2ZPRA

Crystal structure of anionic trypsin isoform 2 from chum salmon
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
221
structure length
221
Chain Sequence
b'IVGGYECKAYSQPHQVSLNSGYHFCGGSLVNENWVVSAAHCYKSRVAVRLGEHNIKVTEGSEQFISSSRVIRHPNYSSYNIDNDIMLIKLSKPATLNTYVQPVALPSSCAPAGTMCTVSGWGNTMSSTADGDKLQCLNIPILSYSDCNNSYPGMITNAMFCAGYLEGGKDSCQGDSGGPVVCNGELQGVVSWGYGCAEPGNPGVYAKVCIFNDWLTSTMAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anionic trypsin
publication title A structural comparison of three isoforms of anionic trypsin from chum salmon (Oncorhynchus keta).
pubmed doi rcsb
molecule tags Hydrolase
total genus 53
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zprA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zprA02
2WINI 5EW2H 1GL0E 1W14U 4KGAA 5EXNA 1ZRBA 4CH2B 4YOJA 5ABWA 4ZKSU 3U1IB 2Y5GA 3ZZDA 3TPIZ 2FO9A 1DFPA 4X2XA 2UUFB 1O5AB 2WV5A 1EZXC 5F8ZA 3MU0A 3A7WA 2I6QA 4TY7A 2BY9X 1GVLA 5GCHF 1HAXB 5DKMA 4NSVA 2ZCKP 4OS1A 4X2VA 1O2LA 3ZV8A 1CGHA 2UUYA 1O36A 3QZRA 1O2SA 3A85A 5JPMH 2NU1E 2XCFA 3GY8A 5F6MA 2EEKA 2OLGA 5IYTA 3RXOA 2AIPA 2B7DH 2ZWLH 1J8AA 1NFWA 3G01A 3LGUA 1LQEA 4YESB 1ANDA 1DICA 3M5LA 1GHXH 1E35B 1UK3A 3SQHE 4ZKRU 2UUJB 1W12U 2VWMA 1EP6A 3MMGA 1DOJA 4E06H 1FPHH 2VVVA 1FAXA 1GBKA 1VCWA 4FU9A 5DG6A 2G81E 1GHVH 3ATWA 1KXEA 1S6FA 4Q2KA 1SGEE 1MAXA 1K2I1 2Y7ZA 1GBCA 4J1YA 2FI4E 2G8TA 4KP0A 3F9HA 2GV7A 3PWBA 4A6LA 2W3KA 1H9IE 3EGKH 4LOYH 3QGJA 1UTKA 4NA7A 1L2EA 4JK5A 2SNWA 2H5DA 4IN1A 3MHWU 1SHYA 2BQWB 3P95A 1QBNA 3U8OH 3NWUA 2PKSC 2AYWA 4JZFH 3S69A 4H4FA 3LIWA 1HXEH 1PQ7A 3BG4B 3EA8A 8ESTE 1ARBA 1RJXB 2H9TH 4GPGA 3SV8A 2Z9IA 1GJDB 3EDXB 2FOHA 4RSPA 2STAE 3BN9A 3LT3A 4DCDA 3SUDA 3M5NA 1HV7A 5EOKA 5E2OA 1OWKA 1V2VT 1INCA 2YNAA 1ZHPA 4X8UH 2ODQA 1GBEA 3MU4A 1TONA 3SGBE 4ASHA 5DP8A 3SJOA 2ZP0H 1MQ6A 1C2HA 2JKHA 4GAWA 1IHSH 3SGAE 1BIOA 3RC5A 1K1PA 1PYTD 2FMJA 5DP5A 1MUEB 2B5TB 4AYYB 4ZXXH 2QN5T 1RTLA 1O2NA 2ZHQH 2A4QA 1XUGA 1LHCH 3SNDA 1HAVB 2Z7FE 2LPRA 2THFB 3H7OA 1TMBH 4JZIA 1HB0B 2FPZA 2OP9A 4X1RU 5GDSH 4TWYA 1QB6A 1O2RA 3HGPA 1FN6A 1TPPA 3RLWH 2BQ6B 1XVMA 3M7UA 1C2DA 2D2DA 2EI6A 4WJG2 5SGAE 1SHHB 2VIVA 1F0RA 2BD7A 4JZDH 2C8WB 3LJOA 1IQGA 2ZQ2A 1QQUA 2O8TA 3RXQA 2CMYA 2ZO3H 1JBUH 5AF9H 1P09A 1DITH 1T8LA 1EAXA 1N8OC 3ATLA 4O03A 6CHAC 3RMOH 1KLJH 1MQ5A 2W7SA 3UTUH 1JIMA 1NTPA 1EATA 3MWIU 2A7HA 4H42U 1F7ZA 1Y5BT 1YYY1 2XC4A 1GBMA 1BRUP 3Q3YA 3VB3A 1ANBA 3FVFB 5K7RA 1MBQA 2VGCC 1NROH 5B6OA 3GCTG 1MCVA 1GI8B 3LC5A 4B76A 3GCHB 3GY4A 2M5TA 3I29A 1O5FH 1V2OT 3RXRA 1TX8A 4AG2A 2WUBA 1S82A 5A2MH 3UQVA 1EAIA 4AFSA 1BHXF 3LU9B 1P2QA 4E05H 1C9PA 3U8RH 1EAUA 3VXEH 3KQDA 1C5PA 2R9PA 1CHOG 3ZZBA 1AFQC 3SZNA 4BANB 3MNSA 4UEHH 4XOJA 2ANKH 5L30H 4Y6DA 3W94A 1XMNB 4Y11E 1THPB 1SGIB 1BRAA 2DE9A 3O8CA 2TIOA 4OS5A 2PUQH 1HJAB 4XSKU 2TPIZ 4D7GA 3ITIA 1P9UA 1NC6A 6CHAB 1ZGVA 1C1SA 2R3UA 4F49A 2PTNA 3MI4A 1ZMLA 2W3IA 1BJUA 2Z3DA 3KEEA 1C4Y2 1C5WB 3OU0A 1SC8U 2GKVE 3ZZ3A 1MU8B 2XTTB 4X8SH 4X6NA 3RXJA 3E8LA 4MDSA 1YLDA 1W10U 2R3YA 2ZDMA 1EX3A 2FOBA 1QJ1B 3TJUA 2FX4A 5LPRA 2HLCA 3S9CA 5BPEA 1BMAA 2ZZUH 1VGCC 1EP5A 2H9EH 1SR5C 1TQ0B 1VCPA 1Y3UA 3MTYA 1QB9A 1BT7A 5HM2A 1BTUA 3TK5A 1GDNA 1QIXB 2BDBA 1O3PB 2QC2A 1SGRE 1GJ4H 1CT4E 4ABBA 1H1BA 3UOUA 2ANWA 2V3OH 5C20A 3RM0H 1PPHE 2R0KA 4AGJA 5HYOA 3Q76A 1AN1E 2F91A 5CHAC 3RP2A 1UVPA 3QK1A 4JYVH 2H1UA 1Z1IA 3O8BA 2ZIQH 3PO1B 1AQ7A 2BXUH 3H5CB 1AGJA 2ZFQH 2ZGBH 4TY6A 2CN0H 3QWCH 1GJAB 1Y59T 2VVCA 1FN8A 5HGGA 4BXSA 2G51A 1K28D 1XXDA 4WXVA 4ABHA 2A4RA 1ZRKA 2BDIA 4CR5A 3SHCH 4X6MA 8LPRA 2AIQA 2SGPE 1V2ST 1CGIE 1P06A 2ZGCA 1GI1A 5HMAA 1BTYA 5T3HA 4U01A 1PPGE 5JBBS 1C5MD 1K9OE 2D8WA 3NPSA 1BB0B 1EB2A 2A7CA 2GDDA 2NWNA 1SBWA 1O3GA 5FHTA 1VGCB 3BG8A 2Y5HA 3HK3B 3QDZB 4OGYA 2G4UA 3STIA 4DGJA 7KMEH 1SQOA 1N6YA 1Q2WA 2FTLE 1UCYK 2FWWA 1HFDA 1LHDH 2QY0B 3SU6A 2VH0A 1EKBB 4K8BA 1TMTH 1GBTA 5EW1H 1VJAU 1SOZA 2UWLA 2OTVA 1O34A 1CHOF 1XUKA 3F1SB 4MNWA 1OYTH 1LHEH 4THNH 2GV6A 4X2YA 1UVOA 2XWAA 3T29A 1AWFH 3ZZ4A 3A8CA 4SGAE 4KKDA 1IQIA 2BYAX 2STBE 2ZECA 1ELEE 3BTHE 1HAOH 1Z71A 1OP0A 3U1JB 2G5VA 1D3QB 1GI4A 3Q3KA 1JWTA 1TWXB 2FTMA 1EUFA 3SI4H 1HNEE 8GCHG 4GVUA 2PTCE 5DJ7A 2IOTA 1UMAH 4DG4A 4Y76A 1K21H 2ULLA 1SGYE 1K1OA 1FI8A 1RFNA 3M37A 4NSYA 2F9NA 1YCPM 2A5KA 1AVGH 3M7QA 1GMCG 4INHA 1OWJA 4FUEA 3ODFA 1UHBB 2P8OB 3TU7H 3FZDA 1UTOA 1TIOA 3CS7A 4CRBA 2ZU4A 1HCGA 3RXDA 1L1JA 4K69A 2QXGA 2ZTZA 4UD9H 1WAYB 4WMEA 2GZ9A 3T25A 2R2MB 1GL1A 2QXHA 1ZMNA 5DO4H 4O3TA 1AVWA 3BTDE 5FX6A 1T4VH 2HVXA 4I8GA 4UFEH 3ZYDA 2TGPZ 2C3SA 2Q6FA 1C2JA 4JMYA 4U30A 3UREA 1UJ1A 1P57B 3BV9B 2ANMH 5JBTA 1MTVA 1JIRA 1C9TA 3L3TA 3SU4A 3D65E 4E7NA 2ODYB 1EXFA 4B73A 1NT1A 2BX4A 1ELAA 2XXLA 4I33A 1DUAA 3GOVB 3SJ9A 1T8MA 2DUCA 4WWYA 1N6XA 4ISOA 1ZTJA 2OD3B 1W7XH 3AAVA 1A5HA 4O97A 1DUEA 1UVSH 4ISHH 2A45B 1AFEH 3SJ8A 4NA8A 1HAYB 2VWLA 4X1NU 1TNGA 1SL3A 1F2SE 1CU1A 1V2KT 3FANA 2ZPSA 1V2RT 4BNRA 2Y5FA 4ZROA 3ATKA 5GIBA 2O8UA 5FAHA 1ZPZA 3T27A 2KAIA 3M3SA 2P3UB 4MNXA 3QTOH 2FS8A 2FOAA 5AVDA 3KQCA 1UCYE 1C5UA 4X6PA 2K1QA 2BOHB 1YPEH 2UUKB 1BTXA 5ETXA 5G4BA 1AHTH 1E38B 5JDUB 1SLXB 1CA0B 2OCVB 1S0QA 4ZKNU 3RXFA 2J94A 2ZCHP 3RC6A 1UTPA 2F9BH 2JETB 3NUMA 1GWAA 1HXFH 4IGDA 3MNBA 2ZGHA 3ZZ5A 2J92A 5C1XA 1BHXB 1ESBA 4NFEA 4X8TH 4ZKOU 1O2VA 1DSUA 6LPRA 1QRWA 4A1TA 1RS0A 2GT8A 5A8ZA 1RIWC 4U2WA 1A5IA 3GCOA 1TPAE 1WTGH 4XBBA 4OS4A 3ZZCA 3HKIB 1AKSA 2CHAC 4JZEH 1O32A 4A7IB 1XXFA 3V13A 2D26C 5DP3A 1B7XB 2F3CE 1BBRH 1THSH 1DWBH 4AYVB 3BSQA 1GHZA 2Y7XA 4X8VH 1EB1H 2FYRA 4FVDA 4QT8C 1IQJA 1GMCF 4ZHLU 3M5OA 1A5GH 1C1UH 1KXDA 2NU4E 1DM4B 3DT0H 2ZDNA 4PROA 1SQAA 3VB5A 3RMMH 5EU8A 2QIQA 1NRPH 4FU7A 4O9VA 4X6OA 3QTVH 1WQSA 1EJAA 3TLOA 1ZHRA 3HATH 1P2IA 1XUIA 3A83A 1GHWH 1ELDE 1E37B 4X1QU 4YLUA 2ZTYA 1EZUC 4YM9A 4D9QA 3TK9A 3SU2A 1FNIA 1GGDC 1QA7A 1K1LA 3UWIA 4JYTA 2PW8H 1HAPH 3GYLB 5LPFA 1WUNH 1ZMJA 2QV1A 2Z3CA 2P59A 3UOPA 3QGNB 1S5SA 3QN7A 1C1QA 1BJVA 1PQAA 1NPMA 3V7TA 1V2JT 1S83A 5AFZH 3EYDA 5EODA 2W26A 3TGJE 2PHBA 1XM1A 2B8OH 1RIWB 1G3CA 3GY6A 3UPEA 3TGKE 1C1OA 4XE4A 3PLPA 3SNAA 2CHAB 4K60A 7ESTE 1E0FD 3O8DA 1SB1H 1GBBA 3AAUA 1GBHA 3CP7A 1OX1A 4OS6A 1FLEE 4CHAC 5A09A 1KIGH 2I6SA 4MTBA 1SFIA 1KXAA 1C2IA 3N7OA 2AEIH 5DP9A 4NIVA 4HZHA 1AE5A 2QXIA 4Y8ZA 2HALA 1FY1A 1W7GH 3PM3A 1BMMH 2Z9KA 1CA8B 1MKWH 3HGNA 3SV2H 2VIQA 2A31A 4NG9H 1TNHA 4NZLA 2PKAB 1OPHB 3ELAH 1HIAA 3O8RA 5C1UA 1HAZB 3PMBB 1C5TA 4Y8YA 5C3NA 1AY6H 1TGTA 1TNIA 3PB1E 3IG6B 1O5GH 1A0LA 2AMDA 1V2WT 5L2ZH 1RRKA 1TRYA 4YZUA 1G30B 1NRNH 1SGFA 2YOLA 2BD5A 1XVOA 2VH6A 1GHBG 3BTTE 5J4QA 2VIDA 4BTTB 2UWPA 1YC0A 4BAOB 1YCPH 2FDAA 2XRCA 4AGKA 3BTGE 1A3EH 4UFFH 4BTUB 7GCHG 2BXTH 4NGAH 1MKXK 3EA7A 1BRBE 3D23A 1D3PB 1LVYA 5K0HA 1NRSH 2ZHFH 5ESTE 1DE7H 3SUGA 1MTNC 1Z8JB 4A92A 3PWCA 2VIOA 1H9HE 2J34A 2ZF0H 1FV9A 5DPAA 5C5OA 3MYWA 4ISNA 2PGQB 3MFJA 1C1VH 1SQTA 2CV3A 2YNBA 2A5AA 3B8JA 3U9AH 1K1NA 4FUJA 1Y8TA 1ESTA 1IOEA 3S7HB 4IBLH 5F03A 1P2OA 1TLDA 2WYGA 2C90B 1AB9C 2XBXA 2BX3A 2V3HH 3ZV9A 5DGJA 1TBRH 3RU4T 1T32A 2AERH 4LXBH 3T62A 1LVBA 1QL8A 1SFQB 4IC5A 1QJ7B 1GBIA 4GCHG 2TRMA 3A7VA 3ATIA 1AMHA 2A32A 4FUDA 3P6ZB 2HRVA 1PPCE 1V2QT 4FUCA 1P2MA 1BITA 1WQVH 1NU7B 2PKSB 1TMUH 1SGFG 4YO9A 1A2CH 1EPTA 2XBWA 1O3OA 1QB1A 1J9CH 1TX6A 1IQFA 1GDQA 2ANYA 2ZGJA 1YPHC 1HAHH 4AZ2B 1H4WA 4FUHA 4MNVA 5E0JA 1T7CA 1P2JA 5A8YA 1MTNB 3OTJE 1FDPA 1OWHA 1MBMA 1ZJKA 1UTMA 2QCYA 3MOCA 1DLKB 1C5QA 3LGTA 2XC0A 2AH4X 4KELA 4UFDH 3SN8A 4AFZA 1D3DB 1QBOA 1ZLRA 1DXWA 1UVTH 2ESTE 3KNXA 5F8TA 3DA9B 3BTWE 3E3TA 1ZTLA 1J14A 1ELGA 3SJIA 1BMLA 1O5DH 2JH0D 1P9SA 3ENSB 2F9OA 5FPYA 3RXMA 1LVMA 1J17T 4AN7A 1V2NT 1TNKA 1OOKB 3E16B 4UONA 2ZFRH 1HJ9A 1P2KA 1ZHMA 1F0UA 2BLWA 1F0SA 5FPTA 2J95A 3K6YA 1BA8B 4X1PU 2BDGA 3Q77A 3P8GA 3DHKH 4UE7H 1O3EA 1W0ZU 3BTQE 2QF0A 1QURH 4R8TB 1BMNH 1N8OB 3QO6A 2BZAA 4Y0ZE 1TAWA 1O3DA 1DY9A 1SMFE 3A7YA 1QTFA 3SV7A 1OWIA 2RA0A 1YPKH 3UIRA 1RTKA 4CR9A 1O3HA 1JOUB 1O3FA 2OINA 4IS5A 4ZUHA 3ZZAA 3RU4E 1AO5A 1OP2A 4LZ1H 1O2TA 3BTFE 3LDXH 4DOQA 1OXGA 1JRSA 1C2FA 3C27B 1O39A 2VGCB 1MD8A 1GBFA 1CBWC 3TH4H 3A7ZA 1AE8H 1IQMA 4Q7XA 3GCNA 3RU4D 1TX7A 3B9FH 5JB8S 1IAUA 1C2MA 1WCZA 2ASUB 1NO9H 4IMQA 1GHYH 4GCHF 4I8HA 1O35A 1OSSA 1C5VA 1SGTA 4HFPB 2FOMB 4B75A 1DVAH 1JRTA 1LTOA 4DIIH 1CO7E 4BAHB 1BTWA 1O37A 1AFQB 1ACBE 4NWLA 1WYKA 1VZQH 1MMJN 3QZQA 4FUGA 2AGEX 1SI5H 3RXTA 2P95A 2ZU2A 4K5ZA 1F5LA 1ZJDA 1H9LB 2ZKSA 3GY3A 3UFAA 4BAMB 1EJNA 4GLYA 5L6NH 3TNSA 4YT7H 2O8LA 2GVFA 5T6GA 2QXJA 3T28A 3LOXA 4OS2A 2BDYA 5T6DA 4VGCC 3PLKA 1D6WA 1GBLA 3UNRA 3L33A 1H8DH 3RXPA 1O3MA 2SGDE 5FPSA 2GCHG 4H6TA 5EGMA 3P17H 1Q3XA 1O2QA 3DUXH 5A0BA 1D3TB 2FI3E 1GMDG 1XUHA 1TOMH 1QY6A 1ZGIA 2HNTC 3GCTF 1KDQA 3F68H 3QX5H 5JYIA 2XC5A 1TB6H 1P8VC 3T26A 1BRCE 2FX6A 2PR3A 1BTHH 1YF4A 1BZXE 1ARCA 2NU3E 1IQLA 5PTPA 1GMHG 1S85A 3SOSA 1C1NA 4NA9H 1TNJA 2V35A 1SLWB 2VB0A 5T6FA 3F6UH 3PTBA 1YBWA 1Z6JH 1PYTC 2TGTA 3P8NA 4CRGA 2XBVA 4NIYA 1OWEA 5L2YH 3P70B 5CHAB 1ELFA 2EC9H 2BHGA 2G00A 5EXMA 4YT6H 1KY9A 1O2KA 5E0GA 1ANCA 2ZDLA 3SBKA 2J2UA 2BLQA 1GG6C 1ID5H 9ESTA 4MQAA 4I7YH 3RXAA 1XKBC 3GDUA 3VXFH 5CE1A 4VGCB 2A4GA 1FY3A 1ETSH 3RDZA 1O3NA 4NZQA 1DWCH 2B9LA 3VB4A 3M36A 1TFXA 4ISLA 1DDJA 2IPHA 4K8YA 1LDTT 1OKXA 2PSXA 3S9BA 4ZXYH 1C4V2 3S7KB 2Z6BD 3K6ZA 3A81A 4UDWH 2WPMS 2O8MA 4ZH8A 1AD8H 1ZSJA 1EAWA 1UTJA 4CRDA 2BTCE 1UK4A 2WPLS 3KCGH 2R2WU 3JZ2B 2VU8E 4Y79A 3BIUH 3OY5U 1C1MA 3URDA 1X7AC 1PPBH 2FOGA 2VINA 2P93A 1HRTH 1KTSB 3D62A 3M61U 5A0CA 1A4WH 1C5SA 2ZDVH 4INKA 2VJ1A 1NN6A 2A5IA 1AWHB 2G52A 2PV9B 2OQ5A 1ELBA 5DK1A 1C5YB 2DE8A 2H5CA 5HXFA 1TNLA 2GZ8A 2FOEA 3SI3H 1S84A 4AX9H 4Y7BA 2A2QH 4R0IA 1C5RA 3K2UA 4MPWA 4ABDA 4WH8A 1CGJE 5FCKA 3MU8A 3RLYH 1C5XB 1NFUA 3M3VA 1P0SH 1LKAA 1U6QA 2P16A 2SFAA 4GHTA 1UVUH 1TGNA 1T31A 3A87A 3MNCA 2GMTC 3I77A 4GHQA 4MNYA 3SW2B 3P8OA 3UR6A 1EQ9A 1A46H 4MLFB 1DWEH 3SHAH 3SU3A 1VCQA 3A88A 1C2GA 3RXKA 1RGQA 4Y8XA 3MH4A 3A82A 1GMDF 2HPQH 3BF6H 5FBIA 3U69H 3VB6A 1TABE 2Z3EA 1QFKH 5TCAA 1THRH 4Y10E 1HUTH 5AFYH 3RC4A 2JH6D 2SGAA 2SGFE 2ZU1A 1SLVB 2C8ZB 2VVUA 1ZSKA 5GCHG 2SGQE 1KXFA 3V0XA 1SGPE 1G3BA 3EA9A 3LKWA 1AUTC 1CQQA 1O31A 1OWDA 1GBAA 1GMHF 3T5FH 1GI2A 1L4DA 3PTNA 1EOLA 1BDAA 2GT7A 2XNIA 1HLTH 1N1LA 3CENA 1DSTA 3VPKA 3SO3A 1D6RA 2FS9A 1C4U2 4RKOB 2PSYA 4M7GA 1FIZA 1V2UT 1C5ZB 2F9PA 4RN6A 5A0AE 4D7FA 1IQEA 4DT7B 1Z8GA 2WUCA 4ISIH 1C1PA 3VGCC 1P2NA 3KN2A 1O3BA 5C5NA 1CE5A 4IW4E 3V3MA 3AW1A 2EI7A 4U32A 1C2KA 1FAKH 1O2IA 2V6NA 1ABIH 8GCHF 4KTUA 3IITA 3GDSA 1PQ5A 1ZR0A 1HJ8A 1O2UA 1J15A 4UFGH 2D1JA 2O8WA 1F0TA 2AMPA 2ZU5A 4GUXA 3SU0A 2Y82A 2OC0A 3FZZA 2C4FH 1LPGB 1NFXA 5LH8A 1W3CA 1QQ4A 2BDCA 4CRCA 1KXBA 2HGTH 3A8BA 3A84A 2B0FA 4FUIA 1KYNA 1SLUB 1PJPA 1WSSH 1DPOA 1DY8A 2GP9B 4AB8A 1GBJA 2GCTC 4JYUH 4MPXA 2FESH 3BEUA 2QA9E 2ZQ1A 4AORA 2P3TB 1ORFA 1EZQA 4ZHAA 3ZZ8A 3RMNH 1KTTB 1PPFE 2XBYA 1J16A 2JH5D 1BTPA 2Q1JA 3PMJA 1DS2E 1FY8E 2P94A 2GZ7A 2ZHDA 4H6SB 4ABAA 1V2LT 1HIAB 3FP8E 4ABGA 1CT0E 2AFQB 4Q7YA 2FYQA 1K22H 3CS0A 3TJNA 3UR9A 1LPKB 3A8DA 1YCPK 1NRQH 2EA3A 4HI3A 4RKJB 3MU1A 3NK8A 1BBRE 3RXEA 2OC7A 1CVWH 1E36B 1FMGA 3P92A 2BD8A 5FBEA 3RXIA 5GXPA 1CSOE 1B0FA 5CMXH 2Y6TA 1NU9A 1XKAC 2BDAA 3AVZA 4YTAA 1NESE 1V2TT 1ZSLA 3HK6B 4JZ1A 4JK6A 1OYQA 4CBNA 1EPTC 3M3TA 1W8BH 1WV7H 2J9NA 4CH8B 1FY4A 3GY5A 4MVNA 3SNBA 1ANEA 2IN2A 3KQBA 3LH1A 3BG4C 3TJVA 1KXCA 4SGBE 2TGDA 4TWWA 4YLQH 1FY5A 1SSXA 3KF2A 3QLPH 4MPUA 1GBDA 4FUFA 1SPJA 2GCTB 1C5OH 1NM6A 2BB4A 4FU8A 4FXGH 4Y7AA 1MTUA 3F9FA 4B71A 1HYLA 1YPMH 3NXPA 3TNTA 4IMZA 1O5EH 1C2EA 4WH6A 3SGQE 1ZPCA 1A0JA 1GGDB 3M7TA 1C5LH 4I32A 1AI8H 1T8NA 3MO9A 5EG4A 3GYMA 2QF3A 1EJMA 3RUOA 1SGNE 2ZCLP 1P12E 2ALPA 5AHGH 2ZGXH 1XUJA 5FXLA 4I31A 2GDEH 2F83A 1QCPA 1OP8A 3C1KA 3E0NB 3L6PA 2BDHA 1L0ZA 1A61H 1PPEE 1TE0A 5E8EH 3PROA 6GCHG 2HWLB 1Z8IB 5HM9A 4JCNA 1AU8A 1SOTA 1O2JA 1O2GH 1LO6A 1TGBA 2HNTF 1EPTB 4K1EA 4CHAB 2HNTE 1EASA 2CGAA 1A3BH 1IQKA 2J4IA 5EPNA 1YPLH 1MZDA 4XDEA 3ZZ9A 1Z7KA 4Y71A 3A89A 4MPVA 1O2MA 2J38A 3PYHA 4WVPE 1C1RA 2FI5E 1NS3A 2XCNA 1ZYOA 4Z6AH 2FXRA 1NY22 4FVBA 5DP7A 3TH3H 1UO6A 4E7RG 3K65B 5LGOA 2WPJS 2VIWA 1O2PA 3RXSA 1YKTA 1B5GH 4B74A 1T4UH 2PKAA 1LMWB 3HPTB 4BTIB 1QRZA 3MO3A 1FZZA 1P11E 3KL6A 1G3DA 3ZVCA 2FP7B 2Y81A 1TOCB 2RCEA 1E34B 3GCHC 1IQHA 1T8OA 2BM2A 5DP4A 1AZZA 1TBZH 1RTFB 5TCCA 3UNSA 2GD4B 4F4OC 1NFYA 3VEQB 3QUMP 2W7UA 1YPJH 2Z94A 3TIUA 1K1IA 3A80A 2W5EA 5FCRA 4A1VA 1OS8A 2BOKA 2GX4A 2ZC9H 3GICB 3LGVA 3DFLA 1G2MA 3TITA 2BQ7B 2A7JA 2RG3A 3TJOA 2GGVB 5DP6A 4Z0KA 3U8TH 3ZYEA 5EQQA 1G3EA 1GDUA 4A1XA 5I46H 1FXYA 1MAYA 3BTEE 1SGQE 5EQRA 5JB9S 3V12A 1V6DA 1A1RA 2Y80A 3T2NA 3LC3A 1UTNA 1GCTC 1YGCH 4FUBA 1BOQA 3OYPA 4AFQA 4DIHH 1MTSA 1QA0A 1LHGH 4ZMAH 3PMHB 1MKXH 1HJAC 2Z9JA 1DT2A 3TVJB 4B1TA 4ZAEA 2BD9A 4YOGA 3UY9A 1DANH 4NIWA 4WXIA 5ESBA 3MH5A 1AB9B 3UNQA 1ELTA 3UQOA 2QAAA 1TALA 1F5KU 2FZZA 3MU5A 3SJKA 1VR1H 1L1NA 4XBDA 3E90B 1HAVA 1G9IE 1LHFH 1GPZA 2ZA5A 4NIXA 4DW2U 3SUEA 1GHBF 3LPRA 1GJ9B 1BQYA 2ZTXA 4XFQA 6ESTA 1QRXA 3PMAB 3RXGA 1QL9A 3VFEA 2SNVA 4TYDA 4DVAU 3ZVEA 4XBCA 1TGSZ 7GCHF 4ZHMU 2QGRA 2Z9GA 3S9AA 4Q80A 1P02A 2UWOA 1Z6EA 1UTLM 5EXLA 6GCHF 4D76A 3SNCA 3UUZA 2ZHEH 4AB9A 5GJ4B 1GJ8B 3ZVBA 1W0YH 1ZOMA 1ETTH 4OGXA 3TK6A 1KSNA 2VIPA 2RDLA 4DURA 1FQ3A 1LQDB 2WPKS 5JBCS 1GCTB 1O2OA 1RXPA 3RXCA 4K2YA 1O2ZA 3PO1C 1EOJA 1LPZB 5EQSA 2FM2A 2XW9A 3GY7A 4K3JA 2XWBI 4CBOA 3S0NA 2AS9A 3OY6U 4ABJA 3Q3XA 1QL7A 2ZG0H 1BTZA 3NZIA 2FOCA 3D49H 3ZVFA 5LPEA 9LPRA 2BY7X 1Y5UT 1YP9A 2QYIA 1KDQB 1GI7B 2IJOB 3SQEE 3KGPA 4LZ4B 3BIVH 1JMOH 1A7SA 1SVPA 3PV4A 2FOFA 1PQ8A 3BTME 2HOBA 1C5NH 2EI8A 1O2XA 2BY5X 1S81A 2TGAA 5GPIB 3E1XB 3MNXA 4X0WU 1B0EA 3SV9A 1QNJA 1ELCA 1G36A 2TBSA 5J4SA 1TRNA 2H2ZA 1QR3E 1V2PT 2PLXA 4CREA 1NRRH 4O3UA 1HDTH 3LGWA 1SGDE 2BVXH 2OXSA 1K1JA 1Y3VA 2FODA 2BLVA 2OBQA 4D9RA 3SUFA 4INLA 1GI6A 1PPZA 5I25A 2PFEA 4YOIA 1EZSC 3UWJH 3LONA 2WPIS 2A2XH 1GJ6A 2NU0E 1ABJH 3WY8A 1XX9A 3KIDU 3URCA 3U98H 3RXBA 4DY7B 2R0LA 1CBWB 1Z1JA 1FUJA 1C2LA 4X2WA 2OBOA 3LH3A 1AUJA 3NKKA 1Y3WA 2F9UA 3RXLA 4A5TS 3DD2H 5TJXA 3OX7U 2G55A 3KQEA 5GWZA 1FJSA 3E6PH 1P05A 2FIRH 2P8OC 3F9GA 3MO6A 3FFGA 1P04A 2ZI2H 3IWMA 1GHAG 2Z9LA 1TRMA 2WYJA 1G37A 1GJ5H 1O3AA 4LK4A 3ZVDA 1W13U 1LKBA 3BTKE 2ZPRA 3K9XB 1WOFA 1GVKB 4AFUA 1MD7A 1DXPA 4I8JA 2H9HA 2WPHS 2ILNA 1C1WH 2ZFFH 2BMGB 3MH7A 3B23B 1Y5AT 1ESAA 4ABIA 3W95A 2A4OA 1KLTA 2BY8X 4MG3A 1M9UA 1GI0A 1MH0A 1W2KH 1TYNA 1HAIH 4NFFA 3RMLH 1SGCA 3LGYA 4J2YB 3HKJB 3R0FA 1GI9B 2PWXA 3MH6A 4X1SU 1FIWA 5JBAS 4I8KA 1BUIA 2AGIX 1DX5M 1P01A 1Y3XA 4WMFA 2A0QB 2C8YB 3AASA 1IHTH 1ZPBA 1YM0A 2CF9H 3KHVA 4WF8A 1ZTKA 3P8FA 5BRRE 3GISB 2VNTA 3RM2H 1XUFA 1V3XA 1C1TA 3RXHA 1H8IH 1P10A 1O33A 2FEQH 2KAIB 3M35A 1CT2E 2G4TA 3BEFB 1L4ZA 1VITG 1TA2A 2CF8H 1NZQH 1P03A 3DFJA 2FLBH 2ZDAH 3LJJA 1JXPA 3ZVAA 4IC6A 3A86A 1O38A 5F8XA 3EAJA 1V2MT 3F9EA 1ETRH 1YPGH 3OSYA 1MCTA 1TA6A 3BEIB 4K1SA 1WTHD 2GTBA 1HBTH 2XYAA 1CA0C 2OQUA 1QJ6B 3ODDA 2Q6DA 4ABFA 5C1YA 3R3GB 1UCYH 3A7TA 2ZFTA 2C8XB 4GSOA 1O2HA 2JETC 1QHRB 1GG6B 4B2BA 1BBRK 1WBGB 1FPCH 2BVSH 1GI5A 1HGTH 1GI3A 2GCHF 1WU1A 2PGBB 2BD2A 2ZDKA 1FONA 2NU2E 2V0BA 5E2PA 4I8LA 3EE0B 1AIXH 1O3JA 2BD3A 2BD4A 2VWNA 1AKSB 1TPSA 1Q31A 4OS7A 3SV6A 2Q6GA 3LGIA 5EPYA 1S6HA 3EQ0H 4TPYA 1UHBA 1QGFA 1O2YA 2AMQA 3ATMA 4K1TA 1G2LA 5A8XA 3SNEA 2O9QA 1RD3B 4KTSA 2H6MA 1O3CA 3SU1A 4Y0YE 1DLEA 1SG8B 1MTWA 3RXUA 2BLOA 1GCDA 5E0HA 3STJA 1GHAF 1UK2A 1W11U 3ZZ7A 3ZVGA 3RXVA 4CRFA 5C67A 5IDKA 2C93B 5H4IB 4CRAA 3E91A 2LNCA 3JZ1B 1LCYA 4B2CA 3VB7A 1O2WA 1VITH 2ALVA 8KME2 1UTQA 4DJZB 1O3LA 2ZU3A 4AOQA 1YLCA 1YPHE 2OUAA 4D8NA 1TQ7B 3I78A 3SU5A 2ODPA 4IN2A 3GDVA 2CXVA 2HPPH 1IQNA 3TGIE 2BVRH 4B2AA 1GJ7B 2AGGX 1Y3YA 1TBQH 2WV4A 1F5RA 4ABEA 2GMTB 3Q00A 3ESTA 4NWKA 3FP6E 1ELVA 1S0RA 3A7XA 1A0HB 2FLRH 4NCYA 1LVOA 4Q7ZA 3AW0A 1D9IA 2BY6X 2ZPQA 1O30A 2ZFPH 3A8AA 1F92A 4AG1A 2RA3A 2A1DB 1TGCA 2ZNKH 3H7TA 1O3IA 2CJIA 4TPIZ 1O5BB 1DWDH 4KTCA 3FP7E 1K1MA 1Z8RA 1MKWK 3ZZ6A 2ZHWH 2SGEE 3NCLA 3FAOA 1G32B 1QBVH 4BAKB 1CHGA 1GJCB 2P3FH 1VJ9U 5FX5A 1O5CB 1TPOA 2G5NA 1PFXC 5C2ZA 1MU6B 4HTCH 1VITF 3M5MA 1MZAA 1P3EA 2PUXB 1BCUH 1O0DH 1HAGE 1O3KA 3SORA 4HGCA 2VWOA 2F9VA 2ZFSA 1P3CA 1D4PB 4WY3A 3GY2A 4BXWA 2ZEBA 1AVXA 3TH2H 3E0PB 4BAQB 1AZ8A 2BZ6H 1ZZZA 3VGCB 1GVZA 3PLBA 7LPRA 4WMDA 2OC8A 1GJBB 1HPGA 2OC1A 4ESTE 1KLIH 1L1GA 4BOHA
chains in the Genus database with same CATH superfamily
2WINI 5EW2H 1GL0E 1W14U 4KGAA 5EXNA 1ZRBA 4CH2B 4YOJA 5ABWA 4ZKSU 3U1IB 2Y5GA 3ZZDA 3TPIZ 2FO9A 1DFPA 4X2XA 2UUFB 1O5AB 2WV5A 1EZXC 1E79D 1OHHD 2LELA 3MU0A 3A7WA 5F8ZA 2I6QA 4TY7A 2BY9X 1GVLA 5GCHF 1HAXB 5DKMA 4NSVA 2ZCKP 4OS1A 4X2VA 1O2LA 3ZV8A 1CGHA 2UUYA 1O36A 3QZRA 1O2SA 3A85A 5JPMH 2NU1E 2XCFA 3GY8A 4FOUC 2EEKA 5F6MA 2OLGA 5IYTA 3RXOA 2AIPA 2B7DH 2QF4A 2ZWLH 1J8AA 1NFWA 3G01A 3LGUA 1LQEA 4YESB 1ANDA 1DICA 3M5LA 1GHXH 1E35B 1UK3A 3SQHE 4ZKRU 2UUJB 1W12U 2VWMA 1EP6A 3MMGA 3OFND 3KYFA 1DOJA 4E06H 1FPHH 2VVVA 1FAXA 1GBKA 1VCWA 4FU9A 5DG6A 2G81E 1GHVH 3ATWA 3PRDA 1KXEA 1S6FA 4Q2KA 1SGEE 1MAXA 1K2I1 2Y7ZA 1GBCA 4J1YA 5CHBA 2FI4E 2G8TA 4KP0A 3F9HA 2GV7A 3PWBA 4A6LA 2W3KA 1H9IE 3EGKH 4LOYH 3QGJA 1UTKA 4XD7D 1YWUA 4NA7A 1L2EA 4JK5A 2SNWA 2H5DA 4IN1A 3MHWU 1SHYA 2BQWB 3P95A 1QBNA 3U8OH 3NWUA 2PKSC 2AYWA 4JZFH 3S69A 4H4FA 3LIWA 1HXEH 1PQ7A 3BG4B 3EA8A 8ESTE 1ARBA 1RJXB 2H9TH 4GPGA 3SV8A 2Z9IA 1GJDB 3EDXB 2FOHA 4RSPA 2STAE 3BN9A 3LT3A 4DCDA 3SUDA 3M5NA 1HV7A 5EOKA 5E2OA 3OTPA 1OWKA 1V2VT 1INCA 2YNAA 1ZHPA 4X8UH 2ODQA 1GBEA 3MU4A 1TONA 3SGBE 4ASHA 5DP8A 2F43B 3SJOA 2ZP0H 1MQ6A 1C2HA 2JKHA 4GAWA 1IHSH 3SGAE 1BIOA 3RC5A 1K1PA 1PYTD 2FMJA 5DP5A 1MUEB 2B5TB 4AYYB 4ZXXH 2QN5T 1RTLA 1O2NA 2ZHQH 2A4QA 5DN6D 1XUGA 1LHCH 3SNDA 1HAVB 2Z7FE 2LPRA 2THFB 3H7OA 1TMBH 4JZIA 1HB0B 2FPZA 2OP9A 4X1RU 5GDSH 4TWYA 1QB6A 1O2RA 3HGPA 1FN6A 1TPPA 3RLWH 2BQ6B 1XVMA 3M7UA 1C2DA 2D2DA 2EI6A 4WJG2 5SGAE 1SHHB 2VIVA 3PRBA 1F0RA 2BD7A 4JZDH 2RFKC 2C8WB 3LJOA 1IQGA 2HVYB 3DCLA 2ZQ2A 1QQUA 2O8TA 5FL7D 3RXQA 2CMYA 2ZO3H 1JBUH 5AF9H 1P09A 1DITH 1T8LA 1EAXA 1N8OC 3ATLA 4O03A 6CHAC 3RMOH 1KLJH 1MQ5A 2W7SA 3UTUH 3U28C 1JIMA 1NTPA 1EATA 3DSGA 3MWIU 2A7HA 4H42U 1F7ZA 1Y5BT 1YYY1 3GS9A 1K0HA 2XC4A 1GBMA 3KYGA 1BRUP 3Q3YA 3VB3A 1ANBA 3FVFB 5K7RA 1MBQA 2VGCC 1NROH 5B6OA 3GCTG 1MCVA 1GI8B 3LC5A 4B76A 3GCHB 3GY4A 2M5TA 2K0QA 3I29A 1O5FH 1V2OT 3RXRA 1TX8A 4AG2A 2WUBA 1S82A 5A2MH 3UQVA 1EAIA 4AFSA 1BHXF 3LU9B 1P2QA 4E05H 1C9PA 3U8RH 1EAUA 3VXEH 3KQDA 2LP6A 1C5PA 2R9PA 1CHOG 3ZZBA 1AFQC 4XRNA 3SZNA 4BANB 3MNSA 4UEHH 4XOJA 2ANKH 5L30H 5C94A 4Y6DA 3W94A 1XMNB 4Y11E 1THPB 1SGIB 1BRAA 2DE9A 3O8CA 2TIOA 4OS5A 2PUQH 1HJAB 4XSKU 2TPIZ 4D7GA 3ITIA 1P9UA 1NC6A 6CHAB 1ZGVA 1C1SA 2R3UA 4F49A 2PTNA 3MI4A 1ZMLA 2W3IA 1BJUA 2Z3DA 3KEEA 1C4Y2 1C5WB 3OU0A 1SC8U 2GKVE 3ZZ3A 1MU8B 2XTTB 4X8SH 4X6NA 3RXJA 3E8LA 4MDSA 1YLDA 1W10U 1YY3A 2R3YA 2ZDMA 1EX3A 2FOBA 1QJ1B 3TJUA 2FX4A 5LPRA 2HLCA 3S9CA 5BPEA 3W1EA 1BMAA 2ZZUH 1VGCC 2EY4C 1EP5A 1W0JD 2H9EH 1SR5C 1TQ0B 1VCPA 1Y3UA 3MTYA 1QB9A 1BT7A 5HM2A 1BTUA 3TK5A 1GDNA 1QIXB 2BDBA 1O3PB 2QC2A 1SGRE 1GJ4H 1CT4E 4ABBA 1H1BA 3UOUA 2ANWA 2V3OH 5C20A 3RM0H 1PPHE 2R0KA 4AGJA 5HYOA 3Q76A 1AN1E 2F91A 5CHAC 3RP2A 1UVPA 3QK1A 4JYVH 2H1UA 1Z1IA 3O8BA 2ZIQH 3PO1B 1AQ7A 2BXUH 3H5CB 1AGJA 2ZFQH 2W6JD 2ZGBH 2CN0H 4TY6A 3QWCH 1GJAB 1Y59T 2VVCA 1FN8A 5HGGA 4BXSA 2G51A 1K28D 1XXDA 4WXVA 4ABHA 2A4RA 1ZRKA 2BDIA 4CR5A 3SHCH 4X6MA 8LPRA 2AIQA 2SGPE 1V2ST 1CGIE 1P06A 5HIZA 2ZGCA 1GI1A 5HMAA 1W0KD 1BTYA 2XOKD 4B6FA 5T3HA 4U01A 1PPGE 5JBBS 1C5MD 1K9OE 2D8WA 3NPSA 5F53A 1BB0B 1EB2A 2A7CA 2GDDA 2NWNA 1SBWA 1O3GA 5FHTA 1VGCB 3BG8A 2Y5HA 3HK3B 3QDZB 4OGYA 2G4UA 3STIA 4DGJA 7KMEH 2KX4A 1SQOA 1N6YA 1Q2WA 2FTLE 1UCYK 2FWWA 1HFDA 1LHDH 2QY0B 3SU6A 2VH0A 1EKBB 4K8BA 1TMTH 1GBTA 5EW1H 1VJAU 1SOZA 2UWLA 2OTVA 1O34A 1CHOF 1XUKA 3F1SB 4MNWA 1OYTH 1LHEH 4THNH 5GNDA 2GV6A 4X2YA 1UVOA 2XWAA 3T29A 1AWFH 3ZZ4A 3A8CA 4SGAE 4KKDA 1IQIA 2BYAX 2STBE 2ZECA 1ELEE 3BTHE 3OEHD 1HAOH 1Z71A 1OP0A 3U1JB 2G5VA 1D3QB 1GI4A 3Q3KA 1JWTA 1TWXB 2FTMA 1EUFA 3SI4H 1HNEE 8GCHG 4GVUA 2PTCE 5DJ7A 2IOTA 1UMAH 4DG4A 4Y76A 1K21H 2ULLA 1SGYE 1K1OA 3DSPA 3VG8A 1FI8A 1RFNA 3M37A 4NSYA 2F9NA 1YCPM 2A5KA 1AVGH 3M7QA 1GMCG 4INHA 1OWJA 2CK3D 4FUEA 3ODFA 1UHBB 2P8OB 3TU7H 1BMFD 3FZDA 1UTOA 1TIOA 3CS7A 4CRBA 2ZU4A 1HCGA 3RXDA 1L1JA 4K69A 2QXGA 2ZTZA 4UD9H 1WAYB 4WMEA 2GZ9A 3OE7D 3T25A 2R2MB 1GL1A 2QXHA 1ZMNA 5DO4H 4O3TA 2XNDD 1AVWA 3BTDE 5FX6A 1T4VH 2HVXA 4I8GA 4UFEH 3ZYDA 2TGPZ 2C3SA 2Q6FA 1C2JA 4JMYA 4U30A 3UREA 1UJ1A 1P57B 3BV9B 2ANMH 5JBTA 1MTVA 1JIRA 1C9TA 3L3TA 3SU4A 3D65E 4E7NA 2ODYB 1EXFA 4B73A 1NT1A 4M9FA 2BX4A 1ELAA 2L74A 2XXLA 4I33A 3UAIC 1DUAA 3GOVB 3SJ9A 1T8MA 2DUCA 4WWYA 1N6XA 4ISOA 1ZTJA 2OD3B 1W7XH 3AAVA 1A5HA 4O97A 1DUEA 1UVSH 4ISHH 2A45B 1SQRA 1AFEH 3SJ8A 4NA8A 1HAYB 2VWLA 4X1NU 1TNGA 2V7QD 1SL3A 1F2SE 1CU1A 1V2KT 3FANA 2ZPSA 1V2RT 4BNRA 2Y5FA 4ZROA 3ATKA 5GIBA 2O8UA 5FAHA 1ZPZA 3T27A 2KAIA 3M3SA 2P3UB 5EIYA 4MNXA 3QTOH 2FS8A 2FOAA 5AVDA 3KQCA 1UCYE 1C5UA 4X6PA 2K1QA 2BOHB 1YPEH 2UUKB 1BTXA 5ETXA 5G4BA 1AHTH 1E38B 5JDUB 1SLXB 1CA0B 2OCVB 1S0QA 4ZKNU 3RXFA 2J94A 2ZCHP 3RC6A 1UTPA 2F9BH 2JETB 3NUMA 1GWAA 4YXWD 1HXFH 4IGDA 3MNBA 2ZGHA 1H8HD 3ZZ5A 2J92A 5C1XA 1BHXB 1ESBA 4NFEA 4X8TH 4ZKOU 1O2VA 1DSUA 6LPRA 1QRWA 2KM0A 4A1TA 1RS0A 2GT8A 5A8ZA 1RIWC 4U2WA 1A5IA 3WWBA 3GCOA 1TPAE 1WTGH 4XBBA 4OS4A 3ZZCA 4I86A 3HKIB 1AKSA 2CHAC 4JZEH 1O32A 4A7IB 3F2FA 1XXFA 3V13A 2D26C 5DP3A 1B7XB 2F3CE 1BBRH 1THSH 1DWBH 4AYVB 3BSQA 1GHZA 2Y7XA 4X8VH 1EB1H 2FYRA 4FVDA 4QT8C 1IQJA 1GMCF 4ZHLU 3M5OA 1A5GH 1C1UH 1KXDA 2NU4E 1DM4B 4TT3D 3DT0H 2ZDNA 4PROA 1SQAA 3VB5A 3RMMH 5EU8A 2QIQA 1NRPH 4FU7A 4O9VA 4X6OA 3QTVH 1WQSA 1EJAA 3TLOA 1ZHRA 3HATH 1P2IA 1XUIA 3A83A 1GHWH 1ELDE 1E37B 4X1QU 4YLUA 2ZTYA 1EZUC 4YM9A 4D9QA 3TK9A 3SU2A 1FNIA 1GGDC 1QA7A 4DT4A 1K1LA 3UWIA 4JYTA 2PW8H 1HAPH 3GYLB 5LPFA 1WUNH 1ZMJA 2QV1A 2Z3CA 2P59A 3UOPA 3QGNB 1S5SA 3QN7A 1C1QA 1BJVA 1PQAA 1NPMA 5EJLA 3V7TA 1V2JT 1S83A 5AFZH 3EYDA 5EODA 2W26A 3TGJE 2PHBA 1XM1A 2B8OH 1RIWB 1G3CA 3GY6A 3UPEA 3TGKE 1C1OA 4XE4A 3PLPA 3SNAA 2CHAB 4K60A 7ESTE 1E0FD 3O8DA 1SB1H 1GBBA 3AAUA 1GBHA 2JDID 3CP7A 1OX1A 4OS6A 1FLEE 4CHAC 5A09A 3SZEA 1KIGH 2I6SA 4MTBA 1SFIA 1KXAA 1C2IA 3N7OA 2AEIH 5DP9A 5HIYA 4NIVA 4HZHA 1AE5A 2QXIA 2J98A 4Y8ZA 2HALA 1FY1A 1W7GH 3PM3A 1BMMH 2Z9KA 1CA8B 1MKWH 2JIZD 3HGNA 2VIQA 2A31A 4NG9H 1TNHA 2OK5A 3SV2H 4NZLA 2PKAB 1OPHB 3ELAH 1HIAA 3O8RA 2J97A 5C1UA 1HAZB 3PMBB 1C5TA 4Y8YA 5C3NA 1AY6H 1TGTA 1TNIA 3PB1E 3IG6B 1O5GH 1A0LA 2AMDA 1V2WT 5L2ZH 1RRKA 1TRYA 4YZUA 3PV5A 1G30B 1NRNH 2WSSD 1SGFA 2YOLA 2BD5A 2WHXA 1XVOA 2VH6A 1E1QD 1GHBG 3BTTE 5J4QA 2VIDA 3NRLA 4BTTB 2UWPA 1YC0A 4BAOB 3N7DA 1YCPH 2FDAA 2XRCA 4AGKA 3BTGE 1A3EH 4UFFH 4BTUB 7GCHG 2BXTH 4NGAH 1MKXK 3EA7A 1BRBE 3D23A 1D3PB 1LVYA 5K0HA 1NRSH 2ZHFH 5ESTE 1DE7H 3SUGA 1MTNC 1Z8JB 4A92A 3PWCA 2VIOA 1H9HE 2J34A 2ZF0H 1FV9A 5DPAA 5C5OA 3MYWA 4ISNA 2PGQB 3MFJA 1C1VH 1SQTA 2CV3A 2YNBA 2A5AA 3B8JA 3U9AH 1K1NA 4FUJA 1Y8TA 1ESTA 1IOEA 3S7HB 4IBLH 5F03A 1P2OA 1TLDA 2WYGA 2C90B 1AB9C 2XBXA 2BX3A 2V3HH 3ZV9A 5DGJA 1TBRH 3RU4T 1T32A 2AERH 4LXBH 3T62A 1LVBA 1QL8A 1SFQB 4IC5A 1QJ7B 1GBIA 4GCHG 2TRMA 3A7VA 3ATIA 1AMHA 2A32A 4FUDA 3P6ZB 2HRVA 1PPCE 1V2QT 4FUCA 1P2MA 1BITA 1WQVH 1NU7B 2PKSB 1TMUH 1SGFG 4YO9A 1A2CH 1EPTA 2XBWA 1O3OA 1QB1A 1J9CH 1TX6A 1IQFA 1GDQA 2ANYA 2ZGJA 1YPHC 1HAHH 4AZ2B 2J5UA 1H4WA 4FUHA 4MNVA 5E0JA 1T7CA 1P2JA 5A8YA 1MTNB 3OTJE 1FDPA 3F2HA 1OWHA 1MBMA 1ZJKA 1UTMA 2QCYA 3MOCA 4FETA 1DLKB 1C5QA 3LGTA 2XC0A 2AH4X 4KELA 5C0TA 4UFDH 3SN8A 4AFZA 1D3DB 1QBOA 3OEED 1ZLRA 1DXWA 2YMSC 1UVTH 2ESTE 3KNXA 5F8TA 3DA9B 5C17A 3BTWE 3E3TA 1ZTLA 1J14A 1ELGA 3SJIA 1BMLA 1O5DH 5KGOA 2JH0D 1P9SA 3ENSB 2JJ1D 2F9OA 5FPYA 3RXMA 1LVMA 1J17T 4AN7A 1V2NT 4ZCNA 1TNKA 1OOKB 3E16B 4UONA 2ZFRH 1HJ9A 1P2KA 1ZHMA 1F0UA 2BLWA 1F0SA 5FPTA 2J95A 5T1VA 3K6YA 1BA8B 4X1PU 2BDGA 3Q77A 3P8GA 3DHKH 4UE7H 1O3EA 1W0ZU 3BTQE 2QF0A 1QURH 4R8TB 1BMNH 1N8OB 3QO6A 2BZAA 4Y0ZE 1TAWA 1O3DA 1DY9A 1SMFE 1QZ8A 3A7YA 1QTFA 3SV7A 1OWIA 2RA0A 1YPKH 3UIRA 1RTKA 4TSFD 4CR9A 1O3HA 1JOUB 1O3FA 2OINA 4IS5A 1KMHB 4ZUHA 3ZZAA 3RU4E 1AO5A 1OP2A 4LZ1H 1O2TA 3BTFE 3LDXH 3PV2A 4DOQA 3FOAA 1OXGA 1JRSA 1C2FA 3C27B 1O39A 2VGCB 1MD8A 1GBFA 1CBWC 3TH4H 3A7ZA 1AE8H 1IQMA 4Q7XA 3GCNA 3RU4D 1TX7A 3B9FH 1SKYE 5JB8S 1IAUA 1C2MA 1WCZA 2ASUB 1NO9H 4IMQA 1GHYH 4GCHF 4I8HA 1O35A 1OSSA 1C5VA 1SGTA 4HFPB 2FOMB 4B75A 1DVAH 1JRTA 1LTOA 1NBME 4DIIH 1CO7E 4BAHB 1BTWA 1O37A 1AFQB 1ACBE 4NWLA 1WYKA 1VZQH 1MMJN 3F0OA 3QZQA 4FUGA 2AGEX 1SI5H 3RXTA 2P95A 2ZU2A 4K5ZA 1F5LA 1ZJDA 1H9LB 2ZKSA 3GY3A 3UFAA 4BAMB 1EJNA 4GLYA 5L6NH 3TNSA 4YT7H 2O8LA 2GVFA 5T6GA 2QXJA 3T28A 3LOXA 4OS2A 2BDYA 5T6DA 4VGCC 3PLKA 1D6WA 1GBLA 3UNRA 3L33A 1H8DH 3RXPA 1O3MA 2SGDE 5FPSA 2GCHG 4H6TA 5EGMA 3P17H 1Q3XA 1O2QA 1WDIA 3DUXH 5A0BA 1D3TB 2FI3E 1GMDG 1XUHA 1TOMH 1QY6A 1ZGIA 2HNTC 3GCTF 1KDQA 3F68H 3QX5H 5JYIA 2XC5A 1TB6H 1P8VC 3T26A 1BRCE 2FX6A 2PR3A 2WPDD 1BTHH 4ACBA 1YF4A 1BZXE 1ARCA 2NU3E 1IQLA 5PTPA 1GMHG 1S85A 3SOSA 1H8ED 1C1NA 4NA9H 1TNJA 2V35A 1SLWB 2VB0A 5T6FA 3F6UH 3PTBA 1YBWA 1Z6JH 2QF5A 1PYTC 2TGTA 3P8NA 4CRGA 2XBVA 4NIYA 1OWEA 3FKSD 5L2YH 3P70B 5CHAB 1ELFA 2EC9H 2BHGA 2G00A 5EXMA 4YT6H 3WW7A 1KY9A 1O2KA 5E0GA 3N99A 1ANCA 2ZDLA 3SBKA 2J2UA 2BLQA 1GG6C 1ID5H 9ESTA 4MQAA 4I7YH 3RXAA 1XKBC 3GDUA 3VXFH 5CE1A 4VGCB 2A4GA 1FY3A 1ETSH 3RDZA 1O3NA 4NZQA 1DWCH 2B9LA 3VB4A 3M36A 1TFXA 4ISLA 1DDJA 2IPHA 4K8YA 1LDTT 1OKXA 2PSXA 3S9BA 4ZXYH 1C4V2 3S7KB 2Z6BD 3K6ZA 3A81A 4UDWH 2WPMS 2O8MA 4ZH8A 1AD8H 1ZSJA 1EAWA 1UTJA 4CRDA 2BTCE 4P00A 1UK4A 2WPLS 3KCGH 2R2WU 3JZ2B 2VU8E 4Y79A 3BIUH 3OY5U 1C1MA 3URDA 1X7AC 1PPBH 2FOGA 2VINA 2P93A 1HRTH 1KTSB 3D62A 3M61U 5A0CA 1A4WH 1C5SA 2ZDVH 4INKA 2VJ1A 1NN6A 2A5IA 4F55A 5KECA 1AWHB 2G52A 2PV9B 2OQ5A 1ELBA 5DK1A 1C5YB 2DE8A 2H5CA 5HXFA 4AC9A 1TNLA 2GZ8A 2FOEA 3SI3H 1S84A 4AX9H 4Y7BA 2A2QH 4R0IA 1C5RA 3K2UA 4MPWA 4ABDA 4WH8A 1CGJE 5FCKA 3MU8A 3RLYH 1C5XB 1NFUA 3M3VA 1P0SH 1LKAA 1U6QA 2P16A 2SFAA 4GHTA 1UVUH 1TGNA 1T31A 3A87A 3MNCA 2GMTC 3I77A 4GHQA 4MNYA 3SW2B 3P8OA 3UR6A 1EQ9A 1A46H 4MLFB 3ZIAD 1DWEH 3SHAH 3SU3A 1VCQA 3A88A 1C2GA 3RXKA 1RGQA 4Y8XA 3MH4A 3A82A 1GMDF 2HPQH 3BF6H 5FBIA 3U69H 3VB6A 1TABE 2Z3EA 1QFKH 5TCAA 1THRH 4Y10E 1HUTH 5AFYH 3RC4A 2JH6D 2SGAA 2SGFE 2ZU1A 1SLVB 2C8ZB 2VVUA 1ZSKA 5GCHG 2SGQE 1KXFA 3V0XA 1SGPE 1G3BA 3EA9A 3LKWA 1AUTC 1CQQA 1O31A 1OWDA 1GBAA 1GMHF 3T5FH 1GI2A 1L4DA 3PTNA 1EOLA 1BDAA 2GT7A 2XNIA 2KCAA 1HLTH 1N1LA 3CENA 5CDFE 1DSTA 3VPKA 3SO3A 1D6RA 2FS9A 2KR7A 1C4U2 4RKOB 2PSYA 4M7GA 1FIZA 1V2UT 1C5ZB 2F9PA 4RN6A 5A0AE 4D7FA 1IQEA 4DT7B 1Z8GA 2WUCA 4ISIH 1C1PA 3VGCC 1P2NA 3KN2A 2IPQX 1O3BA 5C5NA 1CE5A 4IW4E 3V3MA 3AW1A 2EI7A 4U32A 1C2KA 1FAKH 1O2IA 2V6NA 1ABIH 8GCHF 4KTUA 2AHME 3IITA 3GDSA 2W6ID 1PQ5A 1ZR0A 1HJ8A 1O2UA 1J15A 4UFGH 2D1JA 2O8WA 1F0TA 2AMPA 2ZU5A 1FX0B 4GUXA 3SU0A 2Y82A 2OC0A 3FZZA 2C4FH 1LPGB 1NFXA 5LH8A 1W3CA 1QQ4A 2BDCA 4CRCA 1KXBA 2HGTH 3A8BA 3A84A 2B0FA 4FUIA 1KYNA 1SLUB 1PJPA 1WSSH 1DPOA 1DY8A 2GP9B 4AB8A 1S6LA 1GBJA 2GCTC 4JYUH 4MPXA 2FESH 3BEUA 2QA9E 2ZQ1A 4AORA 3F3BA 2P3TB 1ORFA 1EZQA 2J98B 4ZHAA 3CNRA 3ZZ8A 1EFRD 1KTTB 3RMNH 1PPFE 2XBYA 3AK5A 1J16A 2JH5D 1BTPA 2Q1JA 3PMJA 1DS2E 1FY8E 2P94A 4RT0A 2GZ7A 2ZHDA 4H6SB 4ABAA 1V2LT 1HIAB 3FP8E 4ABGA 1CT0E 2AFQB 4Q7YA 2FYQA 1K22H 3CS0A 3TJNA 3UR9A 1LPKB 3A8DA 1YCPK 1NRQH 2EA3A 4HI3A 4RKJB 3MU1A 3NK8A 1BBRE 3RXEA 2OC7A 2WV9A 1CVWH 1E36B 3N7EA 1FMGA 3P92A 2BD8A 5FBEA 3RXIA 5GXPA 1CSOE 1B0FA 5CMXH 2Y6TA 1NU9A 1XKAC 2BDAA 3AVZA 4YTAA 1NESE 1V2TT 1ZSLA 3HK6B 4JZ1A 4JK6A 1OYQA 4CBNA 1EPTC 3M3TA 1MABB 1W8BH 1WV7H 2J9NA 4CH8B 1FY4A 3GY5A 4MVNA 3SNBA 1ANEA 2IN2A 3KQBA 3LH1A 3BG4C 3TJVA 1KXCA 4SGBE 2TGDA 4TWWA 4YLQH 1FY5A 1SSXA 3KF2A 3QLPH 4MPUA 1GBDA 4FUFA 1SPJA 2GCTB 1C5OH 1NM6A 2BB4A 4FU8A 4FXGH 4Y7AA 1MTUA 3F9FA 4B71A 1HYLA 1YPMH 1WXRA 3NXPA 3TNTA 4IMZA 1O5EH 1C2EA 4WH6A 3SGQE 1ZPCA 1A0JA 1GGDB 3M7TA 1C5LH 4I32A 4OM9A 1AI8H 1T8NA 3MO9A 3SYJA 5EG4A 3GYMA 2QF3A 1EJMA 3RUOA 1SGNE 2ZCLP 1P12E 2ALPA 5AHGH 2ZGXH 1XUJA 5FXLA 4I31A 2GDEH 2M2AA 2F83A 1QCPA 1OP8A 3C1KA 3E0NB 3L6PA 2BDHA 1L0ZA 1A61H 1PPEE 1TE0A 5E8EH 3PROA 6GCHG 2HWLB 1Z8IB 5HM9A 4JCNA 1AU8A 1SOTA 1O2JA 1O2GH 1LO6A 1TGBA 2HNTF 1EPTB 4K1EA 4CHAB 2HNTE 1EASA 4HG6A 2CGAA 1A3BH 1IQKA 2J4IA 5EPNA 1YPLH 1MZDA 4XDEA 3ZZ9A 1Z7KA 4Y71A 3A89A 4MPVA 1O2MA 2J38A 3PYHA 4WVPE 1C1RA 2FI5E 1NS3A 2XCNA 1ZYOA 4Z6AH 2FXRA 1NY22 4FVBA 5DP7A 3TH3H 1UO6A 4E7RG 3K65B 5LGOA 2WPJS 5EJZA 2VIWA 1O2PA 3RXSA 1YKTA 1B5GH 4B74A 1T4UH 2PKAA 1LMWB 3HPTB 4BTIB 1QRZA 3MO3A 1FZZA 1P11E 3KL6A 1G3DA 3ZVCA 2FP7B 2Y81A 1TOCB 2RCEA 1E34B 4ACAA 3GCHC 1IQHA 1T8OA 2BM2A 5DP4A 3H09A 1AZZA 1TBZH 1RTFB 5TCCA 3UNSA 2GD4B 4F4OC 1NFYA 3VEQB 3QUMP 2W7UA 1YPJH 2Z94A 3TIUA 1K1IA 3A80A 3FN8A 2W5EA 5FCRA 4A1VA 1OS8A 2BOKA 2GX4A 2ZC9H 3GICB 3LGVA 3DFLA 1G2MA 3TITA 2BQ7B 2A7JA 2RDEA 2RG3A 3TJOA 2GGVB 5DP6A 4Z0KA 3U8TH 3ZYEA 5EQQA 1G3EA 1GDUA 4A1XA 5I46H 1FXYA 1MAYA 3BTEE 1SGQE 5EQRA 5JB9S 3V12A 1V6DA 4F48B 1A1RA 2Y80A 3T2NA 3LC3A 1UW7A 1UTNA 1GCTC 1YGCH 4FUBA 1BOQA 3OYPA 4AFQA 4DIHH 1MTSA 1QA0A 1LHGH 4ZMAH 3PMHB 1MKXH 1HJAC 2Z9JA 1DT2A 3TVJB 3EE7A 4B1TA 4ZAEA 2BD9A 4YOGA 3UY9A 1DANH 4NIWA 4RT1A 4WXIA 2KCPA 5ESBA 3MH5A 1AB9B 2VBCA 3UNQA 1ELTA 3UQOA 2QAAA 1TALA 1F5KU 2FZZA 3MU5A 3SJKA 1VR1H 1L1NA 4XBDA 3E90B 3FO8D 1HAVA 1G9IE 5IK2D 1LHFH 1GPZA 2ZA5A 4NIXA 4DW2U 3SUEA 1GHBF 3LPRA 1GJ9B 1BQYA 1YLNA 2ZTXA 4XFQA 6ESTA 1QRXA 3PMAB 3RXGA 1QL9A 3VFEA 2SNVA 4TYDA 4DVAU 3ZVEA 4XBCA 1TGSZ 7GCHF 4ZHMU 2QGRA 2Z9GA 3S9AA 4Q80A 1P02A 2UWOA 1Z6EA 1UTLM 5EXLA 6GCHF 4D76A 3SNCA 3UUZA 2ZHEH 4AB9A 5GJ4B 1GJ8B 3ZVBA 1W0YH 1ZOMA 1ETTH 4OGXA 3TK6A 1KSNA 2VIPA 2RDLA 4DURA 1FQ3A 1LQDB 2WPKS 5JBCS 1GCTB 1O2OA 1RXPA 3RXCA 4K2YA 1O2ZA 3PO1C 1EOJA 1LPZB 5EQSA 2FM2A 2XW9A 3GY7A 4K3JA 2XWBI 4Q4LA 4CBOA 3S0NA 2AS9A 3OY6U 4ABJA 3Q3XA 1QL7A 1VKYA 2HLDD 2ZG0H 1BTZA 3NZIA 2FOCA 3D49H 3ZVFA 2YMSB 5LPEA 9LPRA 2BY7X 1Y5UT 1YP9A 2QYIA 1KDQB 1GI7B 2IJOB 3SQEE 3KGPA 4LZ4B 3BIVH 1JMOH 1A7SA 1SVPA 3PV4A 2FOFA 1PQ8A 3BTME 2HOBA 1C5NH 2EI8A 1O2XA 2BY5X 1S81A 2TGAA 5GPIB 3E1XB 3MNXA 4X0WU 1B0EA 3SV9A 1QNJA 1ELCA 1G36A 2TBSA 5J4SA 1TRNA 2H2ZA 1QR3E 1V2PT 2PLXA 1NBMD 4CREA 1NRRH 4O3UA 1HDTH 3LGWA 1SGDE 2BVXH 2OXSA 1K1JA 1Y3VA 2F4LA 2FODA 2BLVA 2OBQA 4D9RA 3SUFA 4RI0A 4INLA 1GI6A 1PPZA 5I25A 2PFEA 4YOIA 1EZSC 3UWJH 3LONA 2WPIS 2A2XH 1GJ6A 3KQ5A 2NU0E 1ABJH 3DSOA 3WY8A 1XX9A 3KIDU 3URCA 3U98H 3RXBA 4DY7B 2R0LA 1CBWB 1Z1JA 1FUJA 1C2LA 4X2WA 2OBOA 3LH3A 1AUJA 3NKKA 1Y3WA 2F9UA 3RXLA 4A5TS 3DD2H 4Z1MD 5TJXA 3OX7U 2G55A 3KQEA 5GWZA 1FJSA 3F2GA 3E6PH 1P05A 2IJD1 2FIRH 2P8OC 3F9GA 3MO6A 3FFGA 1P04A 2ZI2H 3IWMA 1GHAG 2Z9LA 1TRMA 2WYJA 2PP6A 1G37A 1GJ5H 1O3AA 2KFWA 4LK4A 3ZVDA 1W13U 1LKBA 3BTKE 2ZPRA 3K9XB 1WOFA 1GVKB 4AFUA 1MD7A 1DXPA 4I8JA 2H9HA 2WPHS 5C0UA 2ILNA 1C1WH 2ZFFH 2BMGB 3MH7A 3B23B 2WZQA 1Y5AT 1ESAA 4ABIA 3W95A 2A4OA 1KLTA 2BY8X 4MG3A 1M9UA 1GI0A 1MH0A 1W2KH 1TYNA 1HAIH 3OAAD 4NFFA 2KCYA 3RMLH 2JJ2D 1SGCA 3LGYA 4J2YB 3HKJB 3R0FA 1GI9B 2PWXA 3MH6A 4X1SU 1FIWA 5JBAS 4I8KA 1BUIA 2AGIX 1DX5M 1P01A 1Y3XA 4WMFA 2A0QB 2C8YB 3WWFA 3AASA 1IHTH 1ZPBA 1YM0A 2CF9H 3KHVA 4WF8A 1ZTKA 4P02A 3P8FA 5BRRE 3GISB 2VNTA 3RM2H 1XUFA 5EJ1A 1V3XA 1C1TA 3RXHA 1H8IH 1P10A 5DSFA 1O33A 2FEQH 2KAIB 3M35A 1CT2E 2G4TA 3BEFB 1L4ZA 1VITG 1TA2A 2CF8H 1NZQH 1P03A 3DFJA 2FLBH 2ZDAH 3LJJA 1JXPA 3ZVAA 4IC6A 3A86A 1O38A 5F8XA 3EAJA 1V2MT 3F9EA 1ETRH 1YPGH 3OSYA 1MCTA 1TA6A 3BEIB 4K1SA 1WTHD 2GTBA 1HBTH 2GJGA 2XYAA 1CA0C 2OQUA 1QJ6B 3ODDA 2Q6DA 4ABFA 5C1YA 3R3GB 1UCYH 2K8IA 3A7TA 4ASUD 2ZFTA 2C8XB 4GSOA 1O2HA 2JETC 2V3MA 1QHRB 5B6LA 1GG6B 4B2BA 1BBRK 1WBGB 1FPCH 2BVSH 5KEDA 1GI5A 1HGTH 1GI3A 2GCHF 1WU1A 2BD2A 2PGBB 2ZDKA 1FONA 2NU2E 1COWD 2V0BA 5E2PA 4I8LA 3EE0B 1AIXH 1O3JA 2BD3A 2BD4A 2VWNA 1AKSB 1TPSA 1Q31A 4OS7A 3SV6A 2EQNA 2Q6GA 3LGIA 5EPYA 2KZ4A 1S6HA 2QE7D 3EQ0H 2L6OA 4TPYA 1UHBA 1QGFA 1O2YA 2AMQA 3ATMA 4K1TA 1G2LA 5A8XA 3SNEA 1E1RD 2O9QA 1RD3B 4KTSA 2H6MA 1O3CA 3SU1A 4Y0YE 1DLEA 1SG8B 1MTWA 3RXUA 3UB0A 2BLOA 1GCDA 5E0HA 3STJA 1GHAF 1UK2A 1W11U 3ZZ7A 3ZVGA 3RXVA 4CRFA 5C67A 5IDKA 2C93B 5H4IB 4CRAA 3E91A 5HKKD 2LNCA 3JZ1B 1LCYA 4B2CA 3VB7A 1O2WA 1VITH 2ALVA 8KME2 1UTQA 4DJZB 1O3LA 2ZU3A 4AOQA 1YLCA 1YPHE 2OUAA 4D8NA 1TQ7B 3I78A 3SU5A 2ODPA 4IN2A 3GDVA 2CXVA 2HPPH 1IQNA 3TGIE 2BVRH 4B2AA 1GJ7B 2AGGX 1Y3YA 1TBQH 2WV4A 1F5RA 4ABEA 2GMTB 3Q00A 3ESTA 4NWKA 3FP6E 1ELVA 1S0RA 3A7XA 1A0HB 2FLRH 4NCYA 1LVOA 4Q7ZA 4B6EA 3AW0A 1D9IA 2BY6X 2ZPQA 1O30A 2ZFPH 3A8AA 1F92A 3MQKC 4AG1A 2RA3A 2A1DB 1TGCA 2ZNKH 3H7TA 1O3IA 2CJIA 2KCOA 4TPIZ 1O5BB 1DWDH 4KTCA 3FP7E 1K1MA 1Z8RA 1MKWK 3ZZ6A 2ZHWH 2SGEE 3NCLA 3FAOA 1G32B 1QBVH 4BAKB 1CHGA 1GJCB 2P3FH 1VJ9U 5FX5A 1O5CB 1TPOA 2G5NA 1PFXC 5C2ZA 1MU6B 4HTCH 2YMSD 1VITF 3M5MA 1MZAA 1P3EA 2PUXB 1BCUH 1O0DH 1HAGE 1O3KA 3SORA 3F0PA 4HGCA 2VWOA 2F9VA 2ZFSA 1P3CA 1D4PB 4WY3A 3GY2A 4BXWA 2ZEBA 1AVXA 3TH2H 3E0PB 4BAQB 1AZ8A 2BZ6H 1ZZZA 4Q63A 3VGCB 1GVZA 3PLBA 7LPRA 4WMDA 2OC8A 1GJBB 1HPGA 2OC1A 4ESTE 1KLIH 1L1GA 4BOHA
chains in the Genus database with same CATH topology
2WINI 5EW2H 1GL0E 1W14U 4KGAA 5EXNA 1ZRBA 4CH2B 4YOJA 5ABWA 4ZKSU 3U1IB 2Y5GA 3ZZDA 3TPIZ 2FO9A 1DFPA 4X2XA 2UUFB 1O5AB 2WV5A 1EZXC 5F8ZA 3MU0A 3A7WA 2I6QA 4TY7A 2BY9X 1GVLA 5GCHF 1HAXB 5DKMA 4NSVA 2ZCKP 4OS1A 4X2VA 1O2LA 3ZV8A 1CGHA 2UUYA 1O36A 3QZRA 1O2SA 3A85A 5JPMH 2NU1E 2XCFA 3GY8A 5F6MA 2EEKA 2OLGA 5IYTA 3RXOA 2AIPA 2B7DH 2ZWLH 1J8AA 1NFWA 3G01A 3LGUA 1LQEA 4YESB 1ANDA 1DICA 3M5LA 1GHXH 1E35B 1UK3A 3SQHE 4ZKRU 2UUJB 1W12U 2VWMA 1EP6A 3MMGA 1DOJA 4E06H 1FPHH 2VVVA 1FAXA 1GBKA 1VCWA 4FU9A 5DG6A 2G81E 1GHVH 3ATWA 1KXEA 1S6FA 4Q2KA 1SGEE 1MAXA 1K2I1 2Y7ZA 1GBCA 4J1YA 2FI4E 2G8TA 4KP0A 3F9HA 2GV7A 3PWBA 4A6LA 2W3KA 1H9IE 3EGKH 4LOYH 3QGJA 1UTKA 4NA7A 1L2EA 4JK5A 2SNWA 2H5DA 4IN1A 3MHWU 1SHYA 2BQWB 3P95A 1QBNA 3U8OH 3NWUA 2PKSC 2AYWA 4JZFH 3S69A 4H4FA 3LIWA 1HXEH 1PQ7A 3BG4B 3EA8A 8ESTE 1ARBA 1RJXB 2H9TH 4GPGA 3SV8A 2Z9IA 1GJDB 3EDXB 2FOHA 4RSPA 2STAE 3BN9A 3LT3A 4DCDA 3SUDA 3M5NA 1HV7A 5EOKA 5E2OA 1OWKA 1V2VT 1INCA 2YNAA 1ZHPA 4X8UH 2ODQA 1GBEA 3MU4A 1TONA 3SGBE 4ASHA 5DP8A 3SJOA 2ZP0H 1MQ6A 1C2HA 2JKHA 4GAWA 1IHSH 3SGAE 1BIOA 3RC5A 1K1PA 1PYTD 2FMJA 5DP5A 1MUEB 2B5TB 4AYYB 4ZXXH 2QN5T 1RTLA 1O2NA 2ZHQH 2A4QA 1XUGA 1LHCH 3SNDA 1HAVB 2Z7FE 2LPRA 2THFB 3H7OA 1TMBH 4JZIA 1HB0B 2FPZA 2OP9A 4X1RU 5GDSH 4TWYA 1QB6A 1O2RA 3HGPA 1FN6A 1TPPA 3RLWH 2BQ6B 1XVMA 3M7UA 1C2DA 2D2DA 2EI6A 4WJG2 5SGAE 1SHHB 2VIVA 1F0RA 2BD7A 4JZDH 2C8WB 3LJOA 1IQGA 2ZQ2A 1QQUA 2O8TA 3RXQA 2CMYA 2ZO3H 1JBUH 5AF9H 1P09A 1DITH 1T8LA 1EAXA 1N8OC 3ATLA 4O03A 6CHAC 3RMOH 1KLJH 1MQ5A 2W7SA 3UTUH 1JIMA 1NTPA 1EATA 3MWIU 2A7HA 4H42U 1F7ZA 1Y5BT 1YYY1 2XC4A 1GBMA 1BRUP 3Q3YA 3VB3A 1ANBA 3FVFB 5K7RA 1MBQA 2VGCC 1NROH 5B6OA 3GCTG 1MCVA 1GI8B 3LC5A 4B76A 3GCHB 3GY4A 2M5TA 3I29A 1O5FH 1V2OT 3RXRA 1TX8A 4AG2A 2WUBA 1S82A 5A2MH 3UQVA 1EAIA 4AFSA 1BHXF 3LU9B 1P2QA 4E05H 1C9PA 3U8RH 1EAUA 3VXEH 3KQDA 1C5PA 2R9PA 1CHOG 3ZZBA 1AFQC 3SZNA 4BANB 3MNSA 4UEHH 4XOJA 2ANKH 5L30H 4Y6DA 3W94A 1XMNB 4Y11E 1THPB 1SGIB 1BRAA 2DE9A 3O8CA 2TIOA 4OS5A 2PUQH 1HJAB 4XSKU 2TPIZ 4D7GA 3ITIA 1P9UA 1NC6A 6CHAB 1ZGVA 1C1SA 2R3UA 4F49A 2PTNA 3MI4A 1ZMLA 2W3IA 1BJUA 2Z3DA 3KEEA 1C4Y2 1C5WB 3OU0A 1SC8U 2GKVE 3ZZ3A 1MU8B 2XTTB 4X8SH 4X6NA 3RXJA 3E8LA 4MDSA 1YLDA 1W10U 2R3YA 2ZDMA 1EX3A 2FOBA 1QJ1B 3TJUA 2FX4A 5LPRA 2HLCA 3S9CA 5BPEA 1BMAA 2ZZUH 1VGCC 1EP5A 2H9EH 1SR5C 1TQ0B 1VCPA 1Y3UA 3MTYA 1QB9A 1BT7A 5HM2A 1BTUA 3TK5A 1GDNA 1QIXB 2BDBA 1O3PB 2QC2A 1SGRE 1GJ4H 1CT4E 4ABBA 1H1BA 3UOUA 2ANWA 2V3OH 5C20A 3RM0H 1PPHE 2R0KA 4AGJA 5HYOA 3Q76A 1AN1E 2F91A 5CHAC 3RP2A 1UVPA 3QK1A 4JYVH 2H1UA 1Z1IA 3O8BA 2ZIQH 3PO1B 1AQ7A 2BXUH 3H5CB 1AGJA 2ZFQH 2ZGBH 4TY6A 2CN0H 3QWCH 1GJAB 1Y59T 2VVCA 1FN8A 5HGGA 4BXSA 2G51A 1K28D 1XXDA 4WXVA 4ABHA 2A4RA 1ZRKA 2BDIA 4CR5A 3SHCH 4X6MA 8LPRA 2AIQA 2SGPE 1V2ST 1CGIE 1P06A 2ZGCA 1GI1A 5HMAA 1BTYA 5T3HA 4U01A 1PPGE 5JBBS 1C5MD 1K9OE 2D8WA 3NPSA 1BB0B 1EB2A 2A7CA 2GDDA 2NWNA 1SBWA 1O3GA 5FHTA 1VGCB 3BG8A 2Y5HA 3HK3B 3QDZB 4OGYA 2G4UA 3STIA 4DGJA 7KMEH 1SQOA 1N6YA 1Q2WA 2FTLE 1UCYK 2FWWA 1HFDA 1LHDH 2QY0B 3SU6A 2VH0A 1EKBB 4K8BA 1TMTH 1GBTA 5EW1H 1VJAU 1SOZA 2UWLA 2OTVA 1O34A 1CHOF 1XUKA 3F1SB 4MNWA 1OYTH 1LHEH 4THNH 2GV6A 4X2YA 1UVOA 2XWAA 3T29A 1AWFH 3ZZ4A 3A8CA 4SGAE 4KKDA 1IQIA 2BYAX 2STBE 2ZECA 1ELEE 3BTHE 1HAOH 1Z71A 1OP0A 3U1JB 2G5VA 1D3QB 1GI4A 3Q3KA 1JWTA 1TWXB 2FTMA 1EUFA 3SI4H 1HNEE 8GCHG 4GVUA 2PTCE 5DJ7A 2IOTA 1UMAH 4DG4A 4Y76A 1K21H 2ULLA 1SGYE 1K1OA 1FI8A 1RFNA 3M37A 4NSYA 2F9NA 1YCPM 2A5KA 1AVGH 3M7QA 1GMCG 4INHA 1OWJA 4FUEA 3ODFA 1UHBB 2P8OB 3TU7H 3FZDA 1UTOA 1TIOA 3CS7A 4CRBA 2ZU4A 1HCGA 3RXDA 1L1JA 4K69A 2QXGA 2ZTZA 4UD9H 1WAYB 4WMEA 2GZ9A 3T25A 2R2MB 1GL1A 2QXHA 1ZMNA 5DO4H 4O3TA 1AVWA 3BTDE 5FX6A 1T4VH 2HVXA 4I8GA 4UFEH 3ZYDA 2TGPZ 2C3SA 2Q6FA 1C2JA 4JMYA 4U30A 3UREA 1UJ1A 1P57B 3BV9B 2ANMH 5JBTA 1MTVA 1JIRA 1C9TA 3L3TA 3SU4A 3D65E 4E7NA 2ODYB 1EXFA 4B73A 1NT1A 2BX4A 1ELAA 2XXLA 4I33A 1DUAA 3GOVB 3SJ9A 1T8MA 2DUCA 4WWYA 1N6XA 4ISOA 1ZTJA 2OD3B 1W7XH 3AAVA 1A5HA 4O97A 1DUEA 1UVSH 4ISHH 2A45B 1AFEH 3SJ8A 4NA8A 1HAYB 2VWLA 4X1NU 1TNGA 1SL3A 1F2SE 1CU1A 1V2KT 3FANA 2ZPSA 1V2RT 4BNRA 2Y5FA 4ZROA 3ATKA 5GIBA 2O8UA 5FAHA 1ZPZA 3T27A 2KAIA 3M3SA 2P3UB 4MNXA 3QTOH 2FS8A 2FOAA 5AVDA 3KQCA 1UCYE 1C5UA 4X6PA 2K1QA 2BOHB 1YPEH 2UUKB 1BTXA 5ETXA 5G4BA 1AHTH 1E38B 5JDUB 1SLXB 1CA0B 2OCVB 1S0QA 4ZKNU 3RXFA 2J94A 2ZCHP 3RC6A 1UTPA 2F9BH 2JETB 3NUMA 1GWAA 1HXFH 4IGDA 3MNBA 2ZGHA 3ZZ5A 2J92A 5C1XA 1BHXB 1ESBA 4NFEA 4X8TH 4ZKOU 1O2VA 1DSUA 6LPRA 1QRWA 4A1TA 1RS0A 2GT8A 5A8ZA 1RIWC 4U2WA 1A5IA 3GCOA 1TPAE 1WTGH 4XBBA 4OS4A 3ZZCA 3HKIB 1AKSA 2CHAC 4JZEH 1O32A 4A7IB 1XXFA 3V13A 2D26C 5DP3A 1B7XB 2F3CE 1BBRH 1THSH 1DWBH 4AYVB 3BSQA 1GHZA 2Y7XA 4X8VH 1EB1H 2FYRA 4FVDA 4QT8C 1IQJA 1GMCF 4ZHLU 3M5OA 1A5GH 1C1UH 1KXDA 2NU4E 1DM4B 3DT0H 2ZDNA 4PROA 1SQAA 3VB5A 3RMMH 5EU8A 2QIQA 1NRPH 4FU7A 4O9VA 4X6OA 3QTVH 1WQSA 1EJAA 3TLOA 1ZHRA 3HATH 1P2IA 1XUIA 3A83A 1GHWH 1ELDE 1E37B 4X1QU 4YLUA 2ZTYA 1EZUC 4YM9A 4D9QA 3TK9A 3SU2A 1FNIA 1GGDC 1QA7A 1K1LA 3UWIA 4JYTA 2PW8H 1HAPH 3GYLB 5LPFA 1WUNH 1ZMJA 2QV1A 2Z3CA 2P59A 3UOPA 3QGNB 1S5SA 3QN7A 1C1QA 1BJVA 1PQAA 1NPMA 3V7TA 1V2JT 1S83A 5AFZH 3EYDA 5EODA 2W26A 3TGJE 2PHBA 1XM1A 2B8OH 1RIWB 1G3CA 3GY6A 3UPEA 3TGKE 1C1OA 4XE4A 3PLPA 3SNAA 2CHAB 4K60A 7ESTE 1E0FD 3O8DA 1SB1H 1GBBA 3AAUA 1GBHA 3CP7A 1OX1A 4OS6A 1FLEE 4CHAC 5A09A 1KIGH 2I6SA 4MTBA 1SFIA 1KXAA 1C2IA 3N7OA 2AEIH 5DP9A 4NIVA 4HZHA 1AE5A 2QXIA 4Y8ZA 2HALA 1FY1A 1W7GH 3PM3A 1BMMH 2Z9KA 1CA8B 1MKWH 3HGNA 3SV2H 2VIQA 2A31A 4NG9H 1TNHA 4NZLA 2PKAB 1OPHB 3ELAH 1HIAA 3O8RA 5C1UA 1HAZB 3PMBB 1C5TA 4Y8YA 5C3NA 1AY6H 1TGTA 1TNIA 3PB1E 3IG6B 1O5GH 1A0LA 2AMDA 1V2WT 5L2ZH 1RRKA 1TRYA 4YZUA 1G30B 1NRNH 1SGFA 2YOLA 2BD5A 1XVOA 2VH6A 1GHBG 3BTTE 5J4QA 2VIDA 4BTTB 2UWPA 1YC0A 4BAOB 1YCPH 2FDAA 2XRCA 4AGKA 3BTGE 1A3EH 4UFFH 4BTUB 7GCHG 2BXTH 4NGAH 1MKXK 3EA7A 1BRBE 3D23A 1D3PB 1LVYA 5K0HA 1NRSH 2ZHFH 5ESTE 1DE7H 3SUGA 1MTNC 1Z8JB 4A92A 3PWCA 2VIOA 1H9HE 2J34A 2ZF0H 1FV9A 5DPAA 5C5OA 3MYWA 4ISNA 2PGQB 3MFJA 1C1VH 1SQTA 2CV3A 2YNBA 2A5AA 3B8JA 3U9AH 1K1NA 4FUJA 1Y8TA 1ESTA 1IOEA 3S7HB 4IBLH 5F03A 1P2OA 1TLDA 2WYGA 2C90B 1AB9C 2XBXA 2BX3A 2V3HH 3ZV9A 5DGJA 1TBRH 3RU4T 1T32A 2AERH 4LXBH 3T62A 1LVBA 1QL8A 1SFQB 4IC5A 1QJ7B 1GBIA 4GCHG 2TRMA 3A7VA 3ATIA 1AMHA 2A32A 4FUDA 3P6ZB 2HRVA 1PPCE 1V2QT 4FUCA 1P2MA 1BITA 1WQVH 1NU7B 2PKSB 1TMUH 1SGFG 4YO9A 1A2CH 1EPTA 2XBWA 1O3OA 1QB1A 1J9CH 1TX6A 1IQFA 1GDQA 2ANYA 2ZGJA 1YPHC 1HAHH 4AZ2B 1H4WA 4FUHA 4MNVA 5E0JA 1T7CA 1P2JA 5A8YA 1MTNB 3OTJE 1FDPA 1OWHA 1MBMA 1ZJKA 1UTMA 2QCYA 3MOCA 1DLKB 1C5QA 3LGTA 2XC0A 2AH4X 4KELA 4UFDH 3SN8A 4AFZA 1D3DB 1QBOA 1ZLRA 1DXWA 1UVTH 2ESTE 3KNXA 5F8TA 3DA9B 3BTWE 3E3TA 1ZTLA 1J14A 1ELGA 3SJIA 1BMLA 1O5DH 2JH0D 1P9SA 3ENSB 2F9OA 5FPYA 3RXMA 1LVMA 1J17T 4AN7A 1V2NT 1TNKA 1OOKB 3E16B 4UONA 2ZFRH 1HJ9A 1P2KA 1ZHMA 1F0UA 2BLWA 1F0SA 5FPTA 2J95A 3K6YA 1BA8B 4X1PU 2BDGA 3Q77A 3P8GA 3DHKH 4UE7H 1O3EA 1W0ZU 3BTQE 2QF0A 1QURH 4R8TB 1BMNH 1N8OB 3QO6A 2BZAA 4Y0ZE 1TAWA 1O3DA 1DY9A 1SMFE 3A7YA 1QTFA 3SV7A 1OWIA 2RA0A 1YPKH 3UIRA 1RTKA 4CR9A 1O3HA 1JOUB 1O3FA 2OINA 4IS5A 4ZUHA 3ZZAA 3RU4E 1AO5A 1OP2A 4LZ1H 1O2TA 3BTFE 3LDXH 4DOQA 1OXGA 1JRSA 1C2FA 3C27B 1O39A 2VGCB 1MD8A 1GBFA 1CBWC 3TH4H 3A7ZA 1AE8H 1IQMA 4Q7XA 3GCNA 3RU4D 1TX7A 3B9FH 5JB8S 1IAUA 1C2MA 1WCZA 2ASUB 1NO9H 4IMQA 1GHYH 4GCHF 4I8HA 1O35A 1OSSA 1C5VA 1SGTA 4HFPB 2FOMB 4B75A 1DVAH 1JRTA 1LTOA 4DIIH 1CO7E 4BAHB 1BTWA 1O37A 1AFQB 1ACBE 4NWLA 1WYKA 1VZQH 1MMJN 3QZQA 4FUGA 2AGEX 1SI5H 3RXTA 2P95A 2ZU2A 4K5ZA 1F5LA 1ZJDA 1H9LB 2ZKSA 3GY3A 3UFAA 4BAMB 1EJNA 4GLYA 5L6NH 3TNSA 4YT7H 2O8LA 2GVFA 5T6GA 2QXJA 3T28A 3LOXA 4OS2A 2BDYA 5T6DA 4VGCC 3PLKA 1D6WA 1GBLA 3UNRA 3L33A 1H8DH 3RXPA 1O3MA 2SGDE 5FPSA 2GCHG 4H6TA 5EGMA 3P17H 1Q3XA 1O2QA 3DUXH 5A0BA 1D3TB 2FI3E 1GMDG 1XUHA 1TOMH 1QY6A 1ZGIA 2HNTC 3GCTF 1KDQA 3F68H 3QX5H 5JYIA 2XC5A 1TB6H