HA 3A83A 1ZMNA 4E06H 1XUIA 2W3KA 4I7YH 4B2AA 1G3EA 2QF3A