2ZPRA

Crystal structure of anionic trypsin isoform 2 from chum salmon
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
221
structure length
221
Chain Sequence
IVGGYECKAYSQPHQVSLNSGYHFCGGSLVNENWVVSAAHCYKSRVAVRLGEHNIKVTEGSEQFISSSRVIRHPNYSSYNIDNDIMLIKLSKPATLNTYVQPVALPSSCAPAGTMCTVSGWGNTMSSTADGDKLQCLNIPILSYSDCNNSYPGMITNAMFCAGYLEGGKDSCQGDSGGPVVCNGELQGVVSWGYGCAEPGNPGVYAKVCIFNDWLTSTMAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anionic trypsin
publication title A structural comparison of three isoforms of anionic trypsin from chum salmon (Oncorhynchus keta).
pubmed doi rcsb
molecule tags Hydrolase
total genus 53
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zprA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zprA02
4IN1A 2ALVA 1PQAA 1TB6H 2D2DA 3AAVA 3FVFB 3LGTA 4BAQB 2F9OA 3F9EA 2CHAB 2XWBI 1GBKA 3S9BA 1QCPA 2ZFPH 4Z0KA 3SGBE 3BG8A 1SLUB 5GWZA 4I7YH 1ELCA 1MBQA 1WQVH 4I8JA 1LO6A 4IBLH 1SGTA 3RXIA 1Y5UT 2Z9GA 2C8YB 1GDNA 2P59A 2Y7ZA 1FY3A 3ZVAA 1O31A 1V2KT 4UFDH 1ZZZA 3ZVEA 1TPOA 2F9PA 1ZMLA 1SGPE 1UTPA 5FBEA 2XC5A 5PTPA 2W3KA 1VJAU 4OS7A 1D6RA 4X1PU 2GZ7A 1KTTB 1TQ7B 1KXAA 2JH0D 2RCEA 3EA7A 2F91A 3W95A 1E37B 1TGBA 3UR9A 2VIVA 1DX5M 2FYQA 2VVCA 2VIPA 1TMTH 2K1QA 4X8TH 1E0FD 3FFGA 3ZZ8A 3C1KA 4FUFA 3CS0A 4FUHA 3RXDA 5A0AE 5FX6A 4K5ZA 4NIVA 1BBRE 1BBRK 4NWKA 2QXHA 3RC6A 1GHVH 1GJBB 1XUFA 5TCAA 1ETSH 3VPKA 2J9NA 1HAVB 2FI3E 1ZMNA 2QC2A 4B1TA 3OY5U 5FPSA 1A0JA 4UEHH 3V3MA 4FU8A 5HGGA 3S9CA 1GBTA 1OWKA 2WPHS 2Z3DA 2J34A 3ODDA 2FOAA 3T62A 4SGAE 1KXDA 3ODFA 1IHTH 1T8OA 1IQMA 3KL6A 2A5IA 1O2KA 4GCHG 1L0ZA 2TGTA 4GAWA 4TPYA 3KCGH 1YCPH 4E7NA 2YOLA 2C90B 1DM4B 2AFQB 2J94A 4CHAB 3QWCH 3D49H 1QL7A 2ZDMA 2ZPQA 2VIDA 2TGAA 1GHBG 1C2KA 1EZQA 3A87A 4ZHAA 4A6LA 2YNBA 1TNKA 2YNAA 2ZFRH 2H5CA 3AW0A 3T25A 2W7SA 5F03A 2RG3A 1RIWC 1XXDA 1YCPM 5DP7A 1GJ6A 3SNDA 3SUDA 3A8CA 3W94A 3S9AA 1E34B 1EX3A 3E1XB 3SHAH 1KLJH 1ZHPA 2H6MA 2VB0A 1XVMA 2VIQA 1GBMA 4YLQH 4X2XA 3GY8A 2G55A 3BG4B 3PO1B 1C9TA 2BLQA 1EAWA 2G52A 1QQUA 2AMPA 2FOCA 3GYMA 4ISLA 1TFXA 1ZOMA 1L1JA 1KXEA 2FODA 1SQTA 1SGYE 9LPRA 2FO9A 1GMDG 2ZNKH 1UCYK 1QR3E 1SGRE 2VIOA 1FN8A 1K22H 1THSH 5AVDA 5FXLA 3RMLH 1MD7A 1GL0E 4IC5A 3RU4E 2HWLB 1CVWH 2ZQ1A 3UR6A 4LOYH 1Y59T 1RTLA 5E0HA 5EW2H 1O3KA 1KXBA 3QO6A 4H42U 1P2KA 1PPGE 1BTHH 2AEIH 1YBWA 2FEQH 3UIRA 8KME2 3KQDA 1C1OA 2F3CE 1JWTA 1EZUC 1ZRBA 5DPAA 3SW2B 3MMGA 4NWLA 2A4GA 1BZXE 4K8BA 1OX1A 1UTLM 5F8XA 3A7XA 5B6OA 2RA0A 2O8WA 4H6SB 1YP9A 3ATWA 2CF8H 3QLPH 1CGIE 4CR9A 1LPZB 2BB4A 1T31A 4D9QA 1ZHMA 2W5EA 1FY4A 4KELA 1G3BA 2R0KA 1QBNA 3LH3A 1O0DH 1XXFA 1G9IE 1SPJA 1J9CH 1NESE 4INHA 1G2LA 2GCTC 4O9VA 1E36B 1S81A 1LPKB 1B0EA 1OWJA 1G3CA 1Y3XA 2GKVE 1QL9A 1O2QA 5GIBA 2PSXA 1F5LA 4DW2U 3LGVA 3A82A 1V2NT 1GGDB 1F0SA 3Q76A 3CP7A 1C5TA 2F9BH 1KLTA 4Y8XA 1HUTH 1LDTT 3VB6A 2VVUA 4WMFA 1GI8B 1ZPBA 1TPSA 1O38A 1P03A 2XNIA 1M9UA 1CT4E 1HAOH 2PSYA 1HAYB 2ODYB 3QTOH 4BXWA 1NRRH 1O3AA 4E7RG 1O3NA 1HAHH 2GZ8A 1O2HA 2WV5A 1S5SA 2ODPA 1OSSA 2WUCA 3LGIA 1P2JA 4NIWA 4MG3A 2FYRA 2FOEA 3VB3A 2ZFQH 4ESTE 2ZDLA 1GJ4H 1S82A 4MPXA 1FZZA 1ZYOA 3RXEA 1MTWA 3PWBA 5E0JA 4J2YB 1C1UH 2BD8A 2HLCA 3ENSB 3DFJA 1IQLA 2ZC9H 1J17T 4Y79A 1T8NA 2XBXA 5ABWA 3T2NA 4AX9H 1V2OT 1TX6A 4GVUA 4K2YA 1QA0A 3RMOH 2BXUH 2ZIQH 3EA8A 3EAJA 1A61H 4LK4A 4NIYA 3STJA 1GI4A 2P8OC 1KDQA 1PQ5A 1BTPA 3QZRA 1VITH 1Q31A 3LU9B 3QK1A 2ZECA 2ANKH 2SFAA 4ZXXH 1DSUA 1UTQA 2QV1A 5EGMA 1NN6A 5JBTA 4CRFA 2LPRA 4B2CA 1SGEE 1XVOA 1C5OH 1Q2WA 1WBGB 1TX8A 1TRNA 1V2MT 2NU4E 4HTCH 3PMAB 1EPTA 1TGCA 2H5DA 3LKWA 2WPIS 1B7XB 4XOJA 1TPAE 1ZSKA 3MNXA 1SGDE 1D3DB 3DFLA 2FX4A 1FQ3A 2F9NA 2Y5GA 3I78A 1MKWK 1OYQA 1RD3B 3RUOA 1V2PT 1WAYB 1C5YB 2B0FA 2ULLA 3PTBA 1N6YA 1W11U 4IGDA 1O5EH 4ABDA 2VWLA 3LC5A 1PJPA 1YC0A 4A7IB 2GGVB 3OU0A 1O3EA 1RTKA 1KXFA 3E6PH 3WY8A 4AFSA 1UTMA 1C2IA 1DXPA 1FAXA 3RXQA 2HNTE 5DP6A 3HGNA 4ABJA 1ELAA 2GT7A 1A0HB 3V13A 2WPMS 4YOJA 1LHDH 2Q6DA 1UO6A 3D23A 3SU4A 1O2GH 1XUGA 4Q7XA 5C20A 3PYHA 1AWFH 1SB1H 3GDUA 2HGTH 4KTSA 1BRUP 1SSXA 3BEIB 2OCVB 1G2MA 3PM3A 5A0BA 1A4WH 5FAHA 2WYJA 4IN2A 1YPJH 1GBHA 2UUYA 2BQ7B 4NFFA 1W12U 1O5AB 4I31A 1DFPA 2D26C 1MKXH 2VVVA 1C4Y2 3OSYA 3TJOA 1UTKA 3KIDU 1O34A 4KTCA 2XTTB 2VGCB 2VINA 1GBCA 2J95A 1E35B 1GJAB 2OC0A 2BDAA 1BJVA 1O33A 4NCYA 3A7VA 1O3MA 3TVJB 1QFKH 1C1MA 1P2OA 2A4RA 3P6ZB 1DOJA 5T6GA 3I29A 2BD5A 1DLKB 1EB1H 1WYKA 5DK1A 2BOHB 1AN1E 3PMBB 2Y80A 1NRSH 3TJUA 1O2JA 1EOLA 1FAKH 1GHZA 3A88A 4M7GA 1HNEE 1C5VA 2ZP0H 2CHAC 1TBQH 4CH2B 1Y3VA 2UWOA 1TRMA 3BIVH 1AY6H 1LMWB 2F9UA 1MTNC 1V2UT 5EQRA 4IW4E 1VZQH 3V12A 2VWNA 2VWOA 1IQHA 1F92A 4NA8A 1CE5A 4DG4A 4NFEA 2P3UB 1KIGH 1TE0A 1LTOA 1Z8RA 1UVTH 5L2ZH 1O3CA 1N8OC 1ZPCA 4GCHF 5CHAB 2ZHQH 3K6ZA 1NRPH 3Q77A 5F6MA 3L3TA 2AIPA 7ESTE 1EZXC 3UPEA 3UWIA 1O2RA 1PPEE 2V6NA 2FOBA 1BQYA 1BJUA 2BLVA 1S0QA 4GSOA 2AMQA 5SGAE 1MMJN 1A0LA 3PB1E 3EQ0H 1EJAA 1T8LA 2ZA5A 4AFQA 1W8BH 1QHRB 1ZSLA 2A5KA 3BTME 3KHVA 3GCHB 2OINA 2BQWB 2ZWLH 2PLXA 1FIZA 4JK6A 3E16B 1CT0E 2I6QA 3HKIB 5AFZH 1Y3YA 2PGBB 4Y0YE 1O3JA 1LKAA 4MNWA 3SU3A 2OBQA 1ZHRA 4XBBA 4YLUA 2P94A 1G32B 4BAMB 4ISIH 1TGTA 4OGYA 2BXTH 2B9LA 2SNVA 1NRQH 2GX4A 3GY6A 3K6YA 4H6TA 3AW1A 3MH7A 4YOGA 4Y6DA 1HJ8A 2FI4E 3TGKE 1J15A 4DT7B 1AB9B 2G8TA 2IOTA 2WV4A 2AERH 3RDZA 4BOHA 1O2XA 1TNJA 1MCTA 5A09A 2FZZA 2FLBH 2P93A 3SV7A 1W13U 2A7JA 3T28A 4IMQA 2GDDA 1Z1JA 1XKBC 1C5QA 2BLOA 5DP4A 1GBJA 1LHFH 5TJXA 5IYTA 1ESTA 1IHSH 2ZDVH 1OWIA 2W3IA 4SGBE 2RDLA 1SLVB 2F9VA 1SOTA 3T5FH 2GCHG 2TGDA 4U01A 3SJ9A 1MQ5A 1E38B 4I8LA 3MWIU 1KYNA 1W7GH 4TY7A 4BAHB 4ZKNU 4B75A 3RC5A 1TA6A 3K2UA 1QTFA 5LPFA 1V2RT 3H7OA 3RXPA 2V3OH 1T8MA 4WXIA 4X2YA 1UHBA 3GCTF 2LNCA 2FI5E 3M5MA 1ELTA 4BTUB 1ESAA 3ATLA 3SUEA 1C2JA 3SNAA 3SQEE 1O3PB 3A8BA 1BHXB 3M37A 2EC9H 4JK5A 1TOMH 2H9EH 2ZFSA 6LPRA 3LIWA 2BLWA 3RXVA 5DJ7A 1Z8JB 2TPIZ 3OX7U 1ORFA 2IPHA 1P0SH 4AZ2B 2BD4A 1V2ST 3BTKE 2AS9A 1P2IA 3BG4C 2SGQE 3VB7A 2R3YA 1P01A 1UVUH 4WJG2 2XWAA 2SGAA 1DY8A 3HK6B 2BX3A 3R3GB 2OD3B 1PYTC 4MPWA 5C1UA 2XBWA 4TYDA 3QX5H 1MTVA 2ZTZA 3HGPA 1ELVA 1SFIA 4A92A 1ZTJA 2ZHFH 2P16A 2F83A 1FLEE 4K69A 1W10U 2BY7X 1FIWA 1SGIB 6CHAC 1EATA 1BHXF 3SHCH 3SORA 4B73A 4AB8A 4BNRA 3F9HA 3ELAH 3SGQE 4I8HA 1DXWA 3UFAA 4FUIA 3M35A 1BDAA 1P09A 1XX9A 4INLA 2ZU1A 3LGYA 1AIXH 2OP9A 1AZ8A 5A8YA 4YTAA 3M5OA 3RXFA 5L30H 2BY5X 2FS9A 1OWEA 1WTGH 4UE7H 3M5NA 3MO6A 1RFNA 5JDUB 1JRSA 2EI7A 1A1RA 2O8TA 3NPSA 1H8IH 3PTNA 6GCHG 2KAIB 4K3JA 1ZPZA 1CA8B 3RXTA 1O2PA 3PV4A 2QXJA 1AVXA 5FBIA 3Q3YA 2P95A 1UK2A 3D62A 3RMNH 1C2DA 4YT7H 2FP7B 2FWWA 1S6HA 3ZZDA 1QBVH 1GGDC 1L2EA 3V0XA 1SHHB 2ZTXA 3M36A 1NM6A 3KF2A 1BRBE 3PLBA 1K9OE 1YPMH 5EQQA 2XCNA 1DUEA 1GHXH 1GDUA 4D9RA 5A8ZA 1A5IA 3A83A 1OP8A 5FCKA 1JBUH 1LVMA 2Q6FA 4RKJB 2OC7A 4B74A 4MNYA 2O8MA 4WVPE 2ZKSA 1YYY1 1D3PB 1NS3A 3P95A 1HIAB 1B0FA 1YPGH 1HAGE 3UOUA 2JETB 1VGCB 1EAUA 1A5HA 4X2WA 5E8EH 3K65B 2G4UA 1AFEH 4D8NA 5C67A 1CGJE 2SGPE 1H8DH 2GDEH 1D4PB 3EGKH 1C2LA 3HK3B 3TNSA 4NA9H 1UTNA 1AVWA 4FUCA 4B2AA 1RTFB 1DWBH 3F6UH 3E3TA 3SU0A 4IS5A 2DUCA 2PKSB 1P2NA 2WINI 1BTYA 1LVOA 2G00A 4AGKA 8GCHF 3TH3H 1ANBA 3A81A 1K1LA 3FP7E 3BTDE 2PW8H 4FVDA 4KGAA 1ELGA 3IWMA 1EZSC 3KQCA 4YESB 1CHOG 1IQFA 2A1DB 2G5VA 4FUJA 1Y3UA 1K1OA 1NZQH 4ZXYH 1EQ9A 1G37A 5C2ZA 7GCHG 1VCQA 5DP8A 1MZDA 2OC1A 3VB5A 3SQHE 1UCYE 1ZJDA 3ZV8A 1KTSB 3DUXH 3MI4A 2ZDAH 4UFGH 4IMZA 1WSSH 2AMDA 4X1NU 1O35A 1FMGA 3HKJB 1W7XH 1YKTA 1BA8B 1EP6A 2C93B 3MYWA 1NC6A 1MZAA 1NTPA 5HMAA 1PQ8A 1TNGA 8ESTE 1NO9H 1QB1A 2Y7XA 1DSTA 1UK3A 4B76A 1GMCF 2FTLE 4OS1A 1NFWA 1DWDH 1EAXA 5GDSH 5HXFA 1HBTH 1SLXB 2XBYA 1JRTA 3BTQE 2FTMA 1ZTLA 4X8SH 3SN8A 1MD8A 1AD8H 4FXGH 1GBFA 4AFUA 1HXEH 3SJKA 1UTOA 3VGCB 1BIOA 3RLWH 5FCRA 1O39A 2A0QB 1VITF 1CBWB 3MU0A 3TJNA 3VFEA 5C5OA 6ESTA 1G3EA 4TY6A 2ZPSA 1SFQB 2BVRH 4DIHH 1C1VH 1O5CB 2VJ1A 4CH8B 3RXGA 2FX6A 3ATMA 3A85A 3KEEA 4MNXA 2XRCA 4ZMAH 3SI4H 3LPRA 1AQ7A 1JIRA 2STAE 1L1GA 1CGHA 1GBAA 2R9PA 1HAXB 1AUJA 1F2SE 1GBBA 1QJ1B 2EA3A 3MU1A 1GG6C 4CRCA 1O3BA 4U30A 2Y81A 1C5SA 1AKSB 3TGIE 1ELEE 2VGCC 2V35A 4FUDA 1P05A 1T7CA 1O2NA 3KGPA 1HLTH 1TA2A 3TITA 4UD9H 1DUAA 3OTJE 4X6OA 1K1JA 4Y11E 2Z9JA 1ELFA 2PKAB 1N1LA 1FNIA 1UTJA 4XBDA 1IQKA 1O2SA 4HI3A 1P12E 3M7UA 1CSOE 3E0PB 2B8OH 4GUXA 3FANA 4GPGA 1HAIH 4NZLA 5EU8A 1MUEB 2Z6BD 1D3QB 3QTVH 4NSYA 1C1RA 3IG6B 3C27B 3MH4A 3QDZB 3U1IB 1IQNA 2VIWA 1IQIA 1OPHB 4YZUA 3SJOA 2HPQH 1F5RA 1V2JT 1O5BB 1G30B 4A5TS 2GMTC 3BIUH 1EAIA 4X1SU 2BD7A 2BY9X 1AFQB 4ISOA 1BOQA 1TONA 4X6MA 4ZROA 4AOQA 2UWLA 4OS4A 4CRDA 2BQ6B 5CHAC 4RSPA 1RXPA 3TJVA 5JBAS 1AGJA 3A80A 1D9IA 3BEUA 3UQOA 3FP8E 3Q3XA 1QA7A 1TOCB 3GOVB 4MLFB 2GCHF 1C1WH 4AG2A 1O3OA 1BMLA 4JZ1A 4YM9A 3SV9A 1RIWB 1O5GH 1V2TT 2GV7A 3TIUA 2WPJS 4I33A 3UNQA 3GCHC 3SJ8A 3P8OA 1BUIA 5JB9S 2GV6A 1ARCA 3JZ1B 1AE8H 1HJ9A 4GHQA 1ACBE 3TLOA 1G3DA 4CRAA 2V0BA 1TIOA 1HAVA 2UUJB 1C2MA 3EDXB 1BB0B 3RU4D 2ZPRA 4K1SA 1WQSA 5GPIB 4HZHA 1O2UA 1O2VA 2TIOA 2VU8E 4UFEH 2H9HA 4O97A 1NFYA 2BZAA 3D65E 1HDTH 5DP5A 1T4VH 2ANWA 1KSNA 2G81E 2ZGJA 4ABEA 3ZV9A 1AB9C 2FDAA 1ETRH 3SU1A 4KTUA 4ABIA 2Z9LA 1H9HE 4Y76A 2BVSH 1TRYA 1HGTH 1NROH 3GY4A 3UREA 2CV3A 1Z1IA 1EASA 2J2UA 5FPTA 2JH6D 3H7TA 2GP9B 2FOGA 4D7FA 1SL3A 3PWCA 3E91A 1FDPA 4Q7YA 3TPIZ 1QIXB 3CS7A 5F8TA 1P04A 3KN2A 3SV2H 2VWMA 4A1XA 2ZQ2A 2Z7FE 2ZF0H 1Q3XA 1QB9A 2Z9IA 1RRKA 2SGFE 3ZVCA 1GHAG 1YCPK 2HOBA 1P2QA 1F0UA 1S6FA 1LVYA 4NG9H 2QCYA 3TU7H 5DGJA 2CGAA 4Z6AH 2ZU4A 3UUZA 1PPCE 1YLDA 1ZJKA 4X1RU 2ZHWH 1YPLH 3UNSA 1IAUA 1K2I1 1AVGH 1C5WB 1BBRH 3CENA 1DANH 3M3TA 4WF8A 5FX5A 2THFB 1F5KU 1JMOH 2XC0A 3DT0H 6GCHF 4WWYA 3SZNA 4ZKRU 3DD2H 1MU6B 3F9FA 1C1SA 2HALA 4OS6A 2P3TB 3BTEE 2A45B 2ILNA 1DT2A 1ZSJA 1P3CA 1GCTB 1QGFA 1IQJA 1GI9B 4KKDA 3RXHA 1GJ5H 1K21H 4WH6A 4F49A 1MH0A 1P9UA 4OS2A 1K1IA 1WOFA 1B5GH 4K8YA 3VEQB 4X8VH 3A89A 3SGAE 5I25A 1NU7B 1SHYA 2PTNA 3F68H 3MOCA 3UQVA 1SBWA 1SR5C 2BTCE 2UUFB 1IOEA 3RXJA 1VCWA 1XUHA 3DHKH 2W7UA 4MNVA 1YGCH 2UWPA 3N7OA 3ZYEA 1HCGA 1SGFA 3GY2A 1JIMA 3OYPA 1O5FH 3SV8A 2A31A 2ZG0H 2VH6A 1GHBF 1S83A 2G51A 1BMMH 1AZZA 3SUFA 4PROA 1O3FA 3NWUA 4UFFH 4DJZB 1ZLRA 2B5TB 3RXRA 1FY8E 4AFZA 3DA9B 3SNEA 1Y8TA 5T3HA 3S7KB 3U8OH 5C1YA 2FOHA 2R0LA 4QT8C 2ZTYA 2P8OB 1GI2A 3ZZ4A 3ZYDA 1PPFE 5LH8A 3IITA 5GJ4B 1T4UH 2AGEX 2PTCE 1DLEA 2A7HA 2PHBA 3SBKA 4AB9A 3O8BA 4Y8YA 1SMFE 1F0RA 1UCYH 1C4V2 1VJ9U 2PR3A 1ZRKA 1CO7E 3PROA 2C3SA 1TWXB 1TABE 3B23B 5DG6A 2OQUA 1C1TA 3ZZ5A 1GMDF 1D6WA 4INKA 3BTFE 1GBDA 1SGFG 2ZGBH 1L4DA 4Q7ZA 1Z6EA 3BEFB 2ZHDA 4OGXA 2V3HH 1AU8A 4ZAEA 4AYVB 3ITIA 1GI3A 3ZZAA 2EI6A 3A8DA 1OYTH 3F1SB 2OUAA 1ZGIA 3SU5A 1W3CA 4Q80A 1PFXC 3A7TA 4TPIZ 4UDWH 2ZGXH 4BTTB 1P10A 2STBE 1XM1A 3TGJE 1DY9A 1GI0A 1NFUA 2JKHA 4B71A 2JETC 2ZFTA 1VGCC 4JZFH 1P2MA 3PMHB 1GMHG 2NU0E 3NXPA 3RXAA 4CHAC 1ESBA 4NGAH 3ZVBA 2J38A 1ANEA 2H2ZA 2C8XB 2H9TH 1ID5H 4LZ4B 1QJ6B 1V2LT 5DO4H 1EP5A 2O8UA 1SQAA 2OXSA 4TWYA 1PPZA 4AYYB 1GL1A 2Z9KA 1V2VT 1C1QA 2Y6TA 4LXBH 3H5CB 4D7GA 1HYLA 3ZZ9A 2PKSC 1QNJA 3ZZ3A 1XUKA 3U8RH 2O9QA 2FM2A 1H9IE 2DE9A 1J14A 4THNH 3SNBA 1HJAB 1WCZA 3F9GA 4FUGA 4AORA 1GJ8B 4VGCB 5HYOA 3MU4A 1SG8B 4X6PA 1QB6A 4ZKOU 3PO1C 2FIRH 5C1XA 4YO9A 3ZZ7A 5ESBA 2BOKA 2ZZUH 1GJDB 1VCPA 1C5PA 2BD2A 1FUJA 3FZZA 3SO3A 3UY9A 2CXVA 1TNIA 2HPPH 5CMXH 1FN6A 1A3EH 1ANCA 2QXIA 5H4IB 2HNTF 5DP9A 4WXVA 4FUBA 1GDQA 3A7WA 4Y10E 3LJJA 2DE8A 4ISHH 3HATH 1A7SA 3HPTB 1YM0A 5C5NA 5LPRA 4ABAA 1NRNH 5AHGH 2P3FH 4CRGA 1MTNB 1Y3WA 1CA0B 4CRBA 3UNRA 5GXPA 2B7DH 5K7RA 2PFEA 2Z3CA 3QGJA 1GBIA 3RM0H 3U8TH 1ELBA 3SJIA 1JXPA 2IN2A 4O03A 3O8DA 5I46H 4DIIH 1V2QT 3SV6A 1TNLA 3GCOA 1N8OB 3SU6A 2WUBA 4ZKSU 3VGCC 1FPCH 3KQBA 4HFPB 1CBWC 1ETTH 1HB0B 3LONA 2FXRA 4F4OC 2HRVA 4LZ1H 1C2HA 2NU1E 1C5MD 1TX7A 4NSVA 1LKBA 3QGNB 4U32A 4XE4A 3ZVDA 3OY6U 3MO9A 1DITH 3BV9B 1C1NA 3RXLA 4O3TA 1FONA 1GBEA 2BDCA 2R2WU 1MU8B 3P8GA 1SLWB 1O3DA 4ISNA 1V6DA 4KP0A 2A5AA 1KDQB 3G01A 5L6NH 1UVPA 2CF9H 2VH0A 1Z71A 1C5LH 2ZI2H 3Q3KA 1MKWH 3LOXA 3P8FA 2A32A 1GJ9B 1MKXK 1ARBA 2PV9B 4AG1A 2VNTA 3SU2A 1P3EA 3BTHE 4BAOB 1C5ZB 5LGOA 4ASHA 4AN7A 3NK8A 2QIQA 1EPTB 1C5NH 4MPVA 3TNTA 2ODQA 4BXSA 3JZ2B 2BVXH 3M61U 5EQSA 4AGJA 1C5XB 1LHCH 4I8KA 2BHGA 4BAKB 2GTBA 4ZH8A 2BDHA 3E8LA 2GVFA 1UVSH 1GI7B 4X2VA 1SQOA 1BTZA 1UMAH 4FVBA 2QGRA 2BDIA 5L2YH 2EEKA 3I77A 2BDYA 3ATIA 1OWDA 2W26A 3M3VA 1ABJH 2WPLS 2J4IA 5EXLA 2QN5T 2O8LA 4NA7A 3TK6A 1DE7H 1TMBH 2Y5HA 2FMJA 1GI5A 1GWAA 1AFQC 3A7ZA 5HM9A 4Y7AA 1Z7KA 4NIXA 3SI3H 3RXCA 1W14U 5EPNA 1NT1A 1C1PA 2BY6X 5EODA 1O2YA 1WU1A 2IJOB 2AIQA 1GPZA 2ZU5A 1GHAF 1HPGA 5G4BA 2NU2E 2AH4X 2Z94A 2TRMA 4R0IA 1SI5H 1BITA 2AGIX 4DGJA 1GVKB 1PYTD 4R8TB 3P8NA 2JH5D 1THPB 3MH6A 4YT6H 3B8JA 1U6QA 1YF4A 2BX4A 3UWJH 1GJ7B 3MNCA 2ASUB 5A0CA 1A5GH 2FOFA 1PQ7A 1QBOA 3EE0B 2R2MB 3TK5A 3MNBA 7KMEH 1J8AA 3KQEA 1KXCA 3AAUA 1AHTH 3MHWU 1C2EA 3GDVA 4BANB 1O2LA 5CE1A 4FUEA 4WY3A 3RXKA 1K28D 1BRCE 1Z6JH 1LHGH 1BCUH 3URCA 1PPHE 1RJXB 1C9PA 1QURH 2ZFFH 2ESTE 1EXFA 1TBRH 2QF3A 3MTYA 4MQAA 2ALPA 5ESTE 1INCA 3RLYH 1FY1A 2ZDNA 1VR1H 1XMNB 6CHAB 1QRZA 5GCHG 1MTSA 1GI1A 3UTUH 2Y5FA 5EPYA 4CBOA 4JYVH 4RN6A 1HAPH 4JYTA 1QRXA 2G4TA 3ATKA 1P06A 1TNHA 1BMNH 1HRTH 4X8UH 1FJSA 1TGNA 5K0HA 3VB4A 1RS0A 3BTWE 1MAYA 3NKKA 1EJMA 3RXUA 2Q6GA 3V7TA 2GD4B 3S0NA 1DPOA 4X0WU 3U9AH 4Q2KA 1P11E 4ZHLU 3FZDA 3GCTG 2ZO3H 4OS5A 3NZIA 4K1TA 3M7TA 1ZMJA 2SNWA 1Z8IB 1C2FA 4MTBA 3RM2H 1UJ1A 1X7AC 3AASA 3O8RA 3MNSA 4CREA 1TYNA 3PMJA 1AUTC 5J4SA 1SVPA 2OQ5A 2XC4A 1P8VC 3GISB 4JMYA 3GY7A 1QL8A 5JBCS 3U1JB 4A1VA 4ZUHA 1BTXA 1V2WT 3RU4T 1YLCA 2A2QH 1O5DH 4XFQA 4ABFA 1GCTC 2BY8X 1NFXA 1YPEH 3KNXA 3GY3A 4ABBA 2C8WB 4CBNA 1AMHA 2D8WA 2FOMB 1G36A 1LQDB 5E0GA 1O2TA 4XSKU 3P70B 1W2KH 2ZGHA 1Y5BT 5T6FA 3RP2A 1S85A 3RXBA 9ESTA 2D1JA 1N6XA 1WTHD 1KY9A 3PLKA 1F0TA 1O3GA 2Y82A 2GT8A 4YOIA 1O2ZA 1W0ZU 1FY5A 1NPMA 1ANDA 1O3LA 3TK9A 1GI6A 4K60A 1EJNA 3VXFH 1BTUA 3LGWA 4WH8A 2CJIA 2XCFA 5ETXA 3Q00A 3P17H 1GMHF 2QY0B 2ZHEH 2SGEE 1V3XA 1S0RA 2G5NA 1HFDA 1DVAH 1H4WA 2KAIA 2ZCKP 1ZGVA 3BSQA 1GHWH 1LHEH 3GYLB 2FS8A 2FESH 4BTIB 5C3NA 4J1YA 4GHTA 1TLDA 1MBMA 1UHBB 1BRAA 1EKBB 1S84A 3L6PA 4B2BA 1THRH 1LQEA 1GBLA 4RKOB 2BD3A 1C4U2 3LC3A 3S69A 1BT7A 3FP6E 1GHYH 1TGSZ 1GJCB 4DOQA 5J4QA 2R3UA 4JZEH 1F7ZA 7LPRA 2XW9A 2TGPZ 3M5LA 3ESTA 1HAZB 1DWEH 5FPYA 1YPHE 1Y5AT 1CQQA 1CT2E 2SGDE 4MPUA 3ZZCA 2BMGB 4JCNA 1K1PA 2BM2A 1HV7A 3L33A 1HIAA 2C8ZB 1WV7H 3LDXH 1YPHC 1QQ4A 3VXEH 1LCYA 3EA9A 4E06H 1XUIA 5DP3A 2FPZA 3ZVGA 3RC4A 1O32A 3A8AA 1K1MA 5LPEA 1KLIH 3P92A 1A2CH 2XXLA 1D3TB 1QRWA 4O3UA 2UUKB 4WMDA 3E90B 1XUJA 3A7YA 2QXGA 3U98H 5HM2A 1OWHA 2XBVA 2HNTC 2CN0H 4ABHA 2AYWA 1J16A 1H9LB 3SOSA 5AF9H 3QUMP 3B9FH 1CHGA 4E05H 4A1TA 2H1UA 8GCHG 2PWXA 2WPKS 2GCTB 2ANYA 2M5TA 1GVZA 2QYIA 1OKXA 3MH5A 1HJAC 1GVLA 2OLGA 1C5RA 4VGCC 3SUGA 3T29A 3LH1A 3MFJA 3ZVFA 2PUXB 2XYAA 4NZQA 4CR5A 4FU9A 3PLPA 1GG6B 3A86A 1O2WA 3ZZ6A 3TH4H 1O3IA 1AO5A 1EOJA 2OTVA 2A7CA 2QAAA 1SGQE 4K1EA 1RGQA 3T26A 1W0YH 1PPBH 1SGCA 4H4FA 5EW1H 1ZR0A 4HGCA 1DDJA 1EUFA 1NY22 1QY6A 5A2MH 5TCCA 1OP0A 2RA3A 3BTTE 1DS2E 2ZU2A 2ZU3A 4JYUH 1IQEA 5JYIA 3U69H 3ZZBA 5JB8S 3LT3A 1FXYA 3MU5A 1GMCG 4XDEA 1CU1A 3RXMA 3SNCA 2BD9A 1H1BA 3R0FA 1CA0C 2ANMH 2GMTB 3GCNA 1MCVA 5BRRE 5E2OA 1TAWA 2BYAX 3BF6H 2WYGA 1DICA 1AWHB 2GZ9A 1ELDE 4WMEA 1O30A 1P02A 1UVOA 1VITG 3MU8A 5EOKA 4IC6A 4TWWA 2BZ6H 5BPEA 1SGNE 1L4ZA 1K1NA 1IQGA 1OS8A 3LJOA 2ZCLP 1GCDA 2BDGA 5AFYH 1YPKH 4FU7A 4JZDH 4UONA 5IDKA 1AKSA 1C5UA 1TMUH 2NU3E 1BTWA 2J92A 1MQ6A 1AE5A 3RXOA 1O2OA 1O37A 2ZCHP 1CHOF 4X6NA 1JOUB 5A8XA 4ZHMU 1LVBA 3EYDA 1LPGB 1UK4A 2PGQB 2Q1JA 2Z3EA 7GCHF 1TALA 2FLRH 1O3HA 2PKAA 4DY7B 5F8ZA 1TBZH 3FAOA 1ZTKA 1TQ0B 2I6SA 1EPTC 1BMAA 4Y8ZA 2C4FH 5FHTA 3STIA 1T32A 2BDBA 5DKMA 5JBBS 4DVAU 1MAXA 1FV9A 2EI8A 5JPMH 1P9SA 1O36A 3BTGE 3MO3A 5E2PA 4MDSA 1QJ7B 1NU9A 3QZQA 2A4OA 4Y7BA 3BN9A 3E0NB 4JZIA 1OOKB 4ABGA 3URDA 1WUNH 3O8CA 2PUQH 1A3BH 1DWCH 3RXSA 1P57B 2QA9E 3A84A 1Z8GA 3UOPA 4X1QU 1OP2A 3M3SA 5GCHF 4Y71A 3GICB 4DURA 2QF0A 3NCLA 1C2GA 2TBSA 1SC8U 4Y0ZE 5EXMA 3K9XB 1MTUA 4U2WA 2ZEBA 1XKAC 1A46H 2HVXA 4XBCA 1AI8H 2OBOA 3QN7A 3AVZA 3TH2H 1FI8A 1EB2A 5EXNA 4DCDA 1FPHH 1TPPA 1O2MA 3GY5A 4MVNA 3NUMA 2CMYA 5EG4A 2OC8A 2ZDKA 1SOZA 1HXFH 3GDSA 1O2IA 5T6DA 2A4QA 2NWNA 4D76A 3M7QA 1OXGA 4GLYA 8LPRA 3LGUA 2AGGX 3S7HB 2A2XH 2ZGCA 1ABIH 4I32A 3RMMH 3T27A 1L1NA 4I8GA
chains in the Genus database with same CATH superfamily
4IN1A 2ALVA 1PQAA 1TB6H 2D2DA 1BMFD 3AAVA 3FVFB 3LGTA 4BAQB 2F9OA 3F9EA 2CHAB 2XWBI 1GBKA 3S9BA 1QCPA 2ZFPH 4Z0KA 3SGBE 3BG8A 1SLUB 5GWZA 4I7YH 1ELCA 2KZ4A 1MBQA 1WQVH 4I8JA 1LO6A 4IBLH 1SGTA 3RXIA 1Y5UT 2Z9GA 2C8YB 1GDNA 1UW7A 2P59A 2Y7ZA 1FY3A 3ZVAA 1O31A 1V2KT 4UFDH 1ZZZA 3ZVEA 1TPOA 2F9PA 1ZMLA 1SGPE 1UTPA 5FBEA 2XC5A 5PTPA 2W3KA 1VJAU 4OS7A 1D6RA 4X1PU 2GZ7A 1KTTB 1TQ7B 1KXAA 2JH0D 2RCEA 3EA7A 3F0OA 2V3MA 2F91A 3W95A 1E37B 1TGBA 3UR9A 2VIVA 1DX5M 2FYQA 2VVCA 2VIPA 1TMTH 2K1QA 4X8TH 1MABB 1E0FD 3FFGA 3ZZ8A 3C1KA 4FUFA 3CS0A 4FUHA 3RXDA 5A0AE 4FETA 5FX6A 4K5ZA 4NIVA 1BBRE 1BBRK 4NWKA 2QXHA 3RC6A 1GHVH 1GJBB 1XUFA 5TCAA 1ETSH 3VPKA 2J9NA 1HAVB 2FI3E 1ZMNA 2QC2A 4B1TA 3OY5U 5FPSA 1A0JA 4UEHH 3V3MA 4FU8A 5HGGA 3S9CA 1GBTA 1OWKA 2WPHS 2Z3DA 2J34A 3ODDA 2FOAA 3T62A 4SGAE 1KXDA 3ODFA 1IHTH 1T8OA 1IQMA 3KL6A 2A5IA 1O2KA 4GCHG 1L0ZA 2TGTA 4GAWA 4TPYA 3KCGH 4FOUC 1YCPH 4E7NA 2YOLA 2C90B 1DM4B 2AFQB 2J94A 4CHAB 3QWCH 3D49H 1QL7A 2ZDMA 2ZPQA 2VIDA 2TGAA 1GHBG 1C2KA 1EZQA 3A87A 4ZHAA 4A6LA 2YNBA 1TNKA 2YNAA 2ZFRH 2H5CA 3AW0A 3T25A 2W7SA 5F03A 2RG3A 1RIWC 1XXDA 1YCPM 5DP7A 1GJ6A 2JDID 3SNDA 3SUDA 3A8CA 3W94A 3S9AA 1E34B 1EX3A 3E1XB 3SHAH 1KLJH 1ZHPA 2H6MA 2VB0A 1XVMA 2VIQA 1GBMA 4YLQH 4X2XA 3GY8A 2G55A 3BG4B 3PO1B 1C9TA 2BLQA 2CK3D 1EAWA 2G52A 1QQUA 2AMPA 2FOCA 3GYMA 5CDFE 4ISLA 1TFXA 1ZOMA 1L1JA 1KXEA 2FODA 1SQTA 1SGYE 9LPRA 2FO9A 1GMDG 2ZNKH 1UCYK 1QR3E 1SGRE 2VIOA 1FN8A 1K22H 1THSH 5AVDA 5FXLA 3RMLH 1MD7A 1GL0E 4IC5A 3RU4E 2HWLB 1CVWH 2ZQ1A 3UR6A 4LOYH 1Y59T 1RTLA 5E0HA 5EW2H 1O3KA 1KXBA 3QO6A 4H42U 1P2KA 1PPGE 1BTHH 2AEIH 1YBWA 2FEQH 3UIRA 8KME2 3KQDA 1C1OA 2F3CE 1JWTA 1EZUC 1ZRBA 5DPAA 3SW2B 3MMGA 4NWLA 2A4GA 1BZXE 4K8BA 1OX1A 1UTLM 5F8XA 3A7XA 5B6OA 2RA0A 2O8WA 4H6SB 2KCYA 1YP9A 3ATWA 2CF8H 3QLPH 1CGIE 4CR9A 1LPZB 2BB4A 1T31A 4D9QA 1ZHMA 2W5EA 3OEED 1FY4A 4KELA 1G3BA 2R0KA 1QBNA 3LH3A 1O0DH 1XXFA 1G9IE 1SPJA 1J9CH 1NESE 4INHA 1G2LA 2GCTC 4O9VA 1E36B 1S81A 1LPKB 1B0EA 1OWJA 1G3CA 1Y3XA 2GKVE 1QL9A 1O2QA 5GIBA 4AC9A 2PSXA 1F5LA 4DW2U 3LGVA 3A82A 1V2NT 5C0UA 1GGDB 1F0SA 3Q76A 3CP7A 1C5TA 2F9BH 1KLTA 4Y8XA 1HUTH 1LDTT 3VB6A 2VVUA 4WMFA 1GI8B 1ZPBA 1WXRA 1TPSA 1O38A 1P03A 2XNIA 1M9UA 1CT4E 1HAOH 2PSYA 1HAYB 2ODYB 3QTOH 4BXWA 1NRRH 1O3AA 4E7RG 1O3NA 1HAHH 2GZ8A 1O2HA 2WV5A 1S5SA 2ODPA 5T1VA 1OSSA 2WUCA 3LGIA 1P2JA 4NIWA 4MG3A 2FYRA 2FOEA 3VB3A 2ZFQH 4ESTE 2ZDLA 1GJ4H 1S82A 4MPXA 1FZZA 1ZYOA 3RXEA 1MTWA 3PWBA 3KYGA 5E0JA 4J2YB 1C1UH 2BD8A 2HLCA 3ENSB 3DFJA 1IQLA 2ZC9H 1J17T 2J5UA 4Y79A 1T8NA 2XBXA 5ABWA 3T2NA 4AX9H 1V2OT 1TX6A 4GVUA 4K2YA 2RFKC 1QA0A 3RMOH 2BXUH 2ZIQH 3EA8A 3EAJA 5DSFA 1A61H 4LK4A 4NIYA 3STJA 1GI4A 2P8OC 1KDQA 1PQ5A 1BTPA 3QZRA 1VITH 1Q31A 3LU9B 3QK1A 2ZECA 2ANKH 2SFAA 4ZXXH 1DSUA 1UTQA 2QV1A 5EGMA 1NN6A 5JBTA 4CRFA 2LPRA 4B2CA 1SGEE 1XVOA 1C5OH 1Q2WA 1WBGB 1TX8A 3UAIC 1TRNA 1V2MT 2NU4E 4HTCH 3PMAB 1EPTA 1TGCA 2H5DA 3LKWA 2WPIS 1B7XB 4XOJA 1TPAE 1ZSKA 3MNXA 1SGDE 1D3DB 2WSSD 3DFLA 2FX4A 1FQ3A 2F9NA 2Y5GA 3I78A 1MKWK 1OYQA 1RD3B 3RUOA 1V2PT 1WAYB 1C5YB 2B0FA 2ULLA 3PTBA 1N6YA 1W11U 4IGDA 1O5EH 4ABDA 3N7EA 2VWLA 3LC5A 1PJPA 1YC0A 4A7IB 1FX0B 2GGVB 3OU0A 1O3EA 1RTKA 1KXFA 3E6PH 3WY8A 4AFSA 1UTMA 1C2IA 1DXPA 1FAXA 3RXQA 2HNTE 5DP6A 3N7DA 3HGNA 4ABJA 1SQRA 1ELAA 2GT7A 1A0HB 3V13A 2WPMS 4YOJA 1LHDH 2Q6DA 1UO6A 3D23A 3SU4A 1O2GH 1XUGA 4Q7XA 5C20A 3PYHA 2WV9A 1AWFH 1SB1H 3GDUA 2HGTH 2JJ1D 4KTSA 1BRUP 1SSXA 3BEIB 2OCVB 1G2MA 3PM3A 5A0BA 1A4WH 5FAHA 2WYJA 4IN2A 1YPJH 1GBHA 2UUYA 2BQ7B 4NFFA 1W12U 1O5AB 4I31A 1DFPA 2D26C 1MKXH 2VVVA 1C4Y2 3OSYA 3TJOA 1UTKA 3KIDU 1O34A 4KTCA 2XTTB 2VGCB 2VINA 1GBCA 2J95A 1E35B 1GJAB 2OC0A 2BDAA 4HG6A 1BJVA 1O33A 4NCYA 3A7VA 1O3MA 3TVJB 1QFKH 1C1MA 1P2OA 2A4RA 3P6ZB 1DOJA 5T6GA 3I29A 2BD5A 1DLKB 1EB1H 2LELA 1WYKA 5DK1A 2BOHB 1AN1E 3PMBB 2Y80A 1NRSH 4TT3D 3TJUA 1O2JA 1EOLA 1FAKH 1GHZA 3A88A 4M7GA 1HNEE 1C5VA 2ZP0H 2CHAC 1TBQH 4CH2B 1EFRD 1Y3VA 1E1RD 1TRMA 2UWOA 3BIVH 5EJLA 1AY6H 1LMWB 2F9UA 1MTNC 1V2UT 5EQRA 4IW4E 1VZQH 3V12A 2VWNA 2VWOA 1IQHA 1F92A 4NA8A 1CE5A 4DG4A 4NFEA 2P3UB 1KIGH 1TE0A 1LTOA 1Z8RA 1UVTH 5L2ZH 1O3CA 1N8OC 1ZPCA 4GCHF 5CHAB 2ZHQH 3K6ZA 1NRPH 3Q77A 5F6MA 3L3TA 2AIPA 7ESTE 1EZXC 3UPEA 3UWIA 1O2RA 1PPEE 2V6NA 2FOBA 1BQYA 1BJUA 2KX4A 2BLVA 1S0QA 4GSOA 2AMQA 3PV5A 5SGAE 1MMJN 1A0LA 3H09A 3EQ0H 3PB1E 1EJAA 1T8LA 2ZA5A 4AFQA 1W8BH 1QHRB 1ZSLA 2A5KA 3BTME 3KHVA 3GCHB 2OINA 3OEHD 2BQWB 2ZWLH 2PLXA 1FIZA 4JK6A 3E16B 1CT0E 2I6QA 3HKIB 5AFZH 1Y3YA 2PGBB 4Y0YE 1O3JA 1LKAA 4MNWA 3SU3A 2OBQA 1ZHRA 4XBBA 4YLUA 2P94A 1G32B 4BAMB 4ISIH 1TGTA 4OGYA 2BXTH 2B9LA 2SNVA 1NRQH 2GX4A 3GY6A 3K6YA 4H6TA 3AW1A 3MH7A 4YOGA 4Y6DA 1HJ8A 2FI4E 3TGKE 1J15A 2RDEA 1AB9B 2G8TA 4DT7B 2IOTA 2WV4A 2AERH 3RDZA 4BOHA 1O2XA 1TNJA 1MCTA 5A09A 2FZZA 2FLBH 2P93A 3SV7A 2V7QD 1W13U 2A7JA 3T28A 4IMQA 2GDDA 1Z1JA 1XKBC 1C5QA 2BLOA 5DP4A 1GBJA 1LHFH 5TJXA 5IYTA 3VG8A 1ESTA 1IHSH 2ZDVH 1COWD 2L74A 1OWIA 2W3IA 1QZ8A 4SGBE 2RDLA 1SLVB 2F9VA 1SOTA 3T5FH 2GJGA 2GCHG 2TGDA 4U01A 3SJ9A 1MQ5A 1E38B 4I8LA 3MWIU 2F4LA 1KYNA 1W7GH 2WPDD 4TY7A 4BAHB 4ZKNU 4B75A 3RC5A 1TA6A 3K2UA 1QTFA 5LPFA 1V2RT 3H7OA 3RXPA 2V3OH 1T8MA 4WXIA 4X2YA 1UHBA 3GCTF 2JJ2D 2FI5E 2LNCA 3M5MA 1ELTA 2VBCA 4BTUB 1ESAA 3ATLA 3SUEA 1C2JA 3SNAA 3SQEE 1O3PB 3A8BA 1BHXB 3M37A 2EC9H 4JK5A 5F53A 1TOMH 2H9EH 2ZFSA 6LPRA 3LIWA 2BLWA 4XRNA 3RXVA 5DJ7A 1Z8JB 2TPIZ 3OX7U 2WZQA 1ORFA 2IPHA 1P0SH 4AZ2B 2BD4A 1V2ST 3BTKE 2AS9A 1P2IA 3BG4C 1YWUA 2SGQE 3VB7A 2R3YA 1P01A 1UVUH 4WJG2 2XWAA 2SGAA 3GS9A 1DY8A 3HK6B 2BX3A 3R3GB 2OD3B 1PYTC 4MPWA 5C1UA 2XBWA 4TYDA 3QX5H 1MTVA 2J97A 2ZTZA 3HGPA 1ELVA 1SFIA 4A92A 1ZTJA 2ZHFH 2P16A 2F83A 1FLEE 4K69A 1W10U 2BY7X 1FIWA 1SGIB 6CHAC 1EATA 1BHXF 3SHCH 3SORA 4B73A 4AB8A 4BNRA 3F9HA 3ELAH 3SGQE 4I8HA 1DXWA 3UFAA 4FUIA 3OTPA 3M35A 1BDAA 1P09A 1XX9A 4INLA 2ZU1A 3LGYA 1AIXH 2OP9A 1AZ8A 4M9FA 5A8YA 4YTAA 3M5OA 3RXFA 5L30H 5HKKD 2BY5X 2FS9A 1OWEA 1WTGH 4UE7H 3M5NA 3MO6A 1RFNA 5JDUB 1JRSA 2EI7A 1A1RA 2O8TA 3NPSA 1H8IH 3PTNA 6GCHG 2KAIB 2YMSC 4K3JA 1ZPZA 1CA8B 3NRLA 3RXTA 1O2PA 3PV4A 2QXJA 1AVXA 5FBIA 3Q3YA 2P95A 1UK2A 3D62A 3RMNH 1C2DA 4YT7H 2FP7B 2FWWA 1S6HA 3ZZDA 1QBVH 1GGDC 1L2EA 3V0XA 1SHHB 2ZTXA 3M36A 1NM6A 3KF2A 1BRBE 3SZEA 3PLBA 1K9OE 1YPMH 5EQQA 2XCNA 1DUEA 1GHXH 1GDUA 4D9RA 5A8ZA 1A5IA 3A83A 1OP8A 5FCKA 1JBUH 1LVMA 2Q6FA 4RKJB 2OC7A 4B74A 4MNYA 2O8MA 4WVPE 2ZKSA 1YYY1 1D3PB 1NS3A 3P95A 1HIAB 1B0FA 1YPGH 1HAGE 3UOUA 2JETB 1VGCB 1EAUA 1A5HA 4X2WA 5E8EH 3K65B 2G4UA 1AFEH 4D8NA 5C67A 1CGJE 2SGPE 1H8DH 2GDEH 1D4PB 3EGKH 1C2LA 3HK3B 3TNSA 4NA9H 1UTNA 1AVWA 4FUCA 4B2AA 1RTFB 1NBME 5DN6D 1DWBH 3F6UH 3E3TA 3SU0A 4IS5A 2DUCA 2PKSB 1P2NA 2WINI 4TSFD 1BTYA 1LVOA 2G00A 3SYJA 4AGKA 8GCHF 3TH3H 1ANBA 3A81A 1K1LA 3FP7E 3BTDE 2PW8H 4FVDA 4KGAA 1ELGA 3IWMA 1EZSC 3KQCA 4YESB 1CHOG 1IQFA 2A1DB 2G5VA 4FUJA 1Y3UA 3EE7A 1K1OA 1NZQH 4ZXYH 1EQ9A 1G37A 5C2ZA 5CHBA 7GCHG 1VCQA 1H8HD 5DP8A 1MZDA 2OC1A 3VB5A 3SQHE 1UCYE 1ZJDA 3ZV8A 2IJD1 1KTSB 3DUXH 3MI4A 1S6LA 2ZDAH 4UFGH 4IMZA 1WSSH 2AMDA 4X1NU 1O35A 1FMGA 3HKJB 1W7XH 1YKTA 1BA8B 1EP6A 2C93B 3MYWA 1NC6A 1MZAA 1NTPA 5HMAA 1PQ8A 1TNGA 8ESTE 1NO9H 1QB1A 2Y7XA 1DSTA 1UK3A 4B76A 1GMCF 2FTLE 4OS1A 1NFWA 1DWDH 1EAXA 5GDSH 5HXFA 1HBTH 1SLXB 2XBYA 1JRTA 3BTQE 2FTMA 1ZTLA 4X8SH 3SN8A 1MD8A 1AD8H 4FXGH 1GBFA 2J98B 4AFUA 1HXEH 3SJKA 1UTOA 3UB0A 3VGCB 1BIOA 3RLWH 5FCRA 1O39A 2A0QB 1VITF 1CBWB 3MU0A 3TJNA 2YMSD 3VFEA 5C5OA 6ESTA 1G3EA 4TY6A 2ZPSA 1SFQB 2BVRH 2W6JD 4DIHH 1C1VH 1O5CB 3DSPA 2VJ1A 4CH8B 3RXGA 2FX6A 3ATMA 3A85A 3KEEA 4MNXA 2XRCA 4ZMAH 1YY3A 3SI4H 3LPRA 1AQ7A 1JIRA 2JIZD 2STAE 1L1GA 2W6ID 2WHXA 1CGHA 1GBAA 2R9PA 1HAXB 1AUJA 1F2SE 1GBBA 1QJ1B 2EA3A 3MU1A 1GG6C 4CRCA 1O3BA 4U30A 2Y81A 1C5SA 4ACAA 1AKSB 3TGIE 1ELEE 2VGCC 2V35A 4FUDA 1P05A 1T7CA 1O2NA 3KGPA 1HLTH 1TA2A 3TITA 4UD9H 2LP6A 4ZCNA 1DUAA 3OTJE 4X6OA 1K1JA 4Y11E 4Z1MD 2Z9JA 1ELFA 2PKAB 1N1LA 1FNIA 1UTJA 4XBDA 1IQKA 1O2SA 4HI3A 1P12E 3M7UA 1CSOE 3E0PB 2B8OH 4GUXA 3FANA 4GPGA 1HAIH 4NZLA 5EU8A 1MUEB 2Z6BD 1K0HA 1D3QB 3QTVH 4NSYA 1C1RA 3IG6B 3C27B 3MH4A 3QDZB 3U1IB 1IQNA 2VIWA 1IQIA 1OPHB 4YZUA 3SJOA 2HPQH 1F5RA 1V2JT 1O5BB 1G30B 4A5TS 2GMTC 3BIUH 1EAIA 4X1SU 2BD7A 2L6OA 2BY9X 1AFQB 4ISOA 1BOQA 1TONA 4X6MA 4ZROA 4AOQA 2UWLA 4OS4A 4CRDA 2BQ6B 1NBMD 5CHAC 4RSPA 1RXPA 3TJVA 5JBAS 1AGJA 3A80A 1D9IA 3BEUA 3UQOA 3FP8E 3Q3XA 1QA7A 1TOCB 3GOVB 4MLFB 2GCHF 1C1WH 4AG2A 1O3OA 1BMLA 4JZ1A 4YM9A 2QF4A 3SV9A 1RIWB 1O5GH 1V2TT 2GV7A 3TIUA 2WPJS 4I33A 3UNQA 3GCHC 3SJ8A 3P8OA 1BUIA 5JB9S 2GV6A 1ARCA 3JZ1B 1AE8H 1HJ9A 4GHQA 1ACBE 3TLOA 1G3DA 4CRAA 2V0BA 1TIOA 1HAVA 2UUJB 1C2MA 3EDXB 1BB0B 3RU4D 2KCAA 4ACBA 2ZPRA 4K1SA 5HIZA 1WQSA 5GPIB 4HZHA 1O2UA 1O2VA 2TIOA 2VU8E 4UFEH 2H9HA 4O97A 1NFYA 2BZAA 3D65E 1HDTH 5DP5A 1T4VH 2ANWA 1KSNA 2G81E 2ZGJA 4ABEA 3ZV9A 1AB9C 2FDAA 1ETRH 3SU1A 4KTUA 4ABIA 2Z9LA 1H9HE 4Y76A 2BVSH 1TRYA 1HGTH 1NROH 3GY4A 3UREA 5KEDA 2CV3A 1Z1IA 1EASA 2J2UA 5FPTA 2JH6D 3H7TA 2GP9B 2FOGA 4D7FA 1SL3A 3PWCA 3E91A 1FDPA 4Q7YA 3TPIZ 1QIXB 3CS7A 5F8TA 1P04A 3KN2A 3SV2H 2VWMA 4OM9A 4A1XA 2ZQ2A 2Z7FE 2ZF0H 1Q3XA 1QB9A 2Z9IA 1RRKA 2SGFE 1E79D 3ZVCA 1GHAG 1YCPK 2HOBA 1P2QA 1F0UA 1S6FA 1LVYA 4NG9H 2QCYA 3TU7H 5EJ1A 5DGJA 2CGAA 4Z6AH 2ZU4A 3UUZA 1PPCE 1YLDA 1ZJKA 4X1RU 2ZHWH 1YPLH 3DCLA 3UNSA 1IAUA 1K2I1 1AVGH 1C5WB 1BBRH 3CENA 1DANH 3ZIAD 3M3TA 4WF8A 5FX5A 2THFB 1F5KU 1JMOH 2XC0A 3DT0H 6GCHF 4WWYA 3SZNA 4ZKRU 3DD2H 5C94A 1MU6B 3F9FA 4F55A 1C1SA 2HALA 4OS6A 2P3TB 3BTEE 2A45B 2ILNA 1DT2A 1ZSJA 1P3CA 1GCTB 1QGFA 1IQJA 1GI9B 4KKDA 3RXHA 2IPQX 1GJ5H 1K21H 4WH6A 3F2FA 4F49A 1MH0A 1P9UA 4OS2A 1K1IA 1WDIA 1WOFA 1B5GH 4K8YA 3VEQB 4X8VH 3A89A 4F48B 3SGAE 5I25A 1NU7B 1SHYA 2PTNA 3F68H 5FL7D 3MOCA 3UQVA 1SBWA 1SR5C 2BTCE 2UUFB 2KFWA 1IOEA 3RXJA 1VCWA 1XUHA 3DHKH 2W7UA 4MNVA 1YGCH 2UWPA 3N7OA 3ZYEA 1HCGA 1SGFA 3GY2A 3W1EA 1JIMA 3OYPA 1O5FH 3SV8A 2A31A 2ZG0H 2HLDD 2VH6A 1GHBF 1S83A 2G51A 1BMMH 1AZZA 3SUFA 4PROA 1O3FA 3NWUA 4UFFH 4DJZB 1ZLRA 2B5TB 3RXRA 1FY8E 4AFZA 3DA9B 3SNEA 1Y8TA 5T3HA 3S7KB 3U8OH 3U28C 5C1YA 2FOHA 2R0LA 4QT8C 2ZTYA 2P8OB 1GI2A 3ZZ4A 3ZYDA 1PPFE 5LH8A 3IITA 5GJ4B 1T4UH 2AGEX 2PTCE 1DLEA 2A7HA 2PHBA 3SBKA 4AB9A 3O8BA 4Y8YA 1SMFE 1F0RA 1UCYH 1C4V2 1VJ9U 2PR3A 1ZRKA 1CO7E 3PROA 2C3SA 1TWXB 1TABE 3B23B 5DG6A 2OQUA 1C1TA 3ZZ5A 1GMDF 1D6WA 1KMHB 3MQKC 4INKA 3BTFE 1GBDA 1SGFG 2ZGBH 1L4DA 4Q7ZA 1Z6EA 1W0KD 3PRBA 3BEFB 2ZHDA 4OGXA 2V3HH 1AU8A 4ZAEA 4AYVB 3ITIA 1GI3A 3ZZAA 2EI6A 3A8DA 1OYTH 3F1SB 2OUAA 1ZGIA 3SU5A 1W3CA 4Q80A 1PFXC 3A7TA 4TPIZ 4UDWH 2ZGXH 4BTTB 1P10A 2STBE 1XM1A 3TGJE 1DY9A 1GI0A 1NFUA 2JKHA 4B71A 2JETC 2ZFTA 1VGCC 4JZFH 1P2MA 3PMHB 1GMHG 2NU0E 3NXPA 3RXAA 4CHAC 1ESBA 4NGAH 3ZVBA 2J38A 2EQNA 5B6LA 1ANEA 2H2ZA 2C8XB 2H9TH 3WWFA 1ID5H 4LZ4B 1QJ6B 1V2LT 5DO4H 1EP5A 2O8UA 1SQAA 2OXSA 4TWYA 1PPZA 4AYYB 1GL1A 2Z9KA 1V2VT 1C1QA 2Y6TA 4LXBH 3H5CB 4D7GA 1HYLA 3ZZ9A 2KM0A 2PKSC 1QNJA 3ZZ3A 1XUKA 3U8RH 2O9QA 2FM2A 1H9IE 2DE9A 1J14A 3DSGA 4THNH 3SNBA 1HJAB 1WCZA 3F9GA 4FUGA 4AORA 1GJ8B 4VGCB 5HYOA 2F43B 3MU4A 1SG8B 4X6PA 1QB6A 4ZKOU 3PO1C 2FIRH 5C1XA 4YO9A 3ZZ7A 5ESBA 2BOKA 2ZZUH 1GJDB 1VCPA 1C5PA 2BD2A 1FUJA 3FZZA 3SO3A 3UY9A 2CXVA 1TNIA 2HPPH 5CMXH 1FN6A 1A3EH 1ANCA 2QXIA 5H4IB 2HNTF 5DP9A 4WXVA 4FUBA 1GDQA 3A7WA 4Y10E 3LJJA 2DE8A 4ISHH 3HATH 1A7SA 5C17A 3HPTB 1YM0A 5C5NA 5LPRA 3KYFA 4ABAA 1NRNH 5AHGH 2P3FH 4CRGA 1MTNB 1Y3WA 1CA0B 4CRBA 3UNRA 5GXPA 2B7DH 5K7RA 2PFEA 2Z3CA 3QGJA 1GBIA 3RM0H 3U8TH 1ELBA 3SJIA 1JXPA 2IN2A 4O03A 3O8DA 5I46H 4DIIH 1V2QT 3SV6A 1TNLA 3GCOA 1N8OB 3SU6A 4Q4LA 2WUBA 4ZKSU 3VGCC 1FPCH 3KQBA 4HFPB 1CBWC 1ETTH 1HB0B 3LONA 2FXRA 4F4OC 2HRVA 4LZ1H 1C2HA 2NU1E 1C5MD 1TX7A 4NSVA 1LKBA 3QGNB 4U32A 4XE4A 3ZVDA 3OY6U 4B6EA 3MO9A 1DITH 3BV9B 1C1NA 3RXLA 4O3TA 1FONA 1GBEA 2BDCA 2R2WU 1MU8B 3P8GA 1SLWB 1O3DA 4ISNA 1V6DA 4KP0A 2A5AA 1KDQB 3G01A 5L6NH 1UVPA 2CF9H 4ASUD 2VH0A 1Z71A 1C5LH 2ZI2H 3Q3KA 1MKWH 3LOXA 3OE7D 3P8FA 2A32A 1GJ9B 3PV2A 1MKXK 1ARBA 2PV9B 4AG1A 2VNTA 3SU2A 1P3EA 3BTHE 3OFND 1C5ZB 4BAOB 4ASHA 5LGOA 4AN7A 3NK8A 2QIQA 1EPTB 1C5NH 4MPVA 3TNTA 2ODQA 4BXSA 3JZ2B 2BVXH 3M61U 5EQSA 4AGJA 1C5XB 1LHCH 4I8KA 2BHGA 4BAKB 2GTBA 4ZH8A 2BDHA 3E8LA 3F3BA 2GVFA 1UVSH 1GI7B 4X2VA 1SQOA 1BTZA 1UMAH 4FVBA 2QGRA 3DSOA 2BDIA 5L2YH 2EEKA 3I77A 2BDYA 3ATIA 1OWDA 2W26A 3M3VA 1ABJH 2WPLS 2J4IA 5EXLA 2QN5T 2O8LA 3CNRA 4NA7A 3TK6A 1DE7H 5KECA 1TMBH 1E1QD 2Y5HA 3AK5A 2FMJA 1GI5A 1GWAA 1AFQC 3A7ZA 5HM9A 4I86A 4Y7AA 1Z7KA 4NIXA 3SI3H 3RXCA 1W14U 5EPNA 1NT1A 1C1PA 2BY6X 5EODA 1O2YA 1WU1A 3PRDA 2IJOB 2AIQA 1GPZA 2ZU5A 1GHAF 1HPGA 5G4BA 2NU2E 2AH4X 2Z94A 2TRMA 4R0IA 1SI5H 1BITA 5EIYA 2AGIX 4DGJA 1GVKB 1PYTD 4R8TB 3P8NA 3N99A 2JH5D 1THPB 3MH6A 4YT6H 3B8JA 1U6QA 1YF4A 2BX4A 3UWJH 1GJ7B 3MNCA 2ASUB 5A0CA 1A5GH 2FOFA 1PQ7A 4RI0A 1QBOA 3EE0B 2R2MB 3TK5A 3MNBA 7KMEH 1J8AA 3KQEA 1KXCA 3AAUA 1AHTH 3MHWU 1C2EA 2HVYB 3GDVA 4BANB 1O2LA 5CE1A 1H8ED 4FUEA 4WY3A 3RXKA 1K28D 1BRCE 1Z6JH 1LHGH 1BCUH 3URCA 1PPHE 1RJXB 1C9PA 1QURH 2ZFFH 2ESTE 1EXFA 1TBRH 2QF3A 3MTYA 4MQAA 2ALPA 5ESTE 1INCA 3RLYH 1FY1A 2ZDNA 1VR1H 1XMNB 6CHAB 1QRZA 5GCHG 1MTSA 1GI1A 3UTUH 2Y5FA 5EPYA 4CBOA 4JYVH 4RN6A 1HAPH 4JYTA 1QRXA 2G4TA 3ATKA 1P06A 1TNHA 1BMNH 1HRTH 4X8UH 1FJSA 1TGNA 3OAAD 3VB4A 5K0HA 1RS0A 3BTWE 1MAYA 3NKKA 1EJMA 3RXUA 2EY4C 2Q6GA 3V7TA 2GD4B 3S0NA 1DPOA 4X0WU 3U9AH 4Q2KA 1P11E 4ZHLU 3FZDA 3GCTG 2ZO3H 4OS5A 3NZIA 4RT1A 4K1TA 3M7TA 3KQ5A 1ZMJA 2AHME 4B6FA 2SNWA 1Z8IB 1C2FA 4MTBA 3RM2H 4Q63A 1UJ1A 1X7AC 3WW7A 3AASA 3O8RA 3MNSA 2YMSB 1YLNA 4CREA 1TYNA 3PMJA 1AUTC 5J4SA 1SVPA 2OQ5A 2XC4A 1P8VC 2PP6A 3GISB 4JMYA 3GY7A 2KR7A 1QL8A 5JBCS 3U1JB 4A1VA 4ZUHA 1BTXA 1V2WT 3RU4T 1YLCA 2A2QH 1O5DH 4XFQA 4ABFA 1GCTC 2BY8X 1NFXA 1YPEH 3KNXA 3GY3A 4ABBA 2C8WB 2KCOA 4CBNA 1AMHA 1SKYE 2D8WA 2FOMB 1G36A 1LQDB 5E0GA 1O2TA 4XSKU 3P70B 1W2KH 2ZGHA 1Y5BT 5T6FA 3RP2A 1S85A 3RXBA 9ESTA 2D1JA 1N6XA 1WTHD 1KY9A 3PLKA 1F0TA 1O3GA 2Y82A 2GT8A 4YOIA 1O2ZA 1W0ZU 1FY5A 1NPMA 1ANDA 1O3LA 3TK9A 1GI6A 5KGOA 4K60A 1EJNA 3VXFH 1BTUA 3LGWA 4WH8A 2CJIA 2XCFA 5ETXA 3Q00A 3P17H 1GMHF 2QY0B 2ZHEH 2SGEE 1V3XA 3FO8D 1S0RA 1VKYA 2G5NA 1HFDA 1DVAH 1H4WA 2KAIA 2ZCKP 1ZGVA 1OHHD 3BSQA 1GHWH 1LHEH 3GYLB 2FS8A 2FESH 4BTIB 5C3NA 4J1YA 4GHTA 1TLDA 1MBMA 1UHBB 1BRAA 1EKBB 1S84A 3L6PA 4B2BA 1THRH 1LQEA 1GBLA 4RKOB 2BD3A 1C4U2 3LC3A 3S69A 1BT7A 3FP6E 1GHYH 1TGSZ 1GJCB 4DOQA 5J4QA 2R3UA 4JZEH 1F7ZA 7LPRA 2XW9A 2TGPZ 3M5LA 4P00A 3ESTA 1HAZB 1DWEH 5FPYA 1YPHE 1Y5AT 1CQQA 1CT2E 2SGDE 4MPUA 3WWBA 3ZZCA 2BMGB 2XOKD 4JCNA 1K1PA 2BM2A 1HV7A 3L33A 1HIAA 2C8ZB 1WV7H 3LDXH 1YPHC 1QQ4A 3F2GA 3VXEH 1LCYA 3EA9A 4E06H 1XUIA 5DP3A 2FPZA 3ZVGA 3RC4A 1O32A 3A8AA 1K1MA 5LPEA 1KLIH 3P92A 1A2CH 2XXLA 1D3TB 1QRWA 4O3UA 2UUKB 4WMDA 3E90B 1XUJA 3A7YA 2KCPA 2QXGA 3U98H 5HM2A 3F2HA 1OWHA 2XBVA 2HNTC 2CN0H 4ABHA 2AYWA 1J16A 1H9LB 3SOSA 5AF9H 3QUMP 3B9FH 1CHGA 4E05H 4A1TA 2H1UA 8GCHG 2PWXA 2WPKS 2GCTB 2ANYA 2M5TA 1GVZA 2QYIA 1OKXA 3MH5A 1HJAC 1GVLA 2OLGA 1C5RA 4VGCC 3SUGA 3T29A 3LH1A 3MFJA 3ZVFA 2PUXB 2XYAA 4NZQA 4CR5A 4FU9A 3PLPA 1GG6B 3A86A 1O2WA 3ZZ6A 3TH4H 1O3IA 1AO5A 1EOJA 2OTVA 2A7CA 2QAAA 1SGQE 4K1EA 1RGQA 3T26A 1W0YH 1PPBH 1SGCA 4H4FA 5EW1H 1ZR0A 4HGCA 1DDJA 1EUFA 1NY22 1QY6A 5A2MH 5TCCA 1OP0A 2RA3A 3BTTE 1DS2E 3FOAA 2ZU2A 2ZU3A 4JYUH 1IQEA 5JYIA 3U69H 3ZZBA 5JB8S 3LT3A 1FXYA 3MU5A 1GMCG 4XDEA 1CU1A 2J98A 3RXMA 3SNCA 2BD9A 1H1BA 3R0FA 1CA0C 2ANMH 2GMTB 3GCNA 1MCVA 5BRRE 5C0TA 5E2OA 1TAWA 2BYAX 3BF6H 2WYGA 1DICA 1AWHB 2GZ9A 4DT4A 1ELDE 4WMEA 1O30A 1P02A 1UVOA 1VITG 3MU8A 5EOKA 4IC6A 4TWWA 2BZ6H 5BPEA 1SGNE 1L4ZA 1K1NA 4RT0A 1IQGA 1OS8A 3LJOA 2ZCLP 4P02A 1GCDA 2BDGA 5AFYH 1YPKH 4FU7A 4JZDH 4UONA 5IDKA 1AKSA 1C5UA 1TMUH 2NU3E 1BTWA 2J92A 1MQ6A 1AE5A 3RXOA 1O2OA 5IK2D 1O37A 2ZCHP 1CHOF 4X6NA 1JOUB 5A8XA 5GNDA 4ZHMU 1LVBA 3EYDA 1LPGB 1UK4A 2PGQB 2Q1JA 2Z3EA 7GCHF 1TALA 2FLRH 1O3HA 2PKAA 4DY7B 2K0QA 5F8ZA 1TBZH 3FAOA 1ZTKA 1TQ0B 2I6SA 3FN8A 1W0JD 1EPTC 1BMAA 4Y8ZA 2C4FH 5FHTA 3STIA 1T32A 2BDBA 5DKMA 5JBBS 2OK5A 4DVAU 1MAXA 1FV9A 2XNDD 2EI8A 5JPMH 1P9SA 1O36A 3BTGE 3MO3A 5E2PA 4MDSA 1QJ7B 1NU9A 3QZQA 2A4OA 4Y7BA 3BN9A 5HIYA 3E0NB 4JZIA 1OOKB 4ABGA 3URDA 1WUNH 3O8CA 2K8IA 2PUQH 1A3BH 1DWCH 3RXSA 1P57B 2QA9E 3A84A 1Z8GA 3UOPA 4X1QU 1OP2A 3M3SA 5GCHF 4Y71A 3GICB 4DURA 2QF0A 3NCLA 2M2AA 1C2GA 2TBSA 5EJZA 3F0PA 1SC8U 4Y0ZE 5EXMA 3FKSD 3K9XB 1MTUA 4U2WA 2ZEBA 2QE7D 1XKAC 1A46H 2HVXA 4XBCA 1AI8H 2OBOA 3QN7A 3AVZA 3TH2H 1FI8A 1EB2A 5EXNA 4DCDA 1FPHH 1TPPA 1O2MA 3GY5A 4MVNA 3NUMA 2CMYA 5EG4A 2OC8A 2ZDKA 1SOZA 1HXFH 3GDSA 1O2IA 5T6DA 2A4QA 2NWNA 4D76A 3M7QA 2QF5A 4YXWD 1OXGA 4GLYA 8LPRA 3LGUA 2AGGX 3S7HB 2A2XH 2ZGCA 4XD7D 1ABIH 4I32A 3RMMH 3T27A 1L1NA 4I8GA
chains in the Genus database with same CATH topology
4IN1A 2ALVA 1PQAA 1TB6H 2D2DA 3AAVA 3FVFB 3LGTA 4BAQB 2F9OA 3F9EA 2CHAB 2XWBI 1GBKA 3S9BA 1QCPA 2ZFPH 4Z0KA 3SGBE 3BG8A 1SLUB 5GWZA 4I7YH 1ELCA 1MBQA 1WQVH 4I8JA 1LO6A 4IBLH 1SGTA 3RXIA 1Y5UT 2Z9GA 2C8YB 1GDNA 2P59A 2Y7ZA 1FY3A 3ZVAA 1O31A 1V2KT 4UFDH 1ZZZA 3ZVEA 1TPOA 2F9PA 1ZMLA 1SGPE 1UTPA 5FBEA 2XC5A 5PTPA 2W3KA 1VJAU 4OS7A 1D6RA 4X1PU 2GZ7A 1KTTB 1TQ7B 1KXAA 2JH0D 2RCEA 3EA7A 2F91A 3W95A 1E37B 1TGBA 3UR9A 2VIVA 1DX5M 2FYQA 2VVCA 2VIPA 1TMTH 2K1QA 4X8TH 1E0FD 3FFGA 3ZZ8A 3C1KA 4FUFA 3CS0A 4FUHA 3RXDA 5A0AE 5FX6A 4K5ZA 4NIVA 1BBRE 1BBRK 4NWKA 2QXHA 3RC6A 1GHVH 1GJBB 1XUFA 5TCAA 1ETSH 3VPKA 2J9NA 1HAVB 2FI3E 1ZMNA 2QC2A 4B1TA 3OY5U 5FPSA 1A0JA 4UEHH 3V3MA 4FU8A 5HGGA 3S9CA 1GBTA 1OWKA 2WPHS 2Z3DA 2J34A 3ODDA 2FOAA 3T62A 4SGAE 1KXDA 3ODFA 1IHTH 1T8OA 1IQMA 3KL6A 2A5IA 1O2KA 4GCHG 1L0ZA 2TGTA 4GAWA 4TPYA 3KCGH 1YCPH 4E7NA 2YOLA 2C90B 1DM4B 2AFQB 2J94A 4CHAB 3QWCH 3D49H 1QL7A 2ZDMA 2ZPQA 2VIDA 2TGAA 1GHBG 1C2KA 1EZQA 3A87A 4ZHAA 4A6LA 2YNBA 1TNKA 2YNAA 2ZFRH 2H5CA 3AW0A 3T25A 2W7SA 5F03A 2RG3A 1RIWC 1XXDA 1YCPM 5DP7A 1GJ6A 3SNDA 3SUDA 3A8CA 3W94A 3S9AA 1E34B 1EX3A 3E1XB 3SHAH 1KLJH 1ZHPA 2H6MA 2VB0A 1XVMA 2VIQA 1GBMA 4YLQH 4X2XA 3GY8A 2G55A 3BG4B 3PO1B 1C9TA 2BLQA 1EAWA 2G52A 1QQUA 2AMPA 2FOCA 3GYMA 4ISLA 1TFXA 1ZOMA 1L1JA 1KXEA 2FODA 1SQTA 1SGYE 9LPRA 2FO9A 1GMDG 2ZNKH 1UCYK 1QR3E 1SGRE 2VIOA 1FN8A 1K22H 1THSH 5AVDA 5FXLA 3RMLH 1MD7A 1GL0E 4IC5A 3RU4E 2HWLB 1CVWH 2ZQ1A 3UR6A 4LOYH 1Y59T 1RTLA 5E0HA 5EW2H 1O3KA 1KXBA 3QO6A 4H42U 1P2KA 1PPGE 1BTHH 2AEIH 1YBWA 2FEQH 3UIRA 8KME2 3KQDA 1C1OA 2F3CE 1JWTA 1EZUC 1ZRBA 5DPAA 3SW2B 3MMGA 4NWLA 2A4GA 1BZXE 4K8BA 1OX1A 1UTLM 5F8XA 3A7XA 5B6OA 2RA0A 2O8WA 4H6SB 1YP9A 3ATWA 2CF8H 3QLPH 1CGIE 4CR9A 1LPZB 2BB4A 1T31A 4D9QA 1ZHMA 2W5EA 1FY4A 4KELA 1G3BA 2R0KA 1QBNA 3LH3A 1O0DH 1XXFA 1G9IE 1SPJA 1J9CH 1NESE 4INHA 1G2LA 2GCTC 4O9VA 1E36B 1S81A 1LPKB 1B0EA 1OWJA 1G3CA 1Y3XA 2GKVE 1QL9A 1O2QA 5GIBA 2PSXA 1F5LA 4DW2U 3LGVA 3A82A 1V2NT 1GGDB 1F0SA 3Q76A 3CP7A 1C5TA 2F9BH 1KLTA 4Y8XA 1HUTH 1LDTT 3VB6A 2VVUA 4WMFA 1GI8B 1ZPBA 1TPSA 1O38A 1P03A 2XNIA 1M9UA 1CT4E 1HAOH 2PSYA 1HAYB 2ODYB 3QTOH 4BXWA 1NRRH 1O3AA 4E7RG 1O3NA 1HAHH 2GZ8A 1O2HA 2WV5A 1S5SA 2ODPA 1OSSA 2WUCA 3LGIA 1P2JA 4NIWA 4MG3A 2FYRA 2FOEA 3VB3A 2ZFQH 4ESTE 2ZDLA 1GJ4H 1S82A 4MPXA 1FZZA 1ZYOA 3RXEA 1MTWA 3PWBA 5E0JA 4J2YB 1C1UH 2BD8A 2HLCA 3ENSB 3DFJA 1IQLA 2ZC9H 1J17T 4Y79A 1T8NA 2XBXA 5ABWA 3T2NA 4AX9H 1V2OT 1TX6A 4GVUA 4K2YA 1QA0A 3RMOH 2BXUH 2ZIQH 3EA8A 3EAJA 1A61H 4LK4A 4NIYA 3STJA 1GI4A 2P8OC 1KDQA 1PQ5A 1BTPA 3QZRA 1VITH 1Q31A 3LU9B 3QK1A 2ZECA 2ANKH 2SFAA 4ZXXH 1DSUA 1UTQA 2QV1A 5EGMA 1NN6A 5JBTA 4CRFA 2LPRA 4B2CA 1SGEE 1XVOA 1C5OH 1Q2WA 1WBGB 1TX8A 1TRNA 1V2MT 2NU4E 4HTCH 3PMAB 1EPTA 1TGCA 2H5DA 3LKWA 2WPIS 1B7XB 4XOJA 1TPAE 1ZSKA 3MNXA 1SGDE 1D3DB 3DFLA 2FX4A 1FQ3A 2F9NA 2Y5GA 3I78A 1MKWK 1OYQA 1RD3B 3RUOA 1V2PT 1WAYB 1C5YB 2B0FA 2ULLA 3PTBA 1N6YA 1W11U 4IGDA 1O5EH 4ABDA 2VWLA 3LC5A 1PJPA 1YC0A 4A7IB 2GGVB 3OU0A 1O3EA 1RTKA 1KXFA 3E6PH 3WY8A 4AFSA 1UTMA 1C2IA 1DXPA 1FAXA 3RXQA 2HNTE 5DP6A 3HGNA 4ABJA 1ELAA 2GT7A 1A0HB 3V13A 2WPMS 4YOJA 1LHDH 2Q6DA 1UO6A 3D23A 3SU4A 1O2GH 1XUGA 4Q7XA 5C20A 3PYHA 1AWFH 1SB1H 3GDUA 2HGTH 4KTSA 1BRUP 1SSXA 3BEIB 2OCVB 1G2MA 3PM3A 5A0BA 1A4WH 5FAHA 2WYJA 4IN2A 1YPJH 1GBHA 2UUYA 2BQ7B 4NFFA 1W12U 1O5AB 4I31A 1DFPA 2D26C 1MKXH 2VVVA 1C4Y2 3OSYA 3TJOA 1UTKA 3KIDU 1O34A 4KTCA 2XTTB 2VGCB 2VINA 1GBCA 2J95A 1E35B 1GJAB 2OC0A 2BDAA 1BJVA 1O33A 4NCYA 3A7VA 1O3MA 3TVJB 1QFKH 1C1MA 1P2OA 2A4RA 3P6ZB 1DOJA 5T6GA 3I29A 2BD5A 1DLKB 1EB1H 1WYKA 5DK1A 2BOHB 1AN1E 3PMBB 2Y80A 1NRSH 3TJUA 1O2JA 1EOLA 1FAKH 1GHZA 3A88A 4M7GA 1HNEE 1C5VA 2ZP0H 2CHAC 1TBQH 4CH2B 1Y3VA 2UWOA 1TRMA 3BIVH 1AY6H 1LMWB 2F9UA 1MTNC 1V2UT 5EQRA 4IW4E 1VZQH 3V12A 2VWNA 2VWOA 1IQHA 1F92A 4NA8A 1CE5A 4DG4A 4NFEA 2P3UB 1KIGH 1TE0A 1LTOA 1Z8RA 1UVTH 5L2ZH 1O3CA 1N8OC 1ZPCA 4GCHF 5CHAB 2ZHQH 3K6ZA 1NRPH 3Q77A 5F6MA 3L3TA 2AIPA 7ESTE 1EZXC 3UPEA 3UWIA 1O2RA 1PPEE 2V6NA 2FOBA 1BQYA 1BJUA 2BLVA 1S0QA 4GSOA 2AMQA 5SGAE 1MMJN 1A0LA 3PB1E 3EQ0H 1EJAA 1T8LA 2ZA5A 4AFQA 1W8BH 1QHRB 1ZSLA 2A5KA 3BTME 3KHVA 3GCHB 2OINA 2BQWB 2ZWLH 2PLXA 1FIZA 4JK6A 3E16B 1CT0E 2I6QA 3HKIB 5AFZH 1Y3YA 2PGBB 4Y0YE 1O3JA 1LKAA 4MNWA 3SU3A 2OBQA 1ZHRA 4XBBA 4YLUA 2P94A 1G32B 4BAMB 4ISIH 1TGTA 4OGYA 2BXTH 2B9LA 2SNVA 1NRQH 2GX4A 3GY6A 3K6YA 4H6TA 3AW1A 3MH7A 4YOGA 4Y6DA 1HJ8A 2FI4E 3TGKE 1J15A 4DT7B 1AB9B 2G8TA 2IOTA 2WV4A 2AERH 3RDZA 4BOHA 1O2XA 1TNJA 1MCTA 5A09A 2FZZA 2FLBH 2P93A 3SV7A 1W13U 2A7JA 3T28A 4IMQA 2GDDA 1Z1JA 1XKBC 1C5QA 2BLOA 5DP4A 1GBJA 1LHFH 5TJXA 5IYTA 1ESTA 1IHSH 2ZDVH 1OWIA 2W3IA 4SGBE 2RDLA 1SLVB 2F9VA 1SOTA 3T5FH 2GCHG 2TGDA 4U01A 3SJ9A 1MQ5A 1E38B 4I8LA 3MWIU 1KYNA 1W7GH 4TY7A 4BAHB 4ZKNU 4B75A 3RC5A 1TA6A 3K2UA 1QTFA 5LPFA 1V2RT 3H7OA 3RXPA 2V3OH 1T8MA 4WXIA 4X2YA 1UHBA 3GCTF 2LNCA 2FI5E 3M5MA 1ELTA 4BTUB 1ESAA 3ATLA 3SUEA 1C2JA 3SNAA 3SQEE 1O3PB 3A8BA 1BHXB 3M37A 2EC9H 4JK5A 1TOMH 2H9EH 2ZFSA 6LPRA 3LIWA 2BLWA 3RXVA 5DJ7A 1Z8JB 2TPIZ 3OX7U 1ORFA 2IPHA 1P0SH 4AZ2B 2BD4A 1V2ST 3BTKE 2AS9A 1P2IA 3BG4C 2SGQE 3VB7A 2R3YA 1P01A 1UVUH 4WJG2 2XWAA 2SGAA 1DY8A 3HK6B 2BX3A 3R3GB 2OD3B 1PYTC 4MPWA 5C1UA 2XBWA 4TYDA 3QX5H 1MTVA 2ZTZA 3HGPA 1ELVA 1SFIA 4A92A 1ZTJA 2ZHFH 2P16A 2F83A 1FLEE 4K69A 1W10U 2BY7X 1FIWA 1SGIB 6CHAC 1EATA 1BHXF 3SHCH 3SORA 4B73A 4AB8A 4BNRA 3F9HA 3ELAH 3SGQE 4I8HA 1DXWA 3UFAA 4FUIA 3M35A 1BDAA 1P09A 1XX9A 4INLA 2ZU1A 3LGYA 1AIXH 2OP9A 1AZ8A 5A8YA 4YTAA 3M5OA 3RXFA 5L30H 2BY5X 2FS9A 1OWEA 1WTGH 4UE7H 3M5NA 3MO6A 1RFNA 5JDUB 1JRSA 2EI7A 1A1RA 2O8TA 3NPSA 1H8IH 3PTNA 6GCHG 2KAIB 4K3JA 1ZPZA 1CA8B 3RXTA 1O2PA 3PV4A 2QXJA 1AVXA 5FBIA 3Q3YA 2P95A 1UK2A 3D62A 3RMNH 1C2DA 4YT7H 2FP7B 2FWWA 1S6HA 3ZZDA 1QBVH 1GGDC 1L2EA 3V0XA 1SHHB 2ZTXA 3M36A 1NM6A 3KF2A 1BRBE 3PLBA 1K9OE 1YPMH 5EQQA 2XCNA 1DUEA 1GHXH 1GDUA 4D9RA 5A8ZA 1A5IA 3A83A 1OP8A 5FCKA 1JBUH 1LVMA 2Q6FA 4RKJB 2OC7A 4B74A 4MNYA 2O8MA 4WVPE 2ZKSA 1YYY1 1D3PB 1NS3A 3P95A 1HIAB 1B0FA 1YPGH 1HAGE 3UOUA 2JETB 1VGCB 1EAUA 1A5HA 4X2WA 5E8EH 3K65B 2G4UA 1AFEH 4D8NA 5C67A 1CGJE 2SGPE 1H8DH 2GDEH 1D4PB 3EGKH 1C2LA 3HK3B 3TNSA 4NA9H 1UTNA 1AVWA 4FUCA 4B2AA 1RTFB 1DWBH 3F6UH 3E3TA 3SU0A 4IS5A 2DUCA 2PKSB 1P2NA 2WINI 1BTYA 1LVOA 2G00A 4AGKA 8GCHF 3TH3H 1ANBA 3A81A 1K1LA 3FP7E 3BTDE 2PW8H 4FVDA 4KGAA 1ELGA 3IWMA 1EZSC 3KQCA 4YESB 1CHOG 1IQFA 2A1DB 2G5VA 4FUJA 1Y3UA 1K1OA 1NZQH 4ZXYH 1EQ9A 1G37A 5C2ZA 7GCHG 1VCQA 5DP8A 1MZDA 2OC1A 3VB5A 3SQHE 1UCYE 1ZJDA 3ZV8A 1KTSB 3DUXH 3MI4A 2ZDAH 4UFGH 4IMZA 1WSSH 2AMDA 4X1NU 1O35A 1FMGA 3HKJB 1W7XH 1YKTA 1BA8B 1EP6A 2C93B 3MYWA 1NC6A 1MZAA 1NTPA 5HMAA 1PQ8A 1TNGA 8ESTE 1NO9H 1QB1A 2Y7XA 1DSTA 1UK3A 4B76A 1GMCF 2FTLE 4OS1A 1NFWA 1DWDH 1EAXA 5GDSH 5HXFA 1HBTH 1SLXB 2XBYA 1JRTA 3BTQE 2FTMA 1ZTLA 4X8SH 3SN8A 1MD8A 1AD8H 4FXGH 1GBFA 4AFUA 1HXEH 3SJKA 1UTOA 3VGCB 1BIOA 3RLWH 5FCRA 1O39A 2A0QB 1VITF 1CBWB 3MU0A 3TJNA 3VFEA 5C5OA 6ESTA 1G3EA 4TY6A 2ZPSA 1SFQB 2BVRH 4DIHH 1C1VH 1O5CB 2VJ1A 4CH8B 3RXGA 2FX6A 3ATMA 3A85A 3KEEA 4MNXA 2XRCA 4ZMAH 3SI4H 3LPRA 1AQ7A 1JIRA 2STAE 1L1GA 1CGHA 1GBAA 2R9PA 1HAXB 1AUJA 1F2SE 1GBBA 1QJ1B 2EA3A 3MU1A 1GG6C 4CRCA 1O3BA 4U30A 2Y81A 1C5SA 1AKSB 3TGIE 1ELEE 2VGCC 2V35A 4FUDA 1P05A 1T7CA 1O2NA 3KGPA 1HLTH 1TA2A 3TITA 4UD9H 1DUAA 3OTJE 4X6OA 1K1JA 4Y11E 2Z9JA 1ELFA 2PKAB 1N1LA 1FNIA 1UTJA 4XBDA 1IQKA 1O2SA 4HI3A 1P12E 3M7UA 1CSOE 3E0PB 2B8OH 4GUXA 3FANA 4GPGA 1HAIH 4NZLA 5EU8A 1MUEB 2Z6BD 1D3QB 3QTVH 4NSYA 1C1RA 3IG6B 3C27B 3MH4A 3QDZB 3U1IB 1IQNA 2VIWA 1IQIA 1OPHB 4YZUA 3SJOA 2HPQH 1F5RA 1V2JT 1O5BB 1G30B 4A5TS 2GMTC 3BIUH 1EAIA 4X1SU 2BD7A 2BY9X 1AFQB 4ISOA 1BOQA 1TONA 4X6MA 4ZROA 4AOQA 2UWLA 4OS4A 4CRDA 2BQ6B 5CHAC 4RSPA 1RXPA 3TJVA 5JBAS 1AGJA 3A80A 1D9IA 3BEUA 3UQOA 3FP8E 3Q3XA 1QA7A 1TOCB 3GOVB 4MLFB 2GCHF 1C1WH 4AG2A 1O3OA 1BMLA 4JZ1A 4YM9A 3SV9A 1RIWB 1O5GH 1V2TT 2GV7A 3TIUA