2ZPRA

Crystal structure of anionic trypsin isoform 2 from chum salmon
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
221
structure length
221
Chain Sequence
IVGGYECKAYSQPHQVSLNSGYHFCGGSLVNENWVVSAAHCYKSRVAVRLGEHNIKVTEGSEQFISSSRVIRHPNYSSYNIDNDIMLIKLSKPATLNTYVQPVALPSSCAPAGTMCTVSGWGNTMSSTADGDKLQCLNIPILSYSDCNNSYPGMITNAMFCAGYLEGGKDSCQGDSGGPVVCNGELQGVVSWGYGCAEPGNPGVYAKVCIFNDWLTSTMAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anionic trypsin
publication title A structural comparison of three isoforms of anionic trypsin from chum salmon (Oncorhynchus keta).
pubmed doi rcsb
molecule tags Hydrolase
total genus 53
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zprA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zprA02
1AY6H 3GYLB 1O33A 1AQ7A 1QRWA 2ZDLA 1TFXA 3TVJB 2P3TB 2PUQH 1O5FH 3SQEE 1UMAH 2RA0A 3ODFA 1C5XB 3VXFH 1EPTB 1XUGA 2A1DB 2VGCC 2Q6DA 1GPZA 1UK2A 4XBDA 1T8MA 4NZLA 4DOQA 2W26A 3SJ9A 5IYTA 1SOZA 2Z7FE 1QQ4A 2QA9E 3MNXA 1C2HA 2FLBH 1MZDA 2D1JA 1GI0A 4O9VA 1EB2A 4YO9A 5A09A 3PLBA 2BXUH 1WQVH 4Q2KA 1TA2A 1A4WH 3DFJA 2ZFRH 2BVSH 1S6FA 2UUYA 1MZAA 1GVZA 4WXIA 4JZ1A 4DGJA 1SPJA 2J2UA 3A83A 1XUJA 3UNSA 3RM2H 1HAXB 1S81A 4MVNA 1GHBF 1ABIH 1W0YH 3EE0B 3FP7E 3LOXA 3LGVA 7GCHF 1QY6A 3ZVGA 2JETC 5LH8A 1QB6A 2FWWA 5EW2H 2BQ6B 1MCTA 1BMMH 1SGQE 1YBWA 3GICB 1EKBB 1Z1IA 3UQOA 5C1XA 1CA0C 1GI7B 1W14U 2OP9A 2NU0E 2GV6A 1GHXH 5A0BA 2OQ5A 2O8WA 1SGDE 2QXIA 3NPSA 3S9BA 1ZZZA 1L0ZA 2B0FA 2D2DA 4NIWA 3MYWA 2ZFFH 1EJNA 2W3IA 2Y5GA 1QL8A 4GHQA 4CBOA 1W11U 1T32A 3DT0H 3GDSA 4H6TA 1DFPA 1FXYA 5G4BA 4KTUA 7LPRA 5HM2A 1GJDB 3RU4D 1JRTA 3DFLA 2UUFB 3M5MA 1K1MA 2XYAA 1UVTH 3RLYH 2EI6A 1DSTA 2CGAA 4J1YA 3PLKA 2XBYA 2Y80A 3A86A 3V7TA 2FPZA 4ABGA 5LPRA 2FMJA 1B5GH 2PKSC 3AAUA 5DP4A 2UUKB 5FBEA 4CRBA 2F9BH 2BXTH 4ISIH 1GVKB 4NCYA 1CHGA 4MPVA 1BA8B 1C5TA 2P16A 1EJMA 1JOUB 1O3MA 2FOGA 5L2YH 1ZMLA 1TMUH 1DY8A 3VB7A 4LK4A 4YT7H 1O2VA 1PPZA 1L4ZA 2BD3A 2H6MA 3M3VA 2SGPE 3S69A 1AZZA 3DA9B 4JYUH 2F3CE 3ZZ4A 3FZDA 1GMHF 1O34A 1P2KA 3ZVDA 1ABJH 3SUEA 1W13U 2FOHA 5GCHG 2ZU1A 3NXPA 1S0RA 1P57B 1H9LB 2ZNKH 1EAXA 1HAYB 1DICA 1MAYA 4U01A 1FJSA 3M61U 3CS0A 4WVPE 3B23B 1WSSH 1YKTA 4LZ4B 1WYKA 3EDXB 3GCOA 2IJOB 2F9NA 1ANCA 2YNBA 3A7YA 3CENA 1O3CA 1GL0E 1PPCE 2NU1E 1HAGE 8GCHF 2Z9IA 2Y82A 5J4QA 3RXPA 1LHGH 1V2PT 4NG9H 1LHDH 1G36A 3GY2A 1YPKH 8ESTE 1BBRH 4AFUA 1SG8B 3PTNA 1A3BH 1LMWB 1U6QA 3RXMA 1G32B 5E0GA 3JZ1B 1GJ5H 1C5ZB 5J4SA 1YP9A 4H4FA 1SGPE 1P0SH 2FYRA 1L1JA 3K6ZA 3ODDA 1Y3UA 2AGIX 3VB4A 1DT2A 3GCHB 2VWMA 2F83A 1RFNA 3MO9A 3SJ8A 2FX6A 2GV7A 1FPCH 3SI4H 1AE5A 1O2JA 2R0LA 1EAWA 1GHVH 2FXRA 4ZKRU 4AB9A 3E6PH 2P59A 1BB0B 1A0JA 2AFQB 1UO6A 5L2ZH 2GZ8A 3B9FH 3T29A 1QFKH 3P92A 1TX8A 3GY7A 2OC7A 2PR3A 1SGIB 1D3QB 3KQEA 3TH4H 1WV7H 4CRGA 1QBNA 1V2JT 1TGCA 2ZO3H 3KEEA 4UFGH 1AMHA 1O38A 3IWMA 3LJOA 2QN5T 1MBMA 1C5OH 1GCDA 2BM2A 2IPHA 1BTHH 1FN6A 1P02A 1C2LA 1FUJA 3TJNA 2BD8A 1SGRE 2SGAA 1BTWA 3A8CA 1GBEA 2FM2A 3M5NA 2WPKS 2V6NA 3STIA 3Q76A 2IOTA 1K22H 3S9AA 4X1NU 1A46H 4AX9H 3HGPA 1GHAG 1C2IA 4NWLA 2HALA 3QZRA 1G3CA 3SNEA 1GBAA 3RXHA 3E16B 1OP0A 1B0EA 4DIHH 2C8WB 4LXBH 3TNSA 1F0SA 3TGIE 4Y7BA 1OXGA 1EZUC 4X8SH 2QXJA 4AGJA 1LPGB 4ZXXH 3S0NA 3LDXH 3UNQA 4ZHLU 3OX7U 1C5RA 3V0XA 5EXNA 2GZ9A 1LHFH 1A61H 2WV4A 1K1NA 2ZEBA 4GCHF 1P2MA 3E1XB 4R8TB 2QGRA 2CXVA 4CBNA 4Z6AH 1A5IA 1VITG 4BTIB 2FO9A 4WF8A 2Y6TA 3SU2A 3MU1A 1CGHA 1BQYA 1DOJA 1O3LA 1V2KT 5EG4A 1P04A 1DXWA 1TPPA 2WYJA 1A0LA 2H5CA 2FI4E 4XE4A 5I25A 2RA3A 4I7YH 1UTKA 2FOFA 1O3DA 1VCWA 1P3CA 1SSXA 2A0QB 3U9AH 5EQQA 2ANKH 2C90B 4D7GA 5ETXA 1GVLA 4QT8C 3H7OA 2WPMS 1OWEA 2FS8A 1C5UA 2QV1A 3C27B 2NU4E 3RXGA 4UD9H 1QRZA 1BMLA 3BTWE 1S85A 2IN2A 1A1RA 3LT3A 2P3UB 1ELDE 1UTOA 2STBE 5EODA 3GCTF 3TPIZ 3BV9B 1BUIA 1C2FA 1P9SA 4X6NA 3TGKE 3RXFA 2BY7X 3SUGA 1C5YB 1LHCH 5C3NA 1MH0A 5AHGH 1PYTD 4BAMB 1O3EA 2A4RA 1ELEE 2GTBA 2J9NA 4D9QA 2B5TB 1KYNA 5DP5A 3PROA 1GMDF 4FUDA 1G2LA 1Z1JA 4GSOA 3EYDA 4D8NA 1G3DA 1LTOA 1E36B 3TH2H 4O03A 2FYQA 1O3PB 4JZIA 4AFQA 2J94A 3OTJE 1XUFA 1BJVA 1SGFA 1C1SA 4RSPA 1GDUA 2K1QA 1HJ8A 2I6SA 2ZHEH 2GT8A 4SGBE 1Q3XA 1NO9H 1D3PB 3EA7A 1SMFE 3PO1B 3RU4E 1H9IE 1PJPA 2XWBI 3ITIA 3QK1A 3FP8E 3ZZ6A 2PW8H 2FOAA 5EQSA 1C5LH 4ZHMU 3TNTA 5C20A 3BTDE 3E91A 1HJ9A 4Y8YA 1PYTC 2VJ1A 4WMDA 4IBLH 1GHBG 3QTOH 4F49A 1NT1A 1V2UT 3RXQA 1BT7A 2Z3DA 1SI5H 2O8UA 1HAZB 2ZTXA 2BDYA 3LGTA 3SQHE 2VIQA 3ENSB 1HLTH 2PSXA 4NIXA 4X8TH 1HDTH 1TRNA 3ZZ3A 1BCUH 2AGEX 2C93B 1GHWH 1VR1H 1KLTA 4JZEH 4KKDA 4I8HA 3A80A 3LPRA 1V2MT 2XRCA 1PQAA 2ZU3A 4YZUA 1JRSA 3P8FA 1YC0A 1QGFA 4JYVH 1ELTA 4UEHH 4ESTE 4FVDA 8LPRA 4FXGH 1A5GH 4BAHB 2JH0D 4WWYA 1UHBA 2F91A 4DCDA 3ZV9A 4F4OC 2H1UA 1EAIA 1ELBA 1ELFA 2HPQH 2BY8X 3HKJB 5DPAA 1UCYE 4U2WA 1C5VA 2VU8E 5BPEA 1TOMH 2TRMA 1HXEH 1VGCB 2R9PA 1DUAA 4ABJA 4CREA 2PLXA 1DITH 1SFIA 3VGCC 2HPPH 2BZ6H 2FTMA 1IQGA 5FPSA 4Q80A 2OXSA 1DDJA 3SU4A 4JZDH 5FPYA 3SW2B 4PROA 3TU7H 1MBQA 1O2UA 5JBTA 1DANH 1TABE 4IS5A 2GGVB 1ZMNA 2CF8H 3RXAA 3ZZ8A 1O5AB 4I32A 1P05A 1TLDA 3A89A 2FP7B 1YPJH 1XKBC 3CP7A 3VB6A 3U69H 1NRNH 3M7UA 2ZI2H 3SUFA 2GKVE 3ZZ5A 3PMAB 1J9CH 2FI3E 4X1PU 2XTTB 2ZC9H 1P10A 4AYYB 4CRFA 5AFZH 1HAIH 1T8NA 1GDQA 1TGTA 1AZ8A 1ZMJA 3GY6A 3SV8A 1Y3WA 4ISNA 3M36A 3BSQA 1O2OA 1PPEE 3RXCA 2XWAA 3O8BA 1Y3VA 2VIWA 3TH3H 4OS6A 4I31A 1CBWC 2ZQ2A 3BEFB 4MNVA 2ESTE 1O2IA 2AYWA 1WQSA 1TBQH 1THSH 1TX6A 4B2AA 3UTUH 5GPIB 3ATLA 4ZXYH 2DE9A 1NESE 1JXPA 1WOFA 3VFEA 3ZV8A 1SGYE 1TGSZ 4TPIZ 1K2I1 1A0HB 4NZQA 4XFQA 2G4UA 1O3BA 1W2KH 2BY9X 3UUZA 3QLPH 1IQNA 1GMCF 2HNTE 4Y71A 1V2RT 4AFZA 3SBKA 3VEQB 4B75A 3RC5A 1C4V2 2AMQA 1J8AA 1C2MA 4K1TA 5HM9A 1CE5A 4CHAB 5JBAS 3SV6A 2P8OC 3MH4A 3C1KA 1Y5BT 4ABAA 1GJAB 1XVOA 4CH2B 1HPGA 1SHHB 4I33A 2XC5A 1Y8TA 1RTFB 4ZH8A 6GCHF 4ZAEA 3EGKH 1ARBA 2A5AA 4XBCA 2BOHB 1O2PA 1VJAU 1EASA 5DP6A 1CQQA 3O8CA 3D49H 1GGDC 4X0WU 4JZFH 5FPTA 3SGQE 2AERH 2UWLA 1V2NT 6LPRA 1ANEA 4K8BA 2FTLE 3BN9A 3P17H 3KGPA 4FUHA 3U8RH 1SGCA 1A3EH 3RXEA 1GBHA 3L33A 1BMAA 1G37A 1HB0B 1IQLA 1TRYA 1O35A 1Z8JB 1C5QA 2ZDVH 4AGKA 1ESBA 3PB1E 4UFEH 1MD8A 3I29A 2XBWA 4DVAU 2SGFE 1F7ZA 3E8LA 1ESTA 2AH4X 4FUJA 1RJXB 1L2EA 1FN8A 1HGTH 3F9EA 4TY7A 1PPHE 1Q2WA 1OWIA 4I8GA 4GCHG 3S7HB 1AGJA 1CT4E 1TONA 3RMLH 1FPHH 1DSUA 3MU5A 4A1VA 4Y0ZE 1AI8H 2TGDA 1AKSA 3A88A 3LC3A 1O3GA 1O2SA 3RMMH 1IQMA 3ATMA 3RXDA 3ELAH 4NA7A 4AG1A 2SGEE 2C8XB 3RXSA 1OP8A 1MTSA 2ZHDA 5TCAA 1TMBH 2G52A 1NZQH 3BTEE 1UVUH 1NFXA 4I8KA 3M3TA 3LKWA 1D9IA 4Y10E 1EP5A 2ZGJA 3SGBE 1DWDH 4O3TA 1Z8GA 1Z7KA 4KTSA 3U8OH 4JK6A 1ZRKA 3GYMA 2ZDNA 4ZMAH 3GY8A 1MTNB 4IC6A 2ZPQA 1YLDA 2ZDMA 1ZSKA 1P09A 2PKAA 4A92A 2ZU5A 1D6RA 2ZQ1A 3MU0A 5F8XA 3MWIU 5HGGA 1AUTC 1LVYA 1NTPA 4FUGA 1AB9B 1Y59T 3GCTG 2Y5HA 1YPMH 4MNYA 3Q3KA 2BVRH 5A0CA 2QXGA 3QO6A 4K8YA 4GAWA 1O5DH 2WUCA 1C1TA 4H42U 1XUHA 3BTKE 2ZF0H 1O37A 1ZPCA 2SGDE 1O5BB 2G5VA 2BDIA 4X2WA 1Q31A 3JZ2B 2SFAA 1ETSH 1GG6C 2AEIH 1KTTB 4BANB 4Y8XA 1GMDG 1HXFH 4B71A 1LVBA 1HJAC 1NPMA 1YCPM 3PMHB 1FAKH 3UIRA 1KSNA 1LQEA 3MNCA 1DM4B 3ZYDA 1SC8U 1EOJA 1NY22 3P6ZB 5EPNA 1BMNH 4ZKOU 2OC8A 2VB0A 3RXKA 1SLWB 5H4IB 1BTXA 2PGBB 1SLXB 4YESB 3NWUA 1O2GH 3BG8A 1S0QA 5T3HA 4Y11E 3SU0A 3BTGE 2H9HA 4H6SB 4X2VA 1K1OA 1HYLA 1YPHC 1SGNE 1TPOA 1UTJA 1MKWK 4FU9A 1ZTKA 1VCPA 1ORFA 3P95A 1ZPBA 5FX6A 5CMXH 1J15A 5EGMA 5E2OA 1FY3A 2B8OH 1KXEA 1S5SA 4ABFA 4K60A 4INHA 2GDEH 3KN2A 1VJ9U 1OWKA 2XCFA 5CHAB 4E05H 1AFEH 2CHAC 3MO6A 4FUBA 4WMEA 1QJ1B 1PPFE 3RMNH 1EUFA 1LPKB 3P70B 3Q77A 2FX4A 5DP8A 2BDBA 1ELAA 3SV7A 5C1YA 1Y5AT 1RIWC 2P3FH 1P03A 1JIMA 3FANA 1OKXA 1VGCC 2HWLB 1UJ1A 1W7XH 3RU4T 1JBUH 2PFEA 3HK6B 4UFFH 1LVMA 3HKIB 1UTMA 4YLUA 2Z6BD 1MKXK 2RDLA 2VH0A 2Z3EA 4U30A 1GBDA 1TNIA 1F92A 3VXEH 2DE8A 1HIAA 5C5OA 3ATWA 4IC5A 2ANWA 5C5NA 1KIGH 2ZECA 3NZIA 3M3SA 1GJ8B 1ZR0A 1F5LA 4GVUA 4MNWA 2G8TA 5LPEA 3MI4A 3MNSA 5AVDA 2NU3E 3RXUA 4BAOB 1GI4A 1BJUA 1OWJA 2D8WA 4GHTA 3T2NA 2RCEA 2BB4A 2QY0B 2BLQA 2HLCA 1GJCB 2TGPZ 2XBXA 2BQWB 2OINA 1C9PA 1DWBH 2R0KA 4YLQH 1P2OA 1C2KA 4FUFA 4DG4A 3LC5A 3HPTB 2GMTC 1XVMA 2A4GA 3U98H 3Q00A 4NIVA 1EZQA 1TAWA 4ISLA 1EAUA 1IQFA 3RXRA 1LDTT 3BG4B 1O2KA 1A5HA 3UOUA 2BDGA 2TBSA 3F9GA 5B6OA 3EA8A 2BYAX 4VGCC 3PMJA 1V2LT 1YM0A 4B73A 1ELVA 1GWAA 2J34A 4OS5A 3I77A 1QBVH 3SUDA 1WU1A 3UR9A 1BZXE 1MUEB 4E7NA 4TYDA 1UK3A 2XBVA 3MMGA 2B7DH 2H9EH 1S6HA 2J4IA 3NK8A 1CGIE 1C9TA 1N8OB 2CF9H 2ILNA 2BX3A 3SNDA 2VWLA 3UQVA 3UREA 6CHAB 5GXPA 1OX1A 4CR5A 1ETRH 3PV4A 1GHYH 3RMOH 1TWXB 4LZ1H 1V2OT 3VPKA 1G2MA 1VITH 2OBQA 3ZZ9A 3LGYA 2ZTZA 1AWHB 1UTLM 2QC2A 1V3XA 2W3KA 3O8RA 1ZTLA 1T8LA 2VH6A 1ELCA 1LKAA 4YOJA 1GCTC 3R0FA 7ESTE 1XXFA 3ZZ7A 1C1WH 4IN2A 3VB3A 3SN8A 3SU5A 2JH6D 1CSOE 1KXDA 4ASHA 3ATKA 2VGCB 1UHBB 4YOGA 1VCQA 3H5CB 2CV3A 2NU2E 1CGJE 2YNAA 1AE8H 1O2TA 4JMYA 1RGQA 4A5TS 4XDEA 5ESBA 3SJOA 1OPHB 1EPTC 2G4TA 1TNJA 3RXTA 4INLA 2HNTC 1O36A 5GWZA 4UONA 1UVOA 1SGEE 1C4U2 1O3JA 1O5GH 4YOIA 1T31A 4ABHA 1GBJA 5A0AE 1GJ7B 1ZTJA 4NWKA 4OS1A 1DWEH 1D4PB 1O3OA 1EQ9A 1THRH 4NA9H 3BTFE 5FBIA 5DO4H 2BQ7B 2Y81A 5HYOA 3M5LA 3SO3A 6GCHG 1GBTA 2C4FH 1LPZB 1V2WT 2EI7A 4BAQB 1GBFA 3GOVB 1FY1A 4WJG2 1Y3XA 1FAXA 1GDNA 2A31A 2JETB 3SGAE 2KAIA 3T26A 3F1SB 4MTBA 3A82A 1O3NA 4Y0YE 1FIWA 1K1LA 1DPOA 2HOBA 1CA0B 2TGTA 4TWWA 3MHWU 1P01A 3P8GA 3RXLA 3A8DA 1O2YA 2G51A 2ZG0H 5SGAE 1SLVB 2V3OH 2ASUB 3T28A 3SU6A 1TX7A 2ZHQH 2LPRA 3SZNA 4IMQA 1S82A 3FZZA 1E35B 1WAYB 5GIBA 2FDAA 1YPHE 2AIPA 3A7TA 4OGYA 4BAKB 4FUCA 3LU9B 1MTNC 2RG3A 2JH5D 1EZXC 4KTCA 4JYTA 3QN7A 2F9OA 1PPGE 1IQJA 2FOCA 1BTYA 1C1PA 7GCHG 2GCHF 4A7IB 4IMZA 1Z6JH 1ZPZA 2PKSB 3FP6E 1OWHA 3GY3A 1AB9C 1CT0E 2SGQE 2W5EA 1LVOA 1O2NA 2BOKA 1AIXH 1V2QT 4CH8B 3GDUA 1O2XA 3BIUH 1P12E 3BTQE 2P95A 3A87A 4Y76A 2VVVA 2A32A 1K1IA 2BD4A 2GD4B 1DE7H 1G9IE 3AW1A 2Z9JA 1CO7E 5I46H 3LH1A 4ZKSU 3S7KB 1NU7B 3ZZDA 1KLJH 3OY6U 1YGCH 4TWYA 5JBBS 2PTCE 3TIUA 1V2ST 1O3AA 1ZHRA 1LKBA 2Y7XA 2ZU2A 2Z3CA 3A84A 3EAJA 3LGWA 1WBGB 1QA7A 3FAOA 1SR5C 3PM3A 4Y6DA 2VIOA 2BD2A 1BOQA 2BLVA 2PHBA 4Q7ZA 4FVBA 3LONA 4ZKNU 1C1VH 1O2WA 1SQAA 4WMFA 1QQUA 4B2BA 2V35A 1NM6A 3A7XA 3NUMA 1O32A 5T6FA 1QL9A 1P11E 3A7WA 5LPFA 3UY9A 1SFQB 4MG3A 3ZVBA 1T4VH 2ODYB 1GJ9B 2VIVA 3MO3A 2OBOA 2GT7A 1UCYK 2ZZUH 5E2PA 5C1UA 2BX4A 3ZZBA 1J16A 1OWDA 1QB9A 1GBKA 4FU8A 1N6YA 1QNJA 2XXLA 2ALVA 3HK3B 5DP3A 1UVPA 1GHZA 2FI5E 2BDCA 1G3EA 1HUTH 2ZDAH 1ZLRA 1QCPA 1GMHG 1LQDB 2SNWA 1AKSB 5FCKA 3RXOA 1MKXH 3AASA 2ZGBH 4I8JA 1ETTH 5ABWA 3ATIA 1K1JA 5ESTE 1ZSLA 3GCHC 2P94A 1WUNH 1HV7A 2C8ZB 4NSYA 3BF6H 2O8TA 2CMYA 1HAPH 1TGNA 1GHAF 3V3MA 5TCCA 4INKA 1DXPA 5DP7A 1HCGA 2FS9A 8GCHG 3BTHE 1Y5UT 1LO6A 3BIVH 5FCRA 3SORA 1GBBA 2PKAB 2A5KA 1VZQH 1OSSA 2ULLA 4ABBA 3GCNA 4ABDA 3AAVA 3U1JB 5A8YA 3A81A 4OS4A 1P9UA 1QURH 2QAAA 2Z9GA 2OD3B 1VITF 3ZZAA 1QTFA 1O2ZA 1ZHPA 3E0PB 5L6NH 3TGJE 1NU9A 3A85A 1UK4A 4WH6A 2AMDA 4XOJA 3D65E 5C67A 1SGTA 2QXHA 2WPIS 1XUIA 1TBZH 3QGNB 5IDKA 2VVCA 1AFQB 2BDHA 4DW2U 4HTCH 2ZFQH 1G30B 1C1MA 1D6WA 2H9TH 1HBTH 2HVXA 4AB8A 1JMOH 9ESTA 2Q6FA 3A8BA 1ID5H 5CE1A 1M9UA 1TNLA 3LGUA 2EI8A 1AWFH 2VNTA 3V12A 1C1NA 4KGAA 3KQDA 1C5WB 4Y7AA 3RM0H 3KHVA 1MTWA 4U32A 3KF2A 1MU6B 2ZKSA 1ZGIA 2GVFA 4B1TA 4NIYA 1NRPH 1Z71A 3R3GB 1T8OA 2QIQA 4I8LA 3A7ZA 1N8OC 1W7GH 1BRCE 1TNGA 6CHAC 3F68H 2R3YA 2J95A 4TPYA 1D3TB 1H9HE 4ZHAA 1K1PA 2BLWA 3AVZA 1O3KA 2ANYA 1YCPK 2GX4A 4E06H 2AMPA 1P2JA 2GCTB 1TPSA 2C3SA 3P8OA 2ZDKA 2ALPA 4Q7YA 2F9PA 3UOPA 5AF9H 2V3HH 3QWCH 1KXAA 1C4Y2 2PV9B 1ZYOA 4YT6H 5JB8S 4K1EA 3K9XB 3ZVAA 3TK9A 1RS0A 1C2GA 1N6XA 2EA3A 4X2YA 1P06A 2ZHFH 1CU1A 3DD2H 3F6UH 1GI1A 4KELA 3IITA 5GDSH 3P8NA 4D7FA 2VIPA 4K3JA 4MPUA 2ZGCA 2QF3A 1EZSC 2OC1A 3SNBA 1O5EH 1ELGA 2R3UA 5FAHA 1C5PA 5DJ7A 2ANMH 1DLKB 2R2MB 3UPEA 3K2UA 3SU1A 4D9RA 3F9FA 4D76A 1C1OA 3HGNA 1ZGVA 5GJ4B 1FZZA 1HIAB 2EC9H 1TE0A 3RLWH 1T7CA 4AZ2B 1J14A 5DG6A 4MDSA 4Y79A 2YOLA 1O5CB 1TIOA 2WUBA 3BTTE 4X1RU 5LGOA 3L3TA 3QDZB 4DT7B 1BHXF 1GBIA 1UTNA 5EOKA 3S9CA 5A8ZA 1XM1A 1PQ7A 3MU4A 3PLPA 2A4OA 1BRUP 2TGAA 2W7SA 3E3TA 1HNEE 2BY5X 1ARCA 1H8DH 1UTPA 1J17T 1H8IH 2ZCKP 3DUXH 3PO1C 2OLGA 4DIIH 1CHOF 3O8DA 2CJIA 3K6YA 1IHTH 1W12U 5E8EH 1JWTA 4XSKU 4K2YA 4O3UA 3L6PA 4ISOA 2AIQA 3GISB 5A8XA 1QJ6B 4X2XA 2O8MA 3EA9A 3MNBA 1TNHA 2GP9B 1NRSH 1F0RA 3HATH 1FLEE 1GL1A 1PFXC 2FZZA 2ZGXH 3BEIB 2ODPA 2Z9LA 1KDQA 4CR9A 2C8YB 3EQ0H 1F5KU 5HXFA 1KY9A 1KXBA 1TOCB 2PTNA 1QBOA 4X1QU 1GBMA 3G01A 1CA8B 1XUKA 1FNIA 2TPIZ 1E38B 4NFEA 2DUCA 4FUEA 1P2NA 1W3CA 4R0IA 5T6DA 1ZOMA 2GDDA 2ZWLH 1C5SA 1C5MD 3M7TA 1RRKA 2O8LA 2PUXB 6ESTA 2A7CA 3NKKA 1BHXB 1Z6EA 1IQHA 2GCHG 3QUMP 1C5NH 1C1UH 1C1RA 2BVXH 5PTPA 1EPTA 3GDVA 1IQKA 2QYIA 3Q3YA 3QTVH 4A1XA 1EXFA 1UVSH 4RN6A 4BNRA 1UCYH 2J38A 3FVFB 2FLRH 5EXLA 3UR6A 2O9QA 3VGCB 1YYY1 1F2SE 2ZIQH 3MH6A 1RTKA 3D23A 2ZGHA 2G55A 1FI8A 5EXMA 4MNXA 3V13A 2OC0A 4NFFA 2FODA 1TPAE 2VVUA 3LH3A 4BTTB 2CN0H 1EATA 1N1LA 3SNAA 5EW1H 1H4WA 2FOBA 1NROH 4UDWH 3TJVA 3ZVFA 4K1SA 5AFYH 1D3DB 3PTBA 5F03A 1SVPA 1E34B 4IN1A 4AYVB 1OOKB 1QRXA 1BTZA 2B9LA 4OS2A 2KAIB 1O30A 1EX3A 4B74A 5JPMH 3M35A 1PQ5A 1W10U 3W95A 3Q3XA 3QZQA 1ACBE 1KLIH 1MAXA 2BD7A 4K69A 2FEQH 2ZA5A 1AVXA 1NFYA 1XKAC 2WV5A 1W8BH 1O2HA 1CBWB 1SHYA 1BTPA 1O39A 1YPGH 3RDZA 3SJIA 4OS7A 1ZRBA 2FESH 4FUIA 4B76A 2PSYA 1O2LA 4AFSA 2D26C 1L4DA 3KQCA 1QA0A 2J92A 4WH8A 1TRMA 3OYPA 3PMBB 3ZVCA 2G5NA 1F0TA 1GBCA 4WY3A 1TBRH 1O2QA 4CRAA 1Y3YA 2OQUA 1RXPA 2H5DA 2G00A 3OY5U 4NSVA 1GI9B 1GJ6A 1S84A 2Z94A 1MTUA 1SQOA 4MQAA 1CVWH 2FIRH 4WXVA 4X8UH 1SQTA 1WTGH 1NC6A 4K5ZA 3K65B 2WPJS 2P8OB 1AFQC 3E90B 1IHSH 1KTSB 4O97A 4CRCA 1NRRH 1QHRB 1FY8E 3KCGH 3W94A 1AD8H 1TNKA 4CHAC 5E0JA 2H2ZA 5F8ZA 1P3EA 1YLCA 1L1NA 3LJJA 2ZTYA 1WTHD 1SLUB 1HFDA 1BTUA 1YCPH 3MH7A 5EU8A 7KMEH 3SOSA 2XCNA 1GGDB 1F5RA 2NWNA 3BTME 2ZCHP 1EP6A 4X1SU 1XXDA 4MPWA 4UFDH 1EJAA 5T6GA 2BD5A 3KL6A 2XNIA 2BMGB 1K21H 1C1QA 3MH5A 3TLOA 1O3FA 3TK6A 1WCZA 5JBCS 1MQ6A 4TY6A 1IOEA 1AVGH 1BIOA 3RC6A 1GMCG 2BLOA 3H7TA 2ZP0H 1AN1E 3TK5A 2GCTC 1O3HA 1ZJKA 2P93A 4HZHA 4BOHA 2V0BA 1Z8IB 8KME2 3T25A 1QR3E 3M7QA 2JKHA 4UE7H 1TQ0B 3SNCA 5FXLA 1NRQH 1OYQA 1QL7A 2ZFSA 2ZHWH 4BXSA 4HGCA 3OU0A 1V2TT 5E0HA 4A1TA 2BTCE 2QF0A 1HAVB 4Q7XA 4THNH 4DURA 5K7RA 1QJ7B 1PPBH 1X7AC 3PWCA 5F8TA 4FU7A 3URDA 4LOYH 4NA8A 2Q1JA 1MMJN 1DS2E 2A2XH 1W0ZU 2FOMB 2BDAA 1ESAA 3UNRA 1GI2A 1SB1H 2UWPA 1RTLA 2F9VA 5JDUB 2ZFTA 3KIDU 4AN7A 1EOLA 1KXCA 2M5TA 1AHTH 2UUJB 1T4UH 4CRDA 5C2ZA 1BRBE 4OGXA 5DGJA 2WYGA 4ZUHA 1THPB 1NS3A 1YF4A 4AOQA 5FHTA 4DY7B 4JCNA 2Z9KA 1GJ4H 1ZJDA 2OUAA 2Y7ZA 1C2EA 1F0UA 3SU3A 2VIDA 1FY4A 1K9OE 1L1GA 1O2MA 3DHKH 3PWBA 5FX5A 1FQ3A 5GCHF 2GZ7A 1EB1H 3UFAA 1HRTH 1OS8A 4DJZB 1A7SA 1GG6B 3GY4A 2WPLS 2HGTH 2ZCLP 1P8VC 3U1IB 4MLFB 2I6QA 2STAE 1HJAB 4SGAE 4ABIA 1MD7A 3N7OA 1FDPA 2BD9A 4ISHH 3VB5A 1BRAA 2Y5FA 1HAOH 1ANBA 1FV9A 3RP2A 1PQ8A 9LPRA 1MTVA 5HMAA 3E0NB 1S83A 3T62A 1GI8B 2A2QH 1GI6A 3LIWA 3SHCH 3M37A 3RC4A 4YM9A 1TGBA 2A5IA 1MCVA 3IG6B 2FOEA 1TB6H 4HI3A 3MTYA 2W7UA 1NFUA 2HRVA 1INCA 1BDAA 3PYHA 1RD3B 1MKWH 1DUEA 3A7VA 2EEKA 3B8JA 1ANDA 3OSYA 2UWOA 4NGAH 1E37B 2F9UA 1IQIA 3T5FH 4A6LA 5BRRE 1E0FD 3MFJA 3I78A 3ZZCA 3ZYEA 3CS7A 1CHOG 1GI3A 4E7RG 1FMGA 1AUJA 3SJKA 2THFB 3ZVEA 1FONA 1DX5M 2ZU4A 1P2QA 1OYTH 1ZHMA 2LNCA 1YPLH 2CHAB 1BITA 5EQRA 2R2WU 1IQEA 3F9HA 1FY5A 1H1BA 1BBRE 1HAVA 3ESTA 4Y8ZA 1RIWB 2BHGA 3RXBA 3KNXA 4AG2A 5CHAC 1QIXB 1V2VT 2TIOA 3AW0A 1DY9A 5DKMA 2XC4A 1MU8B 1SGFG 1ZSJA 1LHEH 1OP2A 4HFPB 3KQBA 1B7XB 5JYIA 1BBRK 2QCYA 4BXWA 5JB9S 1LCYA 3UWJH 4XBBA 2OTVA 3D62A 1V6DA 2BZAA 2XC0A 1AVWA 4ZROA 3STJA 3SHAH 1DVAH 4X6PA 5TJXA 1TALA 4Z0KA 1AO5A 5DK1A 1NN6A 4J2YB 2SNVA 2A7HA 3QX5H 1GJBB 1IAUA 1UTQA 1YPEH 4IGDA 1HAHH 1FIZA 1DWCH 2VWOA 2PWXA 3NCLA 2XW9A 2GMTB 1QB1A 2HNTF 4JK5A 3UWIA 2Q6GA 5DP9A 3FFGA 1O0DH 1P2IA 5K0HA 3M5OA 1AU8A 4GUXA 1O31A 4X6OA 2WPHS 1DLEA 2OCVB 4VGCB 1A2CH 1G3BA 3LGIA 1C2JA 3MOCA 3RXIA 2PGQB 1C2DA 4X8VH 3RUOA 1GI5A 1O3IA 3A8AA 4ABEA 3BG4C 1O2RA 3MU8A 1TA6A 1SL3A 2BY6X 2VINA 1TMTH 5A2MH 2ZPRA 5L30H 1JIRA 1KXFA 4IW4E 1XX9A 3BEUA 2A45B 1TYNA 4GPGA 1MQ5A 3URCA 4B2CA 4KP0A 3GY5A 1XMNB 3U8TH 3TJUA 4GLYA 1GBLA 3RXVA 3SV9A 1KDQB 5F6MA 2VWNA 4BTUB 4M7GA 1SBWA 3SI3H 1NFWA 4RKOB 2ZPSA 2WINI 3TJOA 3WY8A 2AGGX 4MPXA 1B0FA 2G81E 4RKJB 1GCTB 1SOTA 3RXJA 5EPYA 3QGJA 3T27A 1Z8RA 2A7JA 3SV2H 2ODQA 2A4QA 2AS9A 3TITA 2ZFPH 4AORA 1K28D 1CT2E 1TQ7B 4YTAA 4X6MA
chains in the Genus database with same CATH superfamily
1AY6H 3GYLB 1KMHB 1AQ7A 1O33A 1QRWA 2ZDLA 1TFXA 3TVJB 2P3TB 2PUQH 1O5FH 3SQEE 1UMAH 2RA0A 3ODFA 1C5XB 3VXFH 1EPTB 1XUGA 3KYFA 2A1DB 2VGCC 2Q6DA 1GPZA 1UK2A 4XBDA 1T8MA 4NZLA 4DOQA 2W26A 3SJ9A 5IYTA 1SOZA 2Z7FE 1QQ4A 2QA9E 3MNXA 1C2HA 2FLBH 1MZDA 1OHHD 3AK5A 2D1JA 1GI0A 4O9VA 1BMFD 1EB2A 4YO9A 5A09A 3PLBA 2BXUH 1H8ED 2IJD1 1WQVH 4Q2KA 1TA2A 1A4WH 3DFJA 2ZFRH 2BVSH 1S6FA 2UUYA 1MZAA 1GVZA 4WXIA 4JZ1A 4DGJA 1SPJA 2J2UA 3A83A 1XUJA 4ACAA 3UNSA 3RM2H 1HAXB 1S81A 4MVNA 1GHBF 1ABIH 1W0YH 3EE0B 3FP7E 3LOXA 3OEHD 3LGVA 7GCHF 1QY6A 3ZVGA 2JETC 5LH8A 2WHXA 1QB6A 2FWWA 5EW2H 2BQ6B 1MCTA 1BMMH 1SGQE 1YBWA 3GICB 1EKBB 1Z1IA 3UQOA 5C1XA 1CA0C 1GI7B 1QZ8A 1W14U 2OP9A 2NU0E 2GV6A 1GHXH 5A0BA 2OQ5A 2O8WA 1SGDE 2QXIA 3NPSA 3S9BA 1ZZZA 2K0QA 1L0ZA 2B0FA 2D2DA 4NIWA 2J97A 3MYWA 1W0KD 2ZFFH 1EJNA 2W3IA 2Y5GA 1QL8A 4GHQA 4CBOA 1W11U 1T32A 3DT0H 3GDSA 4H6TA 1DFPA 1FXYA 5G4BA 1E1QD 3F3BA 4KTUA 7LPRA 5HM2A 1GJDB 3RU4D 1JRTA 3DFLA 2UUFB 3M5MA 4P02A 1K1MA 2XYAA 1UVTH 3RLYH 2EI6A 1DSTA 2CGAA 4J1YA 3PLKA 4YXWD 2XBYA 2Y80A 3A86A 3V7TA 2FPZA 4ABGA 5LPRA 2FMJA 1B5GH 2PKSC 3AAUA 3SYJA 5DP4A 2UUKB 5FBEA 4CRBA 2F9BH 2BXTH 4ISIH 1GVKB 4NCYA 1CHGA 4MPVA 1BA8B 1C5TA 2P16A 1EJMA 1JOUB 1O3MA 2FOGA 5L2YH 2LELA 1ZMLA 1TMUH 1DY8A 3VB7A 4LK4A 4YT7H 1O2VA 1PPZA 1L4ZA 2BD3A 4M9FA 2H6MA 3M3VA 2SGPE 3S69A 1AZZA 3DA9B 4JYUH 2F3CE 3ZZ4A 3FZDA 1GMHF 1O34A 1P2KA 3ZVDA 3EE7A 1ABJH 3SUEA 1W13U 2FOHA 5GCHG 2ZU1A 3NXPA 1S0RA 1P57B 1H9LB 2ZNKH 1EAXA 1HAYB 1DICA 1MAYA 4FETA 4U01A 1FJSA 3M61U 3CS0A 4WVPE 3B23B 1WSSH 1YKTA 4LZ4B 1WYKA 3EDXB 3GCOA 2IJOB 2F9NA 1ANCA 2YNBA 3A7YA 3CENA 3U28C 1O3CA 2HLDD 1GL0E 1PPCE 2NU1E 1HAGE 8GCHF 3FO8D 2Z9IA 2Y82A 5J4QA 2YMSD 3RXPA 1LHGH 1V2PT 4NG9H 1LHDH 2WV9A 1G36A 3GY2A 1YPKH 8ESTE 1BBRH 4AFUA 1SG8B 3PTNA 1A3BH 1LMWB 1U6QA 3RXMA 1G32B 5E0GA 3JZ1B 1GJ5H 1C5ZB 5J4SA 1YP9A 4H4FA 1SGPE 1P0SH 2FYRA 1L1JA 3K6ZA 3ODDA 1Y3UA 2AGIX 1H8HD 3VB4A 1DT2A 3GCHB 2VWMA 2F83A 1RFNA 3MO9A 3SJ8A 2FX6A 2GV7A 1FPCH 3SI4H 1AE5A 1O2JA 2R0LA 1EAWA 1GHVH 2FXRA 4ZKRU 4AB9A 3E6PH 2P59A 1BB0B 1A0JA 2AFQB 5EJZA 1UO6A 5L2ZH 2GZ8A 3B9FH 3T29A 1QFKH 3P92A 1TX8A 3GY7A 2OC7A 2PR3A 1SGIB 1D3QB 3KQEA 2QF5A 3TH4H 1WV7H 4CRGA 1QBNA 1V2JT 1TGCA 2ZO3H 3KEEA 2YMSC 4UFGH 1AMHA 1O38A 3IWMA 3LJOA 2QN5T 1MBMA 1C5OH 1GCDA 2BM2A 2IPHA 1BTHH 1FN6A 1P02A 1C2LA 5DN6D 1FUJA 3TJNA 2BD8A 1SGRE 2SGAA 1BTWA 1YLNA 3A8CA 1GBEA 2FM2A 3M5NA 2WPKS 2V6NA 3STIA 3Q76A 2IOTA 1K22H 3S9AA 4X1NU 1A46H 4AX9H 3HGPA 1GHAG 1C2IA 4NWLA 2HALA 3QZRA 1G3CA 3SNEA 1GBAA 3RXHA 3E16B 1OP0A 1B0EA 4DIHH 2C8WB 4LXBH 3TNSA 1F0SA 3TGIE 4Y7BA 1OXGA 1EZUC 4X8SH 2QXJA 4AGJA 1LPGB 4ZXXH 3S0NA 3LDXH 3UNQA 4ZHLU 3OX7U 1C5RA 3V0XA 5EXNA 2GZ9A 1LHFH 1A61H 2WV4A 1K1NA 2ZEBA 4GCHF 1P2MA 3E1XB 4R8TB 2QGRA 2CXVA 5KGOA 4CBNA 4Z6AH 1A5IA 1VITG 4BTIB 2FO9A 4WF8A 2Y6TA 3SU2A 3MU1A 1CGHA 1BQYA 1DOJA 1O3LA 1V2KT 5EG4A 1P04A 1DXWA 1TPPA 2WYJA 1A0LA 2H5CA 2FI4E 4XE4A 5I25A 2RA3A 4I7YH 1UTKA 2FOFA 1NBME 1O3DA 1VCWA 1P3CA 1SSXA 3F0OA 2A0QB 3U9AH 5EQQA 2ANKH 2C90B 4D7GA 5ETXA 1GVLA 4QT8C 3H7OA 2WPMS 3PV5A 1OWEA 2FS8A 1C5UA 2QV1A 3C27B 2NU4E 3RXGA 4UD9H 1QRZA 1BMLA 3BTWE 1S85A 2IN2A 1A1RA 3LT3A 3PRDA 2P3UB 1ELDE 1UTOA 2STBE 5EODA 3GCTF 3TPIZ 3BV9B 1BUIA 1C2FA 1P9SA 4X6NA 3TGKE 3RXFA 2BY7X 4XD7D 1FX0B 3SUGA 1C5YB 1LHCH 5C3NA 1MH0A 5AHGH 1WXRA 1PYTD 4BAMB 1O3EA 2A4RA 1ELEE 2GTBA 2J9NA 4D9QA 1S6LA 2B5TB 1KYNA 5DP5A 3PROA 1GMDF 4FUDA 1G2LA 1Z1JA 4ACBA 4GSOA 3EYDA 4D8NA 1COWD 1G3DA 1LTOA 1E36B 3TH2H 4O03A 2FYQA 1O3PB 4JZIA 4AFQA 2J94A 3OTJE 1XUFA 1BJVA 1SGFA 1C1SA 4RSPA 1GDUA 2K1QA 1HJ8A 2I6SA 3PRBA 2ZHEH 2GT8A 4SGBE 1Q3XA 1NO9H 3W1EA 1D3PB 2V7QD 3EA7A 1SMFE 3PO1B 3RU4E 1H9IE 1PJPA 2XWBI 3ITIA 3QK1A 3FP8E 3ZZ6A 2PW8H 2W6ID 3N7DA 4DT4A 2FOAA 5EQSA 1C5LH 4ZHMU 3TNTA 5C20A 3BTDE 3E91A 1HJ9A 4Y8YA 3ZIAD 1PYTC 2VJ1A 4WMDA 4IBLH 1GHBG 3QTOH 4F49A 1NT1A 1V2UT 3RXQA 1BT7A 2Z3DA 1SI5H 2O8UA 1HAZB 4B6EA 2ZTXA 2BDYA 3LGTA 3SQHE 2VIQA 3ENSB 1HLTH 2PSXA 4NIXA 4X8TH 1HDTH 1TRNA 3ZZ3A 1BCUH 2AGEX 2C93B 1GHWH 1VR1H 1KLTA 4JZEH 4KKDA 4I8HA 3A80A 3LPRA 5GNDA 1V2MT 2XRCA 1PQAA 2ZU3A 4YZUA 1JRSA 3P8FA 1YC0A 1QGFA 4JYVH 1ELTA 4UEHH 4ESTE 4FVDA 8LPRA 4FXGH 1A5GH 4BAHB 2JH0D 4WWYA 1UHBA 2F91A 4DCDA 3ZV9A 4F4OC 2H1UA 1EAIA 1ELBA 1ELFA 2HPQH 2BY8X 3HKJB 5DPAA 3WWFA 1UCYE 4U2WA 1C5VA 2VU8E 5BPEA 1TOMH 2TRMA 1HXEH 1VGCB 2R9PA 1DUAA 4ABJA 4CREA 2PLXA 1DITH 1SFIA 3VGCC 2HPPH 2BZ6H 2FTMA 1IQGA 5FPSA 4Q80A 5EIYA 2OXSA 1DDJA 3SU4A 4JZDH 5FPYA 3SW2B 4PROA 3TU7H 1MBQA 1O2UA 3DSOA 1DANH 1TABE 5JBTA 4IS5A 2GGVB 1ZMNA 2CF8H 3RXAA 3ZZ8A 1O5AB 4I32A 1P05A 1TLDA 3A89A 2FP7B 1YPJH 1XKBC 3CP7A 3VB6A 3U69H 1NRNH 3M7UA 2ZI2H 3SUFA 2GKVE 3ZZ5A 3PMAB 1J9CH 2FI3E 4X1PU 2XTTB 2ZC9H 1P10A 4AYYB 4CRFA 5AFZH 1HAIH 1T8NA 1GDQA 1TGTA 1AZ8A 1ZMJA 3GY6A 3SV8A 2M2AA 1Y3WA 4ISNA 3GS9A 3M36A 3BSQA 1O2OA 1PPEE 3RXCA 2XWAA 3O8BA 1Y3VA 2VIWA 3TH3H 4OS6A 4I31A 1CBWC 2ZQ2A 3BEFB 4MNVA 2ESTE 1O2IA 2AYWA 1WQSA 1TBQH 1THSH 1TX6A 4B2AA 3UTUH 5GPIB 3ATLA 4ZXYH 2DE9A 1NESE 1JXPA 1WOFA 3VFEA 3ZV8A 1SGYE 1TGSZ 2LP6A 4TPIZ 1K2I1 1A0HB 1SQRA 4NZQA 4XFQA 2G4UA 1O3BA 1W2KH 2BY9X 3UUZA 3QLPH 1IQNA 1GMCF 2HNTE 4Y71A 1V2RT 4AFZA 3SBKA 3VEQB 4B75A 3N7EA 3RC5A 1C4V2 2AMQA 1J8AA 1C2MA 4K1TA 5HM9A 1CE5A 4CHAB 5JBAS 3SV6A 2P8OC 3MH4A 3C1KA 1Y5BT 4ABAA 1GJAB 1XVOA 4CH2B 1HPGA 1SHHB 3DCLA 4I33A 2XC5A 1Y8TA 1RTFB 4ZH8A 6GCHF 4ZAEA 3EGKH 1ARBA 2A5AA 4XBCA 2BOHB 1O2PA 1VJAU 1EASA 5DP6A 1CQQA 1YWUA 3O8CA 3D49H 1GGDC 4X0WU 4JZFH 5FPTA 3SGQE 2AERH 2UWLA 1V2NT 6LPRA 1ANEA 4K8BA 2FTLE 3BN9A 3P17H 3KGPA 4FUHA 3U8RH 1SGCA 1A3EH 3RXEA 1GBHA 1NBMD 3L33A 1BMAA 1G37A 1HB0B 1IQLA 1TRYA 1O35A 1Z8JB 1C5QA 2ZDVH 4AGKA 1ESBA 3PB1E 4UFEH 1MD8A 3I29A 2XBWA 4DVAU 2SGFE 1F7ZA 3E8LA 1ESTA 2AH4X 4ZCNA 4FUJA 1RJXB 1L2EA 1FN8A 1HGTH 3F9EA 4TY7A 1PPHE 1Q2WA 1OWIA 4I8GA 4GCHG 3N99A 3S7HB 1AGJA 1CT4E 1TONA 3RMLH 1FPHH 1DSUA 3MU5A 4A1VA 4Y0ZE 1EFRD 1AI8H 2TGDA 1AKSA 3A88A 3LC3A 1O3GA 1O2SA 3RMMH 1IQMA 3ATMA 3RXDA 3ELAH 4NA7A 4AG1A 2SGEE 2C8XB 3RXSA 1OP8A 3VG8A 1MTSA 2ZHDA 5TCAA 1TMBH 4OM9A 2G52A 1NZQH 3BTEE 1UVUH 1NFXA 4I8KA 3M3TA 3H09A 3LKWA 1D9IA 4Y10E 1EP5A 2ZGJA 3SGBE 1DWDH 4O3TA 1Z8GA 1Z7KA 4KTSA 3U8OH 4JK6A 1ZRKA 3GYMA 2ZDNA 4ZMAH 3GY8A 1MTNB 5IK2D 3F2HA 4IC6A 2ZPQA 1YLDA 2ZDMA 1ZSKA 1P09A 2PKAA 4A92A 2ZU5A 1D6RA 2ZQ1A 3MU0A 3F0PA 5F8XA 3MWIU 5HGGA 1AUTC 1LVYA 1NTPA 2KCYA 4FUGA 1AB9B 1Y59T 3GCTG 2Y5HA 1YPMH 4MNYA 3Q3KA 3OFND 2BVRH 5A0CA 2QXGA 3QO6A 4K8YA 4GAWA 1O5DH 2WUCA 1C1TA 4H42U 1XUHA 3BTKE 2ZF0H 1O37A 1ZPCA 2SGDE 1O5BB 2G5VA 2BDIA 4X2WA 1Q31A 3JZ2B 2SFAA 1ETSH 1GG6C 2AEIH 5DSFA 1KTTB 4BANB 4Y8XA 1GMDG 1HXFH 4B71A 1LVBA 1HJAC 1NPMA 1YCPM 3PMHB 1FAKH 3UIRA 1KSNA 1LQEA 3MNCA 1DM4B 3ZYDA 1SC8U 1EOJA 1NY22 3P6ZB 5EPNA 1BMNH 4ZKOU 2OC8A 2VB0A 3RXKA 1SLWB 5H4IB 1BTXA 2PGBB 1SLXB 4YESB 3NWUA 1O2GH 3BG8A 1S0QA 5T3HA 4Y11E 3SU0A 3BTGE 2H9HA 4H6SB 4X2VA 1K1OA 1HYLA 5HIZA 1YPHC 1SGNE 1TPOA 1UTJA 4TT3D 1MKWK 4FU9A 1ZTKA 2HVYB 1VCPA 1ORFA 3P95A 1ZPBA 5FX6A 5CMXH 1J15A 2OK5A 4Q63A 5EGMA 5E2OA 1FY3A 2B8OH 1KXEA 1S5SA 5KEDA 4ABFA 4K60A 2KCPA 4INHA 2GDEH 3KN2A 1VJ9U 1OWKA 2XCFA 5CHAB 4E05H 1AFEH 2CHAC 3MO6A 4FUBA 4WMEA 1QJ1B 1PPFE 3RMNH 1EUFA 1LPKB 3P70B 3Q77A 2FX4A 5DP8A 5C94A 2BDBA 1ELAA 3SV7A 3KYGA 5C1YA 1Y5AT 1RIWC 2P3FH 1P03A 1JIMA 3FANA 1OKXA 1VGCC 2HWLB 1UJ1A 1W7XH 3RU4T 1JBUH 2PFEA 3HK6B 4UFFH 1LVMA 3HKIB 2IPQX 1UTMA 4YLUA 5HKKD 2Z6BD 1MKXK 2RDLA 2VH0A 2Z3EA 4U30A 1GBDA 1TNIA 1F92A 3VXEH 2DE8A 1HIAA 5C5OA 3ATWA 4IC5A 2ANWA 5C5NA 1KIGH 2ZECA 3NZIA 3M3SA 1GJ8B 1ZR0A 1F5LA 4GVUA 4MNWA 2G8TA 5CHBA 5LPEA 3MI4A 3MNSA 5AVDA 2NU3E 3RXUA 4BAOB 1GI4A 2AHME 1BJUA 1OWJA 2D8WA 2KR7A 4GHTA 3T2NA 2RCEA 2BB4A 2QY0B 2BLQA 5KECA 2HLCA 1GJCB 2TGPZ 2XBXA 2BQWB 2OINA 1C9PA 1DWBH 2R0KA 4YLQH 1P2OA 1C2KA 4FUFA 5B6LA 4DG4A 3LC5A 3HPTB 2GMTC 1XVMA 2A4GA 3U98H 3Q00A 4NIVA 1EZQA 1W0JD 1TAWA 4ISLA 1EAUA 1IQFA 3RXRA 1LDTT 3BG4B 1O2KA 1A5HA 3UOUA 2BDGA 2TBSA 3F9GA 2KCOA 3EA8A 5B6OA 2BYAX 4VGCC 3UB0A 3PMJA 1V2LT 1YM0A 4B73A 1ELVA 1GWAA 2J34A 4OS5A 3I77A 1QBVH 3SUDA 1WU1A 3UR9A 1BZXE 1MUEB 4E7NA 4TYDA 1UK3A 2XBVA 3MMGA 2B7DH 2H9EH 1S6HA 3FKSD 3UAIC 2J4IA 3NK8A 1CGIE 1C9TA 1N8OB 2CF9H 2ILNA 2BX3A 3SNDA 2VWLA 3UQVA 3UREA 6CHAB 5GXPA 1OX1A 4CR5A 1ETRH 3PV4A 1GHYH 3RMOH 1TWXB 4LZ1H 1V2OT 3VPKA 1G2MA 1VITH 2OBQA 3ZZ9A 3LGYA 2ZTZA 1AWHB 1UTLM 2QC2A 1V3XA 2W3KA 3O8RA 1ZTLA 1T8LA 2VH6A 1ELCA 4RT1A 1LKAA 4YOJA 1GCTC 3R0FA 7ESTE 1XXFA 3ZZ7A 1C1WH 4IN2A 3VB3A 3SN8A 3SU5A 2JH6D 1CSOE 2GJGA 3KQ5A 1KXDA 4ASHA 3ATKA 3PV2A 2VGCB 1UHBB 4YOGA 1VCQA 3H5CB 2CV3A 2NU2E 1CGJE 2YNAA 1AE8H 1O2TA 4JMYA 1RGQA 4A5TS 4XDEA 5ESBA 3SJOA 1OPHB 1EPTC 2G4TA 1TNJA 3RXTA 4INLA 2HNTC 1O36A 5GWZA 4UONA 1UVOA 1SGEE 1C4U2 1O3JA 1O5GH 4YOIA 1T31A 4ABHA 1GBJA 5A0AE 1GJ7B 1ZTJA 4NWKA 4OS1A 1DWEH 1D4PB 1O3OA 1EQ9A 1THRH 4NA9H 3BTFE 5FBIA 5DO4H 2BQ7B 2Y81A 5HYOA 3M5LA 3SO3A 6GCHG 1GBTA 2C4FH 1LPZB 1V2WT 2EI7A 4BAQB 1GBFA 3GOVB 1FY1A 4WJG2 1Y3XA 1FAXA 1GDNA 2A31A 2JETB 3SGAE 2KAIA 3T26A 3F1SB 4MTBA 3A82A 1O3NA 4Y0YE 1FIWA 1K1LA 1DPOA 2HOBA 1CA0B 2TGTA 4TWWA 3MHWU 1P01A 3P8GA 2JJ2D 3RXLA 3A8DA 1O2YA 2G51A 2ZG0H 5SGAE 1SLVB 2V3OH 2ASUB 3T28A 3SU6A 1TX7A 2ZHQH 5FL7D 2LPRA 3SZNA 4IMQA 1S82A 3FZZA 1E35B 1WAYB 5GIBA 2FDAA 1YPHE 2AIPA 3A7TA 4OGYA 4BAKB 4FUCA 3LU9B 1MTNC 2RG3A 2JH5D 1EZXC 4KTCA 4JYTA 3QN7A 2F9OA 1PPGE 1IQJA 2FOCA 2PP6A 1BTYA 1C1PA 7GCHG 2GCHF 4A7IB 4IMZA 1Z6JH 1ZPZA 2PKSB 3FP6E 1OWHA 4FOUC 3GY3A 1AB9C 1CT0E 2SGQE 2W5EA 1LVOA 1O2NA 2BOKA 2JJ1D 1AIXH 1V2QT 4CH8B 3GDUA 1O2XA 3BIUH 3OE7D 1P12E 3BTQE 2P95A 3A87A 4Y76A 2VVVA 2J5UA 2A32A 1K1IA 2BD4A 2GD4B 1DE7H 1G9IE 3AW1A 2Z9JA 1CO7E 5I46H 3DSPA 3LH1A 4ZKSU 3S7KB 1NU7B 3ZZDA 1KLJH 3OY6U 1YGCH 4TWYA 5JBBS 2PTCE 3TIUA 1V2ST 1O3AA 1ZHRA 1LKBA 2Y7XA 2ZU2A 2Z3CA 3A84A 3EAJA 3LGWA 1WBGB 1QA7A 3FAOA 1SR5C 3PM3A 4Y6DA 4TSFD 2VIOA 2BD2A 1BOQA 2BLVA 2PHBA 4Q7ZA 4FVBA 3LONA 4ZKNU 1C1VH 1O2WA 1SQAA 4WMFA 1QQUA 4B2BA 2V35A 1NM6A 3A7XA 3NUMA 1O32A 5T6FA 1QL9A 1P11E 3A7WA 5LPFA 3UY9A 1SFQB 4MG3A 3ZVBA 1T4VH 2ODYB 1GJ9B 2VIVA 3MO3A 2OBOA 2GT7A 1UCYK 2ZZUH 5E2PA 5C1UA 3CNRA 2BX4A 3ZZBA 1J16A 1OWDA 1QB9A 1GBKA 2J98A 4FU8A 1N6YA 1QNJA 2XXLA 2ALVA 3HK3B 2KFWA 5DP3A 1UVPA 1GHZA 2FI5E 2BDCA 1G3EA 1HUTH 2ZDAH 1ZLRA 1QCPA 5C0UA 1GMHG 5C17A 1LQDB 2SNWA 1AKSB 5FCKA 3F2GA 3RXOA 1MKXH 4XRNA 3AASA 2ZGBH 4I8JA 1ETTH 5ABWA 3ATIA 1K1JA 5ESTE 1ZSLA 3GCHC 2P94A 2RDEA 1WUNH 1HV7A 2C8ZB 4NSYA 3BF6H 2O8TA 2CMYA 1HAPH 1TGNA 1GHAF 3V3MA 5TCCA 4INKA 1DXPA 5DP7A 1MABB 1HCGA 5EJ1A 2FS9A 3WW7A 8GCHG 3BTHE 1Y5UT 2EY4C 1LO6A 2YMSB 3BIVH 5FCRA 3SORA 1GBBA 2PKAB 2A5KA 1VZQH 1OSSA 2ULLA 4ABBA 3GCNA 4ABDA 3AAVA 3U1JB 5A8YA 3A81A 4OS4A 1P9UA 1QURH 2QAAA 2Z9GA 2OD3B 1VITF 3ZZAA 1QTFA 1O2ZA 1ZHPA 3E0PB 5L6NH 3TGJE 1NU9A 2W6JD 1UK4A 3A85A 2AMDA 4WH6A 4XOJA 3D65E 5C67A 1SGTA 2QXHA 2WPIS 1XUIA 1TBZH 3NRLA 3QGNB 5IDKA 2VVCA 1AFQB 2BDHA 4DW2U 4HTCH 2ZFQH 1G30B 1WDIA 1C1MA 1D6WA 4ASUD 4RI0A 2H9TH 1HBTH 2HVXA 4AB8A 1JMOH 9ESTA 2Q6FA 3A8BA 1ID5H 5CE1A 1M9UA 3SZEA 1TNLA 3LGUA 2EI8A 1AWFH 2VNTA 3V12A 1C1NA 4KGAA 3KQDA 1C5WB 4Q4LA 4Y7AA 3KHVA 3RM0H 1MTWA 4U32A 3KF2A 1MU6B 2ZKSA 1ZGIA 2GVFA 4B1TA 4NIYA 1NRPH 1Z71A 3R3GB 1T8OA 2QIQA 4I8LA 3A7ZA 1N8OC 1W7GH 1BRCE 1TNGA 6CHAC 3F68H 2R3YA 2J95A 4TPYA 1D3TB 1H9HE 1UW7A 4ZHAA 1K1PA 2BLWA 3AVZA 1O3KA 2ANYA 1YCPK 2GX4A 4E06H 2AMPA 1P2JA 2GCTB 1TPSA 2C3SA 3P8OA 2ZDKA 3FOAA 2ALPA 4Q7YA 2F9PA 3UOPA 5AF9H 2V3HH 3QWCH 1KXAA 3MQKC 1C4Y2 2PV9B 1ZYOA 4YT6H 5JB8S 4RT0A 4K1EA 2L74A 3K9XB 3ZVAA 3TK9A 1RS0A 1C2GA 1N6XA 2EA3A 4X2YA 1P06A 2ZHFH 1CU1A 5EJLA 3DD2H 3F6UH 2RFKC 5T1VA 1GI1A 4KELA 3IITA 5GDSH 3P8NA 4D7FA 2VIPA 5C0TA 4K3JA 4MPUA 2F4LA 2ZGCA 2QF3A 1EZSC 2OC1A 3SNBA 1O5EH 1ELGA 2R3UA 4AC9A 5FAHA 1C5PA 5DJ7A 2ANMH 1DLKB 2R2MB 3UPEA 3K2UA 3SU1A 4D9RA 3F9FA 4D76A 1C1OA 3HGNA 1ZGVA 5GJ4B 1FZZA 1HIAB 2EC9H 1TE0A 3RLWH 1T7CA 4AZ2B 1J14A 5DG6A 4MDSA 4Y79A 2YOLA 1O5CB 1TIOA 2WUBA 3BTTE 4X1RU 5LGOA 3L3TA 3QDZB 4DT7B 1BHXF 1GBIA 1UTNA 5EOKA 3S9CA 5A8ZA 1XM1A 1PQ7A 3MU4A 3PLPA 2A4OA 1BRUP 2TGAA 2W7SA 3E3TA 1HNEE 2BY5X 1ARCA 1H8DH 1UTPA 1J17T 1H8IH 2ZCKP 3DUXH 3PO1C 2OLGA 4DIIH 1CHOF 2XOKD 3O8DA 2CJIA 3K6YA 1IHTH 1W12U 5E8EH 1JWTA 4XSKU 4K2YA 4O3UA 3L6PA 4ISOA 2AIQA 3GISB 5A8XA 1QJ6B 4X2XA 4B6FA 2O8MA 3EA9A 3MNBA 1TNHA 2GP9B 1NRSH 1F0RA 3HATH 1FLEE 1GL1A 1PFXC 2FZZA 2ZGXH 3BEIB 2ODPA 2Z9LA 2QE7D 1KDQA 4CR9A 2C8YB 1YY3A 3EQ0H 1F5KU 2XNDD 5HXFA 1KY9A 1KXBA 1TOCB 2PTNA 1QBOA 4X1QU 1GBMA 3G01A 1CA8B 1XUKA 1FNIA 2TPIZ 1E38B 4NFEA 2DUCA 4FUEA 1P2NA 1W3CA 4R0IA 5T6DA 1ZOMA 2GDDA 2ZWLH 1C5SA 1C5MD 3M7TA 1RRKA 2O8LA 2PUXB 6ESTA 2A7CA 3NKKA 1BHXB 3F2FA 1Z6EA 1IQHA 4Z1MD 2GCHG 3QUMP 1C5NH 1C1UH 1C1RA 2BVXH 5PTPA 1EPTA 3GDVA 1IQKA 2QYIA 3Q3YA 3QTVH 4A1XA 1EXFA 1UVSH 4RN6A 4BNRA 1UCYH 2J38A 3FVFB 2FLRH 5EXLA 3UR6A 2O9QA 3VGCB 1YYY1 1F2SE 2ZIQH 3MH6A 1RTKA 3D23A 2ZGHA 2G55A 1FI8A 5EXMA 4MNXA 3V13A 2OC0A 4NFFA 2FODA 1TPAE 2VVUA 3LH3A 4BTTB 1SKYE 2CN0H 1EATA 1N1LA 3SNAA 5EW1H 1H4WA 2FOBA 1NROH 4UDWH 3TJVA 3ZVFA 4K1SA 5AFYH 1D3DB 3PTBA 5F03A 1SVPA 1E34B 2K8IA 4IN1A 4AYVB 1OOKB 1QRXA 1BTZA 2B9LA 4OS2A 2KAIB 1O30A 1EX3A 4B74A 5JPMH 3M35A 1PQ5A 1W10U 3W95A 3Q3XA 3QZQA 1ACBE 1KLIH 1MAXA 2BD7A 4K69A 2FEQH 2ZA5A 1AVXA 1NFYA 1XKAC 2WV5A 1W8BH 1O2HA 1CBWB 4HG6A 1SHYA 1BTPA 1O39A 1YPGH 3RDZA 3SJIA 4OS7A 1ZRBA 2FESH 4FUIA 4B76A 2PSYA 1O2LA 4AFSA 2D26C 1L4DA 2L6OA 3KQCA 1QA0A 2J92A 4WH8A 1TRMA 3OYPA 3PMBB 3OTPA 3ZVCA 2G5NA 1F0TA 1GBCA 4WY3A 1TBRH 1O2QA 4CRAA 2KCAA 1Y3YA 2OQUA 1RXPA 2H5DA 2G00A 3OY5U 4NSVA 1GI9B 1GJ6A 1S84A 2Z94A 1MTUA 1E79D 1SQOA 4MQAA 1CVWH 2FIRH 4WXVA 4X8UH 1SQTA 1WTGH 1NC6A 4K5ZA 3K65B 2WPJS 2QF4A 2P8OB 1AFQC 3E90B 1IHSH 1KTSB 4O97A 4CRCA 1NRRH 2EQNA 1QHRB 1FY8E 3KCGH 3W94A 1AD8H 1TNKA 4CHAC 5E0JA 2H2ZA 5F8ZA 1P3EA 1YLCA 1L1NA 3LJJA 2ZTYA 1WTHD 1SLUB 1HFDA 1BTUA 1YCPH 3MH7A 5EU8A 7KMEH 3SOSA 2XCNA 1GGDB 1F5RA 2NWNA 3BTME 2ZCHP 1EP6A 4X1SU 1XXDA 4MPWA 4UFDH 1EJAA 5T6GA 2BD5A 3KL6A 2XNIA 2BMGB 1K21H 1C1QA 3MH5A 3TLOA 1O3FA 3TK6A 1WCZA 5JBCS 1MQ6A 4TY6A 1IOEA 1AVGH 1BIOA 3RC6A 1GMCG 2BLOA 3H7TA 2ZP0H 1AN1E 3TK5A 2GCTC 1O3HA 1ZJKA 1E1RD 2P93A 4HZHA 4BOHA 2V0BA 1Z8IB 8KME2 3T25A 1QR3E 3M7QA 2JKHA 4UE7H 1TQ0B 3SNCA 3OEED 5FXLA 1NRQH 1OYQA 1QL7A 2ZFSA 2ZHWH 4BXSA 4HGCA 3OU0A 1V2TT 5E0HA 4A1TA 2J98B 2BTCE 2QF0A 1HAVB 4Q7XA 4THNH 4DURA 1VKYA 5K7RA 1QJ7B 1PPBH 2KZ4A 1X7AC 3PWCA 5F8TA 4FU7A 3URDA 4LOYH 4NA8A 2Q1JA 1MMJN 1DS2E 2A2XH 1W0ZU 2FOMB 2BDAA 1ESAA 3UNRA 1GI2A 1SB1H 2UWPA 1RTLA 2F9VA 5JDUB 2ZFTA 3KIDU 4AN7A 1EOLA 1KXCA 2M5TA 1AHTH 2UUJB 1T4UH 4CRDA 5C2ZA 1BRBE 4OGXA 2V3MA 5DGJA 2WYGA 4ZUHA 1THPB 1NS3A 1YF4A 2JDID 4AOQA 5FHTA 4DY7B 4JCNA 2Z9KA 1GJ4H 1ZJDA 2OUAA 2Y7ZA 1C2EA 1F0UA 3SU3A 2VIDA 2WZQA 4I86A 1FY4A 3OAAD 1K9OE 1L1GA 1O2MA 3DHKH 3PWBA 5FX5A 1FQ3A 5GCHF 2CK3D 2GZ7A 1EB1H 3UFAA 1HRTH 1OS8A 5HIYA 1A7SA 4DJZB 1GG6B 3GY4A 2WPLS 2HGTH 2ZCLP 1P8VC 3U1IB 4MLFB 2I6QA 2STAE 1HJAB 4SGAE 4ABIA 1MD7A 3N7OA 1FDPA 2BD9A 4ISHH 2WPDD 3VB5A 1BRAA 2Y5FA 1HAOH 1ANBA 1FV9A 2VBCA 1PQ8A 3RP2A 9LPRA 1MTVA 5HMAA 3E0NB 1S83A 3T62A 1GI8B 2A2QH 1GI6A 3LIWA 3SHCH 3M37A 3RC4A 4YM9A 1TGBA 2A5IA 1MCVA 3IG6B 2FOEA 1TB6H 4HI3A 3MTYA 2W7UA 1NFUA 2HRVA 1INCA 1BDAA 3PYHA 1RD3B 1MKWH 1DUEA 3A7VA 4P00A 2EEKA 3B8JA 1ANDA 3OSYA 2UWOA 4NGAH 1E37B 2F9UA 1IQIA 3T5FH 4A6LA 5BRRE 1E0FD 3MFJA 3I78A 3ZZCA 3ZYEA 3CS7A 1CHOG 1GI3A 4E7RG 1FMGA 1AUJA 3SJKA 2THFB 5F53A 3ZVEA 1FONA 1DX5M 2ZU4A 1P2QA 2WSSD 1OYTH 1ZHMA 2LNCA 1YPLH 2CHAB 1BITA 5EQRA 2R2WU 1IQEA 3F9HA 1FY5A 1H1BA 1BBRE 1HAVA 3ESTA 4Y8ZA 1RIWB 2BHGA 3RXBA 3KNXA 4AG2A 5CHAC 1QIXB 1V2VT 2TIOA 3AW0A 1DY9A 5DKMA 1K0HA 2XC4A 1MU8B 1SGFG 1ZSJA 1LHEH 1OP2A 4HFPB 3KQBA 1B7XB 3DSGA 5JYIA 1BBRK 2QCYA 4BXWA 5JB9S 1LCYA 3UWJH 4XBBA 2OTVA 3D62A 1V6DA 2BZAA 2F43B 2XC0A 1AVWA 4ZROA 3STJA 3SHAH 1DVAH 4X6PA 5TJXA 1TALA 4Z0KA 1AO5A 5DK1A 1NN6A 4J2YB 2SNVA 2A7HA 3QX5H 1GJBB 1IAUA 1UTQA 1YPEH 4IGDA 1HAHH 1FIZA 2KM0A 1DWCH 3WWBA 2VWOA 2PWXA 3NCLA 2XW9A 2GMTB 1QB1A 2HNTF 4JK5A 3UWIA 2Q6GA 5DP9A 3FFGA 1O0DH 1P2IA 5K0HA 3M5OA 1AU8A 4GUXA 1O31A 4X6OA 2WPHS 1DLEA 2OCVB 4VGCB 1A2CH 1G3BA 3LGIA 2KX4A 1C2JA 3MOCA 3RXIA 2PGQB 1C2DA 4X8VH 3RUOA 1GI5A 1O3IA 3A8AA 4ABEA 3BG4C 1O2RA 2JIZD 3MU8A 1TA6A 1SL3A 2BY6X 2VINA 1TMTH 5A2MH 2ZPRA 5L30H 1JIRA 1KXFA 4IW4E 5CDFE 1XX9A 3BEUA 2A45B 1TYNA 4GPGA 1MQ5A 4F48B 3URCA 4B2CA 4KP0A 3GY5A 1XMNB 3U8TH 3TJUA 4GLYA 4F55A 1GBLA 3RXVA 3SV9A 1KDQB 5F6MA 2VWNA 4BTUB 4M7GA 1SBWA 3SI3H 1NFWA 4RKOB 2ZPSA 2WINI 3TJOA 3WY8A 2AGGX 4MPXA 1B0FA 2G81E 4RKJB 1GCTB 1SOTA 3RXJA 5EPYA 3QGJA 3T27A 1Z8RA 2A7JA 3SV2H 2ODQA 2A4QA 2AS9A 3TITA 2ZFPH 4AORA 1K28D 3FN8A 1CT2E 1TQ7B 4YTAA 4X6MA
chains in the Genus database with same CATH topology
1AY6H 3GYLB 1O33A 1AQ7A 1QRWA 2ZDLA 1TFXA 3TVJB 2P3TB 2PUQH 1O5FH 3SQEE 1UMAH 2RA0A 3ODFA 1C5XB 3VXFH 1EPTB 1XUGA 2A1DB 2VGCC 2Q6DA 1GPZA 1UK2A 4XBDA 1T8MA 4NZLA 4DOQA 2W26A 3SJ9A 5IYTA 1SOZA 2Z7FE 1QQ4A 2QA9E 3MNXA 1C2HA 2FLBH 1MZDA 2D1JA 1GI0A 4O9VA 1EB2A 4YO9A 5A09A 3PLBA 2BXUH 1WQVH 4Q2KA 1TA2A 1A4WH 3DFJA 2ZFRH 2BVSH 1S6FA 2UUYA 1MZAA 1GVZA 4WXIA 4JZ1A 4DGJA 1SPJA 2J2UA 3A83A 1XUJA 3UNSA 3RM2H 1HAXB 1S81A 4MVNA 1GHBF 1ABIH 1W0YH 3EE0B 3FP7E 3LOXA 3LGVA 7GCHF 1QY6A 3ZVGA 2JETC 5LH8A 1QB6A 2FWWA 5EW2H 2BQ6B 1MCTA 1BMMH 1SGQE 1YBWA 3GICB 1EKBB 1Z1IA 3UQOA 5C1XA 1CA0C 1GI7B 1W14U 2OP9A 2NU0E 2GV6A 1GHXH 5A0BA 2OQ5A 2O8WA 1SGDE 2QXIA 3NPSA 3S9BA 1ZZZA 1L0ZA 2B0FA 2D2DA 4NIWA 3MYWA 2ZFFH 1EJNA 2W3IA 2Y5GA 1QL8A 4GHQA 4CBOA 1W11U 1T32A 3DT0H 3GDSA 4H6TA 1DFPA 1FXYA 5G4BA 4KTUA 7LPRA 5HM2A 1GJDB 3RU4D 1JRTA 3DFLA 2UUFB 3M5MA 1K1MA 2XYAA 1UVTH 3RLYH 2EI6A 1DSTA 2CGAA 4J1YA 3PLKA 2XBYA 2Y80A 3A86A 3V7TA 2FPZA 4ABGA 5LPRA 2FMJA 1B5GH 2PKSC 3AAUA 5DP4A 2UUKB 5FBEA 4CRBA 2F9BH 2BXTH 4ISIH 1GVKB 4NCYA 1CHGA 4MPVA 1BA8B 1C5TA 2P16A 1EJMA 1JOUB 1O3MA 2FOGA 5L2YH 1ZMLA 1TMUH 1DY8A 3VB7A 4LK4A 4YT7H 1O2VA 1PPZA 1L4ZA 2BD3A 2H6MA 3M3VA 2SGPE 3S69A 1AZZA 3DA9B 4JYUH 2F3CE 3ZZ4A 3FZDA 1GMHF 1O34A 1P2KA 3ZVDA 1ABJH 3SUEA 1W13U 2FOHA 5GCHG 2ZU1A 3NXPA 1S0RA 1P57B 1H9LB 2ZNKH 1EAXA 1HAYB 1DICA 1MAYA 4U01A 1FJSA 3M61U 3CS0A 4WVPE 3B23B 1WSSH 1YKTA 4LZ4B 1WYKA 3EDXB 3GCOA 2IJOB 2F9NA 1ANCA 2YNBA 3A7YA 3CENA 1O3CA 1GL0E 1PPCE 2NU1E 1HAGE 8GCHF 2Z9IA 2Y82A 5J4QA 3RXPA 1LHGH 1V2PT 4NG9H 1LHDH 1G36A 3GY2A 1YPKH 8ESTE 1BBRH 4AFUA 1SG8B 3PTNA 1A3BH 1LMWB 1U6QA 3RXMA 1G32B 5E0GA 3JZ1B 1GJ5H 1C5ZB 5J4SA 1YP9A 4H4FA 1SGPE 1P0SH 2FYRA 1L1JA 3K6ZA 3ODDA 1Y3UA 2AGIX 3VB4A 1DT2A 3GCHB 2VWMA 2F83A 1RFNA 3MO9A 3SJ8A 2FX6A 2GV7A 1FPCH 3SI4H 1AE5A 1O2JA 2R0LA 1EAWA 1GHVH 2FXRA 4ZKRU 4AB9A 3E6PH 2P59A 1BB0B 1A0JA 2AFQB 1UO6A 5L2ZH 2GZ8A 3B9FH 3T29A 1QFKH 3P92A 1TX8A 3GY7A 2OC7A 2PR3A 1SGIB 1D3QB 3KQEA 3TH4H 1WV7H 4CRGA 1QBNA 1V2JT 1TGCA 2ZO3H 3KEEA 4UFGH 1AMHA 1O38A 3IWMA 3LJOA 2QN5T 1MBMA 1C5OH 1GCDA 2BM2A 2IPHA 1BTHH 1FN6A 1P02A 1C2LA 1FUJA 3TJNA 2BD8A 1SGRE 2SGAA 1BTWA 3A8CA 1GBEA 2FM2A 3M5NA 2WPKS 2V6NA 3STIA 3Q76A 2IOTA 1K22H 3S9AA 4X1NU 1A46H 4AX9H 3HGPA 1GHAG 1C2IA 4NWLA 2HALA 3QZRA 1G3CA 3SNEA 1GBAA 3RXHA 3E16B 1OP0A 1B0EA 4DIHH 2C8WB 4LXBH 3TNSA 1F0SA 3TGIE 4Y7BA 1OXGA 1EZUC 4X8SH 2QXJA 4AGJA 1LPGB 4ZXXH 3S0NA 3LDXH 3UNQA 4ZHLU 3OX7U 1C5RA 3V0XA 5EXNA 2GZ9A 1LHFH 1A61H 2WV4A 1K1NA 2ZEBA 4GCHF 1P2MA 3E1XB 4R8TB 2QGRA 2CXVA 4CBNA 4Z6AH 1A5IA 1VITG 4BTIB 2FO9A 4WF8A 2Y6TA 3SU2A 3MU1A 1CGHA 1BQYA 1DOJA 1O3LA 1V2KT 5EG4A 1P04A 1DXWA 1TPPA 2WYJA 1A0LA 2H5CA 2FI4E 4XE4A 5I25A 2RA3A 4I7YH 1UTKA 2FOFA 1O3DA 1VCWA 1P3CA 1SSXA 2A0QB 3U9AH 5EQQA 2ANKH 2C90B 4D7GA 5ETXA 1GVLA 4QT8C 3H7OA 2WPMS 1OWEA 2FS8A 1C5UA 2QV1A 3C27B 2NU4E 3RXGA 4UD9H 1QRZA 1BMLA 3BTWE 1S85A 2IN2A 1A1RA 3LT3A 2P3UB 1ELDE 1UTOA 2STBE 5EODA 3GCTF 3TPIZ 3BV9B 1BUIA 1C2FA 1P9SA 4X6NA 3TGKE 3RXFA 2BY7X 3SUGA 1C5YB 1LHCH 5C3NA 1MH0A 5AHGH 1PYTD 4BAMB 1O3EA 2A4RA 1ELEE 2GTBA 2J9NA 4D9QA 2B5TB 1KYNA 5DP5A 3PROA 1GMDF 4FUDA 1G2LA 1Z1JA 4GSOA 3EYDA 4D8NA 1G3DA 1LTOA 1E36B 3TH2H 4O03A 2FYQA 1O3PB 4JZIA 4AFQA 2J94A 3OTJE 1XUFA 1BJVA 1SGFA 1C1SA 4RSPA 1GDUA 2K1QA 1HJ8A 2I6SA 2ZHEH 2GT8A 4SGBE 1Q3XA 1NO9H 1D3PB 3EA7A 1SMFE 3PO1B 3RU4E 1H9IE 1PJPA 2XWBI 3ITIA 3QK1A 3FP8E 3ZZ6A 2PW8H 2FOAA 5EQSA 1C5LH 4ZHMU 3TNTA 5C20A 3BTDE 3E91A 1HJ9A 4Y8YA 1PYTC 2VJ1A 4WMDA 4IBLH 1GHBG 3QTOH 4F49A 1NT1A 1V2UT 3RXQA 1BT7A 2Z3DA 1SI5H 2O8UA 1HAZB 2ZTXA 2BDYA 3LGTA 3SQHE 2VIQA 3ENSB 1HLTH 2PSXA 4NIXA 4X8TH 1HDTH 1TRNA 3ZZ3A 1BCUH 2AGEX 2C93B 1GHWH 1VR1H 1KLTA 4JZEH 4KKDA 4I8HA 3A80A 3LPRA 1V2MT 2XRCA 1PQAA 2ZU3A 4YZUA 1JRSA 3P8FA 1YC0A 1QGFA 4JYVH 1ELTA 4UEHH 4ESTE 4FVDA 8LPRA 4FXGH 1A5GH 4BAHB 2JH0D 4WWYA 1UHBA 2F91A 4DCDA 3ZV9A 4F4OC 2H1UA 1EAIA 1ELBA 1ELFA 2HPQH 2BY8X 3HKJB 5DPAA 1UCYE 4U2WA 1C5VA 2VU8E 5BPEA 1TOMH 2TRMA 1HXEH 1VGCB 2R9PA 1DUAA 4ABJA 4CREA 2PLXA 1DITH 1SFIA 3VGCC 2HPPH 2BZ6H 2FTMA 1IQGA 5FPSA 4Q80A 2OXSA 1DDJA 3SU4A 4JZDH 5FPYA 3SW2B 4PROA 3TU7H 1MBQA 1O2UA 5JBTA 1DANH 1TABE 4IS5A 2GGVB 1ZMNA 2CF8H 3RXAA 3ZZ8A 1O5AB 4I32A 1P05A 1TLDA 3A89A 2FP7B 1YPJH 1XKBC 3CP7A 3VB6A 3U69H 1NRNH 3M7UA 2ZI2H 3SUFA 2GKVE 3ZZ5A 3PMAB 1J9CH 2FI3E 4X1PU 2XTTB 2ZC9H 1P10A 4AYYB 4CRFA 5AFZH 1HAIH 1T8NA 1GDQA 1TGTA 1AZ8A 1ZMJA 3GY6A 3SV8A 1Y3WA 4ISNA 3M36A 3BSQA 1O2OA 1PPEE 3RXCA 2XWAA 3O8BA 1Y3VA 2VIWA 3TH3H 4OS6A 4I31A 1CBWC 2ZQ2A 3BEFB 4MNVA 2ESTE 1O2IA 2AYWA 1WQSA 1TBQH 1THSH 1TX6A 4B2AA 3UTUH 5GPIB 3ATLA 4ZXYH 2DE9A 1NESE 1JXPA 1WOFA 3VFEA 3ZV8A 1SGYE 1TGSZ 4TPIZ 1K2I1 1A0HB 4NZQA 4XFQA 2G4UA 1O3BA 1W2KH 2BY9X 3UUZA 3QLPH 1IQNA 1GMCF 2HNTE 4Y71A 1V2RT 4AFZA 3SBKA 3VEQB 4B75A 3RC5A 1C4V2 2AMQA 1J8AA 1C2MA 4K1TA 5HM9A 1CE5A 4CHAB 5JBAS 3SV6A 2P8OC 3MH4A 3C1KA 1Y5BT 4ABAA 1GJAB 1XVOA 4CH2B 1HPGA 1SHHB 4I33A 2XC5A 1Y8TA 1RTFB 4ZH8A 6GCHF 4ZAEA 3EGKH 1ARBA 2A5AA 4XBCA 2BOHB 1O2PA 1VJAU 1EASA 5DP6A 1CQQA 3O8CA 3D49H 1GGDC 4X0WU 4JZFH 5FPTA 3SGQE 2AERH 2UWLA 1V2NT 6LPRA 1ANEA 4K8BA 2FTLE 3BN9A 3P17H 3KGPA 4FUHA 3U8RH 1SGCA 1A3EH 3RXEA 1GBHA 3L33A 1BMAA 1G37A 1HB0B 1IQLA 1TRYA 1O35A 1Z8JB 1C5QA 2ZDVH 4AGKA 1ESBA 3PB1E 4UFEH 1MD8A 3I29A 2XBWA 4DVAU 2SGFE 1F7ZA 3E8LA 1ESTA 2AH4X 4FUJA 1RJXB 1L2EA 1FN8A 1HGTH 3F9EA 4TY7A 1PPHE 1Q2WA 1OWIA 4I8GA 4GCHG 3S7HB 1AGJA 1CT4E 1TONA 3RMLH 1FPHH 1DSUA 3MU5A 4A1VA 4Y0ZE 1AI8H 2TGDA 1AKSA 3A88A 3LC3A 1O3GA 1O2SA 3RMMH 1IQMA 3ATMA 3RXDA 3ELAH 4NA7A 4AG1A 2SGEE 2C8XB 3RXSA 1OP8A 1MTSA 2ZHDA 5TCAA 1TMBH 2G52A 1NZQH 3BTEE 1UVUH 1NFXA 4I8KA 3M3TA 3LKWA 1D9IA 4Y10E 1EP5A 2ZGJA 3SGBE 1DWDH 4O3TA 1Z8GA 1Z7KA 4KTSA 3U8OH 4JK6A 1ZRKA 3GYMA 2ZDNA 4ZMAH 3GY8A 1MTNB 4IC6A 2ZPQA 1YLDA 2ZDMA 1ZSKA 1P09A 2PKAA 4A92A 2ZU5A 1D6RA 2ZQ1A 3MU0A 5F8XA 3MWIU 5HGGA 1AUTC 1LVYA 1NTPA 4FUGA 1AB9B 1Y59T 3GCTG 2Y5HA 1YPMH 4MNYA 3Q3KA 2BVRH 5A0CA 2QXGA 3QO6A 4K8YA 4GAWA 1O5DH 2WUCA 1C1TA 4H42U 1XUHA 3BTKE 2ZF0H 1O37A 1ZPCA 2SGDE 1O5BB 2G5VA 2BDIA 4X2WA 1Q31A 3JZ2B 2SFAA 1ETSH 1GG6C 2AEIH 1KTTB 4BANB 4Y8XA 1GMDG 1HXFH 4B71A 1LVBA 1HJAC 1NPMA 1YCPM 3PMHB 1FAKH 3UIRA 1KSNA 1LQEA 3MNCA 1DM4B 3ZYDA 1SC8U 1EOJA 1NY22 3P6ZB 5EPNA 1BMNH 4ZKOU 2OC8A 2VB0A 3RXKA 1SLWB 5H4IB 1BTXA 2PGBB 1SLXB 4YESB 3NWUA 1O2GH 3BG8A 1S0QA 5T3HA 4Y11E 3SU0A 3BTGE 2H9HA 4H6SB 4X2VA 1K1OA 1HYLA 1YPHC 1SGNE 1TPOA 1UTJA 1MKWK 4FU9A 1ZTKA 1VCPA 1ORFA 3P95A 1ZPBA 5FX6A 5CMXH 1J15A 5EGMA 5E2OA 1FY3A 2B8OH 1KXEA 1S5SA 4ABFA 4K60A 4INHA 2GDEH 3KN2A 1VJ9U 1OWKA 2XCFA 5CHAB 4E05H 1AFEH 2CHAC 3MO6A 4FUBA 4WMEA 1QJ1B 1PPFE 3RMNH 1EUFA 1LPKB 3P70B 3Q77A 2FX4A 5DP8A 2BDBA 1ELAA 3SV7A 5C1YA 1Y5AT 1RIWC 2P3FH 1P03A 1JIMA 3FANA 1OKXA 1VGCC 2HWLB 1UJ1A 1W7XH 3RU4T 1JBUH 2PFEA 3HK6B 4UFFH 1LVMA 3HKIB 1UTMA 4YLUA 2Z6BD 1MKXK 2RDLA 2VH0A 2Z3EA 4U30A 1GBDA 1TNIA 1F92A 3VXEH 2DE8A 1HIAA 5C5OA 3ATWA 4IC5A 2ANWA 5C5NA 1KIGH 2ZECA 3NZIA 3M3SA 1GJ8B 1ZR0A 1F5LA 4GVUA 4MNWA 2G8TA 5LPEA 3MI4A 3MNSA 5AVDA 2NU3E 3RXUA 4BAOB 1GI4A 1BJUA 1OWJA 2D8WA 4GHTA 3T2NA 2RCEA 2BB4A 2QY0B 2BLQA 2HLCA 1GJCB 2TGPZ 2XBXA 2BQWB 2OINA 1C9PA 1DWBH 2R0KA 4YLQH 1P2OA 1C2KA 4FUFA 4DG4A 3LC5A 3HPTB 2GMTC 1XVMA 2A4GA 3U98H 3Q00A 4NIVA 1EZQA 1TAWA 4ISLA 1EAUA 1IQFA 3RXRA 1LDTT 3BG4B 1O2KA 1A5HA 3UOUA 2BDGA 2TBSA 3F9GA 5B6OA 3EA8A 2BYAX 4VGCC 3PMJA 1V2LT 1YM0A 4B73A 1ELVA 1GWAA 2J34A 4OS5A 3I77A 1QBVH 3SUDA 1WU1A 3UR9A 1BZXE 1MUEB 4E7NA 4TYDA 1UK3A 2XBVA 3MMGA 2B7DH 2H9EH 1S6HA 2J4IA 3NK8A 1CGIE 1C9TA 1N8OB 2CF9H 2ILNA 2BX3A 3SNDA 2VWLA 3UQVA 3UREA 6CHAB 5GXPA 1OX1A 4CR5A 1ETRH 3PV4A 1GHYH 3RMOH 1TWXB 4LZ1H 1V2OT 3VPKA 1G2MA 1VITH 2OBQA 3ZZ9A 3LGYA 2ZTZA 1AWHB 1UTLM 2QC2A 1V3XA 2W3KA 3O8RA 1ZTLA 1T8LA 2VH6A 1ELCA 1LKAA 4YOJA 1GCTC 3R0FA 7ESTE 1XXFA 3ZZ7A 1C1WH 4IN2A 3VB3A 3SN8A 3SU5A 2JH6D 1CSOE 1KXDA 4ASHA 3ATKA 2VGCB 1UHBB 4YOGA 1VCQA 3H5CB