2FWWA

Human beta-tryptase ii complexed with 4-piperidinebutyrate to make acylenzyme
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
243
structure length
243
Chain Sequence
IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Tryptase beta-2
publication title Structure-guided design of Peptide-based tryptase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 49
structure length 243
sequence length 243
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2006-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fwwA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fwwA01
1L1NA 1BT7A 2OC8A 4UEHH 4ZXXH 3U8RH 4I8HA 3HGNA 2P8OC 3ZVFA 1O0DH 1SMFE 3SHCH 2V35A 4AB9A 1GMHG 4ABHA 1DLKB 1O3HA 3P95A 4ABBA 3BN9A 1UTPA 2BTCE 3U1IB 3PMJA 5HMAA 1J15A 4FUFA 2XTTB 3BG8A 4XDEA 3E8LA 1F0RA 4DG4A 3QO6A 4KTCA 2WPHS 4H6TA 4WH8A 3ZVBA 4Z6AH 1EASA 1GJCB 2Z9KA 1SLXB 3TK6A 4OS1A 2HRVA 2H5CA 2OP9A 1ZRKA 3NKKA 3RMNH 1QR3E 2BY7X 2HNTC 1THSH 2R0LA 3D23A 4X0WU 4AFUA 4AGKA 2BDAA 3MO3A 3TNTA 1KSNA 1K21H 1GI1A 1A61H 1PQ7A 1J8AA 1V2MT 5B6OA 2HLCA 3ZV8A 3CS0A 8KME2 4ISOA 1TNLA 1QJ7B 2ODYB 3GY5A 4YOGA 2SGDE 3SI4H 2P3UB 2LNCA 3HK6B 3PMAB 1DT2A 1E38B 3SHAH 1AN1E 1YYY1 3BTQE 5SGAE 1RS0A 4GPGA 4R0IA 4X1NU 1EX3A 2ZQ2A 2OC7A 1GJBB 1GHVH 5AFZH 5T6DA 1QTFA 1XUHA 2TRMA 1CT2E 1V2JT 4Q7YA 3M3TA 1OSSA 1XUJA 2G5VA 3BEIB 1GHBF 1O5FH 1V2WT 1CVWH 1P2KA 2ZIQH 1KLIH 1GI6A 2EI7A 4TY7A 1SHHB 5LGOA 1QB6A 2ZGCA 1TPAE 3SQHE 5E8EH 5HYOA 1EKBB 2SFAA 1AUTC 1AZZA 1S6FA 1Z1JA 2V6NA 4BNRA 3BTDE 3KNXA 3MI4A 1O3IA 4XE4A 3SJ9A 1VITG 3KN2A 2VVUA 1FY5A 4LK4A 1W14U 4UDWH 1FDPA 2WPIS 2BLWA 3MH6A 1JWTA 1J17T 2YOLA 1E37B 3MU0A 2AGGX 1GBJA 3MMGA 4MLFB 3E0PB 1MCTA 4SGAE 2Y5HA 1UHBB 1BHXB 1ZZZA 1BCUH 3A88A 1TNIA 1FY4A 1O2VA 2BD9A 1C5UA 1GI0A 1O38A 3FZDA 3DD2H 2RA0A 1AFQC 3FAOA 4X2WA 3SU4A 3UFAA 2BY6X 3LOXA 1GJ5H 1ESAA 4TPYA 1UTMA 1O3CA 1Q3XA 1BTXA 1C9TA 4YTAA 1B0EA 5FBIA 1LTOA 1YPKH 1CBWB 2TIOA 3TU7H 5F8XA 1AE5A 2GX4A 3RMLH 1TLDA 4NWLA 1RTFB 5AVDA 4U32A 2GTBA 1TB6H 1TPPA 3PV4A 1TRMA 5FHTA 2CF9H 3TGJE 2W5EA 3TIUA 2YNBA 1QRWA 3HK3B 2VH6A 3MO9A 6LPRA 5ABWA 3DHKH 2TGTA 1J16A 2HWLB 1C2JA 1IOEA 1TX6A 2AFQB 2BHGA 1L2EA 2ULLA 1SQAA 2TGPZ 1IQHA 1ZSLA 3ZYEA 1O34A 3VB7A 4GAWA 3RXMA 1UCYH 5DJ7A 1O35A 1U6QA 1KLJH 3EA9A 2JETB 4Y71A 1DY9A 1TGBA 5CE1A 7ESTE 2B8OH 2G4TA 4CH2B 1EATA 5E0JA 1HGTH 1KIGH 3QLPH 3MU5A 2CN0H 2QAAA 1QL7A 1WQSA 1O5AB 4NFFA 2Y81A 3QGNB 1WTGH 1W8BH 4B71A 2VNTA 5IYTA 1EOJA 1XKAC 3P17H 3AAUA 5C1UA 4DW2U 1CE5A 1LHGH 3BV9B 1IQKA 2ZQ1A 3RM0H 1QBVH 1YPJH 2KAIB 3FFGA 1CU1A 4J1YA 2ZHWH 3AW1A 3AW0A 3MYWA 1SGTA 2FIRH 1J9CH 2BXUH 4FUDA 2BLVA 4IMZA 3UQVA 1W7GH 4X8VH 1HAXB 1ZJDA 1AHTH 1UJ1A 1BMMH 4CBOA 1W13U 1BBRH 1TBQH 3OU0A 3TK5A 1P2QA 1XXFA 2BZAA 1EZSC 4B75A 1KXCA 3URDA 3PM3A 1VR1H 1Y5AT 1O3GA 3D62A 5C1YA 1OP0A 1SLVB 1F0TA 5GXPA 2OQUA 3LGYA 1SG8B 1LQEA 1ZJKA 3OSYA 7GCHG 1O2MA 3TNSA 2FI5E 4D9QA 3VXFH 1P06A 1SI5H 3ODFA 3TJVA 1ZMLA 1LHDH 2H1UA 3MWIU 4DIHH 4IS5A 1YGCH 1QJ1B 5A8ZA 1GGDC 1HJ9A 1A7SA 1IQNA 1O32A 2B9LA 1ELVA 2H9TH 1FXYA 1UK2A 4CRAA 1O2OA 4KTUA 4FU9A 4FUIA 5I25A 3GY8A 3MH7A 3PMHB 4M7GA 1DITH 1MTNB 1A3BH 2VIOA 4GSOA 3UR9A 2BLQA 1YKTA 4ZKSU 1G2MA 1CBWC 1C5TA 4GCHG 1NN6A 2ZU2A 1ZYOA 1AVXA 2XXLA 1ELTA 4HZHA 3M5NA 1GJ8B 1SHYA 1AU8A 3SQEE 2BDYA 1P01A 2A4GA 3RXLA 1O3OA 1H4WA 4Y10E 2PLXA 3ZVEA 5DP7A 1S82A 3TJUA 3GISB 2VWMA 1O2UA 2F9BH 3RM2H 1O3EA 1Z8IB 1O5GH 2QC2A 2VIDA 2F9PA 2BD8A 1HCGA 1IQGA 1O33A 3ZVGA 3UREA 1LHFH 1GG6B 5HGGA 1K1MA 2CF8H 3KQCA 2VJ1A 4Q7XA 1DPOA 1P9UA 4JZFH 2ZU1A 4ABIA 1GHZA 2JETC 4YOIA 2BD3A 2SNVA 2FOAA 4H42U 2R2MB 4CREA 1Z6JH 3RLWH 1RTLA 4A1XA 2ZZUH 3UOPA 1ARBA 1T8NA 1L4DA 1YPMH 3V0XA 3QZRA 3SV8A 2WUCA 4VGCB 1DM4B 3BTFE 1XVMA 2XRCA 2ZFPH 1TALA 1UHBA 2GT8A 1INCA 4CHAB 1ZMJA 4UFGH 1EJNA 4Y7AA 2QCYA 4D7FA 2ODQA 4ISLA 3E16B 4YESB 4ZUHA 1HDTH 1IQFA 2QXIA 3P8OA 1K1NA 1SPJA 2R0KA 1FI8A 3FANA 1GPZA 2RG3A 5GCHG 1Z8JB 1GHXH 2FTMA 2SGQE 4KP0A 2FOBA 3LT3A 2ZGHA 3PWCA 1SGQE 1Y5BT 1ESTA 2PTCE 3JZ2B 1MTUA 2PV9B 2OBQA 4TPIZ 1O3DA 1SLWB 2J92A 3GY6A 4UFEH 3PO1B 1L4ZA 1GJDB 1HAZB 4X1SU 2FMJA 1TGCA 4AX9H 1TNKA 2VWNA 1C5QA 3RC6A 1HRTH 1O3AA 4GUXA 1W0ZU 2ZDMA 3LDXH 1L1JA 2Q6GA 4IN2A 2FODA 1D9IA 1Y8TA 2Q1JA 2PGQB 1MTNC 1AD8H 1G36A 2O8LA 1FIWA 1Z71A 1NTPA 2OTVA 3H7OA 2FS8A 4JYVH 2SGPE 1OWIA 1V2ST 2QN5T 2WUBA 2XWAA 2ODPA 2UWPA 5EW1H 1D4PB 2Y5GA 3VGCB 1BRAA 2VVCA 2Z7FE 1BTWA 1PYTC 1QL8A 5EU8A 1NS3A 1YPEH 3SNDA 1UO6A 1C1RA 2WYJA 3K6YA 2KAIA 3F9GA 4CRGA 2Q6DA 1TONA 3A8CA 1NFYA 3SGQE 1MZDA 3EE0B 1EZQA 3S9CA 1BRCE 3GY3A 2ANKH 1GG6C 2FOCA 1PPFE 2QXJA 3MHWU 3M7TA 4TWWA 2ZP0H 1KY9A 1V2QT 4E7RG 2ASUB 3I29A 3FP7E 3TJNA 3TH4H 1H9IE 3T25A 4YT6H 1EPTA 1AVWA 4BAHB 1QFKH 2ZDLA 1QL9A 5C3NA 5LPEA 4FUCA 1MTVA 1Y3YA 5L2ZH 1O2IA 1FQ3A 1UCYE 1QJ6B 3QUMP 4VGCC 5FAHA 1T31A 3ITIA 2AH4X 2ZDNA 5GIBA 1P2IA 7LPRA 3RXFA 2R3UA 5K7RA 4CHAC 3ATWA 2J38A 2ZFTA 3SU1A 4A7IB 1D3PB 1UTKA 2PUXB 3GCHB 4Y8ZA 3E3TA 2Y80A 3ZZ3A 1TX8A 3TLOA 5AHGH 3ZYDA 2PUQH 1PPGE 2FX6A 2VVVA 1EZUC 1CT4E 3C27B 1ORFA 4XBBA 2BD4A 1BIOA 3VB3A 1K1LA 4DCDA 1WAYB 2BX4A 2HNTE 3PYHA 5LH8A 1UVTH 1TWXB 5JBBS 3UPEA 1TNHA 5TCAA 3V12A 2EA3A 3KF2A 4JCNA 1NT1A 5L30H 1LPZB 1G2LA 5EQRA 3UWIA 1VJAU 2GT7A 2O8MA 2A5IA 4ISNA 5PTPA 3RXKA 1SGFA 2BD5A 4UE7H 1C4V2 1S5SA 3TVJB 3A81A 2ZU5A 3PO1C 1AZ8A 1BBRE 1NZQH 3SJ8A 3SUFA 1PPCE 3V7TA 3SGBE 4O3TA 1ETRH 3GCTG 1N8OB 2J4IA 3VFEA 1IQJA 2BDBA 2W3KA 1ZSJA 2PSXA 6CHAB 3URCA 4BAMB 2ZCHP 1P2NA 1BMAA 2AGEX 1C5LH 4I8GA 2AYWA 2GZ7A 1GI4A 2FOGA 4NZLA 3SUEA 3LKWA 3DFJA 1G30B 2HALA 3LH1A 1O3FA 1LQDB 2WPJS 3BF6H 1EQ9A 1CHOG 4XBDA 2QF3A 2BYAX 1YM0A 1DY8A 3KQDA 1P2MA 4CRBA 3VGCC 1VGCB 2Y7XA 1ZPZA 3TGIE 4A1VA 2BOKA 2CV3A 1Y59T 2ZGBH 4AFQA 3A7ZA 4D9RA 1ZHRA 1F2SE 1ETSH 1YPGH 2F9OA 1KXDA 4NSYA 3GICB 3HKJB 5EXNA 2F9NA 1O3KA 1AFEH 3GOVB 4B2CA 1FAXA 1SLUB 2AMQA 3RXDA 1H1BA 1TGSZ 1DSUA 1HYLA 1C5PA 4AFZA 5DP5A 5E0HA 2WYGA 1UTNA 2TGDA 1DANH 4NIYA 2D26C 3VB6A 5EGMA 3VB4A 2ZHQH 1MD7A 1SGCA 3TK9A 1ZPBA 3KCGH 1E36B 2FEQH 1KXFA 3STJA 4NIWA 1FY3A 1AGJA 2WV4A 3ELAH 1YLCA 3T26A 4HGCA 3A7XA 1P09A 3QK1A 1XX9A 3BTTE 6GCHG 2FI3E 2XCNA 1A5GH 3RXAA 3RLYH 2O8WA 3A87A 3NK8A 5C1XA 2P3FH 3ZZ8A 4GHQA 3GCHC 3EAJA 1DXPA 1AUJA 1A0LA 2UUFB 4I31A 3Q77A 1NU7B 3UQOA 1AWFH 3F1SB 3M7QA 4E7NA 1VCPA 2EC9H 2GCTB 1GI9B 3STIA 2HGTH 3SU0A 2J2UA 1VCWA 3QZQA 4MNVA 3GY7A 3UNQA 2A5AA 1JMOH 1CA0B 1WQVH 2H9HA 4B76A 1OXGA 1H9HE 3S9AA 2VWLA 2A7HA 1JBUH 2RCEA 3CENA 4OS5A 1JIMA 1ELBA 3HATH 1D3TB 4ISIH 4X8TH 1C1WH 4CRCA 1C5NH 4WH6A 3RXPA 8ESTE 4NZQA 2EEKA 3SV9A 1N8OC 1FV9A 1GMCG 2AEIH 3CS7A 1A46H 1GBCA 2ALVA 1D6WA 4DGJA 6CHAC 2PR3A 1S83A 1NROH 1GHYH 4K1SA 1MBMA 1O2TA 3RXEA 1Z6EA 3Q3KA 3MU8A 4WY3A 5EXMA 5JBTA 4THNH 1C2LA 3Q00A 3LGUA 1E35B 3RXHA 4K60A 1AVGH 1O2SA 3RC5A 1TOCB 3LGTA 1ID5H 1GMDG 4BAKB 3A8AA 2V0BA 2XBVA 1FIZA 1QB9A 1O30A 1O3JA 1UMAH 1A3EH 1CHGA 2P93A 2Y5FA 3KIDU 4O3UA 2A4OA 2C8ZB 2BVSH 3A7TA 4X6OA 4BTTB 3MU1A 1RGQA 2ZDVH 3D65E 1ZPCA 3QTVH 3EA8A 1GBDA 4R8TB 1AKSB 8LPRA 1GHAF 2QV1A 1GBMA 1ANCA 3QDZB 1AIXH 3RXJA 1P04A 3FP8E 3W95A 2ZCKP 1N6YA 4UONA 4E06H 2FYRA 1BITA 2GZ8A 2GMTB 3F9HA 2BVXH 8GCHG 1GBIA 3SU3A 3SNAA 2ZU4A 3EDXB 3M37A 3QGJA 1THPB 1SGYE 2GCHF 4IN1A 1HAIH 1UVSH 4YM9A 1O2RA 1BJUA 3E6PH 4MPUA 2QGRA 1YBWA 4H4FA 1HJ8A 2BZ6H 1DWBH 1SBWA 3RU4T 3S9BA 2VGCB 2WINI 4B2AA 3O8RA 3E91A 1A5HA 1RRKA 2FP7B 5BRRE 2GV6A 3KHVA 4AORA 1K2I1 2C4FH 2GD4B 2C8WB 2GCTC 1ARCA 1HXFH 3C1KA 2YNAA 1YPLH 1ZRBA 3DUXH 3MTYA 1ANDA 1UTQA 2ZG0H 4FVBA 2BDCA 5T6FA 3SW2B 2ZWLH 1CA0C 2BX3A 1MTSA 2ZHFH 3SNCA 2ZTXA 5EQSA 4WMFA 1RFNA 4ABEA 1A5IA 1GI5A 2Z3DA 2WPMS 3RU4E 1P12E 3MU4A 1C2HA 1WUNH 4Y0ZE 3MOCA 3S69A 1S0QA 5A8YA 1DWCH 1P0SH 3ESTA 4ASHA 2BD7A 1EPTB 1T8OA 2BDHA 1LKAA 3TH2H 2XBYA 1FZZA 3ZZ6A 2D2DA 3H7TA 4MNXA 1AY6H 2PKSB 1C1OA 1ELCA 4WXVA 1S6HA 5DP6A 5GPIB 4CRDA 1MCVA 4FXGH 4TWYA 1WU1A 2PHBA 1K22H 4IW4E 4SGBE 3L6PA 4XSKU 4DOQA 1EJAA 3TITA 1NO9H 2ANMH 1MAXA 1QHRB 1TBZH 2C90B 2THFB 2ZPSA 1FONA 2A31A 4K69A 4YO9A 1KXAA 2ZTZA 3HPTB 4A6LA 1IHTH 4JZ1A 3T5FH 3SJOA 1EB1H 1SOZA 3VEQB 1DWDH 1GVKB 4CBNA 2BOHB 1HAGE 1PQAA 3K65B 1TABE 3F9EA 1S84A 3SUGA 4AG1A 1XXDA 5C20A 1LHCH 3SJIA 2VH0A 4LXBH 1HAYB 3PLKA 3BTEE 1HPGA 1ZMNA 2DE8A 3F68H 1C2EA 5C67A 9LPRA 1V2TT 3BTWE 2A4QA 1SGEE 2F91A 2G55A 4MVNA 4YOJA 2PFEA 2OINA 4AG2A 1C2IA 4ZH8A 3LC3A 1GCDA 1FUJA 2A2QH 3ZVDA 1W12U 2UUYA 2AMDA 3S0NA 2GMTC 3B8JA 1GHBG 1O3PB 3NXPA 1XMNB 1TGNA 3SO3A 1VZQH 1C1PA 1GWAA 3BTGE 1NRRH 2JH0D 4I33A 2NU4E 3PB1E 2B5TB 1C5OH 3VB5A 1EJMA 4GLYA 2WPLS 1O31A 1MUEB 1SR5C 2R9PA 1GBHA 4BXSA 3I77A 1O3NA 2H9EH 3HGPA 5EG4A 2VGCC 3UNRA 4ZHAA 4NIXA 4X1RU 1LDTT 2SGEE 1C5YB 1PQ8A 2J9NA 3P92A 1BQYA 2H5DA 4WJG2 5CMXH 2A7CA 3TH3H 1W3CA 2OLGA 3KGPA 1GDUA 5GWZA 4ZHLU 1MU6B 3U98H 1GI2A 3PMBB 2ZFQH 3MH4A 1KXBA 4CR9A 3H5CB 1YLDA 1MMJN 1C2DA 3LPRA 1XVOA 4K5ZA 3S7KB 1SQTA 1UVOA 3SBKA 3SNBA 4F4OC 1O2WA 4XOJA 1O2KA 4QT8C 5FCKA 2V3HH 1AKSA 1OKXA 1Q2WA 2FM2A 1SSXA 1K1OA 1TRYA 5EOKA 1EPTC 4DJZB 1GMHF 1OP2A 1SGNE 1O2XA 3TPIZ 2OC0A 4UFFH 4NFEA 2PKSC 1O3BA 1HAOH 1EAXA 4NA8A 2FOFA 5JBAS 2A45B 2TPIZ 3B23B 1WTHD 2FLBH 2OC1A 2OUAA 3RXIA 5JDUB 1YCPK 3LJOA 1T4VH 3M36A 3M5LA 4FUGA 1BTPA 1TPOA 1GI8B 1MKXK 2DE9A 3IITA 4LZ4B 1NM6A 3Q3XA 4IMQA 3ZZDA 2J94A 1NRNH 4DURA 1WBGB 1P3EA 3LONA 4I8KA 3RUOA 4JK5A 4AZ2B 4INKA 1Z7KA 1LCYA 1K1JA 1F5LA 3FVFB 1ABJH 2PTNA 1OWHA 2D8WA 5F8ZA 3RXOA 4O03A 2O8TA 3SJKA 5DO4H 4UFDH 1NPMA 1YCPM 4OGYA 1H8DH 1HAHH 2FOEA 3VPKA 4O9VA 3QX5H 1AQ7A 1YC0A 3NPSA 4U2WA 2PSYA 4A1TA 5I46H 1HFDA 4K1EA 4IBLH 4FU7A 5JB8S 1C5RA 1O2LA 4BXWA 3UR6A 1EZXC 3BG4B 1TNGA 2BMGB 2VIPA 4ZMAH 4X1QU 2WV5A 4ZKOU 1AWHB 1G3EA 1BA8B 3UY9A 1RJXB 1GVZA 2FXRA 1O5CB 1FN6A 3ZV9A 1P2OA 3Q3YA 1ELFA 4GVUA 3IWMA 5L2YH 4KGAA 3SUDA 1QBOA 2CXVA 1IHSH 1C5WB 3U8TH 1BMNH 4HTCH 3TGKE 4PROA 4X1PU 1HUTH 2BXTH 1AMHA 1F5KU 3ZVAA 3UNSA 5FX6A 2G4UA 2QYIA 1GL1A 4O97A 2CGAA 4Y8XA 1QGFA 2B7DH 5FBEA 1UTOA 4A92A 1LPKB 3T28A 3BTHE 1J14A 1LKBA 2NU3E 1VJ9U 2XWBI 1QIXB 1IQLA 1PPBH 1TIOA 3ENSB 3M3SA 1EP5A 4FVDA 4MDSA 2R2WU 1FMGA 3SV7A 2XNIA 3GDSA 3M5OA 4B73A 5EXLA 4AYYB 1THRH 4OS6A 1XUKA 1QURH 1C2GA 1C5ZB 4KKDA 4XBCA 1V2VT 3NWUA 2IOTA 1GCTB 3ATMA 4Y11E 3LJJA 4Y79A 1EAUA 1WOFA 1NRQH 1PQ5A 1OYQA 3UWJH 1C1TA 1HIAB 1LVBA 1V2OT 1L0ZA 2OD3B 1T8LA 4WWYA 1S85A 4ABAA 1HB0B 3T62A 1V6DA 2TGAA 2Z94A 1BRUP 4YZUA 5F03A 1F0SA 3EYDA 2BQWB 4CRFA 3MNXA 2UWOA 2ZDKA 5C5NA 2TBSA 2Y6TA 3OX7U 1OP8A 2G8TA 2HPPH 1IAUA 3JZ1B 3SZNA 4X6PA 4IC6A 3PROA 1MAYA 2W7UA 2G52A 1H9LB 2Z9JA 3DA9B 5FCRA 3O8CA 5GJ4B 2A0QB 1P03A 4MG3A 1D3QB 1BUIA 2ZPRA 1RIWB 1ABIH 1BRBE 1K1IA 1PYTD 4FUBA 1SVPA 2QXHA 3BTME 2FPZA 5DGJA 4A5TS 4DT7B 1QQ4A 1W10U 1FNIA 2SGAA 5G4BA 3PWBA 3OYPA 5A0AE 1F92A 1OOKB 3BG4C 1WV7H 4JK6A 2PWXA 1E34B 3NUMA 4J2YB 2A7JA 3LC5A 2FOMB 4D76A 3PTNA 2VIQA 1MKWK 4X2YA 3MNSA 2M5TA 2XC5A 1B0FA 1CSOE 3M7UA 3BSQA 2QIQA 5T6GA 3RP2A 1TMTH 4ZAEA 3SNEA 5DK1A 4NCYA 1O2ZA 4H6SB 1YPHE 1T32A 1SGRE 7GCHF 2HNTF 1MQ5A 4AYVB 1MZAA 5DP3A 1FJSA 1KTSB 2GVFA 2ZU3A 1QB1A 2ZNKH 3ATIA 3T27A 3V3MA 4LZ1H 1DUEA 1SB1H 2O9QA 2D1JA 3EGKH 5DKMA 1G3DA 2G51A 1C5MD 3A85A 4DY7B 3MH5A 1P02A 1MD8A 1C1MA 1IQEA 1SGFG 3LH3A 4AGJA 3ATLA 1CA8B 1PJPA 1T7CA 5HM9A 3A84A 2JKHA 3GDUA 4FUHA 2VWOA 1NFXA 1V2RT 3G01A 3Q76A 1GCTC 2H6MA 1EP6A 4GCHF 3U1JB 2GDEH 4RKJB 5A0CA 5FX5A 1Z8GA 1C1QA 2RA3A 2PW8H 1KDQA 1VITH 1QQUA 4NA9H 1DUAA 3IG6B 1SQOA 4AFSA 1P05A 1TA2A 1O3LA 1F0UA 2F9VA 1QY6A 1SOTA 2QXGA 5DPAA 3UUZA 1GHWH 3TJOA 3D49H 2STBE 1C5SA 4Y0YE 1GJ6A 1O5DH 3GCNA 5DP4A 3R0FA 4Y8YA 1H8IH 3CP7A 4ZROA 4INHA 1RTKA 1JRTA 4RSPA 1HV7A 3GY4A 2AMPA 3PLBA 1HAVA 1EAWA 4K8YA 3RXRA 2ZF0H 2C8YB 3OY6U 1IQMA 5DP8A 4FUJA 2ZKSA 1FLEE 3LGWA 5BPEA 1UTLM 1VGCC 5C5OA 2NWNA 5JB9S 5GDSH 1OWKA 1M9UA 2EI6A 3QTOH 1ZLRA 2JH6D 3P6ZB 1GVLA 1RIWC 3F9FA 2ZEBA 1GJ4H 1EUFA 4F49A 1EXFA 4YT7H 1DOJA 1GGDB 2BVRH 2C8XB 4JZDH 2VIWA 2ZFSA 1EAIA 4X8UH 1ACBE 3EA7A 1HJAB 4X2XA 1SGIB 5K0HA 1F7ZA 1DDJA 1NFWA 2SGFE 2XC4A 1YPHC 3FP6E 1ELDE 1GBEA 3LU9B 5AF9H 5GCHF 2XBXA 5JYIA 3BEUA 1XM1A 4ZXYH 1OWJA 1DFPA 1P2JA 2XYAA 1S0RA 3F6UH 4I8JA 1W0YH 3DFLA 2GDDA 1QNJA 2UUKB 2VB0A 4ZKNU 4X8SH 3VXEH 4B1TA 2Z9LA 2O8UA 5EPNA 2CJIA 1A4WH 5A2MH 3BTKE 4BTUB 5ESBA 1XKBC 1XUIA 3BIVH 1ELGA 2FDAA 3PLPA 1HIAA 1TNJA 2VINA 4E05H 3KQEA 2BDGA 2IN2A 3K2UA 3O8DA 4Y7BA 2AIQA 3E1XB 2OQ5A 3RXGA 1CQQA 1DWEH 1C5VA 1O2YA 1QA7A 2ZHDA 1PPZA 4JYTA 2ZDAH 2ZI2H 1BTUA 2SNWA 3SV6A 2NU2E 1MH0A 3ZZ5A 4Q2KA 2OXSA 4BAOB 1RXPA 2PKAB 1G32B 5LPFA 2XC0A 5A09A 2P16A 4IGDA 4WF8A 1X7AC 2BQ7B 1GBBA 1MU8B 3A82A 3S7HB 3UOUA 2A32A 4MQAA 1C1VH 1S81A 1O5BB 1WSSH 1XUFA 3LIWA 3BIUH 4RN6A 1Y3VA 1P9SA 2F9UA 2Z6BD 2F3CE 1JOUB 2IPHA 3QN7A 2VU8E 1BZXE 2A2XH 3M35A 1N1LA 4CH8B 1GBTA 4NG9H 4LOYH 5HXFA 1TMBH 1ELAA 2R3YA 2A1DB 3P8FA 1DICA 3R3GB 3SV2H 1A0HB 3OTJE 1Y3XA 1PPEE 1L1GA 2GV7A 5FPTA 3ZZ7A 3E90B 3RXQA 1NY22 2OBOA 2XCFA 2Z3CA 1OYTH 1YCPH 1UVPA 1ZHMA 3UTUH 2BQ6B 1V2LT 3GYLB 2FO9A 4NWKA 3ZZBA 1TQ0B 4HI3A 2Z9IA 1TFXA 5LPRA 1O37A 1MKXH 4NGAH 1W2KH 4GHTA 1BHXF 2AS9A 4ZHMU 1V2KT 1K1PA 1SFIA 2P59A 2ALPA 1EB2A 1C1SA 1OX1A 1N6XA 1V2UT 4OS4A 3SU2A 1O36A 2FX4A 1JXPA 1HBTH 1AI8H 4ZKRU 1FY1A 1NFUA 4INLA 3E0NB 1A2CH 1GBFA 1TQ7B 2A5KA 3T29A 5J4SA 3AAVA 4MTBA 1QRXA 3RXUA 1HJAC 1C2MA 1NRPH 1ANBA 1GI7B 5CHAB 1GDQA 1BDAA 3ZZAA 1K28D 2HPQH 2P3TB 3A80A 3LGVA 3RDZA 3L3TA 2Y82A 4JMYA 1D3DB 3DT0H 2B0FA 1F5RA 1O2QA 3UIRA 1ZSKA 4WVPE 1YF4A 3ATKA 1MTWA 1GBLA 1KYNA 1ETTH 2FS9A 4Y76A 5T3HA 1Y3UA 2ANYA 4D7GA 1GDNA 4MPWA 4AOQA 2K1QA 3T2NA 5E2PA 2ZTYA 1O2NA 1UK4A 1SFQB 9ESTA 1NU9A 1O2JA 2CMYA 2FWWA 1BJVA 2AGIX 2Z9GA 1JRSA 1P10A 2IJOB 1C1UH 4JZEH 4NA7A 3K6ZA 1NESE 2NU1E 2Q6FA 3GCTF 1W11U 4JZIA 2ZC9H 3A7YA 2JH5D 1O39A 2FI4E 3L33A 1G9IE 1O5EH 1BTZA 3ODDA 4RKOB 4KTSA 3U69H 4Z0KA 1HAPH 3U9AH 3P8GA 2RDLA 1G3BA 4NSVA 5EODA 4BTIB 3KQBA 2ZO3H 3MFJA 4FU8A 5FPYA 1ZTLA 1UCYK 4ISHH 1W7XH 2P94A 3ZVCA 1ZOMA 2ZGJA 2V3OH 3SOSA 4XFQA 5H4IB 1CHOF 1TAWA 4Y6DA 1LMWB 3RXVA 1NRSH 2VIVA 5TJXA 1C2FA 1AB9B 5J4QA 3N7OA 3O8BA 2GKVE 1LHEH 3A8BA 4OS7A 5EQQA 1C4U2 2LPRA 1GJ9B 3SU5A 3I78A 4B2BA 1TPSA 1DE7H 1OPHB 2G00A 3P70B 1TE0A 2ZECA 1GHAG 3K9XB 5E0GA 3ZZCA 1FPCH 1ZTJA 2FTLE 3P8NA 4ABGA 2FESH 1A0JA 4U30A 1BTYA 3MNCA 1P3CA 3M5MA 5JPMH 1ESBA 1KXEA 5HM2A 1Y3WA 1QRZA 1V3XA 1CO7E 1G37A 1O2GH 1ZR0A 3W94A 2FZZA 4CR5A 1Y5UT 1SC8U 2BY8X 2BDIA 3GDVA 1BTHH 2STAE 1YP9A 1E0FD 2ANWA 2XW9A 3RXBA 3ZZ9A 2QY0B 2G81E 3SN8A 1BBRK 2GCHG 1BB0B 3RC4A 1DLEA 2H2ZA 4WMEA 5IDKA 3PTBA 6GCHF 1FY8E 1KTTB 1Z1IA 1CT0E 4X2VA 3SI3H 1P11E 5TCCA 1EOLA 1RD3B 4KELA 1OWDA 2G5NA 2PKAA 4AB8A 1SL3A 5E2OA 3GY2A 1FPHH 5CHAC 1KDQB 4OS2A 1HXEH 3KL6A 2I6QA 2OCVB 3A8DA 2XBWA 3QWCH 1SGPE 7KMEH 5A0BA 5JBCS 2ILNA 1B5GH 3A86A 3B9FH 3GYMA 2ZFFH 1C4Y2 2ZGXH 2UUJB 1ZTKA 1B7XB 3HKIB 1GJ7B 3AASA 5DP9A 1KLTA 1MKWH 2AIPA 2Y7ZA 5F8TA 3MO6A 1LVYA 1TA6A 2ESTE 2CHAB 4JYUH 2BY5X 2W3IA 1JIRA 1A1RA 1GBAA 3SU6A 1VCQA 4MPXA 3RXTA 1P8VC 1O2PA 5FPSA 3RMMH 4TY6A 1XUGA 4MNWA 2NU0E 2AERH 4X6MA 1LO6A 2P8OB 1VITF 1AO5A 4WXIA 1HAVB 1V2PT 2ZA5A 3SGAE 1O3MA 1GMCF 1PPHE 1TMUH 1AE8H 4TYDA 1BMLA 1DSTA 2BD2A 1CGHA 2I6SA 1LVMA 1LPGB 4Q7ZA 1TBRH 2Z3EA 1UK3A 3SORA 1Q31A 3RU4D 3A83A 5ETXA 2P95A 1D6RA 2BLOA 4WMDA 5AFYH 1FAKH 1P57B 1TRNA 3ZZ4A 4NIVA 1ZGVA 2A4RA 4K2YA 2FLRH 1C1NA 2HVXA 1GI3A 1UTJA 1SGDE 6ESTA 1CGIE 2BB4A 1GMDF 3V13A 1GL0E 2W7SA 3RXSA 1GBKA 4IC5A 3NZIA 3GCOA 2UWLA 1AB9C 3FZZA 1LVOA 4ABFA 1ELEE 4YLQH 2FYQA 5FXLA 1ZHPA 4BOHA 2DUCA 4ABDA 2QF0A 2ZCLP 1HLTH 4DVAU 4X6NA 1BOQA 5DG6A 3RXCA 1O2HA 2GP9B 2F83A 1DXWA 1PFXC 2BY9X 1HNEE 2GGVB 4I8LA 1QBNA 3U8OH 4ABJA 1GJAB 3MNBA 4MPVA 1CGJE 1MBQA 2WPKS 4B74A 1Z8RA 5A8XA 1WYKA 1MQ6A 1T4UH 5ESTE 2C93B 4BANB 8GCHF 5C2ZA 1DVAH 4I7YH 1ANEA 2GZ9A 1G3CA 1C5XB 1ZGIA 4ESTE 4K3JA 4FUEA 3BEFB 2BM2A 2ZPQA 1DS2E 1C2KA 3KEEA 1WCZA 5L6NH 1OWEA 1TX7A 3OY5U 3WY8A 2W26A 1C9PA 4OGXA 5EPYA 2FOHA 4MNYA 2EI8A 3AVZA 3NCLA 5EW2H 4YLUA 5F6MA 1IQIA 3A7WA 4UD9H 1K9OE 3RMOH 1T8MA 1QA0A 1TGTA 4AN7A 2J95A 2HOBA 1FN8A 1NC6A 4K1TA 1TYNA 1TOMH 2C3SA 3A89A 4BAQB 1QCPA 2ZHEH 1V2NT 4Q80A 4K8BA 3M3VA 2QA9E 3M61U 4DIIH 2ZFRH 2PGBB 1AFQB 1DX5M 1OS8A 3A7VA 1UVUH 4HFPB 2J34A 3EQ0H 4U01A 4I32A 4D8NA 2CHAC 3LGIA
chains in the Genus database with same CATH superfamily
1L1NA 5DSFA 1BT7A 2OC8A 4UEHH 4ZXXH 3U8RH 4I8HA 2RFKC 3HGNA 2P8OC 3ZVFA 1O0DH 1SMFE 3SHCH 2V35A 4AB9A 1GMHG 4ABHA 1DLKB 1O3HA 3P95A 4ABBA 3BN9A 1UTPA 2BTCE 3U1IB 3PMJA 5HMAA 1J15A 4FUFA 4F55A 2XTTB 1BMFD 3BG8A 4XDEA 3E8LA 1F0RA 4DG4A 1H8HD 3QO6A 4KTCA 2WPHS 4H6TA 4WH8A 3ZVBA 4Z6AH 1COWD 1EASA 1GJCB 2Z9KA 1SLXB 3TK6A 4OS1A 2HRVA 2H5CA 2OP9A 1ZRKA 3NKKA 3RMNH 3FOAA 1QR3E 2BY7X 2HNTC 1THSH 2R0LA 3D23A 4X0WU 4AFUA 4AGKA 2BDAA 3MO3A 3VG8A 3TNTA 1KSNA 1K21H 1GI1A 1A61H 1PQ7A 1J8AA 1V2MT 5B6OA 2HLCA 3ZV8A 3CS0A 8KME2 4ISOA 1TNLA 1QJ7B 2ODYB 3GY5A 4YOGA 2SGDE 3SI4H 2P3UB 2LNCA 3HK6B 3PMAB 1DT2A 1E38B 3SHAH 1AN1E 1YYY1 3BTQE 5SGAE 1RS0A 4GPGA 4R0IA 4X1NU 1EX3A 2ZQ2A 2OC7A 1GJBB 1GHVH 5AFZH 5T6DA 1QTFA 1XUHA 2TRMA 1CT2E 1V2JT 4Q7YA 3M3TA 1OSSA 1XUJA 2G5VA 3BEIB 5CHBA 1GHBF 1O5FH 1V2WT 1CVWH 3OFND 1P2KA 2ZIQH 2EY4C 1KLIH 1GI6A 2EI7A 4TY7A 1SHHB 5LGOA 1QB6A 2ZGCA 1TPAE 3SQHE 5E8EH 5HYOA 1EKBB 2SFAA 1AUTC 4FOUC 1AZZA 1S6FA 1Z1JA 2V6NA 4BNRA 3BTDE 3KNXA 3MI4A 1O3IA 4XE4A 3SJ9A 1VITG 3KN2A 2VVUA 1FY5A 4LK4A 1W14U 4UDWH 1FDPA 2WPIS 2BLWA 5FL7D 3MH6A 1JWTA 1J17T 2YOLA 1E37B 3MU0A 2AGGX 1GBJA 2WSSD 3MMGA 4MLFB 3E0PB 1MCTA 4SGAE 2Y5HA 1UHBB 1BHXB 1ZZZA 1BCUH 3A88A 1TNIA 1FY4A 1O2VA 2BD9A 1C5UA 1GI0A 1O38A 3FZDA 3DD2H 2RA0A 1AFQC 3FAOA 4X2WA 3SU4A 3UFAA 2BY6X 3LOXA 1GJ5H 1ESAA 4TPYA 1UTMA 1O3CA 1Q3XA 1BTXA 1C9TA 2J98B 4YTAA 1B0EA 5FBIA 1LTOA 1YPKH 1CBWB 2TIOA 3TU7H 5F8XA 1AE5A 2GX4A 3RMLH 1TLDA 4NWLA 1RTFB 5AVDA 4U32A 2GTBA 1TB6H 1TPPA 3PV4A 2YMSC 2HVYB 1TRMA 5FHTA 2CF9H 3TGJE 2W5EA 3TIUA 2YNBA 1QRWA 3HK3B 2VH6A 3MO9A 6LPRA 5ABWA 3DHKH 2TGTA 1J16A 2HWLB 1C2JA 1IOEA 1TX6A 2AFQB 2BHGA 1L2EA 2ULLA 1SQAA 2TGPZ 1IQHA 1ZSLA 1FX0B 3ZYEA 1O34A 3VB7A 1S6LA 4GAWA 3RXMA 3H09A 1UCYH 5DJ7A 1O35A 1U6QA 1KLJH 3EA9A 2JETB 4Y71A 1DY9A 1TGBA 5CE1A 7ESTE 2B8OH 2G4TA 4CH2B 1EATA 5E0JA 1HGTH 1KIGH 3QLPH 3MU5A 2CN0H 5C17A 2QAAA 1QL7A 1WQSA 1O5AB 3KQ5A 4NFFA 2Y81A 5EJZA 3QGNB 1WTGH 1W8BH 4B71A 2VNTA 5IYTA 1EOJA 1XKAC 2JJ2D 3P17H 3AAUA 5C1UA 4DW2U 1CE5A 1LHGH 3BV9B 1IQKA 2ZQ1A 3RM0H 1QBVH 1YPJH 2KAIB 3FFGA 1CU1A 4J1YA 2ZHWH 3AW1A 3AW0A 3MYWA 1SGTA 2FIRH 1J9CH 2BXUH 4FUDA 2BLVA 4IMZA 2J97A 3UQVA 1W7GH 3WWBA 4X8VH 1HAXB 1ZJDA 1AHTH 1UJ1A 1BMMH 4CBOA 1W13U 1BBRH 1TBQH 3OU0A 4TSFD 1P2QA 1XXFA 3TK5A 2BZAA 1EZSC 4B75A 1KXCA 3URDA 3PM3A 1VR1H 1Y5AT 1O3GA 3D62A 5C1YA 1OP0A 1SLVB 1F0TA 5GXPA 2OQUA 3LGYA 1SG8B 1LQEA 1ZJKA 3OSYA 7GCHG 1O2MA 3TNSA 2WZQA 2FI5E 4D9QA 3VXFH 1P06A 1SI5H 3ODFA 3TJVA 1ZMLA 1LHDH 2H1UA 3MWIU 4DIHH 4IS5A 1YGCH 1QJ1B 1W0KD 5A8ZA 1E1RD 1GGDC 1HJ9A 1A7SA 2IJD1 1IQNA 1O32A 2B9LA 1ELVA 2H9TH 1FXYA 1UK2A 4CRAA 1O2OA 4KTUA 4FU9A 4FUIA 5I25A 3GY8A 3MH7A 3PMHB 4M7GA 1DITH 2AHME 1MTNB 1A3BH 2VIOA 3FKSD 4GSOA 3UR9A 2BLQA 1YKTA 4ZKSU 1UW7A 1G2MA 5HIYA 1CBWC 1C5TA 4GCHG 1NN6A 2ZU2A 1ZYOA 1AVXA 2XXLA 1ELTA 4HZHA 3M5NA 1GJ8B 1SHYA 1AU8A 3SQEE 2BDYA 1P01A 2A4GA 1OHHD 3RXLA 1O3OA 1EFRD 1H4WA 4Y10E 2PLXA 3ZVEA 5DP7A 1S82A 3TJUA 3GISB 2VWMA 5HKKD 1O2UA 2F9BH 3RM2H 1O3EA 1Z8IB 1O5GH 2QC2A 2VIDA 2F9PA 2BD8A 1HCGA 1IQGA 1O33A 3ZVGA 3UREA 1LHFH 1GG6B 5HGGA 1K1MA 2CF8H 2KFWA 3KQCA 2VJ1A 4Q7XA 1DPOA 1P9UA 4JZFH 2ZU1A 4ABIA 1GHZA 2JETC 4YOIA 4XRNA 2BD3A 2SNVA 2FOAA 4H42U 2R2MB 4CREA 1Z6JH 3RLWH 1RTLA 4A1XA 4Q63A 2ZZUH 3UOPA 1ARBA 1T8NA 1L4DA 1YPMH 3V0XA 3QZRA 3SV8A 2WUCA 4VGCB 1DM4B 3BTFE 1XVMA 2XRCA 2ZFPH 1TALA 1UHBA 2GT8A 1INCA 4CHAB 1ZMJA 4UFGH 1EJNA 4Y7AA 2QCYA 4D7FA 2ODQA 4ISLA 3E16B 4YESB 4ZUHA 1HDTH 1IQFA 2QXIA 3P8OA 1K1NA 3WWFA 3F2FA 1SPJA 2R0KA 1FI8A 3FANA 1GPZA 2RG3A 5GCHG 1Z8JB 1GHXH 2J98A 2FTMA 2SGQE 4KP0A 2FOBA 3LT3A 2ZGHA 3PWCA 1SGQE 1Y5BT 1KMHB 1ESTA 2PTCE 3JZ2B 1MTUA 2PV9B 2OBQA 4TPIZ 1O3DA 1SLWB 2J92A 3GY6A 4UFEH 3PO1B 2IPQX 1L4ZA 1GJDB 1HAZB 4X1SU 2FMJA 1TGCA 4AX9H 1TNKA 2VWNA 1C5QA 3RC6A 1HRTH 1O3AA 4GUXA 1W0ZU 2ZDMA 3LDXH 1L1JA 2Q6GA 4AC9A 4IN2A 2FODA 1D9IA 1Y8TA 2Q1JA 2PGQB 1MTNC 2L74A 1AD8H 1G36A 2O8LA 1FIWA 1Z71A 1NTPA 2OTVA 3H7OA 5KGOA 2FS8A 4JYVH 2SGPE 1OWIA 1V2ST 2QN5T 2WUBA 2XWAA 2ODPA 2UWPA 5EW1H 1D4PB 2Y5GA 3VGCB 1BRAA 2VVCA 2Z7FE 1BTWA 1PYTC 1QL8A 5EU8A 1NS3A 1YPEH 2QF4A 3SNDA 1UO6A 1C1RA 2WYJA 3K6YA 2KAIA 3F9GA 3MQKC 4CRGA 2Q6DA 1TONA 3A8CA 1NFYA 3SGQE 3DSOA 1MZDA 3EE0B 1EZQA 3S9CA 1BRCE 3GY3A 2ANKH 1GG6C 2FOCA 1PPFE 2QXJA 4ACBA 3MHWU 3M7TA 4TWWA 2ZP0H 4RI0A 1KY9A 1V2QT 4E7RG 2ASUB 3I29A 3FP7E 3TJNA 3TH4H 1H9IE 3T25A 4YT6H 1EPTA 1AVWA 4BAHB 5C94A 1QFKH 2ZDLA 4RT1A 1QL9A 5C3NA 5LPEA 4FUCA 1MTVA 1Y3YA 5L2ZH 1O2IA 1FQ3A 1UCYE 1QJ6B 3QUMP 4VGCC 5FAHA 1T31A 3ITIA 2AH4X 2ZDNA 5GIBA 1P2IA 7LPRA 3RXFA 2R3UA 5K7RA 4CHAC 3ATWA 2J38A 2XOKD 2ZFTA 3SU1A 4A7IB 1D3PB 1UTKA 2PUXB 3GCHB 4Y8ZA 3E3TA 2Y80A 3ZZ3A 1TX8A 3TLOA 5AHGH 3ZYDA 2PUQH 1PPGE 2FX6A 2VVVA 1EZUC 1CT4E 3C27B 1ORFA 4XBBA 2BD4A 1BIOA 3VB3A 1K1LA 4DCDA 1WAYB 2BX4A 2HNTE 3PYHA 5LH8A 4M9FA 1UVTH 1TWXB 5JBBS 3UPEA 1TNHA 5TCAA 3V12A 2EA3A 3KF2A 4JCNA 1NT1A 5L30H 1LPZB 1G2LA 5EQRA 3UWIA 1VJAU 2GT7A 2O8MA 2A5IA 4Z1MD 4ISNA 5PTPA 3RXKA 1SGFA 2BD5A 4UE7H 1C4V2 1S5SA 3TVJB 3A81A 2ZU5A 5EIYA 3PO1C 1AZ8A 1BBRE 1NZQH 3SJ8A 3SUFA 1PPCE 5IK2D 3V7TA 3SGBE 4O3TA 1ETRH 3GCTG 1N8OB 2J4IA 3VFEA 1IQJA 2BDBA 2W3KA 1ZSJA 2PSXA 2OK5A 6CHAB 3URCA 4BAMB 2ZCHP 1P2NA 1BMAA 2AGEX 1C5LH 4I8GA 2AYWA 2GZ7A 1GI4A 2FOGA 4NZLA 3SUEA 3LKWA 3DFJA 1G30B 2HALA 3LH1A 1O3FA 1LQDB 2WPJS 3BF6H 1EQ9A 1CHOG 4XBDA 2QF3A 2BYAX 1YM0A 1DY8A 3KQDA 1P2MA 4CRBA 2KR7A 3VGCC 1VGCB 2QE7D 2Y7XA 1ZPZA 3TGIE 4A1VA 2BOKA 2CV3A 1Y59T 2ZGBH 4AFQA 3F3BA 1H8ED 5T1VA 3A7ZA 4D9RA 1ZHRA 1F2SE 2JDID 1ETSH 3N7DA 1YPGH 4F48B 2F9OA 1KXDA 4NSYA 3GICB 3HKJB 5EXNA 2F9NA 1O3KA 1AFEH 3GOVB 4B2CA 1FAXA 1SLUB 2AMQA 3RXDA 1H1BA 1TGSZ 1DSUA 1HYLA 1C5PA 4AFZA 5DP5A 4XD7D 5E0HA 2WYGA 1UTNA 2TGDA 1DANH 4NIYA 2D26C 3VB6A 5EGMA 3VB4A 2ZHQH 1MD7A 3UB0A 1SGCA 3TK9A 1ZPBA 5DN6D 3KCGH 1E36B 2FEQH 1KXFA 2JIZD 4NIWA 3STJA 1FY3A 1AGJA 2WV4A 3ELAH 1YLCA 3T26A 4HGCA 3A7XA 1P09A 3QK1A 1XX9A 3BTTE 6GCHG 2FI3E 2XCNA 1A5GH 3RXAA 3RLYH 2O8WA 3A87A 3NK8A 5C1XA 2P3FH 3ZZ8A 3CNRA 3GCHC 3EAJA 4GHQA 3SYJA 1DXPA 1AUJA 1A0LA 2UUFB 4I31A 3Q77A 1NU7B 3UQOA 1AWFH 3F1SB 3M7QA 4E7NA 1VCPA 2EC9H 2GCTB 1GI9B 3STIA 2HGTH 3SU0A 2J2UA 1VCWA 3QZQA 4MNVA 3GY7A 3UNQA 2A5AA 1JMOH 1CA0B 1WQVH 2H9HA 4B76A 1OXGA 1H9HE 3S9AA 2VWLA 2A7HA 1JBUH 2RCEA 3CENA 4OS5A 1JIMA 1ELBA 3HATH 1D3TB 4ISIH 4X8TH 1C1WH 4HG6A 4CRCA 1C5NH 4WH6A 3RXPA 8ESTE 4NZQA 2EEKA 3SV9A 1N8OC 1FV9A 1GMCG 2AEIH 3CS7A 1A46H 1GBCA 2ALVA 1D6WA 3U28C 4DGJA 6CHAC 2PR3A 1S83A 1NROH 1GHYH 4K1SA 1MBMA 1O2TA 3RXEA 1Z6EA 3Q3KA 3MU8A 4WY3A 5EXMA 5JBTA 4THNH 1C2LA 3Q00A 3LGUA 1E35B 3RXHA 4K60A 1AVGH 1O2SA 3RC5A 1TOCB 3LGTA 3SZEA 1ID5H 1GMDG 4BAKB 3A8AA 2V0BA 2XBVA 1FIZA 1QB9A 1O30A 1O3JA 1UMAH 1A3EH 1CHGA 2P93A 2Y5FA 3KIDU 4O3UA 2A4OA 2C8ZB 2BVSH 3A7TA 4X6OA 4BTTB 3MU1A 1RGQA 2ZDVH 3D65E 1ZPCA 3QTVH 3EA8A 1GBDA 4R8TB 1AKSB 8LPRA 1GHAF 2QV1A 1GBMA 4I86A 1ANCA 3QDZB 1AIXH 3RXJA 1P04A 3FP8E 3W95A 2ZCKP 1N6YA 4UONA 4E06H 2FYRA 1BITA 2GZ8A 2GMTB 3F9HA 2BVXH 8GCHG 1GBIA 3SU3A 3SNAA 2ZU4A 3EDXB 3M37A 3QGJA 1THPB 1SGYE 2GCHF 4IN1A 1HAIH 1UVSH 4YM9A 1O2RA 1BJUA 3E6PH 4MPUA 2QGRA 1YBWA 4P00A 4H4FA 1HJ8A 2BZ6H 1DWBH 1SBWA 3RU4T 3S9BA 2VGCB 2WINI 4B2AA 3O8RA 3E91A 1A5HA 1RRKA 2FP7B 5BRRE 2GV6A 2HLDD 3KHVA 4AORA 1K2I1 2C4FH 2GD4B 2C8WB 2GCTC 1ARCA 1HXFH 3C1KA 2YNAA 2V7QD 1YPLH 1ZRBA 3DUXH 3MTYA 1ANDA 1UTQA 2ZG0H 4FVBA 2BDCA 5T6FA 3SW2B 2ZWLH 1CA0C 2BX3A 1MTSA 2ZHFH 3SNCA 2ZTXA 5EQSA 4WMFA 1RFNA 4ABEA 1A5IA 1GI5A 2Z3DA 2WPMS 3RU4E 1P12E 3MU4A 1C2HA 1WUNH 4DT4A 4Y0ZE 3MOCA 3S69A 1S0QA 5A8YA 1DWCH 1P0SH 3ESTA 4ASHA 2BD7A 1EPTB 1T8OA 2BDHA 1LKAA 3TH2H 2XBYA 1FZZA 3ZZ6A 1NBME 2D2DA 3H7TA 4MNXA 2KZ4A 1AY6H 2PKSB 2F4LA 1C1OA 1ELCA 4WXVA 1S6HA 5DP6A 5GPIB 4CRDA 1MCVA 4FXGH 4TWYA 1WU1A 2PHBA 2RDEA 1K22H 4IW4E 4SGBE 3FN8A 3L6PA 4XSKU 1EJAA 4DOQA 3TITA 1NO9H 2ANMH 1MAXA 1QHRB 1TBZH 2C90B 2THFB 2ZPSA 1FONA 2A31A 4K69A 4YO9A 1KXAA 2ZTZA 3HPTB 4A6LA 1IHTH 4JZ1A 3T5FH 1YWUA 3SJOA 1EB1H 1SOZA 3VEQB 1DWDH 1GVKB 4CBNA 2BOHB 1HAGE 1PQAA 3K65B 1TABE 3F9EA 1S84A 3SUGA 4AG1A 1XXDA 5C20A 1LHCH 3SJIA 2VH0A 3WW7A 4LXBH 1HAYB 3PLKA 3BTEE 1HPGA 1ZMNA 2DE8A 3F68H 1C2EA 5C67A 9LPRA 1V2TT 3BTWE 2A4QA 1SGEE 2F91A 2G55A 4MVNA 4YOJA 2PFEA 2OINA 4AG2A 1C2IA 2YMSD 4ZH8A 3LC3A 1GCDA 1FUJA 2A2QH 3ZVDA 1W12U 2UUYA 2AMDA 3S0NA 2GMTC 3B8JA 1GHBG 1O3PB 3NXPA 2JJ1D 1XMNB 1TGNA 3SO3A 1VZQH 1C1PA 1GWAA 3BTGE 1NRRH 2JH0D 4I33A 2NU4E 3PB1E 2B5TB 1C5OH 3VB5A 1EJMA 4GLYA 2WPLS 1O31A 1MUEB 1SR5C 2R9PA 1GBHA 4BXSA 3I77A 1O3NA 2H9EH 3NRLA 3HGPA 5EG4A 2VGCC 3UNRA 4ZHAA 4NIXA 4X1RU 1LDTT 2SGEE 1C5YB 1PQ8A 2J9NA 3P92A 1BQYA 2H5DA 4WJG2 5CMXH 2A7CA 3TH3H 1W3CA 2OLGA 3KGPA 1GDUA 5GWZA 4ZHLU 1MU6B 3U98H 1GI2A 3PMBB 2W6ID 2ZFQH 3MH4A 1KXBA 4CR9A 2F43B 3H5CB 1YLDA 1MMJN 1C2DA 3LPRA 1XVOA 4K5ZA 3S7KB 1SQTA 1UVOA 3SBKA 3SNBA 4F4OC 1O2WA 4XOJA 4ACAA 1O2KA 4QT8C 5FCKA 2V3HH 1AKSA 1OKXA 1Q2WA 2FM2A 5F53A 1SSXA 5EJ1A 1K1OA 1TRYA 5EOKA 1EPTC 4DJZB 4TT3D 1GMHF 1OP2A 1SGNE 1O2XA 3TPIZ 2OC0A 4UFFH 4NFEA 2PKSC 3F0OA 1O3BA 1HAOH 1EAXA 4RT0A 4NA8A 2FOFA 5JBAS 3OE7D 2A45B 2TPIZ 3B23B 1WTHD 2FLBH 2OC1A 2OUAA 3RXIA 5JDUB 1YCPK 3LJOA 1T4VH 3M36A 3M5LA 4FUGA 1BTPA 1TPOA 1GI8B 1MKXK 2DE9A 3IITA 4LZ4B 1NM6A 3Q3XA 4IMQA 3ZZDA 2J94A 1NRNH 4DURA 1WBGB 1P3EA 3LONA 4I8KA 3RUOA 4JK5A 4AZ2B 4INKA 1Z7KA 1LCYA 1K1JA 1F5LA 3FVFB 1ABJH 2PTNA 1OWHA 2D8WA 5F8ZA 3RXOA 4O03A 2O8TA 3SJKA 5DO4H 4UFDH 1NPMA 1YCPM 4OGYA 2EQNA 3OEHD 2LP6A 3PV5A 1H8DH 1HAHH 2FOEA 3VPKA 3PRDA 4O9VA 3QX5H 1AQ7A 1YC0A 3NPSA 2QF5A 4U2WA 2PSYA 4A1TA 5I46H 1HFDA 2KCYA 4K1EA 4IBLH 4FU7A 5JB8S 1C5RA 1O2LA 4BXWA 3UR6A 1EZXC 3BG4B 1TNGA 2BMGB 2VIPA 4ZMAH 4X1QU 3OAAD 2WV5A 4ZKOU 1AWHB 1G3EA 1BA8B 3UY9A 1RJXB 1GVZA 2FXRA 1O5CB 1FN6A 3ZV9A 1P2OA 3Q3YA 1ELFA 2K0QA 4GVUA 3IWMA 5L2YH 3GS9A 4KGAA 3SUDA 1QBOA 2CXVA 1IHSH 1C5WB 3U8TH 1BMNH 4HTCH 3TGKE 2CK3D 4PROA 4X1PU 1HUTH 2BXTH 1AMHA 1F5KU 3ZVAA 3UNSA 5FX6A 2G4UA 2QYIA 1GL1A 4O97A 2CGAA 4Y8XA 1QGFA 2XNDD 2B7DH 5FBEA 1UTOA 4A92A 1LPKB 3T28A 3BTHE 1J14A 1LKBA 1VJ9U 2NU3E 2XWBI 1QIXB 1IQLA 1PPBH 1TIOA 3ENSB 3M3SA 1EP5A 4FVDA 4MDSA 2R2WU 1FMGA 3SV7A 2XNIA 3GDSA 3M5OA 4B73A 5EXLA 4AYYB 1THRH 4OS6A 1XUKA 1QURH 1C2GA 1C5ZB 4KKDA 4XBCA 1V2VT 3NWUA 2IOTA 1GCTB 3ATMA 4Y11E 3LJJA 4Y79A 1EAUA 1WOFA 1NRQH 1PQ5A 1OYQA 3UWJH 1C1TA 1HIAB 1LVBA 1V2OT 1WDIA 1L0ZA 2OD3B 1T8LA 4WWYA 1S85A 4ABAA 1HB0B 3T62A 1V6DA 2TGAA 2Z94A 1BRUP 3N7EA 4YZUA 5F03A 1F0SA 3EYDA 2BQWB 4CRFA 3MNXA 2UWOA 2ZDKA 5C5NA 2TBSA 2Y6TA 3OX7U 1OP8A 2G8TA 4ZCNA 2HPPH 1IAUA 3JZ1B 3SZNA 4X6PA 4IC6A 3PROA 1MAYA 2W7UA 2G52A 1H9LB 2Z9JA 3DA9B 5FCRA 3O8CA 5GJ4B 4YXWD 2A0QB 1P03A 4MG3A 1D3QB 1BUIA 2ZPRA 1RIWB 2L6OA 1ABIH 1BRBE 1K1IA 1PYTD 4FUBA 1SVPA 2QXHA 3BTME 1E1QD 2FPZA 5DGJA 4A5TS 4DT7B 1QQ4A 1W10U 1FNIA 2SGAA 2J5UA 5G4BA 3PWBA 3OYPA 5A0AE 1F92A 1OOKB 3BG4C 1WV7H 4JK6A 2PWXA 1E34B 3NUMA 4J2YB 2A7JA 3LC5A 2FOMB 4D76A 3PTNA 1SKYE 2VIQA 1MKWK 4X2YA 3MNSA 2M5TA 2XC5A 1B0FA 1CSOE 3F0PA 3M7UA 2K8IA 3BSQA 2QIQA 5T6GA 3RP2A 1TMTH 4ZAEA 3SNEA 5DK1A 4NCYA 4B6EA 1O2ZA 4H6SB 1YPHE 4FETA 1T32A 2YMSB 1SGRE 7GCHF 2HNTF 1MQ5A 4AYVB 1MZAA 5DP3A 1FJSA 1KTSB 2GVFA 2ZU3A 1QB1A 2ZNKH 3ATIA 3T27A 3V3MA 4LZ1H 1DUEA 1SB1H 5KECA 2O9QA 2D1JA 3EGKH 5DKMA 1G3DA 2G51A 1C5MD 3A85A 4DY7B 3MH5A 1P02A 1MD8A 1C1MA 1IQEA 1SGFG 3LH3A 4AGJA 3ATLA 1CA8B 1PJPA 1T7CA 5HM9A 3A84A 2JKHA 3GDUA 4FUHA 2VWOA 1NFXA 1V2RT 3G01A 3Q76A 1GCTC 5CDFE 2H6MA 1EP6A 4GCHF 3U1JB 2GDEH 4RKJB 5A0CA 5FX5A 1Z8GA 1C1QA 2RA3A 2PW8H 1KDQA 1VITH 3PRBA 1QQUA 4NA9H 1DUAA 3IG6B 1SQOA 4AFSA 1P05A 1TA2A 1O3LA 1F0UA 2F9VA 1QY6A 1SOTA 2QXGA 5DPAA 3UUZA 1GHWH 1YLNA 3D49H 3TJOA 2STBE 1C5SA 4Y0YE 1GJ6A 1O5DH 3GCNA 5DP4A 3R0FA 4Y8YA 1H8IH 3CP7A 4ZROA 4INHA 1RTKA 1JRTA 4RSPA 1HV7A 3GY4A 5GNDA 2AMPA 3PLBA 1HAVA 1EAWA 4K8YA 3RXRA 2ZF0H 2C8YB 3OY6U 1IQMA 5DP8A 5HIZA 4FUJA 2ZKSA 1FLEE 3LGWA 5BPEA 1UTLM 1VGCC 5C5OA 2NWNA 5JB9S 5GDSH 1E79D 1OWKA 1M9UA 2EI6A 3QTOH 1ZLRA 2JH6D 3P6ZB 1GVLA 1RIWC 3F9FA 2ZEBA 1GJ4H 1EUFA 4F49A 1EXFA 4YT7H 1DOJA 1GGDB 2BVRH 2C8XB 4JZDH 2VIWA 2ZFSA 1EAIA 4X8UH 1ACBE 3EA7A 1HJAB 4X2XA 1SGIB 5K0HA 1F7ZA 1DDJA 1NFWA 2SGFE 2XC4A 1YPHC 3FP6E 1ELDE 1GBEA 3LU9B 5AF9H 4P02A 5GCHF 2XBXA 5JYIA 3BEUA 1WXRA 1XM1A 4ZXYH 1OWJA 1DFPA 1P2JA 2XYAA 1S0RA 3F6UH 4I8JA 1W0YH 3DFLA 2GDDA 1QNJA 2UUKB 2VB0A 4ZKNU 4X8SH 3VXEH 4B1TA 2Z9LA 2O8UA 5EPNA 2CJIA 1A4WH 5A2MH 3BTKE 4BTUB 5ESBA 1XKBC 1XUIA 3BIVH 1ELGA 2FDAA 3PLPA 1HIAA 1TNJA 2VINA 4E05H 3KQEA 2BDGA 2IN2A 3K2UA 3O8DA 4Y7BA 2AIQA 2WHXA 3E1XB 2OQ5A 3F2HA 5B6LA 2V3MA 3RXGA 1CQQA 1DWEH 1C5VA 1O2YA 4ASUD 1QA7A 3OEED 2ZHDA 1PPZA 4JYTA 2ZDAH 2KCPA 2ZI2H 1BTUA 2SNWA 3SV6A 2NU2E 1MH0A 3ZZ5A 4Q2KA 2OXSA 4BAOB 1RXPA 2PKAB 3PV2A 1G32B 5LPFA 2XC0A 5A09A 2P16A 4IGDA 4WF8A 1X7AC 2BQ7B 1GBBA 1MU8B 3A82A 3S7HB 3UOUA 2A32A 4MQAA 1C1VH 1S81A 1O5BB 1WSSH 1XUFA 3LIWA 3BIUH 4RN6A 1Y3VA 1P9SA 2F9UA 2Z6BD 2F3CE 1JOUB 2IPHA 3QN7A 2VU8E 2WPDD 1BZXE 2A2XH 3M35A 1N1LA 4CH8B 1GBTA 4NG9H 4LOYH 5HXFA 1TMBH 1ELAA 2R3YA 2A1DB 3P8FA 1DICA 3R3GB 3KYGA 3SV2H 1A0HB 4OM9A 5EJLA 3OTJE 3ZIAD 1Y3XA 3F2GA 1PPEE 1L1GA 2GV7A 5FPTA 3ZZ7A 3E90B 3RXQA 1NY22 2OBOA 2XCFA 2Z3CA 1OYTH 1YCPH 1UVPA 1ZHMA 3UTUH 3UAIC 2BQ6B 1V2LT 3GYLB 2FO9A 4NWKA 3ZZBA 2KCOA 1TQ0B 4HI3A 2Z9IA 1TFXA 5LPRA 1O37A 1MKXH 4NGAH 1W2KH 4GHTA 1BHXF 2AS9A 4ZHMU 1V2KT 1K1PA 1SFIA 2P59A 2ALPA 1EB2A 1C1SA 1OX1A 1N6XA 1V2UT 4OS4A 3SU2A 1O36A 2FX4A 1JXPA 1HBTH 1AI8H 4ZKRU 1FY1A 1NFUA 4INLA 3E0NB 1A2CH 1GBFA 1TQ7B 2A5KA 3T29A 5J4SA 3AAVA 4MTBA 1QRXA 3RXUA 1HJAC 1C2MA 2M2AA 3DSPA 1NRPH 1ANBA 1GI7B 5CHAB 1GDQA 1BDAA 5C0UA 3ZZAA 1K28D 2HPQH 2P3TB 3A80A 3LGVA 3RDZA 3L3TA 2Y82A 4JMYA 1D3DB 3DT0H 2B0FA 1F5RA 1O2QA 3UIRA 1ZSKA 4WVPE 1YF4A 3ATKA 1MTWA 1GBLA 1KYNA 1ETTH 2FS9A 4Y76A 5T3HA 1Y3UA 2ANYA 4D7GA 1GDNA 4MPWA 4AOQA 2K1QA 3T2NA 5E2PA 2ZTYA 1O2NA 1UK4A 1SFQB 9ESTA 1NU9A 2KX4A 1O2JA 2CMYA 2FWWA 1BJVA 2AGIX 2Z9GA 1JRSA 1P10A 2IJOB 4B6FA 1C1UH 4JZEH 4NA7A 3K6ZA 5C0TA 1NESE 2NU1E 3KYFA 2Q6FA 3GCTF 1W11U 4JZIA 2ZC9H 3A7YA 2JH5D 1O39A 2FI4E 3L33A 1G9IE 1O5EH 1BTZA 3ODDA 4RKOB 4KTSA 3U69H 4Z0KA 1HAPH 3U9AH 3P8GA 2RDLA 1G3BA 4NSVA 5EODA 4BTIB 3KQBA 2ZO3H 3MFJA 4FU8A 5FPYA 1ZTLA 1UCYK 1YY3A 4ISHH 1W7XH 2P94A 3ZVCA 1ZOMA 2ZGJA 2V3OH 3SOSA 4XFQA 5H4IB 1CHOF 1TAWA 4Y6DA 1LMWB 1W0JD 3RXVA 1NRSH 2VIVA 5TJXA 1C2FA 1AB9B 5J4QA 3N7OA 3O8BA 2GKVE 1LHEH 3A8BA 4OS7A 5EQQA 1C4U2 2LPRA 1GJ9B 3SU5A 3I78A 4B2BA 1TPSA 1DE7H 1OPHB 2G00A 3P70B 1TE0A 2ZECA 1GHAG 3K9XB 2W6JD 5E0GA 5KEDA 3ZZCA 1FPCH 1ZTJA 2FTLE 3P8NA 4ABGA 2FESH 1A0JA 4U30A 1BTYA 3MNCA 2KCAA 1P3CA 3M5MA 5JPMH 1ESBA 1KXEA 5HM2A 1Y3WA 1QRZA 1V3XA 1CO7E 1G37A 1O2GH 1ZR0A 3W94A 2FZZA 4CR5A 1Y5UT 1SC8U 2BY8X 2BDIA 3GDVA 1BTHH 2STAE 1YP9A 1E0FD 2ANWA 2XW9A 3RXBA 3ZZ9A 2QY0B 2G81E 3SN8A 1BBRK 2GCHG 1BB0B 3RC4A 2PP6A 1DLEA 2H2ZA 4WMEA 5IDKA 3PTBA 6GCHF 1FY8E 1KTTB 1Z1IA 1CT0E 4X2VA 3SI3H 1P11E 5TCCA 1EOLA 1RD3B 4KELA 1OWDA 3FO8D 2G5NA 2PKAA 4AB8A 1SL3A 5E2OA 3GY2A 1FPHH 5CHAC 1KDQB 4OS2A 1HXEH 3KL6A 2I6QA 2OCVB 3A8DA 2XBWA 3QWCH 1SGPE 7KMEH 5A0BA 5JBCS 2ILNA 1B5GH 3A86A 3B9FH 3GYMA 2ZFFH 1C4Y2 1K0HA 2ZGXH 2UUJB 1ZTKA 1B7XB 3HKIB 1GJ7B 3AASA 5DP9A 1KLTA 1MKWH 2AIPA 2GJGA 2Y7ZA 5F8TA 3MO6A 1LVYA 1TA6A 2ESTE 2CHAB 4JYUH 2BY5X 2W3IA 1JIRA 1A1RA 1GBAA 3SU6A 1VCQA 4MPXA 3RXTA 1P8VC 1O2PA 4Q4LA 5FPSA 3RMMH 4TY6A 1XUGA 4MNWA 2NU0E 2AERH 4X6MA 1LO6A 2P8OB 1VITF 1AO5A 4WXIA 1HAVB 1V2PT 2ZA5A 3SGAE 1O3MA 1GMCF 1PPHE 1TMUH 1AE8H 4TYDA 1BMLA 1DSTA 2BD2A 2WV9A 1CGHA 2I6SA 1LVMA 1LPGB 4Q7ZA 1TBRH 2Z3EA 1UK3A 3SORA 1Q31A 3RU4D 3A83A 5ETXA 1D6RA 2BLOA 2P95A 4WMDA 5AFYH 1FAKH 1P57B 1TRNA 3ZZ4A 3W1EA 4NIVA 1ZGVA 2A4RA 4K2YA 2FLRH 1C1NA 2HVXA 1GI3A 1UTJA 1SGDE 6ESTA 1CGIE 2BB4A 1VKYA 1GMDF 3V13A 3DCLA 1GL0E 2W7SA 3RXSA 1GBKA 1NBMD 3NZIA 4IC5A 2KM0A 3GCOA 2UWLA 1AB9C 3FZZA 1LVOA 4ABFA 1ELEE 4YLQH 2FYQA 5FXLA 2LELA 1ZHPA 4BOHA 2DUCA 4ABDA 2QF0A 2ZCLP 1HLTH 4DVAU 4X6NA 1BOQA 5DG6A 3RXCA 3AK5A 1O2HA 2GP9B 2F83A 3EE7A 1DXWA 1PFXC 2BY9X 1HNEE 2GGVB 4I8LA 1QBNA 3U8OH 4ABJA 1GJAB 3MNBA 4MPVA 1CGJE 1MBQA 2WPKS 4B74A 1Z8RA 5A8XA 1WYKA 1MQ6A 1T4UH 5ESTE 2C93B 4BANB 8GCHF 5C2ZA 1DVAH 4I7YH 1ANEA 2GZ9A 1G3CA 1C5XB 1ZGIA 1SQRA 4ESTE 4K3JA 1MABB 4FUEA 3BEFB 2BM2A 2ZPQA 1DS2E 1C2KA 3KEEA 1WCZA 5L6NH 1OWEA 1TX7A 3OY5U 3WY8A 2W26A 1C9PA 4OGXA 5EPYA 2FOHA 4MNYA 2EI8A 3AVZA 3NCLA 5EW2H 4YLUA 5F6MA 1IQIA 3A7WA 3DSGA 4UD9H 3OTPA 1K9OE 3RMOH 1T8MA 1QA0A 1TGTA 4AN7A 2J95A 2HOBA 1FN8A 1NC6A 4K1TA 1TYNA 1TOMH 2C3SA 3A89A 4BAQB 1QCPA 2ZHEH 1V2NT 4Q80A 4K8BA 3M3VA 2QA9E 2VBCA 3M61U 3N99A 4DIIH 2ZFRH 2PGBB 1AFQB 1DX5M 1OS8A 3A7VA 1UVUH 4HFPB 2J34A 1QZ8A 3EQ0H 4U01A 4I32A 4D8NA 2CHAC 3LGIA
chains in the Genus database with same CATH topology
1L1NA 1BT7A 2OC8A 4UEHH 4ZXXH 3U8RH 4I8HA 3HGNA 2P8OC 3ZVFA 1O0DH 1SMFE 3SHCH 2V35A 4AB9A 1GMHG 4ABHA 1DLKB 1O3HA 3P95A 4ABBA 3BN9A 1UTPA 2BTCE 3U1IB 3PMJA 5HMAA 1J15A 4FUFA 2XTTB 3BG8A 4XDEA 3E8LA 1F0RA 4DG4A 3QO6A 4KTCA 2WPHS 4H6TA 4WH8A 3ZVBA 4Z6AH 1EASA 1GJCB 2Z9KA 1SLXB 3TK6A 4OS1A 2HRVA 2H5CA 2OP9A 1ZRKA 3NKKA 3RMNH 1QR3E 2BY7X 2HNTC 1THSH 2R0LA 3D23A 4X0WU 4AFUA 4AGKA 2BDAA 3MO3A 3TNTA 1KSNA 1K21H 1GI1A 1A61H 1PQ7A 1J8AA 1V2MT 5B6OA 2HLCA 3ZV8A 3CS0A 8KME2 4ISOA 1TNLA 1QJ7B 2ODYB 3GY5A 4YOGA 2SGDE 3SI4H 2P3UB 2LNCA 3HK6B 3PMAB 1DT2A 1E38B 3SHAH 1AN1E 1YYY1 3BTQE 5SGAE 1RS0A 4GPGA 4R0IA 4X1NU 1EX3A 2ZQ2A 2OC7A 1GJBB 1GHVH 5AFZH 5T6DA 1QTFA 1XUHA 2TRMA 1CT2E 1V2JT 4Q7YA 3M3TA 1OSSA 1XUJA 2G5VA 3BEIB 1GHBF 1O5FH 1V2WT 1CVWH 1P2KA 2ZIQH 1KLIH 1GI6A 2EI7A 4TY7A 1SHHB 5LGOA 1QB6A 2ZGCA 1TPAE 3SQHE 5E8EH 5HYOA 1EKBB 2SFAA 1AUTC 1AZZA 1S6FA 1Z1JA 2V6NA 4BNRA 3BTDE 3KNXA 3MI4A 1O3IA 4XE4A 3SJ9A 1VITG 3KN2A 2VVUA 1FY5A 4LK4A 1W14U 4UDWH 1FDPA 2WPIS 2BLWA 3MH6A 1JWTA 1J17T 2YOLA 1E37B 3MU0A 2AGGX 1GBJA 3MMGA 4MLFB 3E0PB 1MCTA 4SGAE 2Y5HA 1UHBB 1BHXB 1ZZZA 1BCUH 3A88A 1TNIA 1FY4A 1O2VA 2BD9A 1C5UA 1GI0A 1O38A 3FZDA 3DD2H 2RA0A 1AFQC 3FAOA 4X2WA 3SU4A 3UFAA 2BY6X 3LOXA 1GJ5H 1ESAA 4TPYA 1UTMA 1O3CA 1Q3XA 1BTXA 1C9TA 4YTAA 1B0EA 5FBIA 1LTOA 1YPKH 1CBWB 2TIOA 3TU7H 5F8XA 1AE5A 2GX4A 3RMLH 1TLDA 4NWLA 1RTFB 5AVDA 4U32A 2GTBA 1TB6H 1TPPA 3PV4A 1TRMA 5FHTA 2CF9H 3TGJE 2W5EA 3TIUA 2YNBA 1QRWA 3HK3B 2VH6A 3MO9A 6LPRA 5ABWA 3DHKH 2TGTA 1J16A 2HWLB 1C2JA 1IOEA 1TX6A 2AFQB 2BHGA 1L2EA 2ULLA 1SQAA 2TGPZ 1IQHA 1ZSLA 3ZYEA 1O34A 3VB7A 4GAWA 3RXMA 1UCYH 5DJ7A 1O35A 1U6QA 1KLJH 3EA9A 2JETB 4Y71A 1DY9A 1TGBA 5CE1A 7ESTE 2B8OH 2G4TA 4CH2B 1EATA 5E0JA 1HGTH 1KIGH 3QLPH 3MU5A 2CN0H 2QAAA 1QL7A 1WQSA 1O5AB 4NFFA 2Y81A 3QGNB 1WTGH 1W8BH 4B71A 2VNTA 5IYTA 1EOJA 1XKAC 3P17H 3AAUA 5C1UA 4DW2U 1CE5A 1LHGH 3BV9B 1IQKA 2ZQ1A 3RM0H 1QBVH 1YPJH 2KAIB 3FFGA 1CU1A 4J1YA 2ZHWH 3AW1A 3AW0A 3MYWA 1SGTA 2FIRH 1J9CH 2BXUH 4FUDA 2BLVA 4IMZA 3UQVA 1W7GH 4X8VH 1HAXB 1ZJDA 1AHTH 1UJ1A 1BMMH 4CBOA 1W13U 1BBRH 1TBQH 3OU0A 3TK5A 1P2QA 1XXFA 2BZAA 1EZSC 4B75A 1KXCA 3URDA 3PM3A 1VR1H 1Y5AT 1O3GA 3D62A 5C1YA 1OP0A 1SLVB 1F0TA 5GXPA 2OQUA 3LGYA 1SG8B 1LQEA 1ZJKA 3OSYA 7GCHG 1O2MA 3TNSA 2FI5E 4D9QA 3VXFH 1P06A 1SI5H 3ODFA 3TJVA 1ZMLA 1LHDH 2H1UA 3MWIU 4DIHH 4IS5A 1YGCH 1QJ1B 5A8ZA 1GGDC 1HJ9A 1A7SA 1IQNA 1O32A 2B9LA 1ELVA 2H9TH 1FXYA 1UK2A 4CRAA 1O2OA 4KTUA 4FU9A 4FUIA 5I25A 3GY8A 3MH7A 3PMHB 4M7GA 1DITH 1MTNB 1A3BH 2VIOA 4GSOA 3UR9A 2BLQA 1YKTA 4ZKSU 1G2MA 1CBWC 1C5TA 4GCHG 1NN6A 2ZU2A 1ZYOA 1AVXA 2XXLA 1ELTA 4HZHA 3M5NA 1GJ8B 1SHYA 1AU8A 3SQEE 2BDYA 1P01A 2A4GA 3RXLA 1O3OA 1H4WA 4Y10E 2PLXA 3ZVEA 5DP7A 1S82A 3TJUA 3GISB 2VWMA 1O2UA 2F9BH 3RM2H 1O3EA 1Z8IB 1O5GH 2QC2A 2VIDA 2F9PA 2BD8A 1HCGA 1IQGA 1O33A 3ZVGA 3UREA 1LHFH 1GG6B 5HGGA 1K1MA 2CF8H 3KQCA 2VJ1A 4Q7XA 1DPOA 1P9UA 4JZFH 2ZU1A 4ABIA 1GHZA 2JETC 4YOIA 2BD3A 2SNVA 2FOAA 4H42U 2R2MB 4CREA 1Z6JH 3RLWH 1RTLA 4A1XA 2ZZUH 3UOPA 1ARBA 1T8NA 1L4DA 1YPMH 3V0XA 3QZRA 3SV8A 2WUCA 4VGCB 1DM4B 3BTFE 1XVMA 2XRCA 2ZFPH 1TALA 1UHBA 2GT8A 1INCA 4CHAB 1ZMJA 4UFGH 1EJNA 4Y7AA 2QCYA 4D7FA 2ODQA 4ISLA 3E16B 4YESB 4ZUHA 1HDTH 1IQFA 2QXIA 3P8OA 1K1NA 1SPJA 2R0KA 1FI8A 3FANA 1GPZA 2RG3A 5GCHG 1Z8JB 1GHXH 2FTMA 2SGQE 4KP0A 2FOBA 3LT3A 2ZGHA 3PWCA 1SGQE 1Y5BT 1ESTA 2PTCE 3JZ2B 1MTUA 2PV9B 2OBQA 4TPIZ 1O3DA 1SLWB 2J92A 3GY6A 4UFEH 3PO1B 1L4ZA 1GJDB 1HAZB 4X1SU 2FMJA 1TGCA 4AX9H 1TNKA 2VWNA 1C5QA 3RC6A 1HRTH 1O3AA 4GUXA 1W0ZU 2ZDMA 3LDXH 1L1JA 2Q6GA 4IN2A 2FODA 1D9IA 1Y8TA 2Q1JA 2PGQB 1MTNC 1AD8H 1G36A 2O8LA 1FIWA 1Z71A 1NTPA 2OTVA 3H7OA 2FS8A 4JYVH 2SGPE 1OWIA 1V2ST 2QN5T 2WUBA 2XWAA 2ODPA 2UWPA 5EW1H 1D4PB 2Y5GA 3VGCB 1BRAA 2VVCA 2Z7FE 1BTWA 1PYTC 1QL8A 5EU8A 1NS3A 1YPEH 3SNDA 1UO6A 1C1RA 2WYJA 3K6YA 2KAIA 3F9GA 4CRGA 2Q6DA 1TONA 3A8CA 1NFYA 3SGQE 1MZDA 3EE0B 1EZQA 3S9CA 1BRCE 3GY3A 2ANKH 1GG6C 2FOCA 1PPFE 2QXJA 3MHWU 3M7TA 4TWWA 2ZP0H 1KY9A 1V2QT 4E7RG 2ASUB 3I29A 3FP7E 3TJNA 3TH4H 1H9IE 3T25A 4YT6H 1EPTA 1AVWA 4BAHB 1QFKH 2ZDLA 1QL9A 5C3NA 5LPEA 4FUCA 1MTVA 1Y3YA 5L2ZH 1O2IA 1FQ3A 1UCYE 1QJ6B 3QUMP 4VGCC 5FAHA 1T31A 3ITIA 2AH4X 2ZDNA 5GIBA 1P2IA 7LPRA 3RXFA 2R3UA 5K7RA 4CHAC 3ATWA 2J38A 2ZFTA 3SU1A 4A7IB 1D3PB 1UTKA 2PUXB 3GCHB 4Y8ZA 3E3TA 2Y80A 3ZZ3A 1TX8A 3TLOA 5AHGH 3ZYDA 2PUQH 1PPGE 2FX6A 2VVVA 1EZUC 1CT4E 3C27B 1ORFA 4XBBA 2BD4A 1BIOA 3VB3A 1K1LA 4DCDA 1WAYB 2BX4A 2HNTE 3PYHA 5LH8A 1UVTH 1TWXB 5JBBS 3UPEA 1TNHA 5TCAA 3V12A 2EA3A 3KF2A 4JCNA 1NT1A 5L30H 1LPZB 1G2LA 5EQRA 3UWIA 1VJAU 2GT7A 2O8MA 2A5IA 4ISNA 5PTPA 3RXKA 1SGFA 2BD5A 4UE7H 1C4V2 1S5SA 3TVJB 3A81A 2ZU5A 3PO1C 1AZ8A 1BBRE 1NZQH 3SJ8A 3SUFA 1PPCE 3V7TA 3SGBE 4O3TA 1ETRH 3GCTG 1N8OB 2J4IA 3VFEA 1IQJA 2BDBA 2W3KA 1ZSJA 2PSXA 6CHAB 3URCA 4BAMB 2ZCHP 1P2NA 1BMAA 2AGEX 1C5LH 4I8GA 2AYWA 2GZ7A 1GI4A 2FOGA 4NZLA 3SUEA 3LKWA 3DFJA 1G30B 2HALA 3LH1A 1O3FA 1LQDB 2WPJS 3BF6H 1EQ9A 1CHOG 4XBDA 2QF3A 2BYAX 1YM0A 1DY8A 3KQDA 1P2MA 4CRBA 3VGCC 1VGCB 2Y7XA 1ZPZA 3TGIE 4A1VA 2BOKA 2CV3A 1Y59T 2ZGBH 4AFQA 3A7ZA 4D9RA 1ZHRA 1F2SE 1ETSH 1YPGH 2F9OA 1KXDA 4NSYA 3GICB 3HKJB 5EXNA 2F9NA 1O3KA 1AFEH 3GOVB 4B2CA 1FAXA 1SLUB 2AMQA 3RXDA 1H1BA 1TGSZ 1DSUA 1HYLA 1C5PA 4AFZA 5DP5A 5E0HA 2WYGA 1UTNA 2TGDA 1DANH 4NIYA 2D26C 3VB6A 5EGMA 3VB4A 2ZHQH 1MD7A 1SGCA 3TK9A 1ZPBA 3KCGH 1E36B 2FEQH 1KXFA 3STJA 4NIWA 1FY3A 1AGJA 2WV4A 3ELAH 1YLCA 3T26A 4HGCA 3A7XA 1P09A 3QK1A 1XX9A 3BTTE 6GCHG 2FI3E 2XCNA 1A5GH 3RXAA 3RLYH 2O8WA 3A87A 3NK8A 5C1XA 2P3FH 3ZZ8A 4GHQA 3GCHC 3EAJA 1DXPA 1AUJA 1A0LA 2UUFB 4I31A 3Q77A 1NU7B 3UQOA 1AWFH 3F1SB 3M7QA 4E7NA 1VCPA 2EC9H 2GCTB 1GI9B 3STIA 2HGTH 3SU0A 2J2UA 1VCWA 3QZQA 4MNVA 3GY7A 3UNQA 2A5AA 1JMOH 1CA0B 1WQVH 2H9HA 4B76A 1OXGA 1H9HE 3S9AA 2VWLA 2A7HA 1JBUH 2RCEA 3CENA 4OS5A 1JIMA 1ELBA 3HATH 1D3TB 4ISIH 4X8TH 1C1WH 4CRCA 1C5NH 4WH6A 3RXPA 8ESTE 4NZQA 2EEKA 3SV9A 1N8OC 1FV9A 1GMCG 2AEIH 3CS7A 1A46H 1GBCA 2ALVA 1D6WA 4DGJA 6CHAC 2PR3A 1S83A 1NROH 1GHYH 4K1SA 1MBMA 1O2TA 3RXEA 1Z6EA 3Q3KA 3MU8A 4WY3A 5EXMA 5JBTA 4THNH 1C2LA 3Q00A 3LGUA 1E35B 3RXHA 4K60A 1AVGH 1O2SA 3RC5A 1TOCB 3LGTA 1ID5H 1GMDG 4BAKB 3A8AA 2V0BA 2XBVA 1FIZA 1QB9A 1O30A 1O3JA 1UMAH 1A3EH 1CHGA 2P93A 2Y5FA 3KIDU 4O3UA 2A4OA 2C8ZB 2BVSH 3A7TA 4X6OA 4BTTB 3MU1A 1RGQA 2ZDVH 3D65E 1ZPCA 3QTVH 3EA8A 1GBDA 4R8TB 1AKSB 8LPRA 1GHAF 2QV1A 1GBMA 1ANCA 3QDZB 1AIXH 3RXJA 1P04A 3FP8E 3W95A 2ZCKP 1N6YA 4UONA 4E06H 2FYRA 1BITA 2GZ8A 2GMTB 3F9HA 2BVXH 8GCHG 1GBIA 3SU3A 3SNAA 2ZU4A 3EDXB 3M37A 3QGJA 1THPB 1SGYE 2GCHF 4IN1A 1HAIH 1UVSH 4YM9A 1O2RA 1BJUA 3E6PH 4MPUA 2QGRA 1YBWA 4H4FA 1HJ8A 2BZ6H 1DWBH 1SBWA 3RU4T 3S9BA 2VGCB 2WINI 4B2AA 3O8RA 3E91A 1A5HA 1RRKA 2FP7B 5BRRE 2GV6A 3KHVA 4AORA 1K2I1 2C4FH 2GD4B 2C8WB 2GCTC 1ARCA 1HXFH 3C1KA 2YNAA 1YPLH 1ZRBA 3DUXH 3MTYA 1ANDA 1UTQA 2ZG0H 4FVBA 2BDCA 5T6FA 3SW2B 2ZWLH 1CA0C 2BX3A 1MTSA 2ZHFH 3SNCA 2ZTXA 5EQSA 4WMFA 1RFNA 4ABEA 1A5IA 1GI5A 2Z3DA 2WPMS 3RU4E 1P12E 3MU4A 1C2HA 1WUNH 4Y0ZE 3MOCA 3S69A 1S0QA 5A8YA 1DWCH 1P0SH 3ESTA 4ASHA 2BD7A 1EPTB 1T8OA 2BDHA 1LKAA 3TH2H 2XBYA 1FZZA 3ZZ6A 2D2DA 3H7TA 4MNXA 1AY6H 2PKSB 1C1OA 1ELCA 4WXVA 1S6HA 5DP6A 5GPIB 4CRDA 1MCVA 4FXGH 4TWYA 1WU1A 2PHBA 1K22H 4IW4E 4SGBE 3L6PA 4XSKU 4DOQA 1EJAA 3TITA 1NO9H 2ANMH 1MAXA 1QHRB 1TBZH 2C90B 2THFB 2ZPSA 1FONA 2A31A 4K69A 4YO9A 1KXAA 2ZTZA 3HPTB 4A6LA 1IHTH 4JZ1A 3T5FH 3SJOA 1EB1H 1SOZA 3VEQB 1DWDH 1GVKB 4CBNA 2BOHB 1HAGE 1PQAA 3K65B 1TABE 3F9EA 1S84A 3SUGA 4AG1A 1XXDA 5C20A 1LHCH 3SJIA 2VH0A 4LXBH 1HAYB 3PLKA 3BTEE 1HPGA 1ZMNA 2DE8A 3F68H 1C2EA 5C67A 9LPRA 1V2TT 3BTWE 2A4QA 1SGEE 2F91A 2G55A 4MVNA 4YOJA 2PFEA 2OINA 4AG2A 1C2IA 4ZH8A 3LC3A 1GCDA 1FUJA 2A2QH 3ZVDA 1W12U 2UUYA 2AMDA 3S0NA 2GMTC 3B8JA 1GHBG 1O3PB 3NXPA 1XMNB 1TGNA 3SO3A 1VZQH 1C1PA 1GWAA 3BTGE 1NRRH 2JH0D 4I33A 2NU4E 3PB1E 2B5TB 1C5OH 3VB5A 1EJMA 4GLYA 2WPLS 1O31A