3PLPA

Bovine trypsin variant x(tripleile227) in complex with small molecule inhibitor
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGIYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3plpA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3plpA02
1A46H 2Y5HA 5JBBS 1P01A 3P8FA 3KGPA 3TNTA 2J34A 4A1VA 2BVSH 4UE7H 1FY8E 4MPVA 2GCTC 4X8VH 4O9VA 2FO9A 1G3BA 5HXFA 1SVPA 1PPFE 1F5LA 1LHGH 1A4WH 3PYHA 4J2YB 1F92A 1BIOA 1BTZA 4FUIA 5A8ZA 3ZZ5A 1WYKA 1GBMA 1KLJH 1TNHA 4NA8A 1SC8U 1P03A 1XXFA 2G52A 1AE5A 2Y7ZA 4HGCA 4U2WA 4UFFH 8KME2 3VFEA 4WVPE 3SNDA 1AB9B 3BV9B 4Q80A 2J4IA 3A7VA 2BY7X 3V3MA 1WV7H 4OS6A 1LVYA 2VWOA 1F0SA 3RXAA 2A4RA 2BD7A 1CA0C 1TBZH 4KTCA 1RTFB 1C5RA 4DG4A 1D9IA 3H5CB 3ZYDA 2H6MA 7GCHG 1HB0B 2F9BH 3I77A 3RXGA 1A0HB 4NWLA 3ZVGA 2XWAA 1MCVA 1Z1IA 3MTYA 1AGJA 1CHOG 1AO5A 1C5LH 1ZRBA 2OD3B 1DY8A 2B7DH 4PROA 2D1JA 2ZTZA 2ZDKA 1N6YA 3A84A 1GVLA 1XM1A 1O39A 5L6NH 1C5YB 1GI9B 1GJ7B 4BXSA 1BMLA 3SU4A 2OTVA 3OY6U 3P95A 1H1BA 2ZECA 1AFEH 1O3OA 4JZIA 1GHXH 2ZHWH 2WV5A 5B6OA 2ODYB 3SQEE 3LGVA 1LVBA 1GL0E 1GI3A 1BRUP 5EXMA 2FYQA 1BTXA 2AGGX 1V2PT 1TGSZ 1SQTA 2BDYA 4O3TA 1ZPBA 2AMPA 1D3PB 1GBTA 4K1TA 2SNVA 1EASA 1D3QB 3MYWA 2H9TH 2VVVA 3UOUA 1BOQA 1CA0B 1ELGA 1H8DH 1NS3A 1P2QA 1C2FA 1TIOA 2FOGA 3PLPA 1N1LA 1A61H 1QBNA 4WY3A 4XE4A 2VIPA 4K1SA 1UCYH 1O2IA 1H8IH 2OP9A 3A88A 1NU7B 5T6GA 2GTBA 1U6QA 4H4FA 3SV2H 1Z8JB 1P2IA 2O8LA 4OGYA 4B2BA 1ZTLA 1GG6C 1RTLA 2A5KA 2EI8A 4JYVH 3MH4A 1A5HA 3U1JB 1HDTH 3MFJA 2FYRA 1Z6EA 4FUBA 2GP9B 1BTPA 3V7TA 4BTTB 5LPRA 2K1QA 1C5OH 3ZZ7A 1QL8A 2VNTA 5HYOA 2BOKA 3BIUH 3EYDA 3UY9A 3U8RH 3ITIA 1CT2E 2VGCB 3AAVA 1AVWA 1WQSA 2GGVB 3K2UA 3MU5A 3ZZ3A 4LZ4B 3PTNA 2PUQH 1GBHA 2XRCA 3LGWA 1LTOA 1KXEA 2VWMA 2BOHB 1KXBA 2SGQE 4AFZA 2R2WU 1P57B 1PQ5A 5A09A 2ANWA 4K8BA 1YM0A 3A7YA 5GDSH 3BTWE 3LT3A 4JZEH 2GCHG 3LJJA 1ZSLA 3O8CA 1TFXA 3Q00A 1JBUH 4XBCA 1O3AA 3SU5A 3UWIA 4FUEA 5FCKA 1C2JA 1UCYK 4TWWA 3BIVH 1W3CA 2BZAA 1O2QA 3ZV8A 5A8XA 1GBKA 1NN6A 2JH6D 2BD2A 1Y3VA 2VIDA 1S81A 3LIWA 2C93B 5C3NA 2V0BA 4LOYH 1LHEH 3SQHE 1SQOA 3RMLH 1DWDH 3HK3B 1NC6A 4DCDA 1O3MA 1SGRE 1FN8A 1UTJA 1DUAA 3S9AA 3TVJB 2OC8A 2A7JA 1HFDA 3P70B 1SB1H 3MU1A 1XX9A 2PHBA 4XFQA 1YPHE 2PKAA 1C4Y2 1O2PA 2ZU1A 3RUOA 2Z9KA 3ZVFA 2BM2A 1AI8H 5FCRA 1AU8A 1VCQA 1GJ4H 2J38A 4XSKU 1RGQA 1OOKB 3P6ZB 3BG4C 3LJOA 1O2SA 2XBWA 1EJAA 2ZNKH 3U1IB 4GHQA 5DP8A 1AY6H 2V6NA 2SGEE 1CA8B 4DJZB 4YLUA 1G37A 1BMMH 3SNAA 1AQ7A 1W7GH 1D3DB 1TNLA 5EU8A 4I8LA 3RXRA 5DP3A 2DE8A 2W26A 5J4SA 2BDBA 5EQQA 3VB5A 4VGCC 1HAGE 4MNWA 1VJ9U 5E8EH 3UR6A 3UIRA 2BDHA 3SI3H 1EZQA 2O8MA 2ZDLA 3GY5A 4I8GA 3LOXA 2ZI2H 2NWNA 4Q7XA 1O3NA 3LC3A 4I33A 3S0NA 1GPZA 1IQNA 1GBBA 1L2EA 1RD3B 3BTHE 5DP4A 1ZOMA 3RC6A 1EZUC 3KQEA 4WMFA 4B2CA 1FY4A 5K7RA 1T32A 1G3DA 2UWOA 3SJOA 1BMNH 1GHAG 2WV4A 1YPLH 4D9QA 1TE0A 1ZRKA 3IG6B 1GJ8B 1SGTA 1ZGVA 1G3EA 4ISOA 2PKAB 3STJA 9ESTA 1A5GH 1C5VA 3TK5A 4X1NU 5TJXA 4ABBA 1UTQA 1BHXB 2C8WB 1O3GA 1WCZA 2FOHA 2XC0A 1F2SE 1BHXF 1Y3YA 3P8GA 4CBOA 2FZZA 5FPTA 2Z6BD 1O2HA 3VB3A 4R8TB 4Y10E 5FPYA 1FN6A 2QF0A 2Q1JA 2H5DA 3NWUA 1C2MA 3SV9A 1HIAB 3O8DA 1V2QT 4AZ2B 1Y5BT 2HNTE 3MMGA 4JZDH 2ZU4A 3F1SB 1ZSJA 1AWFH 1O3DA 3UTUH 1GHWH 3M7UA 3M36A 4AOQA 1UK3A 2ANMH 4AFUA 8GCHF 5EW1H 1EZXC 1BCUH 1SMFE 3GCTG 3F9HA 1DLEA 2OCVB 1ARCA 5DP5A 2F9UA 5DP6A 3B8JA 4NZLA 1C1RA 1DWEH 1KIGH 2EI7A 2C4FH 4YO9A 8LPRA 1YPEH 1O3JA 2PFEA 1O37A 2FI5E 3T25A 1ANCA 1G9IE 1AUJA 1MTWA 1GL1A 4H42U 2BXTH 1GDUA 1BJVA 1KXDA 3ZVEA 1XUJA 2UWPA 4YESB 3O8BA 1OX1A 2CGAA 1Y3WA 5FBIA 1KXCA 1HCGA 1J17T 1ZYOA 1HAZB 4GCHG 1TGCA 1VITG 3EQ0H 3U9AH 2OC0A 1UVUH 3TNSA 2UUKB 4X8SH 4UFDH 4LK4A 4XBDA 4A92A 3ZZ8A 3H7OA 3BTQE 5GXPA 2ZKSA 2Y5GA 1IHSH 3T28A 2AFQB 4J1YA 3AW0A 1QNJA 1O5AB 2XNIA 1NFYA 1HLTH 1HAHH 4K5ZA 1T4UH 4Y0YE 3V0XA 1AVGH 3MO9A 2FI3E 4IS5A 2VU8E 1QBOA 3OTJE 2HPPH 4CRAA 1RTKA 5GIBA 5EGMA 1EPTA 4SGAE 4NA7A 3BG8A 1C4V2 3VB4A 3R0FA 3TJUA 1O2XA 3PLKA 4RN6A 1GGDC 3T27A 3U8OH 4FVBA 2Y81A 2FP7B 2VJ1A 1EAWA 1T8OA 3AVZA 2JH5D 1TYNA 3BTGE 2QIQA 3M61U 2M5TA 1VCPA 2G8TA 3KHVA 1O0DH 1JIMA 4WF8A 3PB1E 2GV6A 2J9NA 5IDKA 1D6RA 3OSYA 2VIOA 3SNBA 3FP6E 2QGRA 3BG4B 1L0ZA 3UNQA 4Z6AH 4UFGH 1GI2A 1TBRH 2IJOB 2ZP0H 2NU4E 5JYIA 4YOJA 2BMGB 1QJ6B 1GMDG 5FX5A 4BANB 1MZAA 1EAXA 4CRGA 2PW8H 2WINI 4AX9H 3NPSA 1C1SA 2ZDNA 1SGFG 1A0LA 1YCPH 1ZTKA 2A0QB 2VVUA 1Y3UA 1JXPA 1EX3A 1OWKA 1SLXB 1MTNB 1LVOA 2PLXA 3RXEA 1XVMA 1TPOA 1V2VT 3VB7A 1O2GH 3AAUA 1P11E 2XXLA 2A31A 4Y7AA 2FLBH 4AB8A 3RC5A 1C9TA 1VZQH 4OS4A 1SSXA 2BLQA 4GLYA 2CF8H 2QXJA 2OINA 4JK6A 3UWJH 1TNIA 2A7HA 3NKKA 1OXGA 1C5SA 4YTAA 1O2VA 5E0HA 1RS0A 1GBAA 1UTKA 3VXEH 1PPGE 2WPKS 1C1VH 3M3SA 4X1RU 1HXEH 2JH0D 3PWCA 3QDZB 3KL6A 3M37A 1O34A 1MCTA 3RMNH 1GHBG 3SUDA 5JBTA 4TYDA 3RXUA 1YPHC 1GJDB 3Q3YA 1MZDA 5DP7A 7KMEH 1C1UH 1P10A 2ZGCA 3GICB 1NTPA 1RFNA 2BZ6H 4ISNA 1TX8A 3MNSA 4BOHA 2SGPE 4YOGA 2YOLA 1K1OA 1IQMA 4D9RA 1OP2A 1EOJA 2ZTYA 1TGTA 2CF9H 1D4PB 2G55A 2FLRH 4Q7YA 1BITA 2JKHA 5CHAC 4WMEA 4X0WU 1CBWB 1OWEA 2AMDA 2F9NA 1VGCB 1BDAA 4H6SB 4BNRA 1DXPA 2BDCA 1P2NA 3RU4T 1TMTH 3A86A 4ABHA 1P09A 3L6PA 5J4QA 4FUCA 3LGTA 3RXCA 1THPB 4K3JA 2P93A 4OGXA 3NXPA 2ZHQH 1K1MA 3ELAH 1O2YA 3K6YA 1SI5H 5H4IB 4ISHH 4TY7A 1T7CA 1Y5UT 4ZHMU 3FANA 1GBFA 1CQQA 1O3FA 1FXYA 1TMUH 2NU0E 3TH2H 2FIRH 2ZPRA 3BTDE 3EA8A 4MPUA 1ANBA 3SV6A 1VGCC 1O5FH 1GHAF 3K65B 1GI1A 2ZA5A 4K1EA 2BDGA 1O2KA 4WMDA 1DUEA 2R2MB 3IITA 2ZGJA 3A80A 1FQ3A 1QGFA 1E36B 4ZMAH 3GCNA 3SORA 2B9LA 4XDEA 3ZVCA 1L1NA 5FAHA 4K69A 5JPMH 4Y6DA 4ABGA 1SLVB 2GT8A 3OX7U 1NPMA 1PPBH 2Y7XA 1P04A 4INHA 1P2OA 2HRVA 1BBRH 2HNTC 1AD8H 5HM2A 1E35B 5AFZH 1C5TA 4D7FA 4BAQB 3ZVDA 2GX4A 2FS8A 3ZVBA 5EPYA 2TGDA 2XYAA 1EB2A 1QY6A 1C5ZB 3S9CA 3MWIU 1FAKH 4I31A 2EI6A 4X2YA 1AZZA 3TU7H 1BRAA 1ZLRA 1IQFA 4CRBA 1WOFA 1P02A 1HAPH 4MLFB 5DK1A 3ZZ6A 1YBWA 4Q7ZA 4X2VA 2ZO3H 4AG2A 1MKXK 2SGAA 1GMCF 1ETRH 1HPGA 1HJ9A 3A85A 1H4WA 4X6PA 2P16A 4A6LA 1UTMA 1KDQA 3F9FA 5ESTE 4FUHA 2D26C 1TNJA 2FODA 2Z7FE 3NZIA 3RLYH 3DD2H 3FFGA 3FZDA 3KNXA 1WSSH 3FVFB 1WTHD 5T6FA 3QO6A 1LKBA 2Q6DA 3R3GB 2PSXA 1V2WT 4BAOB 1PQ8A 3SGAE 1OWJA 3KQDA 2PUXB 1V2NT 2OXSA 2PKSB 1KLTA 2FOMB 1P05A 3W94A 1YF4A 2ZPQA 2GZ9A 1RIWC 5DGJA 2CN0H 1GJCB 3MH5A 1ZMNA 1TX6A 1L4DA 4I7YH 3E0PB 2A7CA 1DITH 2P3TB 1K9OE 1DX5M 2AS9A 2FMJA 2BY6X 4CRFA 1ID5H 3ATIA 2WUBA 3FZZA 5FBEA 2WPIS 2G4TA 1UVSH 3C27B 4Z0KA 1FJSA 1F5RA 1O3EA 1QJ1B 1IQEA 1WTGH 1W0ZU 4X6NA 3A8BA 1DWCH 2JETC 3RXHA 1TA2A 2LNCA 1MQ6A 2Z3CA 4E05H 1FNIA 2ZFSA 1AN1E 1SGEE 3D62A 3F68H 1AKSB 2ZDMA 1PYTC 4X6OA 4KGAA 4FUDA 3E16B 1IQKA 3U98H 3CS0A 4YT7H 1ZMLA 1UVOA 1UVTH 3RXMA 5JB9S 1ETTH 1F7ZA 2CHAB 5FPSA 2QF3A 1TALA 3IWMA 2ZEBA 4LZ1H 1BRBE 4KELA 2OBOA 1GBJA 2OC1A 2Y6TA 2HLCA 1FDPA 4FXGH 4E06H 4ZUHA 4A5TS 4TY6A 1ZPZA 1TNGA 3HKJB 4HZHA 3LC5A 4FUGA 1O2UA 4NSYA 3HGPA 1DSTA 3S7KB 6LPRA 3ZZCA 2G00A 4DW2U 3G01A 2PWXA 2R3UA 1C2DA 4GSOA 1S82A 1AFQC 1DT2A 1UTNA 1RJXB 1QRZA 1ZHPA 3GY8A 1EXFA 3S7HB 3QZRA 3QTVH 2BQ6B 1UCYE 1G3CA 2A4OA 1BBRK 1ZHRA 3GYMA 2ILNA 2G51A 4K8YA 1NRQH 1PQ7A 2J95A 1HAIH 1GHZA 3A7XA 4Q2KA 4K60A 3Q77A 3JZ2B 2ANKH 3MU8A 3HATH 5EQRA 4E7RG 7GCHF 4ABEA 2RDLA 2CHAC 5IYTA 6ESTA 2BDIA 3GY3A 4KKDA 1MQ5A 3GOVB 5A0BA 4I32A 1DPOA 2ASUB 3P8OA 2XC5A 4IC6A 4JZ1A 3STIA 1LCYA 3RXPA 1QFKH 1KSNA 1SOTA 5E0JA 2CJIA 2UUJB 1NO9H 2RG3A 1P12E 2BD9A 1V6DA 4B74A 4CBNA 3SU6A 1SL3A 5EXLA 3MH6A 5I46H 1ORFA 2FX4A 4ZKRU 3Q76A 4HTCH 3GYLB 4UONA 3NK8A 3MNCA 3MU4A 3T62A 4JZFH 1UO6A 1G2MA 3SW2B 1QR3E 1V2TT 2V3OH 1SR5C 1LHFH 2O8WA 3SU0A 3GCTF 3KIDU 1DS2E 2YNAA 3HK6B 4JK5A 3A7WA 3KEEA 2FTLE 2AMQA 4KTSA 1DFPA 4TWYA 1P2MA 1VITH 3T26A 3E90B 1FONA 2W3KA 1GI7B 1LDTT 5DJ7A 3PV4A 3WY8A 1TOMH 1O2LA 1LMWB 6GCHG 6GCHF 2IN2A 3SHAH 1DDJA 4JCNA 1GHBF 4HI3A 3A83A 3SNEA 1ZZZA 3D65E 2BB4A 2NU1E 4CHAC 1KLIH 2H1UA 3SU2A 3RXVA 1YGCH 1A3BH 4CRCA 1XKBC 1L1GA 3ZV9A 3PWBA 4A1XA 2Q6FA 4BTIB 1BMAA 3LONA 2F9OA 3GY7A 3I78A 4GVUA 5E2PA 4ABFA 1SFIA 3GY2A 5C1XA 1O2WA 3PMHB 1AIXH 4H6TA 5FX6A 4CH2B 1JRTA 3L33A 1AFQB 1ETSH 1QTFA 1O3LA 3F9GA 1CT0E 1O33A 1C1QA 3BEFB 3TLOA 5GCHF 3MHWU 1NRSH 2O9QA 1ZR0A 4BAMB 3EAJA 2WYJA 3T5FH 4IN2A 1K28D 1MAYA 3LGUA 3URDA 4HFPB 2JETB 2Y82A 2ZF0H 2ZHFH 3GCHC 4B76A 5LGOA 4MG3A 3QTOH 1MTUA 1WU1A 5LPEA 1C2HA 1Z8GA 1CGJE 1QA7A 1ANEA 4NA9H 1F5KU 1KDQB 1GMHG 1IAUA 4X8TH 3LH1A 1Y3XA 1GJ5H 5K0HA 3M7QA 5GJ4B 2FS9A 1Q3XA 3RXQA 1SGIB 4GCHF 3ATMA 1ANDA 4CRDA 1Z8RA 5JDUB 1GI6A 1GG6B 3M5NA 1O36A 1A7SA 1EUFA 4NZQA 1JWTA 5EW2H 2FWWA 1ZTJA 1N6XA 1FV9A 3JZ1B 1SG8B 1BB0B 2J2UA 2XWBI 2W7SA 2ZZUH 5CMXH 1XVOA 3RM0H 5LPFA 1C5XB 1ABIH 1C2EA 4QT8C 2A1DB 3GDSA 1CGHA 1BUIA 2XBXA 3MNXA 4X1PU 2WPJS 3CP7A 1O31A 1MKXH 4UD9H 5BRRE 1C5QA 4Y71A 1K2I1 1CU1A 1PJPA 2Y5FA 4AGKA 3ESTA 2B5TB 6CHAC 4YT6H 2PR3A 3BN9A 4MVNA 2F91A 3RXBA 1OWHA 1LPZB 1ELFA 1O30A 3VPKA 1GBIA 2FOBA 4UDWH 3SN8A 2TIOA 4MTBA 5E0GA 4ABIA 1GMDF 1KTSB 5F8TA 4YM9A 4DY7B 2FOAA 3A89A 1NM6A 1QB1A 1IQIA 3LH3A 1OWIA 7ESTE 1SFQB 2CXVA 4DOQA 3KQCA 3TJVA 1J14A 3RXTA 4B1TA 2A5IA 1OPHB 1C5UA 4X2XA 1B5GH 1GMHF 2ZU5A 3MOCA 4F49A 1SHYA 2XC4A 2GD4B 2BVXH 2HALA 3QK1A 4WJG2 1HRTH 1V2LT 6CHAB 2TRMA 1M9UA 4SGBE 2QA9E 3UPEA 1FY1A 2XCFA 4NIVA 4THNH 1UTLM 5A0CA 1UTPA 1MTSA 1FI8A 1SGDE 1V2KT 1O3BA 1AUTC 1EPTC 1P3CA 2AGEX 2TGTA 4RKOB 1T31A 4K2YA 2A2QH 3MU0A 2G5NA 1WBGB 1NFXA 3RXSA 2Y80A 1GI5A 2FI4E 1O3IA 3NCLA 3RMOH 4AYVB 5A0AE 1XUHA 5EODA 2BX4A 2ZWLH 1C2GA 2BY8X 2ZGBH 1C5NH 4RKJB 5HM9A 3C1KA 4R0IA 2GKVE 2ALVA 2F9VA 1QIXB 1BBRE 3SHCH 2Z9LA 2QC2A 2HNTF 4IGDA 2FXRA 4NIYA 1O5BB 3EDXB 2WYGA 1OP0A 1A2CH 3LGIA 1N8OC 2H9EH 3CS7A 1CE5A 1ELBA 1HAYB 1THRH 1W7XH 3F6UH 1YC0A 1TA6A 1S83A 2WUCA 3SV7A 1FUJA 3E91A 5AF9H 1YPMH 1GVKB 3O8RA 4Y0ZE 1P8VC 1Z1JA 2ZGHA 4ISIH 1HAVB 2THFB 1EJNA 2I6SA 3RXOA 1YCPK 1BQYA 1BA8B 2H9HA 1AWHB 3BEIB 4JYUH 3A8DA 1DVAH 1XUIA 4O97A 1AB9C 3UUZA 5AFYH 3SZNA 1PPCE 2GV7A 1OYQA 3OYPA 1CGIE 5HMAA 2BTCE 3M5LA 1C9PA 1HAXB 3GDUA 3GISB 1TPPA 1TQ0B 1B0EA 2FOFA 4INLA 2HPQH 2DUCA 1FLEE 1XUGA 1TNKA 3TK9A 3TGJE 4BXWA 2DE9A 2BVRH 4MNVA 1SGQE 1EZSC 1GDQA 4X1QU 3P8NA 3RP2A 1S84A 3E1XB 4AFSA 1VITF 2EC9H 4AG1A 3ZYEA 1AKSA 5L2ZH 1GGDB 1D6WA 2NU2E 3ODFA 1ELVA 4Y8ZA 1SLWB 2P94A 1G30B 3M7TA 4MNXA 3VGCC 1SLUB 1NY22 2XTTB 1H9LB 1PQAA 1BZXE 1J16A 1EJMA 4ZH8A 5EOKA 1S0QA 1OWDA 4WXVA 3ATWA 2OQUA 1T4VH 1Z71A 4AGJA 3U69H 1L1JA 2Z3DA 8ESTE 1IQLA 3QN7A 1GBEA 2B0FA 3EE0B 1BTUA 1K1PA 1C1WH 2QYIA 3ATKA 1OS8A 2QV1A 1FAXA 1T8NA 3SUFA 2GDEH 5CHAB 1K1NA 1DOJA 2QAAA 1IQJA 2QCYA 2PSYA 5C67A 3M5MA 2ZDAH 2O8TA 2ZCHP 4RSPA 4ZAEA 4ZKNU 4B75A 1EAIA 4AORA 2QN5T 3VB6A 1O5DH 4ZHLU 2Q6GA 1PPZA 3QGNB 3FP7E 1KYNA 4A1TA 5C5OA 3ZZDA 3L3TA 3NUMA 3A87A 4TPYA 4XOJA 3P92A 1DSUA 1W11U 1A0JA 2VIQA 1E37B 3ZZAA 1FPHH 3VXFH 1SBWA 2STBE 4B71A 1TPAE 1DICA 1NU9A 5I25A 3A8CA 4IN1A 1O3KA 2CMYA 1NZQH 3DUXH 1DLKB 3D49H 1MTVA 1G32B 5T3HA 2VH6A 1GJAB 2OBQA 1T8LA 4BAHB 2G5VA 3I29A 4WXIA 1Q31A 1OKXA 1QURH 1ZJDA 1Z6JH 4ZKOU 3H7TA 4D7GA 3PO1C 1NRRH 1A5IA 2VWNA 1LHDH 1Q2WA 2GMTC 3KN2A 2XBYA 2V35A 1E34B 3KQBA 1EP5A 4O03A 1GI0A 3W95A 1DY9A 1FIWA 1P06A 1ESBA 4I8HA 2AERH 4B2AA 4YZUA 4D8NA 2GCHF 1LQDB 4X1SU 2O8UA 2A32A 1QHRB 4GUXA 1TLDA 5DKMA 1PPEE 2VVCA 1EQ9A 3LU9B 1BTYA 4A7IB 2GDDA 4U30A 5PTPA 1PPHE 1GJ9B 3T29A 2RA3A 3PROA 4FUJA 3DA9B 4OS2A 3QZQA 1HBTH 1X7AC 1MKWH 1O2OA 2ZIQH 3TJOA 3RMMH 3UREA 3V13A 2ZU3A 3UFAA 1A1RA 3RDZA 2ZCKP 1AVXA 5AHGH 3RXFA 4WWYA 1TABE 1DXWA 3Q3KA 3OY5U 1HYLA 3TGKE 2EA3A 3DFJA 4IBLH 2J94A 1NESE 2Z9JA 3AW1A 1LO6A 4JYTA 3GY6A 4IC5A 1Y5AT 1DE7H 1W0YH 3V12A 4GAWA 1H9IE 1O2NA 4XBBA 5A2MH 4LXBH 4INKA 1THSH 1QRWA 1W8BH 1E38B 1O32A 1W12U 1LHCH 1FMGA 1O5GH 5C5NA 1QCPA 2EEKA 3SO3A 4NIWA 2OLGA 2BD5A 1GMCG 1N8OB 2FX6A 1FY3A 1QB9A 4NFEA 3RM2H 1PYTD 1MH0A 4YLQH 1NRNH 3S69A 3EA7A 3M5OA 3TGIE 1GBCA 1IQHA 3GCHB 1ELAA 3U8TH 4DIIH 1C2IA 5DP9A 5GWZA 1GHVH 2GCTB 1S0RA 2WPHS 4ABJA 1CVWH 2ZGXH 1QQUA 1P3EA 4UFEH 1CBWC 1GJ6A 5GCHG 3RXLA 2J92A 2ZU2A 3S9BA 1ZGIA 3GCOA 4WH8A 1T8MA 1J15A 1EOLA 2GZ8A 5ESBA 3GDVA 3UR9A 2AH4X 4F4OC 1V2MT 3PTBA 1MAXA 2FOCA 3DT0H 1JMOH 1XXDA 2Z9IA 1SGNE 2KAIA 1O35A 2W7UA 1LKAA 1YPJH 4FUFA 2BLWA 1WQVH 2RA0A 5LH8A 5L2YH 4ZHAA 4FVDA 2C8XB 5EXNA 5ETXA 3LPRA 1P0SH 5GPIB 1P9UA 1MBMA 1C1MA 3E6PH 4NFFA 4D76A 1S6FA 1TQ7B 4M7GA 2NU3E 4OS1A 4X2WA 3LGYA 1DANH 1AE8H 1VR1H 4NGAH 1SPJA 1C5PA 4KP0A 1VJAU 3SJIA 4CH8B 1C5MD 1BTWA 2HOBA 1B7XB 5F8XA 3BTME 2ZPSA 2LPRA 4Y11E 5AVDA 4GHTA 3RC4A 1GBDA 1K1LA 2UUYA 1KXAA 4UEHH 2SGDE 1W13U 2P8OB 1WAYB 1TRMA 1QL9A 2FOEA 3QX5H 3A8AA 1SOZA 3TH3H 1DM4B 4AB9A 1HXFH 2OC7A 2VB0A 4OS5A 3QLPH 1D3TB 4X6MA 3SUGA 1YPGH 1GJBB 3M3TA 3VEQB 4DURA 2BD3A 3QUMP 4MQAA 2SNWA 1JIRA 1SGCA 5FXLA 3BF6H 1CO7E 1TRYA 1YYY1 1OP8A 3TJNA 4X8UH 4O3UA 4U32A 1MUEB 1J8AA 2ZFPH 5DG6A 1MU8B 1EP6A 2H2ZA 5CE1A 5C20A 1CHGA 5T6DA 3VGCB 4ZXYH 3BTTE 2VWLA 2WPMS 1YLCA 2GMTB 3UQVA 3P17H 1Y8TA 3TK6A 5HGGA 2ZQ1A 1IQGA 1EPTB 4NG9H 1V2ST 1O2ZA 5EQSA 1TGBA 1HAOH 1ZHMA 1P2JA 2FM2A 1SQAA 1JOUB 1O3CA 2F83A 3UNRA 1GDNA 2G81E 2ALPA 2ODPA 1UHBA 3SGQE 5TCCA 2AIQA 3OU0A 1O5EH 1GWAA 5C1YA 4CREA 1EB1H 4Y79A 1CT4E 3SJKA 1LPGB 2D8WA 1UK4A 1BRCE 1NROH 1YCPM 1MTNC 1NRPH 4BAKB 5F6MA 2UUFB 2SFAA 9LPRA 2FESH 2ZFRH 2PKSC 2CV3A 2Z94A 4TPIZ 1C1NA 3KCGH 1ZJKA 4Y8YA 5JBAS 2ODQA 3PLBA 1YKTA 1G2LA 2STAE 1ZPCA 4JMYA 2A5AA 1C1TA 4ZROA 1K1IA 3ENSB 1V3XA 1XUFA 4AYYB 1ZMJA 3BTKE 3A7TA 2GT7A 1SGPE 2BQ7B 2ZDVH 1Z8IB 1MU6B 2R0KA 1SGFA 2SGFE 3LKWA 1RXPA 2FEQH 2BDAA 4DVAU 1UK2A 3K9XB 4I8KA 4ZKSU 4AN7A 7LPRA 3E8LA 3SOSA 3F9EA 4CR5A 2ZFTA 1PFXC 1ELDE 2IOTA 3FAOA 3HGNA 3ZZBA 5JB8S 1F0UA 1TGNA 3PM3A 1GCTB 4E7NA 3LDXH 1IOEA 2GZ7A 2Z9GA 1AZ8A 1ELTA 2TGAA 4NSVA 3SU1A 1HGTH 1Y59T 1O38A 2Z3EA 2HWLB 3ZZ4A 2VIWA 1HJAC 2BD8A 3SU3A 2XW9A 1QQ4A 2PGBB 1CHOF 5C2ZA 1FY5A 2F3CE 5DO4H 1NT1A 1K21H 1HIAA 5C1UA 1O5CB 1S5SA 2XCNA 3UNSA 1MBQA 3QWCH 1UJ1A 3CENA 1ARBA 3RU4E 2BHGA 3MO6A 1NFWA 1XUKA 2AYWA 3URCA 4ABAA 4NWKA 2FTMA 3HPTB 1LVMA 2C3SA 3ATLA 1HUTH 1P9SA 1ACBE 3RU4D 1EKBB 1HV7A 1MD7A 1MD8A 2TGPZ 1GCTC 1QB6A 3KF2A 2IPHA 4NIXA 1LPKB 2BD4A 4DT7B 4ZXXH 2ZHDA 4BTUB 1GVZA 1OSSA 1LQEA 1C2KA 2ULLA 3MNBA 2P3UB 2PTNA 1QL7A 4NCYA 1ESTA 1J9CH 4VGCB 2HVXA 5FHTA 3SGBE 3SJ9A 1ABJH 1HNEE 1YPKH 4Y8XA 1TONA 4MPWA 4CR9A 2BQWB 1C1OA 2QXHA 2HGTH 3A7ZA 5EG4A 2R9PA 1QRXA 1W2KH 1CSOE 2BLOA 1XKAC 1S6HA 2V3HH 5EPNA 1V2UT 1DWBH 2FPZA 5SGAE 1ELEE 2P8OC 4IW4E 2R0LA 3PMBB 1GI8B 1TX7A 2I6QA 2PV9B 1B0FA 2P59A 4MDSA 2P3FH 4MNYA 2C8YB 3TITA 2ZQ2A 2GVFA 3A82A 3PMJA 3PO1B 3EA9A 3QGJA 3MO3A 1AMHA 4ASHA 1C5WB 1ESAA 4B73A 4I8JA 1E0FD 2A45B 3BSQA 2ZFQH 3T2NA 2AGIX 1TRNA 5TCAA 3UQOA 3E3TA 1O3HA 1UHBB 2XBVA 2QY0B 2R3YA 1SGYE 1VCWA 1MKWK 4KTUA 2PTCE 1IHTH 2P95A 3FP8E 4AFQA 3RXDA 2AIPA 5F03A 1UMAH 2BY5X 5JBCS 3N7OA 1FZZA 1K1JA 1S85A 2QXGA 3HKIB 2C8ZB 3ZZ9A 1F0RA 1AHTH 1W14U 4OS7A 3ZVAA 3RXKA 1TWXB 1EATA 2TPIZ 2VH0A 1TAWA 2BYAX 1FPCH 2H5CA 3SBKA 3B23B 3RXIA 3GY4A 4IMZA 4ABDA 4DIHH 8GCHG 4ISLA 2OUAA 1RRKA 1KY9A 2PGQB 1KXFA 5ABWA 2D2DA 3BEUA 1TOCB 2ZCLP 1QBVH 1O2MA 2ZTXA 1TBQH 2F9PA 3K6ZA 1L4ZA 1BJUA 1INCA 1A3EH 3TH4H 1YLDA 1UTOA 3DHKH 3E0NB 4U01A 1F0TA 5G4BA 5A8YA 1KTTB 1V2RT 3ODDA 3SNCA 1O2RA 3UOPA 1P2KA 2ZC9H 5E2OA 2A2XH 4IMQA 4CHAB 3SUEA 2BY9X 1ZSKA 2WPLS 3EGKH 2YNBA 4Y7BA 2A4QA 1W10U 3D23A 2BXUH 2VGCC 5BPEA 2A4GA 2ZG0H 2FDAA 1EAUA 2W5EA 3RLWH 1MMJN 1SHHB 1G36A 1K22H 2QXIA 2ZHEH 3TIUA 4YOIA 3TPIZ 1TPSA 1NFUA 1V2JT 1HAVA 2VINA 2C90B 3M35A 2KAIB 4WH6A 1WUNH 4ESTE 3RXJA 1GHYH 1TMBH 2B8OH 4DGJA 1JRSA 1QJ7B 3BTEE 3DFLA 1GBLA 5F8ZA 1GCDA 3MH7A 5L30H 2AEIH 2W3IA 1O2JA 1V2OT 4FU7A 4Y76A 3Q3XA 3PMAB 1C2LA 1OYTH 1RIWB 1O2TA 3SJ8A 1YP9A 1ELCA 1HJ8A 2ANYA 1XMNB 1BT7A 3BTFE 2VIVA 1H9HE 1QA0A 1TB6H 4FU9A 3M3VA 1UVPA 1HJAB 3SV8A 3A81A 1FIZA 4GPGA 1C4U2 2ESTE 3SI4H 5DPAA 3MI4A 1GI4A 4FU8A 1BTHH 2G4UA 2BLVA 2UWLA 2BX3A 2ZFFH 2TBSA 1Z7KA 4MPXA 1C1PA 2OQ5A 2RCEA 1O3PB 3AASA 3B9FH
chains in the Genus database with same CATH superfamily
1A46H 2Y5HA 5JBBS 1P01A 3P8FA 3KGPA 3TNTA 2J34A 4A1VA 2BVSH 4UE7H 1FY8E 4MPVA 2GCTC 4X8VH 4O9VA 2FO9A 2KZ4A 1G3BA 5HXFA 1SVPA 1PPFE 1F5LA 1LHGH 1A4WH 3PYHA 4J2YB 1F92A 1BIOA 1BTZA 4FUIA 5A8ZA 3ZZ5A 5IK2D 1WYKA 1GBMA 1KLJH 1TNHA 4NA8A 1SC8U 1P03A 1XXFA 2G52A 1AE5A 2Y7ZA 4HGCA 4U2WA 2K0QA 4UFFH 8KME2 3VFEA 4WVPE 2J97A 3SNDA 1AB9B 3F0PA 3BV9B 2F4LA 4Q80A 2J4IA 3A7VA 2BY7X 3V3MA 1WV7H 4OS6A 1LVYA 2VWOA 1F0SA 3RXAA 2A4RA 3NRLA 2BD7A 1CA0C 1TBZH 4KTCA 1RTFB 1C5RA 4DG4A 1D9IA 3H5CB 3ZYDA 2H6MA 7GCHG 1HB0B 2F9BH 3I77A 3RXGA 1A0HB 4NWLA 3ZVGA 2XWAA 1MCVA 1Z1IA 3MTYA 1AGJA 1CHOG 1AO5A 1C5LH 1NBME 1ZRBA 2OD3B 1DY8A 2B7DH 4PROA 2D1JA 2ZTZA 2L74A 2ZDKA 1N6YA 3A84A 1GVLA 1XM1A 1O39A 5L6NH 1C5YB 1GI9B 1GJ7B 4BXSA 1BMLA 4HG6A 3N7DA 3SU4A 2OTVA 3OY6U 3P95A 1H1BA 2ZECA 1AFEH 1O3OA 4JZIA 1GHXH 2ZHWH 2WV5A 5B6OA 2ODYB 3CNRA 3SQEE 3LGVA 1LVBA 1GL0E 1GI3A 1BRUP 5EXMA 2FYQA 1BTXA 2AGGX 1V2PT 1TGSZ 1SQTA 2BDYA 4O3TA 1ZPBA 2AMPA 1D3PB 1GBTA 4K1TA 1COWD 3KQ5A 2SNVA 1EASA 1D3QB 3MYWA 2H9TH 2VVVA 3UOUA 1BOQA 1CA0B 1ELGA 1H8DH 1NS3A 1P2QA 1C2FA 1TIOA 2FOGA 3PLPA 1N1LA 1A61H 1QBNA 4WY3A 4XE4A 2VIPA 4K1SA 1UCYH 1O2IA 1H8IH 2OP9A 3A88A 1NU7B 5T6GA 2GTBA 1U6QA 4H4FA 3SV2H 1Z8JB 1P2IA 2O8LA 4OGYA 4B2BA 1ZTLA 1GG6C 1RTLA 2A5KA 2EI8A 4JYVH 3MH4A 1A5HA 3U1JB 1HDTH 3MFJA 2FYRA 1Z6EA 4FUBA 3UAIC 2GP9B 1BTPA 3V7TA 4BTTB 5LPRA 2K1QA 1C5OH 5EJLA 3ZZ7A 1QL8A 2VNTA 5HYOA 2BOKA 3BIUH 3EYDA 3UY9A 3KYGA 3U8RH 3ITIA 1CT2E 2VGCB 3DCLA 3AAVA 1AVWA 1WQSA 2GGVB 3K2UA 3MU5A 3ZZ3A 3GS9A 4LZ4B 3PTNA 2PUQH 1GBHA 2XRCA 3LGWA 1LTOA 1KXEA 2VWMA 2BOHB 1KXBA 2SGQE 4AFZA 2R2WU 1P57B 1PQ5A 5A09A 2ANWA 4K8BA 1YM0A 3A7YA 5GDSH 3BTWE 3LT3A 4JZEH 2GCHG 3LJJA 1ZSLA 3O8CA 1TFXA 3Q00A 1JBUH 4XBCA 1O3AA 3SU5A 3UWIA 3PV5A 4FUEA 5FCKA 1C2JA 1UCYK 4TWWA 3BIVH 1W3CA 2BZAA 1O2QA 3ZV8A 5A8XA 1GBKA 1NN6A 2JH6D 2BD2A 1Y3VA 2VIDA 1S81A 3LIWA 2C93B 5C3NA 2V0BA 4B6FA 4LOYH 1LHEH 3SQHE 1SQOA 3RMLH 4M9FA 1DWDH 3HK3B 1NC6A 4DCDA 1O3MA 1SGRE 1FN8A 5KECA 1UTJA 1DUAA 3S9AA 3TVJB 2OC8A 2A7JA 1HFDA 3P70B 1SB1H 3MU1A 1XX9A 2PHBA 4XFQA 1YPHE 2PKAA 1C4Y2 1O2PA 2ZU1A 3RUOA 2Z9KA 3ZVFA 2BM2A 1AI8H 5FCRA 1AU8A 1VCQA 1GJ4H 2J38A 4XSKU 1RGQA 1OOKB 3P6ZB 3BG4C 3LJOA 1O2SA 2XBWA 1EJAA 2ZNKH 3U1IB 4GHQA 5DP8A 3OE7D 1AY6H 2V6NA 2SGEE 1CA8B 4DJZB 2WZQA 1G37A 1BMMH 4YLUA 3SNAA 1AQ7A 1W7GH 1D3DB 1TNLA 5EU8A 4I8LA 3RXRA 5DP3A 2DE8A 2W26A 5J4SA 3MQKC 2BDBA 5EQQA 3VB5A 4VGCC 1HAGE 4MNWA 1VJ9U 5E8EH 3UR6A 3UIRA 2BDHA 3SI3H 1EZQA 2O8MA 2ZDLA 3GY5A 4I8GA 3LOXA 2ZI2H 2NWNA 4Q7XA 1O3NA 3LC3A 4I33A 3S0NA 1GPZA 1IQNA 1GBBA 1L2EA 1RD3B 3BTHE 5DP4A 5FL7D 1ZOMA 3RC6A 1EZUC 3KQEA 4WMFA 4B2CA 1FY4A 5K7RA 1T32A 1G3DA 2UWOA 3SJOA 1BMNH 1GHAG 2WV4A 1YPLH 4D9QA 1TE0A 1ZRKA 3IG6B 1GJ8B 1SGTA 1ZGVA 1G3EA 4ISOA 2PKAB 3STJA 9ESTA 1A5GH 1C5VA 3TK5A 4X1NU 5TJXA 4ABBA 1UTQA 1BHXB 2C8WB 1O3GA 1WCZA 2FOHA 2XC0A 1F2SE 1BHXF 1Y3YA 3P8GA 2WPDD 4CBOA 2FZZA 5FPTA 2Z6BD 1O2HA 3VB3A 4R8TB 4Y10E 5FPYA 1FN6A 2QF0A 2Q1JA 2H5DA 3NWUA 1C2MA 3ZIAD 1HIAB 3O8DA 1V2QT 4AZ2B 3SV9A 1Y5BT 2HNTE 3MMGA 4JZDH 2ZU4A 3F1SB 3N99A 4RT0A 4F48B 1ZSJA 1AWFH 1O3DA 3UTUH 1GHWH 3PRDA 3M7UA 3M36A 4AOQA 3F0OA 1UK3A 2ANMH 4AFUA 8GCHF 5EW1H 1EZXC 1BCUH 1SMFE 3GCTG 4XD7D 3F9HA 1DLEA 1KMHB 2OCVB 1ARCA 5DP5A 2F9UA 5DP6A 3B8JA 4NZLA 1C1RA 1DWEH 1KIGH 2EI7A 2C4FH 4YO9A 8LPRA 1YPEH 5DSFA 1O3JA 2PFEA 1O37A 2FI5E 3T25A 1ANCA 1G9IE 1AUJA 1MTWA 1GL1A 4H42U 2BXTH 1GDUA 1BJVA 1KXDA 3ZVEA 1XUJA 2UWPA 4YESB 3O8BA 1OX1A 2CGAA 1Y3WA 5FBIA 1KXCA 1HCGA 1J17T 1ZYOA 1HAZB 4GCHG 1TGCA 1VITG 3EQ0H 3U9AH 5EIYA 2OC0A 1UVUH 3TNSA 2UUKB 3F3BA 1H8HD 4X8SH 4UFDH 4LK4A 4XBDA 4A92A 3ZZ8A 3H7OA 3BTQE 5GXPA 2ZKSA 2Y5GA 1IHSH 3T28A 2AFQB 4J1YA 3AW0A 1QNJA 1O5AB 2XNIA 1NFYA 1HLTH 1HAHH 4K5ZA 1QZ8A 4OM9A 1T4UH 4Y0YE 3V0XA 1AVGH 3MO9A 2WV9A 2FI3E 4IS5A 3DSOA 2VU8E 1QBOA 3OTJE 2HPPH 4CRAA 1RTKA 5GIBA 5EGMA 1EPTA 2V3MA 4SGAE 4NA7A 3BG8A 1C4V2 3VB4A 3R0FA 3TJUA 1O2XA 3PLKA 4RN6A 1GGDC 3T27A 1SKYE 3U8OH 4FVBA 3SZEA 2Y81A 2FP7B 2VJ1A 1EAWA 1T8OA 3AVZA 2JH5D 1TYNA 3BTGE 2QIQA 3M61U 2M5TA 1VCPA 2G8TA 2RDEA 5HIZA 3KHVA 1O0DH 1JIMA 4WF8A 3PB1E 3FO8D 2GV6A 2J9NA 5IDKA 1D6RA 3OSYA 2VIOA 5KGOA 3SNBA 3FP6E 2QGRA 3BG4B 1L0ZA 3UNQA 4Z6AH 4UFGH 1GI2A 1TBRH 2IJOB 2ZP0H 2NU4E 5JYIA 4YOJA 4TSFD 2BMGB 1QJ6B 4TT3D 4P00A 1GMDG 5FX5A 4BANB 1MZAA 1EAXA 4CRGA 2PW8H 2WINI 4AX9H 3NPSA 1C1SA 2ZDNA 1SGFG 1A0LA 1YCPH 1ZTKA 2A0QB 2VVUA 3DSPA 1Y3UA 1JXPA 1EX3A 1OWKA 1SLXB 1MTNB 1LVOA 2PLXA 3RXEA 1E1QD 1XVMA 2L6OA 1TPOA 2M2AA 5HKKD 1V2VT 3VB7A 1O2GH 3AAUA 1P11E 2XXLA 2A31A 3FN8A 4Y7AA 5CDFE 2FLBH 4AB8A 3RC5A 1C9TA 1VZQH 4OS4A 1SSXA 2BLQA 4GLYA 2CF8H 2QXJA 2OINA 4JK6A 3UWJH 3EE7A 1TNIA 2A7HA 3NKKA 1OXGA 2HVYB 1C5SA 4YTAA 1O2VA 5E0HA 1RS0A 1GBAA 1UTKA 3VXEH 1PPGE 2WPKS 1C1VH 3M3SA 4X1RU 1HXEH 2JH0D 3PWCA 3QDZB 3KL6A 3M37A 1O34A 1MCTA 3RMNH 1GHBG 3SUDA 5JBTA 4TYDA 3RXUA 1YPHC 1GJDB 1YLNA 3Q3YA 1MZDA 5DP7A 4Z1MD 1C1UH 1P10A 2ZGCA 3PRBA 3GICB 7KMEH 1NTPA 1RFNA 2BZ6H 2LELA 1YY3A 4ISNA 1TX8A 3MNSA 4BOHA 2SGPE 4YOGA 2YOLA 1K1OA 1IQMA 4D9RA 1OP2A 1EOJA 2ZTYA 1TGTA 2CF9H 3AK5A 1D4PB 2G55A 2FLRH 4Q7YA 1BITA 2JKHA 5CHAC 4WMEA 4X0WU 1CBWB 1OWEA 2AMDA 2F9NA 1VGCB 1BDAA 4H6SB 4BNRA 1DXPA 2BDCA 4FETA 1P2NA 3RU4T 1UW7A 1TMTH 3A86A 4ABHA 1P09A 3L6PA 5J4QA 4FUCA 3LGTA 3RXCA 1THPB 4K3JA 2P93A 4OGXA 3NXPA 2ZHQH 1K1MA 3ELAH 1O2YA 3K6YA 1SI5H 5H4IB 4ISHH 4TY7A 1T7CA 1Y5UT 4DT4A 4ZHMU 3FANA 1GBFA 1CQQA 1O3FA 1FXYA 1TMUH 3UB0A 2NU0E 3TH2H 2FIRH 2ZPRA 3BTDE 3EA8A 4MPUA 1ANBA 3SV6A 1VGCC 1O5FH 1GHAF 3K65B 1GI1A 2ZA5A 4K1EA 2BDGA 1O2KA 1E79D 4WMDA 1DUEA 2R2MB 3IITA 2ZGJA 3A80A 1FQ3A 1QGFA 1E36B 4ZMAH 3GCNA 3SORA 2B9LA 4XDEA 3ZVCA 1L1NA 5FAHA 4K69A 5JPMH 4Y6DA 4ABGA 1SLVB 2GT8A 5C0TA 3OX7U 2J5UA 1NPMA 1PPBH 2Y7XA 1P04A 4INHA 1P2OA 2HRVA 1BBRH 2HNTC 1AD8H 5HM2A 4AC9A 1E35B 5AFZH 1C5TA 4D7FA 4BAQB 3ZVDA 2GX4A 2FS8A 3ZVBA 5EPYA 2TGDA 2XYAA 1EB2A 1QY6A 1C5ZB 3S9CA 3MWIU 1FAKH 4I31A 2EI6A 4X2YA 1AZZA 3TU7H 1BRAA 1ZLRA 1IQFA 4CRBA 1WOFA 1P02A 1HAPH 4P02A 4MLFB 5DK1A 3ZZ6A 1YBWA 4Q7ZA 4X2VA 2ZO3H 4AG2A 1MKXK 2SGAA 1GMCF 1ETRH 1HPGA 1HJ9A 3A85A 1H4WA 4X6PA 4ACBA 2P16A 4A6LA 1UTMA 1KDQA 3F9FA 5ESTE 4FUHA 2D26C 1TNJA 1VKYA 2FODA 1NBMD 2Z7FE 3NZIA 3RLYH 3DD2H 4YXWD 3FFGA 3FZDA 3KNXA 1WSSH 3FVFB 4RT1A 1WTHD 5T6FA 3QO6A 1LKBA 2Q6DA 3R3GB 2PSXA 1V2WT 5EJZA 4BAOB 1PQ8A 3SGAE 1OWJA 3KQDA 2PUXB 3OEHD 1V2NT 2OXSA 2PKSB 1KLTA 2FOMB 1P05A 3W94A 1YF4A 2ZPQA 2GZ9A 1RIWC 5DGJA 2CN0H 1GJCB 3MH5A 1ZMNA 1TX6A 1L4DA 4I7YH 3E0PB 2A7CA 1DITH 2P3TB 1K9OE 1DX5M 2AS9A 2FMJA 2BY6X 4CRFA 1ID5H 3ATIA 2WUBA 3FZZA 5FBEA 2WPIS 2G4TA 1UVSH 3C27B 4Z0KA 1FJSA 1F5RA 1O3EA 1QJ1B 1IQEA 1WTGH 1W0ZU 4X6NA 3A8BA 1DWCH 2JETC 3RXHA 1TA2A 2LNCA 1MQ6A 2Z3CA 4E05H 1FNIA 2ZFSA 1AN1E 1SGEE 3D62A 2XOKD 3F68H 1AKSB 2ZDMA 1PYTC 4X6OA 4KGAA 4FUDA 3E16B 1IQKA 3U98H 3CS0A 4YT7H 1ZMLA 1UVOA 1UVTH 3RXMA 5JB9S 1ETTH 1F7ZA 2CHAB 5FPSA 2QF3A 2JDID 1TALA 3IWMA 2ZEBA 4LZ1H 1BRBE 4KELA 2OBOA 1GBJA 2OC1A 2Y6TA 2HLCA 1FDPA 4FXGH 4E06H 3OAAD 4ZUHA 4A5TS 4TY6A 1ZPZA 1TNGA 3HKJB 4HZHA 3LC5A 1WDIA 4FUGA 1O2UA 4NSYA 3HGPA 1DSTA 3S7KB 6LPRA 3ZZCA 2G00A 4DW2U 3PV2A 3G01A 2PWXA 2R3UA 1C2DA 4GSOA 3SYJA 1S82A 1AFQC 1DT2A 1UTNA 1RJXB 1QRZA 1ZHPA 3GY8A 1EXFA 3S7HB 3QZRA 3QTVH 5HIYA 2BQ6B 1UCYE 1G3CA 2A4OA 1BBRK 2QF5A 1ZHRA 3GYMA 2ILNA 2G51A 4K8YA 1NRQH 1PQ7A 2J95A 1HAIH 1GHZA 3A7XA 4Q2KA 4K60A 3Q77A 3JZ2B 2ANKH 3MU8A 3HATH 5EQRA 4E7RG 7GCHF 4ABEA 2RDLA 2CHAC 5IYTA 6ESTA 2BDIA 3GY3A 4KKDA 1MQ5A 3GOVB 5A0BA 4I32A 1DPOA 2ASUB 3P8OA 2XC5A 4IC6A 4JZ1A 3STIA 1LCYA 3RXPA 1QFKH 1KSNA 1SOTA 5E0JA 2CJIA 2UUJB 1NO9H 2RG3A 1P12E 2BD9A 1V6DA 4B74A 4CBNA 3SU6A 1SL3A 5EXLA 3MH6A 5I46H 3WW7A 2OK5A 1ORFA 2FX4A 4ZKRU 3Q76A 4HTCH 3GYLB 4UONA 3NK8A 3MNCA 3MU4A 3T62A 4JZFH 1UO6A 1G2MA 3SW2B 1QR3E 1V2TT 2V3OH 1SR5C 1LHFH 2O8WA 3SU0A 3GCTF 3KIDU 1DS2E 2YNAA 3HK6B 4JK5A 3A7WA 3KEEA 2FTLE 2AMQA 1WXRA 2K8IA 4KTSA 1DFPA 4TWYA 1P2MA 1VITH 3T26A 3E90B 1FONA 2W3KA 1GI7B 1LDTT 5DJ7A 3PV4A 3WY8A 2EY4C 1TOMH 1O2LA 1LMWB 6GCHG 6GCHF 2IN2A 3SHAH 1DDJA 4JCNA 1GHBF 4HI3A 3A83A 3SNEA 1ZZZA 3D65E 2BB4A 2NU1E 4CHAC 1KLIH 2H1UA 3SU2A 3RXVA 1YGCH 1A3BH 4CRCA 3H09A 1XKBC 1L1GA 3ZV9A 3PWBA 4A1XA 2Q6FA 4BTIB 1BMAA 3LONA 2F9OA 3GY7A 3I78A 4GVUA 5E2PA 4ABFA 1SFIA 3GY2A 5C1XA 1O2WA 3PMHB 1AIXH 4H6TA 5FX6A 4CH2B 1JRTA 3L33A 1AFQB 1ETSH 1QTFA 1O3LA 3F9GA 1CT0E 1O33A 1C1QA 1YWUA 3BEFB 3TLOA 5GCHF 3MHWU 1NRSH 2O9QA 1ZR0A 4BAMB 3EAJA 2WYJA 3T5FH 4IN2A 1K28D 1MAYA 3LGUA 3URDA 4HFPB 2JETB 2Y82A 2ZF0H 2ZHFH 3GCHC 4B76A 5LGOA 4MG3A 3QTOH 1MTUA 1WU1A 5LPEA 1K0HA 1C2HA 1Z8GA 1CGJE 1QA7A 1ANEA 4NA9H 1F5KU 1KDQB 1GMHG 1IAUA 4X8TH 3LH1A 1Y3XA 1GJ5H 5K0HA 3M7QA 5GJ4B 2FS9A 1Q3XA 3RXQA 1SGIB 4GCHF 3ATMA 1ANDA 4CRDA 2V7QD 1Z8RA 5JDUB 1GI6A 1GG6B 3M5NA 1O36A 1A7SA 1EUFA 4NZQA 1JWTA 5EW2H 2FWWA 1ZTJA 1N6XA 1FV9A 3JZ1B 1SG8B 1BB0B 2J2UA 2XWBI 2W7SA 2ZZUH 3VG8A 5CMXH 1XVOA 3RM0H 5LPFA 1C5XB 1ABIH 1C2EA 4QT8C 2A1DB 3GDSA 1CGHA 1BUIA 2QE7D 2XBXA 3MNXA 4X1PU 2WPJS 3CP7A 1O31A 1MKXH 4UD9H 5BRRE 1C5QA 4Y71A 1K2I1 1CU1A 1PJPA 2Y5FA 4AGKA 3ESTA 2B5TB 6CHAC 4YT6H 2PR3A 3BN9A 4MVNA 2F91A 3RXBA 2QF4A 1OWHA 5CHBA 1LPZB 1ELFA 1O30A 3VPKA 1GBIA 2FOBA 4UDWH 3SN8A 2TIOA 4MTBA 5E0GA 4ABIA 1GMDF 1KTSB 5F8TA 4YM9A 4DY7B 2FOAA 3A89A 1NM6A 1QB1A 1IQIA 3LH3A 1OWIA 2JJ1D 1SFQB 7ESTE 2CXVA 4DOQA 3KQCA 3TJVA 1J14A 3RXTA 4B1TA 2A5IA 1OPHB 1C5UA 5C17A 4F55A 4X2XA 1B5GH 1GMHF 5DN6D 2ZU5A 3MOCA 4F49A 1SHYA 2XC4A 2GD4B 2BVXH 2HALA 3QK1A 4WJG2 3DSGA 1HRTH 1V2LT 6CHAB 2TRMA 1M9UA 4SGBE 2QA9E 3UPEA 1FY1A 2XCFA 4NIVA 4THNH 1UTLM 5A0CA 1UTPA 1MTSA 1FI8A 1SGDE 1V2KT 2CK3D 1O3BA 1AUTC 1EPTC 1P3CA 2AGEX 2TGTA 4RKOB 1T31A 4K2YA 2A2QH 3MU0A 2G5NA 1WBGB 1NFXA 3RXSA 2Y80A 1OHHD 1GI5A 2FI4E 1O3IA 3NCLA 3RMOH 4AYVB 5A0AE 1XUHA 5EODA 4ACAA 2BX4A 2ZWLH 1C2GA 2BY8X 2ZGBH 1C5NH 4RKJB 5HM9A 3C1KA 4R0IA 2GKVE 2ALVA 2F9VA 1SQRA 1QIXB 1BBRE 3SHCH 2YMSC 2QC2A 2HNTF 2Z9LA 4IGDA 2FXRA 4NIYA 1O5BB 3EDXB 2WYGA 1OP0A 1A2CH 3LGIA 1N8OC 2H9EH 3CS7A 1CE5A 1ELBA 1HAYB 1THRH 1W7XH 3F6UH 1YC0A 1TA6A 1S83A 2WUCA 3SV7A 1FUJA 3E91A 5AF9H 1YPMH 1GVKB 3O8RA 4Y0ZE 1P8VC 1Z1JA 2ZGHA 4ISIH 1HAVB 2THFB 1EJNA 2I6SA 3RXOA 1YCPK 1BQYA 1BA8B 2H9HA 1AWHB 3BEIB 4JYUH 3A8DA 1DVAH 1XUIA 4O97A 1AB9C 3UUZA 5AFYH 3SZNA 1PPCE 2GV7A 1OYQA 3OYPA 1CGIE 5HMAA 2IPQX 2BTCE 3M5LA 1C9PA 1HAXB 3GDUA 2YMSB 1TPPA 3GISB 1TQ0B 1B0EA 2FOFA 4INLA 2HPQH 3N7EA 2DUCA 1FLEE 1XUGA 1TNKA 3TK9A 3TGJE 4BXWA 2KCOA 2DE9A 2BVRH 4MNVA 1SGQE 1EZSC 1BMFD 1GDQA 4X1QU 3P8NA 3OEED 3RP2A 1S84A 3E1XB 4AFSA 1VITF 2EC9H 4AG1A 3ZYEA 1AKSA 5L2ZH 1GGDB 1D6WA 2NU2E 3ODFA 1ELVA 4Y8ZA 1SLWB 2P94A 1G30B 3M7TA 4MNXA 3VGCC 1SLUB 1NY22 2XTTB 1H9LB 1PQAA 1BZXE 1J16A 1EJMA 4ZH8A 5EOKA 1S0QA 1OWDA 4WXVA 3ATWA 1H8ED 2OQUA 1T4VH 1Z71A 4AGJA 3U69H 1L1JA 2Z3DA 8ESTE 1IQLA 3QN7A 1GBEA 5C0UA 2B0FA 3EE0B 1BTUA 1K1PA 1C1WH 2QYIA 3ATKA 1OS8A 2QV1A 1FAXA 1T8NA 3SUFA 2GDEH 2JIZD 5CHAB 1K1NA 1DOJA 2QAAA 1IQJA 2QCYA 2PSYA 5C67A 3M5MA 2ZDAH 2O8TA 2ZCHP 4RSPA 4ZAEA 4ZKNU 4B75A 1EAIA 4AORA 2QN5T 3VB6A 1O5DH 4ZHLU 2Q6GA 1PPZA 3QGNB 3FP7E 1KYNA 4A1TA 5C5OA 3ZZDA 3L3TA 3NUMA 3A87A 4TPYA 4XOJA 3P92A 1DSUA 1W11U 2JJ2D 1A0JA 2VIQA 1E37B 3ZZAA 1FPHH 3VXFH 1SBWA 2STBE 3U28C 4B71A 1TPAE 1DICA 1NU9A 5I25A 1MABB 3A8CA 4IN1A 1O3KA 2CMYA 1NZQH 3DUXH 1DLKB 3D49H 1MTVA 1G32B 5T3HA 2VH6A 1GJAB 2OBQA 1T8LA 4BAHB 2G5VA 3I29A 4WXIA 1Q31A 1OKXA 1QURH 1ZJDA 1Z6JH 4ZKOU 3H7TA 4D7GA 3PO1C 1NRRH 1A5IA 2VWNA 1LHDH 1Q2WA 2GMTC 3KN2A 2XBYA 2V35A 1E34B 3KQBA 1EP5A 4O03A 1GI0A 3W95A 2GJGA 1DY9A 1FIWA 4Q4LA 2KR7A 3FKSD 1P06A 1ESBA 4I8HA 2AERH 4B2AA 4YZUA 4D8NA 2GCHF 1LQDB 4X1SU 2KX4A 2WHXA 2O8UA 2A32A 1QHRB 4GUXA 1TLDA 5DKMA 1PPEE 2VVCA 1EQ9A 3LU9B 2HLDD 1BTYA 4A7IB 2GDDA 4U30A 5PTPA 1PPHE 1GJ9B 3T29A 2RA3A 3PROA 4FUJA 3DA9B 4OS2A 3QZQA 1HBTH 1X7AC 1MKWH 1O2OA 2ZIQH 3TJOA 3RMMH 3UREA 3V13A 2ZU3A 4ZCNA 3UFAA 1A1RA 3RDZA 2ZCKP 1AVXA 5AHGH 3RXFA 4WWYA 1TABE 1DXWA 2F43B 3Q3KA 3OY5U 1HYLA 3TGKE 2EA3A 3DFJA 4IBLH 2J94A 1NESE 2Z9JA 3AW1A 1LO6A 4JYTA 3GY6A 4IC5A 4RI0A 1Y5AT 4XRNA 1DE7H 1W0YH 3V12A 4GAWA 1H9IE 1O2NA 2IJD1 4XBBA 5A2MH 4LXBH 4INKA 1THSH 1QRWA 1W8BH 2AHME 1E38B 1O32A 3F2FA 1W12U 1LHCH 1FMGA 1O5GH 5C5NA 1QCPA 2EEKA 3SO3A 4NIWA 2OLGA 2BD5A 1GMCG 1N8OB 2FX6A 1FY3A 1QB9A 4NFEA 3RM2H 1PYTD 1MH0A 4YLQH 1NRNH 3S69A 3EA7A 3M5OA 3TGIE 1GBCA 1IQHA 3GCHB 1ELAA 3U8TH 4DIIH 1C2IA 5DP9A 5GWZA 1GHVH 2GCTB 1S0RA 2W6JD 2WPHS 1W0KD 4ABJA 1E1RD 1CVWH 2ZGXH 1QQUA 1P3EA 4UFEH 1CBWC 1GJ6A 5GCHG 3RXLA 2J92A 2ZU2A 3S9BA 1ZGIA 3GCOA 4WH8A 1T8MA 1J15A 1EOLA 2GZ8A 5ESBA 3GDVA 2KCAA 3UR9A 2AH4X 4F4OC 1V2MT 3PTBA 1MAXA 2FOCA 3DT0H 1JMOH 1XXDA 2Z9IA 1SGNE 2KAIA 1O35A 4Q63A 2W7UA 1LKAA 1YPJH 4FUFA 2BLWA 1WQVH 2RA0A 5LH8A 5L2YH 4ZHAA 4FVDA 2C8XB 5EXNA 5ETXA 3LPRA 5KEDA 1W0JD 5C94A 1P0SH 5GPIB 1P9UA 1MBMA 1C1MA 3E6PH 4NFFA 4D76A 1S6FA 1TQ7B 4M7GA 2YMSD 2NU3E 4OS1A 4X2WA 3LGYA 1DANH 1AE8H 1VR1H 4NGAH 1SPJA 1C5PA 2KFWA 4KP0A 1VJAU 3SJIA 1S6LA 4CH8B 1C5MD 1BTWA 2HOBA 1B7XB 5F8XA 3BTME 2ZPSA 2LPRA 4B6EA 4Y11E 5AVDA 4GHTA 3RC4A 1GBDA 1K1LA 3OTPA 2UUYA 1KXAA 2EQNA 3WWBA 4UEHH 2SGDE 1W13U 2KCYA 2P8OB 1WAYB 1TRMA 1QL9A 2FOEA 3QX5H 3A8AA 1SOZA 3TH3H 1DM4B 2PP6A 4AB9A 1HXFH 2OC7A 2VB0A 2J98A 4OS5A 3QLPH 1D3TB 4X6MA 3SUGA 1YPGH 1GJBB 3M3TA 3VEQB 4DURA 2BD3A 3QUMP 4MQAA 3F2GA 2SNWA 1JIRA 1SGCA 5FXLA 3BF6H 1CO7E 1TRYA 1YYY1 1OP8A 3TJNA 4X8UH 4O3UA 4U32A 1MUEB 1J8AA 2ZFPH 5DG6A 1MU8B 1EP6A 2H2ZA 5T1VA 5CE1A 5C20A 1CHGA 5T6DA 3VGCB 4ZXYH 3BTTE 2VWLA 2WPMS 1YLCA 2GMTB 3UQVA 3P17H 1Y8TA 3TK6A 5EJ1A 5HGGA 2J98B 2ZQ1A 1IQGA 1EPTB 4NG9H 1V2ST 1O2ZA 5EQSA 1TGBA 1HAOH 1ZHMA 1P2JA 2FM2A 1SQAA 1JOUB 1O3CA 2F83A 3UNRA 1GDNA 2G81E 2ALPA 2ODPA 1UHBA 3SGQE 5TCCA 2AIQA 3OU0A 1O5EH 1GWAA 5C1YA 4CREA 1EB1H 4Y79A 1CT4E 3SJKA 3W1EA 1LPGB 2D8WA 1UK4A 1BRCE 1NROH 1YCPM 1MTNC 1NRPH 4BAKB 5F6MA 2UUFB 2SFAA 9LPRA 2FESH 2ZFRH 2PKSC 2CV3A 2Z94A 4TPIZ 1C1NA 3KCGH 1ZJKA 4Y8YA 5JBAS 2ODQA 3PLBA 2RFKC 1YKTA 1G2LA 2STAE 1ZPCA 4JMYA 2A5AA 1C1TA 4ZROA 1K1IA 3ENSB 1V3XA 1XUFA 4AYYB 1ZMJA 3BTKE 3A7TA 2GT7A 1SGPE 2BQ7B 2ZDVH 1Z8IB 1MU6B 1EFRD 2R0KA 1SGFA 2SGFE 3LKWA 1RXPA 2FEQH 2BDAA 4DVAU 2KM0A 1UK2A 3K9XB 4I8KA 4ZKSU 4AN7A 7LPRA 3E8LA 3SOSA 3F9EA 4CR5A 2ZFTA 1PFXC 1ELDE 2IOTA 3FAOA 3HGNA 3ZZBA 5JB8S 1F0UA 1TGNA 3PM3A 1GCTB 4E7NA 3LDXH 1IOEA 2GZ7A 2Z9GA 1AZ8A 1ELTA 2TGAA 2XNDD 4NSVA 3SU1A 1HGTH 1Y59T 1O38A 2Z3EA 2HWLB 3ZZ4A 2VIWA 1HJAC 2BD8A 3SU3A 2XW9A 1QQ4A 2PGBB 1CHOF 5C2ZA 1FY5A 2F3CE 5DO4H 1NT1A 1K21H 1HIAA 5C1UA 1O5CB 1S5SA 2XCNA 3UNSA 1MBQA 3QWCH 1UJ1A 3CENA 1ARBA 3RU4E 2BHGA 3MO6A 1NFWA 1XUKA 2AYWA 3URCA 4ABAA 4NWKA 2FTMA 3HPTB 1LVMA 2C3SA 3ATLA 1HUTH 1P9SA 1ACBE 3RU4D 1EKBB 1HV7A 1MD7A 1MD8A 2TGPZ 1GCTC 1QB6A 3KF2A 2IPHA 4NIXA 1LPKB 2BD4A 4DT7B 4ZXXH 2ZHDA 4BTUB 1GVZA 1OSSA 1LQEA 1C2KA 2ULLA 3MNBA 2P3UB 2PTNA 1QL7A 4NCYA 1ESTA 1J9CH 4VGCB 4I86A 2HVXA 5FHTA 3SGBE 3SJ9A 1ABJH 1HNEE 1YPKH 4Y8XA 1TONA 4MPWA 4CR9A 2BQWB 1C1OA 2QXHA 2HGTH 3A7ZA 5EG4A 2R9PA 1QRXA 1W2KH 1CSOE 2BLOA 1XKAC 1S6HA 2V3HH 5EPNA 1V2UT 1DWBH 2FPZA 5SGAE 1ELEE 2P8OC 4IW4E 2R0LA 3PMBB 1GI8B 1TX7A 2I6QA 2PV9B 1B0FA 2P59A 4MDSA 2P3FH 4MNYA 2C8YB 3TITA 2ZQ2A 2GVFA 3A82A 3PMJA 3PO1B 3EA9A 3QGJA 3MO3A 4ASUD 1AMHA 4ASHA 1C5WB 1ESAA 4B73A 4I8JA 1E0FD 2A45B 3BSQA 2ZFQH 3T2NA 2AGIX 1TRNA 5TCAA 3UQOA 3E3TA 1O3HA 1UHBB 2XBVA 2QY0B 2R3YA 1SGYE 1VCWA 1MKWK 4KTUA 2PTCE 1IHTH 2P95A 3FP8E 4AFQA 3RXDA 2AIPA 3WWFA 5F03A 1UMAH 2BY5X 5JBCS 3N7OA 1FZZA 1K1JA 1S85A 2QXGA 3HKIB 2C8ZB 3ZZ9A 1F0RA 1AHTH 1W14U 4OS7A 3ZVAA 3RXKA 1TWXB 1EATA 2TPIZ 2VH0A 1TAWA 2BYAX 5F53A 1FPCH 2H5CA 3SBKA 3B23B 3RXIA 3GY4A 4IMZA 4ABDA 4DIHH 4FOUC 8GCHG 4ISLA 2OUAA 1RRKA 1KY9A 2PGQB 1KXFA 5ABWA 2D2DA 3BEUA 1TOCB 2ZCLP 1QBVH 1O2MA 2ZTXA 1TBQH 2F9PA 3K6ZA 1L4ZA 1BJUA 5B6LA 3FOAA 1INCA 1A3EH 3TH4H 1YLDA 1UTOA 3DHKH 3E0NB 4U01A 1F0TA 5G4BA 5A8YA 1KTTB 1V2RT 3ODDA 3SNCA 1O2RA 3UOPA 1P2KA 2ZC9H 5E2OA 2A2XH 4IMQA 4CHAB 3SUEA 2BY9X 1ZSKA 3KYFA 2WPLS 3EGKH 2YNBA 4Y7BA 2A4QA 1W10U 2KCPA 3D23A 2BXUH 2VGCC 5BPEA 2A4GA 2ZG0H 2FDAA 1EAUA 2W5EA 3RLWH 1MMJN 1SHHB 1G36A 1K22H 2QXIA 5GNDA 2ZHEH 3TIUA 4YOIA 3F2HA 3TPIZ 1TPSA 1NFUA 1V2JT 1HAVA 2VINA 2C90B 3M35A 2KAIB 4WH6A 1WUNH 4ESTE 3RXJA 1GHYH 1TMBH 2B8OH 4DGJA 1JRSA 1QJ7B 3BTEE 3DFLA 1GBLA 5F8ZA 1GCDA 3MH7A 5L30H 2AEIH 2W3IA 1O2JA 1V2OT 4FU7A 4Y76A 3Q3XA 3PMAB 1C2LA 1OYTH 1RIWB 1O2TA 3OFND 3SJ8A 1YP9A 1ELCA 2LP6A 1HJ8A 2WSSD 2ANYA 1XMNB 2VBCA 1BT7A 3BTFE 1FX0B 2VIVA 1H9HE 1QA0A 1TB6H 4FU9A 3M3VA 1UVPA 1HJAB 3SV8A 3A81A 1FIZA 4GPGA 1C4U2 2ESTE 3SI4H 5DPAA 3MI4A 1GI4A 4FU8A 1BTHH 2G4UA 2BLVA 2UWLA 2BX3A 2ZFFH 2TBSA 1Z7KA 2W6ID 4MPXA 1C1PA 2OQ5A 2RCEA 1O3PB 3AASA 3B9FH
chains in the Genus database with same CATH topology
1A46H 2Y5HA 5JBBS 1P01A 3P8FA 3KGPA 3TNTA 2J34A 4A1VA 2BVSH 4UE7H 1FY8E 4MPVA 2GCTC 4X8VH 4O9VA 2FO9A 1G3BA 5HXFA 1SVPA 1PPFE 1F5LA 1LHGH 1A4WH 3PYHA 4J2YB 1F92A 1BIOA 1BTZA 4FUIA 5A8ZA 3ZZ5A 1WYKA 1GBMA 1KLJH 1TNHA 4NA8A 1SC8U 1P03A 1XXFA 2G52A 1AE5A 2Y7ZA 4HGCA 4U2WA 4UFFH 8KME2 3VFEA 4WVPE 3SNDA 1AB9B 3BV9B 4Q80A 2J4IA 3A7VA 2BY7X 3V3MA 1WV7H 4OS6A 1LVYA 2VWOA 1F0SA 3RXAA 2A4RA 2BD7A 1CA0C 1TBZH 4KTCA 1RTFB 1C5RA 4DG4A 1D9IA 3H5CB 3ZYDA 2H6MA 7GCHG 1HB0B 2F9BH 3I77A 3RXGA 1A0HB 4NWLA 3ZVGA 2XWAA 1MCVA 1Z1IA 3MTYA 1AGJA 1CHOG 1AO5A 1C5LH 1ZRBA 2OD3B 1DY8A 2B7DH 4PROA 2D1JA 2ZTZA 2ZDKA 1N6YA 3A84A 1GVLA 1XM1A 1O39A 5L6NH 1C5YB 1GI9B 1GJ7B 4BXSA 1BMLA 3SU4A 2OTVA 3OY6U 3P95A 1H1BA 2ZECA 1AFEH 1O3OA 4JZIA 1GHXH 2ZHWH 2WV5A 5B6OA 2ODYB 3SQEE 3LGVA 1LVBA 1GL0E 1GI3A 1BRUP 5EXMA 2FYQA 1BTXA 2AGGX 1V2PT 1TGSZ 1SQTA 2BDYA 4O3TA 1ZPBA 2AMPA 1D3PB 1GBTA 4K1TA 2SNVA 1EASA 1D3QB 3MYWA 2H9TH 2VVVA 3UOUA 1BOQA 1CA0B 1ELGA 1H8DH 1NS3A 1P2QA 1C2FA 1TIOA 2FOGA 3PLPA 1N1LA 1A61H 1QBNA 4WY3A 4XE4A 2VIPA 4K1SA 1UCYH 1O2IA 1H8IH 2OP9A 3A88A 1NU7B 5T6GA 2GTBA 1U6QA 4H4FA 3SV2H 1Z8JB 1P2IA 2O8LA 4OGYA 4B2BA 1ZTLA 1GG6C 1RTLA 2A5KA 2EI8A 4JYVH 3MH4A 1A5HA 3U1JB 1HDTH 3MFJA 2FYRA 1Z6EA 4FUBA 2GP9B 1BTPA 3V7TA 4BTTB 5LPRA 2K1QA 1C5OH 3ZZ7A 1QL8A 2VNTA 5HYOA 2BOKA 3BIUH 3EYDA 3UY9A 3U8RH 3ITIA 1CT2E 2VGCB 3AAVA 1AVWA 1WQSA 2GGVB 3K2UA 3MU5A 3ZZ3A 4LZ4B 3PTNA 2PUQH 1GBHA 2XRCA 3LGWA 1LTOA 1KXEA 2VWMA 2BOHB 1KXBA 2SGQE 4AFZA 2R2WU 1P57B 1PQ5A 5A09A 2ANWA 4K8BA 1YM0A 3A7YA 5GDSH 3BTWE 3LT3A 4JZEH 2GCHG 3LJJA 1ZSLA 3O8CA 1TFXA 3Q00A 1JBUH 4XBCA 1O3AA 3SU5A 3UWIA 4FUEA 5FCKA 1C2JA 1UCYK 4TWWA 3BIVH 1W3CA 2BZAA 1O2QA 3ZV8A 5A8XA 1GBKA 1NN6A 2JH6D 2BD2A 1Y3VA 2VIDA 1S81A 3LIWA 2C93B 5C3NA 2V0BA 4LOYH 1LHEH 3SQHE 1SQOA 3RMLH 1DWDH 3HK3B 1NC6A 4DCDA 1O3MA 1SGRE 1FN8A 1UTJA 1DUAA 3S9AA 3TVJB 2OC8A 2A7JA 1HFDA 3P70B 1SB1H 3MU1A 1XX9A 2PHBA 4XFQA 1YPHE 2PKAA 1C4Y2 1O2PA 2ZU1A 3RUOA 2Z9KA 3ZVFA 2BM2A 1AI8H 5FCRA 1AU8A 1VCQA 1GJ4H 2J38A 4XSKU 1RGQA 1OOKB 3P6ZB 3BG4C 3LJOA 1O2SA 2XBWA 1EJAA 2ZNKH 3U1IB 4GHQA 5DP8A 1AY6H 2V6NA 2SGEE 1CA8B 4DJZB 4YLUA 1G37A 1BMMH 3SNAA 1AQ7A 1W7GH 1D3DB 1TNLA 5EU8A 4I8LA 3RXRA 5DP3A 2DE8A 2W26A 5J4SA 2BDBA 5EQQA 3VB5A 4VGCC 1HAGE 4MNWA 1VJ9U 5E8EH 3UR6A 3UIRA 2BDHA 3SI3H 1EZQA 2O8MA 2ZDLA 3GY5A 4I8GA 3LOXA 2ZI2H 2NWNA 4Q7XA 1O3NA 3LC3A 4I33A 3S0NA 1GPZA 1IQNA 1GBBA 1L2EA 1RD3B 3BTHE 5DP4A 1ZOMA 3RC6A 1EZUC 3KQEA 4WMFA 4B2CA 1FY4A 5K7RA 1T32A 1G3DA 2UWOA 3SJOA 1BMNH 1GHAG 2WV4A 1YPLH 4D9QA 1TE0A 1ZRKA 3IG6B 1GJ8B 1SGTA 1ZGVA 1G3EA 4ISOA 2PKAB 3STJA 9ESTA 1A5GH 1C5VA 3TK5A 4X1NU 5TJXA 4ABBA 1UTQA 1BHXB 2C8WB 1O3GA 1WCZA 2FOHA 2XC0A 1F2SE 1BHXF 1Y3YA 3P8GA 4CBOA 2FZZA 5FPTA 2Z6BD 1O2HA 3VB3A 4R8TB 4Y10E 5FPYA 1FN6A 2QF0A 2Q1JA 2H5DA 3NWUA 1C2MA 3SV9A 1HIAB 3O8DA 1V2QT 4AZ2B 1Y5BT 2HNTE 3MMGA 4JZDH 2ZU4A 3F1SB 1ZSJA 1AWFH 1O3DA 3UTUH 1GHWH 3M7UA 3M36A 4AOQA 1UK3A 2ANMH 4AFUA 8GCHF 5EW1H 1EZXC 1BCUH 1SMFE 3GCTG 3F9HA 1DLEA 2OCVB 1ARCA 5DP5A 2F9UA 5DP6A 3B8JA 4NZLA 1C1RA 1DWEH 1KIGH 2EI7A 2C4FH 4YO9A 8LPRA 1YPEH 1O3JA 2PFEA 1O37A 2FI5E 3T25A 1ANCA 1G9IE 1AUJA 1MTWA 1GL1A 4H42U 2BXTH 1GDUA 1BJVA 1KXDA 3ZVEA 1XUJA 2UWPA 4YESB 3O8BA 1OX1A 2CGAA 1Y3WA 5FBIA 1KXCA 1HCGA 1J17T 1ZYOA 1HAZB 4GCHG 1TGCA 1VITG 3EQ0H 3U9AH 2OC0A 1UVUH 3TNSA 2UUKB 4X8SH 4UFDH 4LK4A 4XBDA 4A92A 3ZZ8A 3H7OA 3BTQE 5GXPA 2ZKSA 2Y5GA 1IHSH 3T28A 2AFQB 4J1YA 3AW0A 1QNJA 1O5AB 2XNIA 1NFYA 1HLTH 1HAHH 4K5ZA 1T4UH 4Y0YE 3V0XA 1AVGH 3MO9A 2FI3E 4IS5A 2VU8E 1QBOA 3OTJE 2HPPH 4CRAA 1RTKA 5GIBA 5EGMA 1EPTA 4SGAE 4NA7A 3BG8A 1C4V2 3VB4A 3R0FA 3TJUA 1O2XA 3PLKA 4RN6A 1GGDC 3T27A 3U8OH 4FVBA 2Y81A 2FP7B 2VJ1A 1EAWA 1T8OA 3AVZA 2JH5D 1TYNA 3BTGE 2QIQA 3M61U 2M5TA 1VCPA 2G8TA 3KHVA 1O0DH 1JIMA 4WF8A 3PB1E 2GV6A 2J9NA 5IDKA 1D6RA 3OSYA 2VIOA 3SNBA 3FP6E 2QGRA 3BG4B 1L0ZA 3UNQA 4Z6AH 4UFGH 1GI2A 1TBRH 2IJOB 2ZP0H 2NU4E 5JYIA 4YOJA 2BMGB 1QJ6B 1GMDG 5FX5A 4BANB 1MZAA 1EAXA 4CRGA 2PW8H 2WINI 4AX9H 3NPSA 1C1SA 2ZDNA 1SGFG 1A0LA 1YCPH 1ZTKA 2A0QB 2VVUA 1Y3UA 1JXPA 1EX3A 1OWKA 1SLXB 1MTNB 1LVOA 2PLXA 3RXEA 1XVMA 1TPOA 1V2VT 3VB7A 1O2GH 3AAUA 1P11E 2XXLA 2A31A 4Y7AA 2FLBH 4AB8A 3RC5A 1C9TA 1VZQH 4OS4A 1SSXA 2BLQA 4GLYA 2CF8H 2QXJA 2OINA 4JK6A 3UWJH 1TNIA 2A7HA 3NKKA 1OXGA 1C5SA 4YTAA 1O2VA 5E0HA 1RS0A 1GBAA 1UTKA 3VXEH 1PPGE 2WPKS 1C1VH 3M3SA 4X1RU 1HXEH 2JH0D 3PWCA 3QDZB 3KL6A 3M37A 1O34A 1MCTA 3RMNH 1GHBG 3SUDA 5JBTA 4TYDA 3RXUA 1YPHC 1GJDB 3Q3YA 1MZDA 5DP7A 7KMEH 1C1UH 1P10A 2ZGCA 3GICB 1NTPA 1RFNA 2BZ6H 4ISNA 1TX8A 3MNSA 4BOHA 2SGPE 4YOGA 2YOLA 1K1OA 1IQMA 4D9RA 1OP2A 1EOJA 2ZTYA 1TGTA 2CF9H 1D4PB 2G55A 2FLRH 4Q7YA 1BITA 2JKHA 5CHAC 4WMEA 4X0WU 1CBWB 1OWEA 2AMDA 2F9NA 1VGCB 1BDAA 4H6SB 4BNRA 1DXPA 2BDCA 1P2NA 3RU4T 1TMTH 3A86A 4ABHA 1P09A 3L6PA 5J4QA 4FUCA 3LGTA 3RXCA 1THPB 4K3JA 2P93A 4OGXA 3NXPA 2ZHQH 1K1MA 3ELAH 1O2YA 3K6YA 1SI5H 5H4IB 4ISHH 4TY7A 1T7CA 1Y5UT 4ZHMU 3FANA 1GBFA 1CQQA 1O3FA 1FXYA 1TMUH 2NU0E 3TH2H 2FIRH 2ZPRA 3BTDE 3EA8A 4MPUA 1ANBA 3SV6A 1VGCC 1O5FH 1GHAF 3K65B 1GI1A 2ZA5A 4K1EA 2BDGA 1O2KA 4WMDA 1DUEA 2R2MB 3IITA 2ZGJA 3A80A 1FQ3A 1QGFA 1E36B 4ZMAH 3GCNA 3SORA 2B9LA 4XDEA 3ZVCA 1L1NA 5FAHA 4K69A 5JPMH 4Y6DA 4ABGA 1SLVB 2GT8A 3OX7U 1NPMA 1PPBH 2Y7XA 1P04A 4INHA 1P2OA 2HRVA 1BBRH 2HNTC 1AD8H 5HM2A 1E35B 5AFZH 1C5TA 4D7FA 4BAQB 3ZVDA 2GX4A 2FS8A 3ZVBA 5EPYA 2TGDA 2XYAA 1EB2A 1QY6A 1C5ZB 3S9CA 3MWIU 1FAKH 4I31A 2EI6A 4X2YA 1AZZA 3TU7H 1BRAA 1ZLRA 1IQFA 4CRBA 1WOFA 1P02A 1HAPH 4MLFB 5DK1A 3ZZ6A 1YBWA 4Q7ZA 4X2VA 2ZO3H 4AG2A 1MKXK 2SGAA 1GMCF 1ETRH 1HPGA 1HJ9A 3A85A 1H4WA 4X6PA 2P16A 4A6LA 1UTMA 1KDQA 3F9FA 5ESTE 4FUHA 2D26C 1TNJA 2FODA 2Z7FE 3NZIA 3RLYH 3DD2H 3FFGA 3FZDA 3KNXA 1WSSH 3FVFB 1WTHD 5T6FA 3QO6A 1LKBA 2Q6DA 3R3GB 2PSXA 1V2WT 4BAOB 1PQ8A 3SGAE 1OWJA 3KQDA 2PUXB 1V2NT 2OXSA 2PKSB 1KLTA 2FOMB 1P05A 3W94A 1YF4A 2ZPQA 2GZ9A 1RIWC 5DGJA 2CN0H 1GJCB 3MH5A 1ZMNA 1TX6A 1L4DA 4I7YH 3E0PB 2A7CA 1DITH 2P3TB 1K9OE 1DX5M 2AS9A 2FMJA 2BY6X 4CRFA 1ID5H 3ATIA 2WUBA 3FZZA 5FBEA 2WPIS 2G4TA 1UVSH 3C27B 4Z0KA 1FJSA 1F5RA 1O3EA 1QJ1B 1IQEA 1WTGH 1W0ZU 4X6NA 3A8BA 1DWCH 2JETC 3RXHA 1TA2A 2LNCA 1MQ6A 2Z3CA 4E05H 1FNIA 2ZFSA 1AN1E 1SGEE 3D62A 3F68H 1AKSB 2ZDMA 1PYTC 4X6OA 4KGAA 4FUDA 3E16B 1IQKA 3U98H 3CS0A 4YT7H 1ZMLA 1UVOA 1UVTH 3RXMA 5JB9S 1ETTH 1F7ZA 2CHAB 5FPSA 2QF3A 1TALA 3IWMA 2ZEBA 4LZ1H 1BRBE 4KELA 2OBOA 1GBJA 2OC1A 2Y6TA 2HLCA 1FDPA 4FXGH 4E06H 4ZUHA 4A5TS 4TY6A 1ZPZA 1TNGA 3HKJB 4HZHA 3LC5A 4FUGA 1O2UA 4NSYA 3HGPA 1DSTA 3S7KB 6LPRA 3ZZCA 2G00A 4DW2U 3G01A 2PWXA 2R3UA 1C2DA 4GSOA 1S82A 1AFQC 1DT2A 1UTNA 1RJXB 1QRZA 1ZHPA 3GY8A 1EXFA 3S7HB 3QZRA 3QTVH 2BQ6B 1UCYE 1G3CA 2A4OA 1BBRK 1ZHRA 3GYMA 2ILNA 2G51A 4K8YA 1NRQH 1PQ7A 2J95A 1HAIH 1GHZA 3A7XA 4Q2KA 4K60A 3Q77A 3JZ2B 2ANKH 3MU8A 3HATH 5EQRA 4E7RG 7GCHF 4ABEA 2RDLA 2CHAC 5IYTA 6ESTA 2BDIA 3GY3A 4KKDA 1MQ5A 3GOVB 5A0BA 4I32A 1DPOA 2ASUB 3P8OA 2XC5A 4IC6A 4JZ1A 3STIA 1LCYA 3RXPA 1QFKH 1KSNA 1SOTA 5E0JA 2CJIA 2UUJB 1NO9H 2RG3A 1P12E 2BD9A 1V6DA 4B74A 4CBNA 3SU6A 1SL3A 5EXLA 3MH6A 5I46H 1ORFA 2FX4A 4ZKRU 3Q76A 4HTCH 3GYLB 4UONA 3NK8A 3MNCA 3MU4A 3T62A 4JZFH 1UO6A 1G2MA 3SW2B 1QR3E 1V2TT 2V3OH 1SR5C 1LHFH 2O8WA 3SU0A 3GCTF 3KIDU 1DS2E 2YNAA 3HK6B 4JK5A 3A7WA 3KEEA 2FTLE 2AMQA 4KTSA 1DFPA 4TWYA 1P2MA 1VITH 3T26A 3E90B 1FONA 2W3KA 1GI7B 1LDTT 5DJ7A 3PV4A 3WY8A 1TOMH 1O2LA 1LMWB 6GCHG 6GCHF 2IN2A 3SHAH 1DDJA 4JCNA 1GHBF 4HI3A 3A83A 3SNEA 1ZZZA 3D65E 2BB4A 2NU1E 4CHAC 1KLIH 2H1UA 3SU2A 3RXVA 1YGCH 1A3BH 4CRCA 1XKBC 1L1GA 3ZV9A 3PWBA 4A1XA 2Q6FA 4BTIB 1BMAA 3LONA 2F9OA 3GY7A 3I78A 4GVUA 5E2PA 4ABFA 1SFIA 3GY2A 5C1XA 1O2WA 3PMHB 1AIXH 4H6TA 5FX6A 4CH2B 1JRTA 3L33A 1AFQB 1ETSH 1QTFA 1O3LA 3F9GA 1CT0E 1O33A 1C1QA 3BEFB 3TLOA 5GCHF 3MHWU 1NRSH 2O9QA 1ZR0A 4BAMB 3EAJA 2WYJA 3T5FH 4IN2A 1K28D 1MAYA 3LGUA 3URDA 4HFPB 2JETB 2Y82A 2ZF0H 2ZHFH 3GCHC 4B76A 5LGOA 4MG3A 3QTO