3PLPA

Bovine trypsin variant x(tripleile227) in complex with small molecule inhibitor
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGIYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3plpA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3plpA02
1L2EA 1DWBH 4OS2A 2D2DA 2DE9A 3UR9A 5EU8A 3T25A 3P8FA 2JH0D 1EASA 1P2MA 1MU8B 1HJAB 2ANMH 2F9UA 3EAJA 1UHBB 2PHBA 2P93A 1A0JA 3BTQE 4AB8A 8KME2 3TGKE 2I6QA 3PLBA 4KTUA 1O36A 1WV7H 1E34B 1IOEA 1GJ8B 3GYLB 1JRSA 1ZJKA 4CH8B 1FIWA 5ABWA 4NIVA 1GI2A 2GTBA 3ZV9A 1T7CA 4MNYA 1JXPA 1Z6EA 1O5FH 1SI5H 1WOFA 2GCTC 3QK1A 1CGIE 3OTJE 4WH6A 1QY6A 3UNQA 1GHAG 1O2ZA 3BV9B 5AF9H 1ZRKA 3SNCA 1B7XB 3ZYEA 1LPZB 2AMPA 3MH6A 1HNEE 1CA0C 1BITA 5DP8A 2IOTA 4TY7A 3IITA 1QBOA 3E90B 1TQ0B 2VH0A 2ZHFH 2C3SA 3MI4A 1MTSA 2RDLA 1K1JA 4AFZA 4Q80A 2Z3DA 2OC0A 5G4BA 1HBTH 2A7JA 1XUGA 1P2KA 4MQAA 1C2IA 1QRXA 1ANCA 1E35B 1UTQA 4CH2B 1AO5A 3D23A 1HAVA 1ZZZA 4JYVH 3PMAB 1GJ6A 1QBNA 1THRH 4FVBA 4KTSA 2GKVE 2ZEBA 1XM1A 1C4U2 2JETB 3TK9A 3OYPA 1AVWA 1EPTB 4GAWA 2THFB 3SJOA 8LPRA 1NN6A 1P02A 1ZR0A 2A4RA 1XUFA 5EQRA 2Z9GA 2HNTC 1W0YH 2WYJA 4Y71A 4SGBE 1S6HA 1DDJA 1Z71A 3A80A 2VVUA 1V2PT 1O2VA 3UFAA 4Y7BA 3RMLH 3P6ZB 1C5UA 3PMHB 4ZKOU 1AB9B 5DG6A 1P2IA 2BD7A 4B2CA 4JZFH 1V3XA 4WWYA 1A61H 1NRSH 2B5TB 2P8OB 3V13A 3A82A 4ZHLU 1GHAF 1A5HA 4XBDA 5DKMA 1OWJA 1FAKH 3ENSB 2Z9JA 1C5WB 3RXFA 1TPSA 3KQDA 1FONA 4DJZB 1ACBE 3QTOH 3LH3A 1G3BA 1U6QA 3VPKA 3VB3A 2AYWA 1YKTA 4GSOA 1GVZA 3RC5A 1BA8B 1MQ6A 4H6SB 1Z8RA 2R2MB 1FY5A 2C8WB 4ISNA 1GHXH 2BVXH 1KXFA 1OS8A 1BMAA 4INLA 2J92A 1F5RA 1NFYA 4Y8YA 2XNIA 1XUJA 3F1SB 1RS0A 1SVPA 4CHAB 5EPYA 4YO9A 1V2WT 1G37A 1AD8H 1VGCC 1FLEE 3JZ1B 4FUCA 1D4PB 5EPNA 1ESAA 2GZ8A 1BUIA 1TNIA 3BTFE 5EG4A 2SGFE 1Y5UT 5ESBA 3LKWA 1LPGB 3JZ2B 4DW2U 4WMFA 1O5AB 2GMTC 2PR3A 1H8IH 1DXWA 3OY6U 2UWOA 2FPZA 4ESTE 2QAAA 1W7XH 1P04A 1RIWB 2OC7A 4HTCH 1DVAH 2BDCA 1YYY1 4FUFA 2P3TB 3SUGA 2BM2A 4Y8XA 4K1EA 6CHAB 2WPJS 3MU1A 1K9OE 1QJ7B 3ZZBA 1P2JA 2G52A 3PO1C 3QLPH 1JIRA 1RTKA 1O2SA 3TIUA 1EJAA 1TABE 2EEKA 2B9LA 1HJ9A 3DUXH 4JYUH 3P92A 1BTHH 4ZXYH 2STAE 2PKSC 4Z0KA 1GJ5H 3SU1A 3LGWA 4HGCA 1GHBG 1OPHB 1CBWC 1GBFA 1MTWA 4KP0A 5AHGH 4YT7H 5GDSH 2VWOA 2BD4A 1QJ1B 2G4UA 3S9BA 1CO7E 2O8WA 4NFFA 2V35A 1TMBH 1ZSJA 3U1IB 2R3UA 4NZLA 3SQEE 2ZU3A 3BN9A 5LH8A 2FOHA 4X2YA 3L6PA 1AIXH 1ESTA 3MU5A 1EZUC 4DGJA 4MPXA 3O8DA 1MU6B 2OQUA 3HGNA 1C2GA 1MAYA 3LGTA 1ETTH 2BTCE 4ABGA 1GVKB 3LGUA 2Q1JA 1LQEA 1INCA 1O31A 1VITF 4TYDA 4RKJB 4I31A 2FOGA 3E0NB 1P8VC 3F9GA 1GJDB 1AUJA 1ZGIA 2YNBA 4IMQA 4THNH 3T62A 3AAVA 1TWXB 4BTTB 1ANDA 5GIBA 2H1UA 4Y11E 2CHAB 4ABIA 3QN7A 3ZYDA 1EOJA 1ZPCA 2ZFRH 2BDBA 1SGQE 3RXJA 3SJKA 1OX1A 2Z9IA 4NIWA 2WINI 3H7OA 1FJSA 3V3MA 1ZMLA 4J2YB 1HLTH 2PKAA 4U2WA 4GLYA 2A5IA 2F9BH 4FVDA 1NY22 1KTSB 3SNBA 1GBIA 2G8TA 3I78A 4WF8A 1UTKA 1DE7H 2EI6A 4A1XA 2FOAA 1KY9A 1FDPA 1G3EA 3TITA 2G51A 5T6DA 1GHBF 4CRBA 1F92A 1MQ5A 1P05A 3EA7A 1NRPH 2D26C 2ALPA 1T8MA 3LGVA 4LOYH 1UVPA 1YLDA 1D3DB 1Y3WA 3PTBA 2WPMS 2GCTB 1A2CH 1TMUH 2OC8A 5FPSA 4CRDA 2VU8E 3UR6A 1E0FD 3EA8A 1ZTKA 2AH4X 4K60A 1NRRH 1Y3YA 5C3NA 1CHGA 4F4OC 4IC5A 3FVFB 7ESTE 5FCKA 1CA0B 1F0SA 4H42U 4E7RG 2V6NA 3DT0H 5EXMA 2PGBB 2BD3A 1ZHRA 4CREA 2D1JA 3RC6A 3SU5A 1NC6A 3DA9B 1W12U 1EOLA 3SORA 1Y3VA 1GI4A 1J17T 5A0CA 1BRCE 1C5MD 3RM0H 5EXLA 3P8GA 1PYTC 2ZWLH 3BEIB 3DD2H 2ZDLA 4Y0YE 1LVOA 2ANKH 4O97A 1O2LA 2BDGA 2GD4B 1DICA 1XKAC 3K65B 1UTOA 1K1LA 1P3CA 2AGEX 4K5ZA 4O3TA 4UDWH 3A88A 1FY8E 3RXEA 1DWDH 1AZ8A 1UJ1A 1S83A 2WV4A 5DP3A 1O2RA 1QURH 3PTNA 2QGRA 1VITH 1GHYH 1Q3XA 1V2ST 1CE5A 1BZXE 2G55A 4XFQA 1SGFA 3HK3B 1A1RA 4UFGH 3SV2H 4E05H 1W14U 2Y7ZA 3T2NA 3M3TA 1V2KT 3MO9A 1TONA 2FM2A 1J9CH 2B8OH 3UOUA 1O2YA 1TA6A 1JRTA 2UUJB 2YOLA 1UK2A 4WXVA 3MH4A 2Y5HA 3PV4A 4INKA 4LZ4B 3NCLA 1P0SH 5E8EH 1LHEH 2ZHQH 4J1YA 3ATWA 4FU9A 4IMZA 1IQKA 2ZC9H 1SLVB 1A3EH 1PPBH 2J95A 1BRBE 3UOPA 4ABHA 1ZSKA 1DSUA 2OLGA 4JZ1A 3TNSA 4AN7A 3RXQA 1WBGB 3PWBA 1L0ZA 2SNVA 3E6PH 4ZHAA 1V2LT 1LVMA 3P95A 5C1UA 1D9IA 2VIOA 1SLUB 4RSPA 1VJAU 1BTZA 3RM2H 1UVSH 1GJ4H 1GPZA 1AFEH 3SUDA 1YPKH 3SV7A 1KDQA 1GWAA 1HAVB 1SOZA 2BDAA 3E0PB 4YESB 1S84A 3RXTA 1H8DH 3V7TA 1TPAE 2GZ7A 2XTTB 1IQLA 3TK6A 2VIPA 1W0ZU 2XBYA 5EW1H 2Y7XA 1TNGA 2H9TH 3LOXA 2P3FH 1O2KA 1ZSLA 1M9UA 1SGTA 5C5OA 1GI9B 1K1MA 2VWMA 2KAIA 1QTFA 1G2LA 4X6NA 3RXLA 4AFUA 2BY8X 2FOEA 3BEUA 3ZVFA 1FY4A 1BRUP 3BTTE 1BJVA 2TGDA 1UTLM 1VCWA 1ESBA 1ELCA 1O3KA 3BTEE 4Y7AA 4CR5A 1C1NA 1ABIH 3C1KA 1BMLA 1NZQH 3ZZ7A 3PO1B 2BD5A 3ZZCA 1C5ZB 1E38B 2V3HH 1TX8A 3UPEA 2GV7A 1TGBA 2CF8H 1D6WA 3RMOH 3STIA 1O3NA 2PKSB 3RXGA 3RXHA 1RD3B 3RXBA 3HKJB 1CBWB 4ZROA 3EGKH 1P03A 5JBBS 4MDSA 1S82A 3P70B 5C1XA 3NUMA 1YBWA 1GI0A 1PQAA 1CT0E 1L4ZA 2A4GA 1ZMJA 1CA8B 2TGAA 2CN0H 2BVRH 2HLCA 1Y59T 1GBJA 2VGCC 4YM9A 1TMTH 2ZPRA 4X8TH 1O3AA 3B23B 4DY7B 1QBVH 2O8UA 1RRKA 1LKBA 4IC6A 1PYTD 4X0WU 3KF2A 5HMAA 1TLDA 2A7CA 3TH4H 2SGAA 2BLWA 2F3CE 3EDXB 3PLPA 3GY2A 1SC8U 1K1PA 2FLRH 2W7UA 1YPGH 3KL6A 1RTLA 3KN2A 3MWIU 1QA0A 1K1OA 5ETXA 1IQMA 5E2OA 1HAYB 4OGXA 1CVWH 5JBAS 1DWEH 1EAUA 3GOVB 1P01A 1XUIA 2A45B 3GICB 4D8NA 2Y81A 4D9QA 4TY6A 1TYNA 1QL9A 1A5IA 2FLBH 3OU0A 1B5GH 4ASHA 1GHZA 2BOHB 1OKXA 3GY6A 1P57B 2HNTF 2ODYB 1H9LB 3MNCA 3SU6A 1YPHC 2HPPH 5C67A 4ZXXH 1PPHE 1YC0A 4AYYB 1GBMA 4KGAA 2Z3CA 1TGTA 1LDTT 5HXFA 2M5TA 1ZGVA 1AGJA 2H6MA 2A0QB 1E37B 1ZLRA 1C5XB 2PTCE 4ZUHA 1AKSB 3SI3H 3SW2B 5DJ7A 1NPMA 2GGVB 4I33A 2J94A 4BAMB 4BOHA 2FP7B 2B0FA 1FY3A 2HVXA 4WXIA 3SU4A 2XWBI 1AZZA 1O2IA 3KQEA 4GUXA 9ESTA 4B2AA 4MNWA 2BD8A 3LIWA 3KCGH 4GHTA 4UE7H 3BTWE 2H5CA 2H9HA 1K2I1 1EQ9A 1JBUH 2CXVA 4A92A 1TPOA 4O03A 5ESTE 2C8ZB 1XVMA 3F9HA 1O3MA 1C1UH 4NFEA 3A8DA 4BAHB 1DANH 1A3BH 2WPHS 1QRWA 3LJJA 6ESTA 2VVVA 2ZZUH 3E91A 2FOCA 1ETRH 1KLJH 1MTNC 3OY5U 2HALA 3A85A 2A4QA 1O2NA 1GBDA 3L3TA 1BTUA 2NU2E 1HJ8A 3BTHE 4NA8A 1AQ7A 2A2XH 2TGTA 2PKAB 2QY0B 1Z8IB 1SSXA 3MNXA 1AWHB 1HYLA 1YM0A 2ZGJA 3DFLA 5GPIB 1CT2E 4AB9A 3K6YA 3TPIZ 4ZH8A 1IQJA 2FTLE 1O3DA 1EATA 1CT4E 2BD9A 1GL0E 4TWYA 1O3PB 1A0HB 1THSH 1FXYA 1GI1A 1GJCB 2BDHA 2XBWA 3D62A 2A5AA 3UQVA 1V2UT 2BHGA 3GDVA 1IHSH 5DP5A 1Z8GA 1HAPH 3RMNH 1QRZA 4A7IB 3E1XB 2BDYA 1C9TA 3ZVGA 2CF9H 4ZKNU 1GDQA 1TX7A 4O9VA 2GZ9A 1IQNA 2ZU5A 1AWFH 2IJOB 2FEQH 3RXDA 1C5NH 4BANB 2I6SA 2UUFB 1HIAA 2VIVA 5A2MH 1F2SE 2RG3A 1EZXC 2NU1E 2ZFSA 5E0HA 1MZAA 1XUHA 3MNBA 5A8XA 1IQFA 1IQHA 2FDAA 2XCFA 1N6XA 1GHWH 1RTFB 3A81A 3VGCC 3Q76A 2A4OA 3A8CA 1JOUB 1EJMA 1WU1A 2ZTZA 3SUEA 1SGNE 4MNXA 1K1IA 2XBVA 3QTVH 1XXDA 5I46H 1V2RT 4YOGA 2XC0A 4A1TA 1PPFE 5K0HA 4GHQA 4Y0ZE 3ESTA 3HKIB 4JK5A 2XXLA 4BAKB 1S85A 1TNKA 3EA9A 2OINA 4RN6A 1UK3A 2GV6A 2QC2A 1P12E 1O3JA 1OXGA 2A5KA 1QQUA 1ZHMA 1FN6A 3M3SA 3E16B 2ZNKH 4D9RA 2ZTYA 1O0DH 1VJ9U 4ABDA 1PJPA 1ANBA 1NTPA 1Y3UA 1K28D 4DT7B 2BXTH 1PPZA 2ZQ2A 3SZNA 3OX7U 1TBQH 5JYIA 1KIGH 1HGTH 2G5NA 1VITG 3ZZAA 4M7GA 1BTWA 1GBKA 1L4DA 1HAZB 1MMJN 4I32A 2G00A 3HK6B 1EAXA 2AIPA 4NGAH 2BX3A 1PPGE 3HPTB 3LDXH 1SGDE 2JKHA 3I77A 3W94A 2A31A 2R9PA 1AVGH 3ZVEA 2RA0A 1W7GH 3TH3H 3M36A 4NIYA 4DCDA 3ZVCA 1YF4A 1C1RA 3SHCH 4R8TB 3R3GB 1YP9A 2JH6D 4ABEA 2FX4A 4XE4A 1UK4A 5FXLA 5JB8S 3E3TA 1QNJA 1GL1A 2NU4E 3CP7A 3MOCA 4YTAA 3MFJA 5HM9A 1MD8A 1V2QT 1KDQB 3T29A 4UFFH 1OSSA 1FV9A 2FIRH 1EZSC 2K1QA 2VGCB 5JDUB 1AN1E 2BQ6B 3UWIA 5A0BA 2PTNA 1HUTH 5HYOA 3O8BA 1GBTA 3TJVA 2PSXA 3GY8A 1EX3A 3IWMA 4XOJA 4X8UH 2A2QH 5CHAC 2KAIB 3SGBE 1J14A 4TWWA 1F0UA 2FMJA 3LGIA 5EQSA 1AU8A 4YLQH 3A87A 3TGIE 3QUMP 4YT6H 2XWAA 2SNWA 4AG2A 1V2MT 3SBKA 4X1SU 2HRVA 1F0TA 3BEFB 1TALA 1MKXH 4IW4E 1SGFG 1O39A 1N6YA 1OWDA 1G32B 1KXCA 1C1TA 4NG9H 7KMEH 1TB6H 5IDKA 3M5LA 1C2MA 1UMAH 2FWWA 1ZOMA 4IS5A 4Y76A 2QV1A 2J4IA 3LC5A 1KLIH 1TGCA 5C5NA 4YOIA 1C2LA 4XBBA 4F49A 1ZPBA 2FYQA 1AE5A 4UEHH 1V6DA 1SHHB 4UFEH 4DG4A 1G9IE 5JBTA 1SPJA 3SO3A 1MUEB 2VVCA 1XKBC 1NFWA 4FUDA 4IN2A 2J38A 2HNTE 5E0JA 4X8VH 1QL8A 3K2UA 4AYVB 1BCUH 1ELVA 1LMWB 1N8OC 3GY4A 3QGJA 4GPGA 2IN2A 1QA7A 2UUYA 1T4UH 1BJUA 2O8MA 2ZG0H 1F7ZA 1YPMH 5F8ZA 2ASUB 1L1NA 3U69H 4NCYA 1C1WH 4YZUA 1UO6A 3BTKE 1TNLA 4BTIB 4RKOB 3E8LA 2OQ5A 4WMEA 4XBCA 1HXFH 4XDEA 2R0KA 2QXHA 1G3CA 3LH1A 1C1OA 3ZZ9A 1L1JA 1C2HA 1EB1H 1XX9A 4NZQA 4SGAE 3GCNA 3SU2A 3ZVBA 1WQSA 1P2QA 1UCYH 3QX5H 2BY5X 1DITH 2BYAX 1C5TA 1LTOA 1BT7A 1MBMA 1YPEH 1GJ9B 2SFAA 1Y5BT 1MTNB 4FUEA 1LHFH 1SGPE 3UWJH 3RMMH 5IYTA 3KQBA 1WTGH 1GCTC 2BY6X 1GI3A 4VGCC 4NSVA 1WSSH 3H5CB 1QIXB 5L2YH 3SV9A 4I8GA 3GY5A 2PGQB 3NPSA 1GI5A 3M5OA 5FX6A 2CJIA 1BMNH 1LVBA 4E7NA 1KXDA 1P11E 2ULLA 3B8JA 1GBHA 2XC4A 5EQQA 3QDZB 5T3HA 3KEEA 5AFYH 4K3JA 4B2BA 8ESTE 1W10U 3KNXA 1Q31A 2OBOA 2C90B 4I7YH 2EA3A 2ZP0H 3L33A 1F0RA 3RLYH 1HV7A 1ZJDA 1JIMA 3MH5A 3QZRA 5FPTA 1EP6A 2GDEH 2FTMA 2FO9A 2BY9X 2XRCA 1C5OH 7GCHG 1MZDA 4JK6A 1GMDG 4ZKRU 1OYTH 2ANYA 4WY3A 3LT3A 3VEQB 3ZZ4A 3LJOA 4NA9H 1AI8H 3TJUA 1NRQH 2VWNA 3VGCB 1C9PA 2NU3E 3MTYA 2Y5GA 3M7TA 1BB0B 2BVSH 3SOSA 1W3CA 4B71A 1ELTA 2ZO3H 1GJBB 3ZV8A 3RXIA 4OGYA 2ODQA 1IQGA 3SV6A 1FN8A 4JZDH 1DLEA 2ZA5A 2W7SA 2D8WA 3PWCA 1ZHPA 1ZYOA 5SGAE 2XBXA 1O3FA 1VCQA 2BX4A 5CE1A 2A32A 4ZHMU 4ABJA 1GMHG 1TGSZ 2ZU2A 4JZIA 5L6NH 1GBLA 3M7UA 4AGJA 4JZEH 4X1QU 3K9XB 3U8RH 2BLQA 1Q2WA 1NU7B 1UVUH 1C1PA 1VGCB 1Z6JH 2SGQE 5A8YA 2C8XB 2SGEE 4CRCA 4Y10E 1PQ5A 5LPFA 1O2QA 3TGJE 3IG6B 3LPRA 3TJOA 2Z9KA 1O32A 1BOQA 1GVLA 3MHWU 5E2PA 1WTHD 5LPRA 1CGJE 1H1BA 3NWUA 1F5KU 5JB9S 2FOFA 2GMTB 2ZFFH 1GBCA 1LQDB 1E36B 1GMCG 1QB9A 3MO3A 5F8TA 3A7TA 1HIAB 7GCHF 1EUFA 1GMDF 3M5MA 2ODPA 3U98H 2G4TA 2ZFTA 1C1VH 2BXUH 1C5QA 1A4WH 1O38A 1IQIA 3FP8E 2Q6FA 1OWHA 4GCHG 2WYGA 2F83A 4ISLA 1QJ6B 2GCHG 2IPHA 2BQ7B 1Y3XA 1EKBB 1GG6C 3SNEA 1YCPM 1V2JT 8GCHG 2AS9A 3PYHA 1O37A 1SGCA 4INHA 1G2MA 3VXFH 2P94A 3RUOA 4H6TA 3SNAA 1V2NT 4B76A 9LPRA 1TNJA 1ELAA 5K7RA 2GT7A 3RP2A 1LHGH 2H9EH 2STBE 1VR1H 2W5EA 2ZHDA 1KXBA 2BDIA 4X2WA 4ABFA 1C5SA 1ZMNA 1HCGA 3C27B 3Q77A 1SGYE 2FOMB 3LU9B 1GCDA 3EQ0H 1UCYE 1TE0A 2QXIA 3URCA 3UNRA 5CHAB 1GMHF 3GYMA 1P9SA 1O5GH 1C5LH 1TA2A 1NU9A 1TX6A 3RXOA 4Y8ZA 3PROA 4CRAA 2Z7FE 2BD2A 1FNIA 3SU3A 1BBRH 4YLUA 4AG1A 5FAHA 1ZPZA 1TRYA 1XUKA 5F6MA 1DOJA 4MPVA 1GGDC 1OWIA 4ISIH 2BMGB 2G5VA 2PSYA 4O3UA 4KELA 2XW9A 1FAXA 1C2DA 4ISOA 2VNTA 1C2EA 3TLOA 4MVNA 3SHAH 4AZ2B 4X8SH 1T8OA 5FPYA 1ZRBA 3RLWH 1Z1JA 3MNSA 1HAOH 3ZZDA 1GMCF 3NK8A 1SGRE 2J34A 3S9AA 1C1SA 1OP2A 5EOKA 3S69A 2UWPA 4MLFB 3SI4H 2WPKS 5PTPA 1EAIA 2C4FH 3UREA 3RU4T 4DVAU 3Q00A 2Y5FA 3LONA 4GCHF 4D7FA 2YNAA 5LGOA 3F6UH 1KXEA 4CBOA 4LXBH 2VH6A 1ID5H 3V12A 2GCHF 3A7YA 1TOMH 1O5BB 1KXAA 1PPEE 2QCYA 2BLOA 3ATLA 3U8TH 8GCHF 3UIRA 3GCHC 5L2ZH 1GHVH 1N8OB 1QB6A 4FUGA 4IGDA 1MD7A 1BHXF 1DUAA 1C5YB 4Q7XA 2BLVA 5TJXA 4CRGA 3U8OH 3GY3A 3GDSA 2RCEA 3TJNA 1HFDA 1NFUA 3RXUA 4Q7ZA 3PB1E 1T8LA 3ITIA 2P95A 3RXMA 3BIUH 2W3KA 2CHAC 2PFEA 3ELAH 2AGIX 4IN1A 5E0GA 1X7AC 4U30A 3A7WA 2Z3EA 1TQ7B 1LKAA 4MPUA 3S7HB 1SR5C 4KTCA 6GCHG 3ZZ5A 1GI6A 1DWCH 1NRNH 5J4QA 4Y79A 2PUXB 3SGAE 3M5NA 1OP8A 1UVTH 1ELGA 1S0QA 4AOQA 3CENA 4B1TA 3A7XA 1A46H 1TBZH 3T5FH 1JWTA 1H4WA 3A83A 4ZKSU 4Q7YA 3B9FH 1J16A 2DE8A 1GCTB 4VGCB 5CMXH 3MH7A 2VB0A 3NKKA 1MBQA 3OSYA 3AVZA 4Z6AH 5EXNA 1XVOA 3M35A 2EC9H 2VIQA 4TPIZ 3RXKA 3PMBB 1XXFA 2CV3A 5DP6A 1DT2A 1ZTLA 1H9HE 3RC4A 3MYWA 3FP6E 2BB4A 3Q3YA 1FPHH 3PLKA 3A7VA 1W13U 1D3PB 1C2JA 4JYTA 1F5LA 1SB1H 2TPIZ 3UQOA 5JBCS 1WAYB 1TRNA 5FHTA 5I25A 1QL7A 1T31A 3RXPA 2AERH 2ZI2H 3GCTG 4MNVA 7LPRA 1P9UA 3A8AA 1NFXA 3W95A 1S0RA 2ZQ1A 4AGKA 3SU0A 1IAUA 3GDUA 3ODDA 2WUBA 5EW2H 2ZECA 1W11U 2BOKA 1YLCA 1FMGA 4X6PA 1BBRK 3LGYA 2O8LA 2VIWA 3ODFA 4CRFA 2F9VA 5GCHF 2GP9B 1QCPA 4K8BA 1SHYA 1O2HA 6GCHF 4K2YA 2ZDMA 5C20A 2W26A 1DS2E 5GWZA 4YOJA 2HWLB 5J4SA 1O2MA 4IBLH 3BTME 3RXVA 3AW0A 4MTBA 1BBRE 5C2ZA 2XYAA 1ELEE 3AW1A 4A6LA 1HRTH 1PQ8A 1GDNA 1MKWH 1SG8B 2CGAA 3QO6A 4LK4A 1T32A 1HPGA 1NT1A 3BG8A 2VINA 4X6MA 5FCRA 1MAXA 1K1NA 2QF3A 4DIHH 1A5GH 1GI7B 2GX4A 1UVOA 1AE8H 3UNSA 3O8CA 6LPRA 5BRRE 1O2UA 5DK1A 3VFEA 1SLXB 1THPB 1BDAA 2AMQA 4AORA 1V2OT 2J9NA 2QA9E 3RU4D 5F03A 3KIDU 4D76A 2A7HA 1NESE 3H7TA 1NROH 2P16A 4GVUA 2PLXA 4AFSA 3KQCA 1Y8TA 2SGPE 1P2OA 1DUEA 3GCTF 1HXEH 2OP9A 1B0EA 2VWLA 5C1YA 2ZDNA 3RU4E 2GDDA 1O3BA 1YPHE 2AIQA 2ZDAH 1UTPA 2ALVA 4X2XA 3UY9A 1MH0A 5B6OA 1DPOA 1O5EH 2FI4E 4NWLA 2G81E 4U01A 2EI7A 4ISHH 1MCTA 1FIZA 2ZGXH 2TBSA 1O3LA 4AX9H 2AGGX 1GG6B 4OS6A 4NIXA 5EGMA 5HM2A 2FX6A 1HAIH 4UFDH 1WYKA 2O8TA 5A0AE 3VXEH 2ZHWH 4Y6DA 3RDZA 3BG4C 1RFNA 2P3UB 2FYRA 1O3GA 3BF6H 3U9AH 4FXGH 4BAOB 5F8XA 2PW8H 2XC5A 3HATH 3NZIA 1OWKA 1Y5AT 1V2VT 1DLKB 2PWXA 4AFQA 4BXWA 3BTGE 3ZVDA 2ZCHP 5EODA 1GJ7B 1AY6H 3ZZ3A 3VB4A 3PM3A 4UD9H 1SFIA 1GI8B 4WMDA 1KLTA 4A5TS 1GGDB 3G01A 3GISB 4CR9A 1EB2A 2ZKSA 1BIOA 1CGHA 3Q3KA 1O5DH 1SQAA 3RXCA 1FQ3A 3T26A 2PV9B 3T28A 1AKSA 1YCPH 1O3OA 2ZGBH 4U32A 3TK5A 1TGNA 3S9CA 2LPRA 1ORFA 3M3VA 1HB0B 2ZPQA 1RJXB 2R0LA 1SBWA 1UHBA 4ZMAH 1O2JA 5H4IB 3AASA 1AFQC 5BPEA 4B75A 4QT8C 4XSKU 1D6RA 1N1LA 1C5RA 2BZAA 1VZQH 1LVYA 1QGFA 5DP7A 2AMDA 1DSTA 2H2ZA 3GCHB 2H5DA 1DX5M 1EJNA 5A8ZA 1HAXB 5DPAA 3TU7H 5FX5A 2ESTE 2Y80A 5FBEA 1ELDE 1O5CB 1NS3A 3M37A 3TNTA 1DY9A 2O9QA 1O3IA 4NA7A 5T6FA 1MKWK 4FUHA 4R0IA 1UTMA 3URDA 1JMOH 2FS9A 1QQ4A 4I8JA 3FP7E 1ARBA 1O2XA 1NO9H 3A86A 4I8HA 5FBIA 3FANA 1TBRH 1XMNB 5JPMH 2UUKB 3SJIA 1SLWB 1QR3E 5TCCA 1GBBA 3SGQE 1P10A 3HGPA 3STJA 4BNRA 2F9PA 4PROA 5TCAA 3GY7A 2V3OH 2WPLS 1K22H 4LZ1H 1FZZA 3RXSA 3MU4A 3UTUH 5L30H 3BSQA 3U1JB 3P17H 1ABJH 1EPTA 3ATIA 3AAUA 2HOBA 1TNHA 2ZGCA 1ELFA 3NXPA 1FI8A 1HJAC 1MCVA 1GBAA 3MU8A 3SQHE 1MTUA 1C4V2 2XCNA 3GCOA 1YGCH 3A7ZA 1D3TB 1DXPA 5AVDA 4JCNA 4H4FA 1AMHA 3TH2H 1WCZA 3CS7A 4FUIA 3MU0A 2FS8A 2FI5E 3KGPA 4WJG2 1G3DA 2AEIH 1PFXC 1YPJH 1P09A 2A1DB 2VJ1A 1AVXA 1FPCH 1O30A 4BAQB 4DIIH 3ATKA 4JMYA 2QF0A 2QXGA 2OXSA 3D65E 1DM4B 1QB1A 1TIOA 2Q6GA 1ETSH 4K1TA 2OC1A 1G36A 4FU8A 2QXJA 1L1GA 3SJ9A 2Z6BD 1C1MA 1OYQA 2PUQH 2Y82A 4I8KA 4E06H 3BTDE 4X2VA 3SV8A 2FODA 3MO6A 4FUJA 2QIQA 1GJAB 3F9FA 3SJ8A 5GXPA 3P8NA 3D49H 1BTYA 1A7SA 1S6FA 3FFGA 5DP9A 2EI8A 1BHXB 1MTVA 1J8AA 1O2WA 4ZAEA 3T27A 2Y6TA 1O2GH 2B7DH 1BRAA 1YCPK 2JETC 2QN5T 4MG3A 1EPTC 2OTVA 1IQEA 1BTXA 2NU0E 1QFKH 1FY1A 1S81A 3A8BA 4D7GA 1SGEE 2HPQH 1IHTH 1MKXK 3O8RA 1EAWA 2ZFQH 1V2TT 5DP4A 1RGQA 1Z1IA 3LC3A 3VB6A 4X1NU 1TAWA 1SGIB 2JH5D 4NSYA 1Z8JB 1O33A 3QGNB 3S0NA 1UTJA 3SN8A 2Z9LA 1C5VA 2CMYA 4OS7A 1NM6A 4DOQA 3S7KB 1GDUA 4I8LA 1AB9C 2BQWB 1TPPA 3KHVA 1TFXA 4HI3A 1P3EA 2WPIS 3WY8A 2P8OC 2FZZA 3F68H 1LO6A 3QZQA 2HGTH 1SOTA 1EP5A 3FAOA 2J2UA 2ANWA 2ZF0H 3DHKH 5A09A 1O2PA 3Q3XA 1Z7KA 1C2FA 1W2KH 1VCPA 2UWLA 2V0BA 3PMJA 4OS5A 2ZDVH 3CS0A 1QHRB 2FESH 4WH8A 2GT8A 1OWEA 3N7OA 1A0LA 1BQYA 2FXRA 1C1QA 1LHCH 1CHOG 5GJ4B 1EXFA 1J15A 1ARCA 1D3QB 1SQTA 2W3IA 3VB7A 4CHAC 2OCVB 2ZIQH 1O3HA 2NWNA 4TPYA 3SUFA 3UUZA 3ATMA 1YPLH 2FOBA 2RA3A 3BG4B 2R2WU 4BXSA 1BTPA 1DY8A 2BY7X 1UCYK 2ZCLP 3FZZA 1W8BH 1CU1A 1HAGE 2BZ6H 3QWCH 1AHTH 2ZFPH 4NWKA 2WUCA 1T4VH 3TVJB 1ANEA 1UTNA 1C5PA 4MPWA 4K8YA 2TIOA 2C93B 1BMMH 3A84A 1KYNA 1TOCB 2F9OA 3RXRA 4CBNA 1RIWC 2F91A 1FUJA 4X1RU 4UONA 4HZHA 1P2NA 3F9EA 1CQQA 2SGDE 4K1SA 2ZDKA 4B74A 6CHAC 1O2OA 3BIVH 1AUTC 4B73A 1GBEA 4K69A 2F9NA 2ZTXA 5AFZH 1T8NA 2GVFA 4X1PU 3A89A 1LHDH 3ZZ6A 2OD3B 4ABBA 1G30B 1SMFE 1HAHH 1EZQA 1K21H 1DFPA 2ZU1A 1ZTJA 5DGJA 1ELBA 5LPEA 1O3EA 1O2TA 2ZGHA 3P8OA 4A1VA 2R3YA 2ZCKP 4Q2KA 1WQVH 1SL3A 3FZDA 1AFQB 3M61U 4WVPE 3ZZ8A 2VIDA 1PQ7A 2TGPZ 3K6ZA 1TRMA 2ZU4A 2FI3E 1CHOF 1OOKB 1KSNA 2Q6DA 3MMGA 4DURA 2C8YB 2ILNA 1C2KA 1PPCE 2OBQA 4OS4A 3DFJA 4KKDA 2AFQB 1OP0A 1P06A 2QYIA 1HDTH 3I29A 3M7QA 1O34A 2ZPSA 3VB5A 1LPKB 4X6OA 4FU7A 1SFQB 4HFPB 4OS1A 4BTUB 3ZVAA 1RXPA 1O3CA 5HGGA 4FUBA 2ZHEH 1O35A 1B0FA 2WV5A 3R0FA 2Z94A 1CSOE 1LCYA 3V0XA 1S5SA 1SQOA 2DUCA 2LNCA 3EYDA 2OUAA 3RXAA 5T6GA 2P59A 2TRMA 5GCHG 4ABAA 1KTTB 1WUNH 3SNDA 1C4Y2 1H9IE 3EE0B 5DO4H
chains in the Genus database with same CATH superfamily
1L2EA 1DWBH 4OS2A 2D2DA 2DE9A 3UR9A 5EU8A 1OHHD 3T25A 3P8FA 2JH0D 1EASA 1P2MA 1MU8B 1HJAB 2ANMH 2F9UA 3EAJA 1UHBB 2PHBA 2P93A 1A0JA 3BTQE 4AB8A 8KME2 3TGKE 2I6QA 3PLBA 4KTUA 1O36A 1WV7H 1E34B 1IOEA 1GJ8B 2W6ID 3GYLB 1JRSA 1ZJKA 4CH8B 1FIWA 5ABWA 4NIVA 1GI2A 2GTBA 5IK2D 2KCOA 3ZV9A 1T7CA 4MNYA 1JXPA 1Z6EA 1O5FH 1SI5H 1WOFA 2GCTC 3QK1A 1CGIE 3OTJE 4WH6A 1QY6A 3N7EA 2J98B 3UNQA 1GHAG 5HIYA 1O2ZA 3BV9B 5AF9H 1ZRKA 3SNCA 1B7XB 3ZYEA 1LPZB 2AMPA 3MH6A 2F43B 1HNEE 1CA0C 3GS9A 1BITA 5DP8A 2IOTA 4TY7A 3IITA 4B6FA 1QBOA 3E90B 1TQ0B 2VH0A 2ZHFH 2C3SA 3MI4A 1MTSA 2RDLA 1K1JA 4AFZA 4Q80A 2Z3DA 2OC0A 5G4BA 1HBTH 2A7JA 1XUGA 1P2KA 4MQAA 1C2IA 1QRXA 1ANCA 1E35B 1UTQA 4CH2B 1AO5A 3D23A 1HAVA 1ZZZA 4JYVH 3PMAB 1GJ6A 1QBNA 1THRH 4FVBA 4KTSA 2GKVE 2ZEBA 1XM1A 1C4U2 2JETB 3TK9A 3OYPA 1AVWA 1EPTB 4GAWA 2THFB 3SJOA 8LPRA 1NN6A 1P02A 1ZR0A 2A4RA 1XUFA 5EQRA 2Z9GA 2HNTC 1W0YH 2WYJA 4Y71A 4SGBE 1S6HA 1DDJA 1Z71A 3A80A 2VVUA 1V2PT 1O2VA 5C0UA 3UFAA 4Y7BA 3RMLH 3P6ZB 1C5UA 3PMHB 4ZKOU 1AB9B 5DG6A 1P2IA 2BD7A 4B2CA 4JZFH 1V3XA 4WWYA 1A61H 1NRSH 2B5TB 2F4LA 2P8OB 3V13A 3A82A 4ZHLU 1GHAF 1A5HA 4XBDA 5DKMA 1OWJA 1FAKH 3ENSB 2Z9JA 1C5WB 3RXFA 1TPSA 3KQDA 4TT3D 1FONA 4DJZB 1ACBE 3QTOH 3LH3A 1G3BA 1U6QA 3VPKA 3VB3A 2AYWA 1YKTA 4GSOA 1GVZA 3RC5A 1BA8B 1MQ6A 4H6SB 1Z8RA 2R2MB 1FY5A 1NBMD 2C8WB 4ISNA 1GHXH 2BVXH 4ZCNA 1KXFA 1OS8A 1BMAA 4INLA 2J92A 1COWD 1F5RA 1NFYA 4Y8YA 2XNIA 1XUJA 3F1SB 1RS0A 1SVPA 4CHAB 5EPYA 4YO9A 1V2WT 1NBME 1G37A 4RT0A 1AD8H 1VGCC 1FLEE 3JZ1B 4FUCA 1D4PB 5EPNA 1ESAA 2GZ8A 1BUIA 1TNIA 3BTFE 5EG4A 2SGFE 1Y5UT 5ESBA 3LKWA 1LPGB 3JZ2B 2GJGA 4DW2U 4WMFA 1O5AB 2GMTC 2PR3A 1H8IH 1DXWA 3OY6U 2UWOA 2FPZA 4ESTE 2QAAA 1W7XH 1P04A 1RIWB 2OC7A 4HTCH 1DVAH 2BDCA 1YYY1 4FUFA 2P3TB 3SUGA 2BM2A 4Y8XA 4K1EA 6CHAB 2WPJS 3OAAD 3MU1A 1K9OE 1QJ7B 3ZZBA 1P2JA 2G52A 3PO1C 3QLPH 2IJD1 1JIRA 1RTKA 1O2SA 3TIUA 1EJAA 1TABE 3SYJA 2EEKA 2B9LA 1HJ9A 3DUXH 4JYUH 3P92A 1BTHH 4ZXYH 2STAE 4ACAA 2PKSC 3DSPA 4Z0KA 1GJ5H 3SU1A 3LGWA 4HGCA 1GHBG 1OPHB 1CBWC 1GBFA 1MTWA 4KP0A 5AHGH 4YT7H 3UB0A 5GDSH 2VWOA 2BD4A 1QJ1B 2G4UA 3S9BA 1CO7E 2O8WA 4NFFA 2V35A 1TMBH 1ZSJA 3U1IB 2R3UA 4NZLA 3SQEE 2ZU3A 3BN9A 5LH8A 1VKYA 2FOHA 4X2YA 3L6PA 1AIXH 1ESTA 3MU5A 1EZUC 4DGJA 4MPXA 3O8DA 1MU6B 2OQUA 3HGNA 3PRBA 1C2GA 1MAYA 3LGTA 1ETTH 2BTCE 4ABGA 1GVKB 2YMSD 3LGUA 2Q1JA 1LQEA 1INCA 1O31A 1VITF 4TYDA 4RKJB 4I31A 2FOGA 3E0NB 1P8VC 3F9GA 1GJDB 1AUJA 5DN6D 1ZGIA 2YNBA 4IMQA 4THNH 3T62A 3AAVA 1TWXB 4BTTB 1ANDA 5GIBA 2H1UA 4Y11E 2CHAB 4ABIA 3QN7A 3ZYDA 1EOJA 1ZPCA 2ZFRH 2BDBA 1SGQE 3RXJA 3SJKA 1OX1A 2Z9IA 4NIWA 2WINI 3H7OA 1FJSA 3V3MA 1ZMLA 4J2YB 1HLTH 2PKAA 4U2WA 4GLYA 2A5IA 2F9BH 4FVDA 1NY22 1KTSB 3SNBA 5EJLA 1GBIA 2G8TA 3I78A 4WF8A 1UTKA 1DE7H 5KGOA 2EI6A 4A1XA 2FOAA 1KY9A 1FDPA 1G3EA 3TITA 2G51A 5T6DA 1GHBF 4CRBA 1F92A 1MQ5A 1P05A 3EA7A 1NRPH 2D26C 2ALPA 1T8MA 3LGVA 4LOYH 1UVPA 1YLDA 1D3DB 1Y3WA 3PTBA 2WPMS 2GCTB 1A2CH 1TMUH 2OC8A 5FPSA 4CRDA 2VU8E 3UR6A 1E0FD 3EA8A 1ZTKA 2AH4X 4K60A 1NRRH 2L74A 1Y3YA 5C3NA 1CHGA 4F4OC 4IC5A 3FVFB 7ESTE 5FCKA 1CA0B 1F0SA 2K8IA 4H42U 4E7RG 2V6NA 3DT0H 5EXMA 2PGBB 2BD3A 1ZHRA 4CREA 3SZEA 2D1JA 3RC6A 3SU5A 1NC6A 3DA9B 1W12U 1EOLA 3OTPA 1Y3VA 3SORA 1GI4A 2V3MA 1J17T 5A0CA 1BRCE 1C5MD 3RM0H 5EXLA 3P8GA 1PYTC 2ZWLH 3BEIB 3DD2H 2ZDLA 4Y0YE 1LVOA 2ANKH 4O97A 1O2LA 2BDGA 2GD4B 1DICA 1XKAC 3K65B 1WXRA 1UTOA 1K1LA 1P3CA 2AGEX 4K5ZA 4O3TA 4UDWH 3A88A 1FY8E 3RXEA 1DWDH 1AZ8A 1UJ1A 1S83A 2WV4A 5DP3A 1O2RA 1QURH 3PTNA 2QGRA 1VITH 1GHYH 1Q3XA 1V2ST 1CE5A 1BZXE 2G55A 4XFQA 1SGFA 3HK3B 1A1RA 4UFGH 3SV2H 4E05H 1W14U 3DSGA 2Y7ZA 3T2NA 3M3TA 1V2KT 3MO9A 1TONA 2FM2A 1J9CH 2B8OH 3UOUA 1O2YA 1TA6A 1JRTA 1H8HD 2UUJB 2YOLA 1UK2A 4WXVA 3MH4A 2Y5HA 3PV4A 4INKA 4LZ4B 3NCLA 1P0SH 5E8EH 3VG8A 1LHEH 2ZHQH 4J1YA 3ATWA 4FU9A 4IMZA 1IQKA 2ZC9H 1SLVB 1A3EH 1PPBH 2J95A 1BRBE 3UOPA 4ABHA 1ZSKA 1DSUA 2OLGA 4JZ1A 3TNSA 4AN7A 3RXQA 1WBGB 3PWBA 1L0ZA 2SNVA 3E6PH 4ZHAA 1V2LT 1LVMA 3P95A 5C1UA 1D9IA 2VIOA 2K0QA 1SLUB 4RSPA 1VJAU 1BTZA 1UW7A 3RM2H 1UVSH 1GJ4H 1GPZA 1BMFD 1S6LA 1AFEH 4OM9A 3SUDA 1YPKH 3CNRA 3SV7A 1KDQA 1GWAA 1HAVB 1SOZA 2BDAA 2KZ4A 3E0PB 4YESB 1S84A 3RXTA 1H8DH 3V7TA 1TPAE 2GZ7A 2XTTB 1IQLA 3TK6A 2VIPA 1W0ZU 2XBYA 5EW1H 2Y7XA 1TNGA 2H9TH 3LOXA 2P3FH 1O2KA 1ZSLA 1M9UA 1SGTA 5C5OA 1GI9B 1K1MA 2VWMA 2KAIA 1QTFA 1G2LA 1E1RD 4X6NA 3RXLA 4AFUA 2BY8X 2FOEA 3BEUA 3F3BA 3ZVFA 1FY4A 1BRUP 3BTTE 1BJVA 2TGDA 1UTLM 1VCWA 1ESBA 1ELCA 1O3KA 3BTEE 4Y7AA 4CR5A 1C1NA 1ABIH 3C1KA 1BMLA 1NZQH 3ZZ7A 3PO1B 2BD5A 3ZZCA 1C5ZB 1E38B 3NRLA 2V3HH 1TX8A 3UPEA 2GV7A 1TGBA 2CF8H 1D6WA 2JJ1D 3RMOH 3STIA 1O3NA 2PKSB 3RXGA 3RXHA 1RD3B 3RXBA 3HKJB 1CBWB 4ZROA 3EGKH 1P03A 5JBBS 4MDSA 1S82A 3P70B 5C1XA 3MQKC 3NUMA 1YBWA 1GI0A 1PQAA 1CT0E 1L4ZA 2A4GA 1ZMJA 1CA8B 2TGAA 2CN0H 2BVRH 2HLCA 1Y59T 1GBJA 2VGCC 4YM9A 1TMTH 2ZPRA 4X8TH 1O3AA 3B23B 4DY7B 1QBVH 2O8UA 1RRKA 1LKBA 4IC6A 1PYTD 4X0WU 3KF2A 2HLDD 2JJ2D 5HMAA 1TLDA 2A7CA 3TH4H 2SGAA 2BLWA 2F3CE 3EDXB 3PLPA 3GY2A 1SC8U 1K1PA 5DSFA 3W1EA 2FLRH 2W7UA 1YPGH 3KL6A 1RTLA 3KN2A 3PV2A 3MWIU 1QA0A 1K1OA 5ETXA 1IQMA 5E2OA 1HAYB 4OGXA 1CVWH 5JBAS 1DWEH 1EAUA 3GOVB 1P01A 1XUIA 2A45B 5EIYA 3GICB 4D8NA 2Y81A 4D9QA 4TY6A 1TYNA 1QL9A 5B6LA 1A5IA 2FLBH 3OU0A 1B5GH 4ASHA 1GHZA 5HIZA 2BOHB 1OKXA 3GY6A 1P57B 2HNTF 2ODYB 1H9LB 3MNCA 3SU6A 1YPHC 2HPPH 5C67A 4ZXXH 1PPHE 1YC0A 4AYYB 1GBMA 4KGAA 2Z3CA 3F0PA 5KEDA 1SKYE 1LDTT 1TGTA 2M5TA 1ZGVA 5HXFA 1AGJA 1YY3A 2H6MA 2A0QB 1E37B 1ZLRA 1C5XB 2PTCE 4ZUHA 1AKSB 5EJ1A 3SI3H 3SW2B 5DJ7A 1NPMA 2GGVB 4I33A 2J94A 4BAMB 4BOHA 2FP7B 2B0FA 1FY3A 2HVXA 4WXIA 3SU4A 2XWBI 1AZZA 1O2IA 3KQEA 4GUXA 9ESTA 4B2AA 4MNWA 2BD8A 3LIWA 3KCGH 4GHTA 4UE7H 1EFRD 3BTWE 2H5CA 2H9HA 1K2I1 1EQ9A 1JBUH 2CXVA 4A92A 1TPOA 4O03A 5ESTE 2C8ZB 1XVMA 3F9HA 1O3MA 1C1UH 4NFEA 3A8DA 4BAHB 1DANH 1A3BH 2WPHS 1QRWA 3LJJA 6ESTA 4FETA 2VVVA 3U28C 2ZZUH 3E91A 2FOCA 1ETRH 1KLJH 1MTNC 3OY5U 2HALA 3A85A 2A4QA 1O2NA 1GBDA 3L3TA 1BTUA 2NU2E 1HJ8A 3BTHE 4NA8A 1AQ7A 2A2XH 2TGTA 2PKAB 2QY0B 1Z8IB 1SSXA 3MNXA 1AWHB 1HYLA 1YM0A 2ZGJA 3DFLA 5GPIB 1CT2E 4AB9A 3K6YA 3TPIZ 4ZH8A 1IQJA 2FTLE 1O3DA 1EATA 2KM0A 1CT4E 2BD9A 1GL0E 4TWYA 1O3PB 1A0HB 1THSH 1FXYA 1GI1A 1GJCB 2BDHA 2XBWA 3D62A 2A5AA 3UQVA 1V2UT 2BHGA 3GDVA 4AC9A 1IHSH 5DP5A 1Z8GA 1HAPH 3RMNH 1QRZA 4A7IB 3E1XB 2BDYA 1C9TA 3ZVGA 2CF9H 4ZKNU 1GDQA 1TX7A 4O9VA 2GZ9A 1IQNA 2ZU5A 1AWFH 2IJOB 4HG6A 2FEQH 3RXDA 1C5NH 4BANB 2I6SA 2UUFB 1HIAA 2VIVA 5A2MH 3F2FA 1F2SE 2RG3A 1EZXC 2NU1E 2ZFSA 5E0HA 1MZAA 1XUHA 3MNBA 5A8XA 1IQFA 1IQHA 2FDAA 2XCFA 1N6XA 1GHWH 1RTFB 3A81A 3VGCC 3Q76A 2QF4A 2A4OA 3A8CA 1JOUB 1EJMA 1WU1A 2ZTZA 3SUEA 1SGNE 4MNXA 1K1IA 2XBVA 3QTVH 1XXDA 5I46H 2XOKD 1V2RT 4YOGA 2W6JD 2XC0A 4A1TA 1PPFE 5K0HA 4GHQA 4Y0ZE 3ESTA 3HKIB 4JK5A 2XXLA 4BAKB 1S85A 1TNKA 3EA9A 2OINA 4RN6A 1UK3A 2GV6A 2QC2A 4ACBA 1P12E 1O3JA 1OXGA 2A5KA 1QQUA 1ZHMA 1FN6A 3M3SA 3UAIC 3E16B 2ZNKH 4D9RA 2ZTYA 1O0DH 1VJ9U 4ABDA 1PJPA 1ANBA 1NTPA 1Y3UA 1K28D 4DT7B 4P02A 2BXTH 1PPZA 2ZQ2A 3SZNA 3OX7U 1TBQH 5JYIA 1KIGH 1HGTH 2G5NA 1VITG 1H8ED 4M7GA 3ZZAA 1BTWA 1GBKA 1L4DA 1HAZB 1MMJN 4I32A 2G00A 3HK6B 1EAXA 2AIPA 4NGAH 2BX3A 1PPGE 3HPTB 3LDXH 1SGDE 2JKHA 3I77A 3W94A 2A31A 2R9PA 1AVGH 3ZVEA 4F48B 2RA0A 1W7GH 3TH3H 3M36A 4NIYA 4DCDA 3ZVCA 1YF4A 1C1RA 3SHCH 4R8TB 1E79D 3R3GB 1YP9A 2JH6D 4ABEA 4RI0A 2FX4A 4XE4A 1UK4A 5FXLA 5JB8S 3E3TA 1QNJA 1GL1A 2NU4E 3CP7A 3MOCA 4YTAA 3MFJA 5HM9A 1MD8A 1V2QT 1KDQB 3T29A 4UFFH 1OSSA 1FV9A 2FIRH 1EZSC 2K1QA 2VGCB 5JDUB 1AN1E 2BQ6B 3UWIA 5A0BA 2PTNA 1HUTH 5HYOA 3O8BA 1GBTA 3TJVA 2PSXA 3GY8A 1EX3A 3IWMA 2CK3D 4XOJA 4X8UH 2A2QH 5CHAC 2KAIB 3SGBE 1J14A 4TWWA 1F0UA 2FMJA 3LGIA 5EQSA 1AU8A 4YLQH 3A87A 3TGIE 3QUMP 4YT6H 2XWAA 2SNWA 4AG2A 4M9FA 1V2MT 3SBKA 4X1SU 2HRVA 1F0TA 3BEFB 1TALA 1MKXH 4IW4E 1SGFG 1O39A 1N6YA 1OWDA 1G32B 1KXCA 1C1TA 4NG9H 7KMEH 1QZ8A 1TB6H 5IDKA 3M5LA 1C2MA 1UMAH 2FWWA 1ZOMA 3KYFA 4IS5A 4Y76A 2QV1A 2J4IA 3LC5A 1KLIH 1TGCA 5C5NA 4YOIA 1C2LA 4XBBA 4F49A 1ZPBA 2FYQA 1AE5A 4UEHH 1V6DA 1SHHB 4UFEH 4DG4A 1G9IE 5JBTA 1SPJA 3SO3A 2J98A 1MUEB 2VVCA 1XKBC 1NFWA 4FUDA 4IN2A 2J38A 2HNTE 5E0JA 4X8VH 1QL8A 3K2UA 3N7DA 4AYVB 2HVYB 1BCUH 5FL7D 1ELVA 1LMWB 1N8OC 3GY4A 3QGJA 4GPGA 2IN2A 1QA7A 2UUYA 1T4UH 1BJUA 2O8MA 2ZG0H 1F7ZA 1YPMH 5F8ZA 2ASUB 1L1NA 4YXWD 3U69H 4NCYA 1C1WH 4YZUA 1UO6A 3BTKE 1TNLA 4BTIB 4RKOB 3E8LA 2OQ5A 4WMEA 4XBCA 3AK5A 1HXFH 4XDEA 2RFKC 2R0KA 2QXHA 1G3CA 3LH1A 1C1OA 3ZZ9A 1L1JA 1C2HA 1EB1H 1XX9A 4NZQA 4SGAE 3GCNA 3SU2A 3ZVBA 1WQSA 1P2QA 1UCYH 3QX5H 2BY5X 1DITH 2BYAX 1C5TA 1LTOA 1BT7A 1MBMA 1YPEH 1GJ9B 2SFAA 3PRDA 1Y5BT 1MTNB 4FUEA 1LHFH 1SGPE 3UWJH 3RMMH 5IYTA 3KQBA 1WTGH 1GCTC 2BY6X 1GI3A 4VGCC 4NSVA 1WSSH 3H5CB 1QIXB 5L2YH 3SV9A 4I8GA 3GY5A 2PGQB 3NPSA 1GI5A 3M5OA 5FX6A 2CJIA 1BMNH 1LVBA 4E7NA 1KXDA 1P11E 2ULLA 3B8JA 1GBHA 2XC4A 5EQQA 3QDZB 5T3HA 3KEEA 5AFYH 3KYGA 4K3JA 4B2BA 8ESTE 1W10U 3KNXA 1Q31A 2OBOA 3OEHD 2C90B 4I7YH 2EA3A 2ZP0H 3L33A 1K0HA 1F0RA 3RLYH 1HV7A 1YLNA 2KCYA 1ZJDA 1JIMA 3MH5A 3QZRA 5FPTA 2KX4A 1EP6A 2GDEH 2FTMA 2FO9A 2BY9X 2XRCA 1C5OH 7GCHG 1MZDA 4JK6A 1GMDG 4ZKRU 1OYTH 2ANYA 4WY3A 3LT3A 3VEQB 3ZZ4A 3LJOA 4NA9H 1AI8H 3TJUA 1NRQH 2VWNA 3VGCB 1C9PA 2NU3E 3MTYA 2Y5GA 3M7TA 1BB0B 2BVSH 3SOSA 1W3CA 4B71A 1ELTA 2WZQA 2ZO3H 1GJBB 3ZV8A 3RXIA 4OGYA 2ODQA 1IQGA 3SV6A 1FN8A 4JZDH 1DLEA 2ZA5A 2W7SA 2D8WA 3PWCA 1ZHPA 1ZYOA 5SGAE 2XBXA 4ASUD 1O3FA 1VCQA 2BX4A 5CE1A 2A32A 4ZHMU 4ABJA 1GMHG 1TGSZ 2ZU2A 4JZIA 5L6NH 1GBLA 3M7UA 4AGJA 4JZEH 4X1QU 3K9XB 3U8RH 2BLQA 1Q2WA 1NU7B 1UVUH 1C1PA 1VGCB 1Z6JH 2SGQE 5A8YA 2C8XB 5CHBA 2SGEE 4CRCA 4Y10E 1PQ5A 3F0OA 5LPFA 1O2QA 3TGJE 3IG6B 3LPRA 3TJOA 2Z9KA 1O32A 1BOQA 1GVLA 3MHWU 5E2PA 1WTHD 5LPRA 1CGJE 1H1BA 3NWUA 1F5KU 5JB9S 2FOFA 2GMTB 2ZFFH 1GBCA 1LQDB 1E36B 1GMCG 1QB9A 3MO3A 5F8TA 3A7TA 1HIAB 7GCHF 1EUFA 1GMDF 3M5MA 2ODPA 3U98H 2G4TA 2ZFTA 1C1VH 2BXUH 1C5QA 1A4WH 1O38A 1IQIA 3FP8E 2Q6FA 1OWHA 4GCHG 2WYGA 2F83A 4ISLA 1QJ6B 2GCHG 2IPHA 2BQ7B 1Y3XA 1EKBB 1GG6C 3SNEA 1YCPM 1V2JT 8GCHG 2AS9A 3PYHA 3F2HA 1O37A 1SGCA 2WHXA 4INHA 1G2MA 2AHME 3VXFH 2P94A 3RUOA 4H6TA 3SNAA 1V2NT 4B76A 9LPRA 1TNJA 1ELAA 5K7RA 2GT7A 3RP2A 1LHGH 2H9EH 2STBE 3DCLA 1VR1H 2W5EA 2ZHDA 1KXBA 2BDIA 4X2WA 4ABFA 1C5SA 1ZMNA 1HCGA 3C27B 3Q77A 1SGYE 2FOMB 3LU9B 3ZIAD 1GCDA 3EQ0H 1UCYE 1TE0A 2QXIA 3URCA 3UNRA 5CHAB 1GMHF 3GYMA 1P9SA 1O5GH 3WWBA 1C5LH 1TA2A 1NU9A 1TX6A 3RXOA 4Y8ZA 3PROA 4CRAA 2Z7FE 2BD2A 1FNIA 3SU3A 1BBRH 4YLUA 4AG1A 5FAHA 1ZPZA 1TRYA 1XUKA 5F6MA 1DOJA 4MPVA 5EJZA 1GGDC 1OWIA 4ISIH 2BMGB 2G5VA 2PSYA 4O3UA 4KELA 2XW9A 1FAXA 1C2DA 4ISOA 2VNTA 1C2EA 3TLOA 4MVNA 3SHAH 4AZ2B 4X8SH 1T8OA 5FPYA 1ZRBA 3RLWH 2JDID 1Z1JA 3MNSA 1HAOH 3ZZDA 1GMCF 3NK8A 1SGRE 2J34A 3S9AA 1C1SA 1OP2A 5EOKA 3S69A 2L6OA 2UWPA 4MLFB 3SI4H 2WPKS 5PTPA 1EAIA 2C4FH 3UREA 3RU4T 4DVAU 3Q00A 2Y5FA 3LONA 4GCHF 4D7FA 2YNAA 5LGOA 2KCPA 1KXEA 3F6UH 4LXBH 4CBOA 2VH6A 1ID5H 3V12A 2GCHF 3A7YA 1TOMH 1O5BB 1KXAA 1PPEE 1WDIA 2QCYA 2BLOA 3ATLA 3U8TH 8GCHF 3UIRA 3F2GA 3GCHC 5L2ZH 1GHVH 1N8OB 1QB6A 4FUGA 4IGDA 1MD7A 1BHXF 1DUAA 1C5YB 4Q7XA 2BLVA 5TJXA 4CRGA 3U8OH 3GY3A 3GDSA 2RCEA 3TJNA 1HFDA 1NFUA 3RXUA 4Q7ZA 3PB1E 1T8LA 3ITIA 2P95A 3RXMA 3BIUH 2W3KA 2CHAC 2PFEA 3ELAH 2AGIX 4IN1A 5E0GA 1X7AC 4U30A 3A7WA 2Z3EA 1TQ7B 5F53A 5GNDA 1LKAA 4MPUA 3S7HB 1SR5C 4KTCA 6GCHG 3ZZ5A 1GI6A 1DWCH 1NRNH 5J4QA 4Y79A 2PUXB 3SGAE 3M5NA 1OP8A 1UVTH 3OFND 1ELGA 1S0QA 4AOQA 3CENA 4B1TA 3A7XA 1A46H 1TBZH 3T5FH 1JWTA 1H4WA 3A83A 4ZKSU 4Q7YA 3B9FH 1J16A 2DE8A 1GCTB 4VGCB 5CMXH 3MH7A 2VB0A 3NKKA 1MBQA 3OSYA 3AVZA 4Z6AH 5EXNA 1XVOA 3M35A 2EC9H 2VIQA 4TPIZ 3RXKA 3PMBB 1XXFA 2CV3A 5DP6A 1DT2A 1ZTLA 1H9HE 4I86A 3RC4A 3MYWA 3FP6E 2BB4A 5HKKD 3Q3YA 1FPHH 3PLKA 3A7VA 1W13U 1D3PB 5C17A 1C2JA 4JYTA 1F5LA 1SB1H 2TPIZ 3UQOA 5JBCS 4P00A 1WAYB 1TRNA 2J5UA 5FHTA 5I25A 1QL7A 1T31A 3RXPA 2AERH 2ZI2H 3GCTG 4MNVA 7LPRA 1P9UA 3A8AA 1NFXA 4XD7D 3W95A 1S0RA 2ZQ1A 4AGKA 3SU0A 1IAUA 3GDUA 3ODDA 2WUBA 5EW2H 2ZECA 4Q63A 2XNDD 1W11U 2BOKA 1YLCA 1FMGA 4X6PA 1BBRK 2YMSC 3LGYA 2O8LA 5C94A 2VIWA 3ODFA 4CRFA 1SQRA 2F9VA 5GCHF 2GP9B 1QCPA 4K8BA 1SHYA 1O2HA 6GCHF 4K2YA 2ZDMA 5C20A 2PP6A 4B6EA 2W26A 1DS2E 5GWZA 4YOJA 2HWLB 5J4SA 1O2MA 4IBLH 3BTME 3RXVA 2IPQX 3AW0A 4MTBA 1BBRE 5C2ZA 2XYAA 1ELEE 3AW1A 4A6LA 1HRTH 1PQ8A 1GDNA 1MKWH 1SG8B 2CGAA 3QO6A 4LK4A 5C0TA 1T32A 1HPGA 1NT1A 3BG8A 2VINA 4X6MA 5FCRA 1MAXA 1K1NA 2QF3A 4DIHH 1A5GH 1GI7B 2GX4A 1UVOA 1AE8H 3N99A 3UNSA 3O8CA 6LPRA 2WV9A 5BRRE 1O2UA 5DK1A 3VFEA 1SLXB 1THPB 1BDAA 2AMQA 4AORA 1V2OT 2J9NA 2QA9E 3RU4D 5F03A 3KIDU 4D76A 2A7HA 1NESE 3H7TA 1NROH 2P16A 4TSFD 4GVUA 2PLXA 4AFSA 3KQCA 1Y8TA 2SGPE 1P2OA 1DUEA 3GCTF 1HXEH 2OP9A 1B0EA 2VWLA 5C1YA 2ZDNA 3RU4E 2GDDA 1O3BA 3FN8A 4Z1MD 1YPHE 2AIQA 2ZDAH 1UTPA 3EE7A 3OE7D 2ALVA 4X2XA 3UY9A 1MH0A 5B6OA 1DPOA 1O5EH 2FI4E 4NWLA 2G81E 4U01A 2EI7A 4ISHH 1MCTA 1FIZA 2ZGXH 2TBSA 1O3LA 4AX9H 2AGGX 1GG6B 4OS6A 4NIXA 5EGMA 5HM2A 2FX6A 1HAIH 4UFDH 1WYKA 2O8TA 1W0JD 5A0AE 3VXEH 2ZHWH 4Y6DA 3RDZA 3BG4C 1RFNA 2P3UB 2FYRA 1O3GA 3BF6H 3U9AH 4FXGH 4BAOB 5F8XA 2PW8H 2XC5A 3HATH 3NZIA 1OWKA 1Y5AT 1V2VT 1DLKB 2PWXA 4AFQA 4BXWA 3BTGE 3ZVDA 2ZCHP 5EODA 1GJ7B 1AY6H 3ZZ3A 3VB4A 3PM3A 4UD9H 1SFIA 1GI8B 4WMDA 3WWFA 1KLTA 4A5TS 1GGDB 3G01A 3GISB 4CR9A 1EB2A 2ZKSA 4RT1A 1BIOA 1CGHA 3Q3KA 1O5DH 1SQAA 3RXCA 1FQ3A 3T26A 2PV9B 3T28A 1AKSA 1YCPH 1O3OA 2ZGBH 4U32A 3TK5A 1TGNA 3S9CA 2LPRA 1ORFA 3M3VA 1HB0B 2KFWA 2ZPQA 1RJXB 2R0LA 1SBWA 1UHBA 4ZMAH 1O2JA 5H4IB 3AASA 1E1QD 1AFQC 5BPEA 4B75A 4QT8C 4XSKU 1MABB 1D6RA 1N1LA 2V7QD 1C5RA 2BZAA 1VZQH 1LVYA 1QGFA 5DP7A 2AMDA 1DSTA 2H2ZA 3GCHB 2H5DA 1DX5M 1EJNA 5A8ZA 1HAXB 5DPAA 3TU7H 5FX5A 2ESTE 2Y80A 5FBEA 1ELDE 1O5CB 1NS3A 3M37A 3PV5A 1DY9A 2O9QA 3TNTA 1O3IA 4NA7A 5T6FA 1MKWK 4FUHA 4R0IA 1UTMA 3URDA 1JMOH 2FS9A 1QQ4A 2LP6A 4I8JA 3FP7E 1ARBA 1O2XA 1NO9H 3A86A 4I8HA 5FBIA 3FANA 1TBRH 1XMNB 5JPMH 2UUKB 3SJIA 1SLWB 1QR3E 5TCCA 1GBBA 4DT4A 3SGQE 1P10A 3HGPA 3STJA 4BNRA 2F9PA 4PROA 5TCAA 3GY7A 2V3OH 2WPLS 1K22H 5CDFE 4LZ1H 1FZZA 3RXSA 3MU4A 3UTUH 5L30H 1FX0B 3BSQA 3U1JB 3P17H 3FKSD 1ABJH 1EPTA 3ATIA 3AAUA 2HOBA 2WPDD 1TNHA 1KMHB 2ZGCA 1ELFA 3NXPA 1FI8A 1HJAC 1MCVA 3WW7A 1GBAA 3MU8A 3SQHE 1MTUA 1C4V2 2XCNA 3GCOA 1YGCH 3A7ZA 1D3TB 1DXPA 5AVDA 4JCNA 4H4FA 1AMHA 3TH2H 1WCZA 3CS7A 4FUIA 3MU0A 2FS8A 2FI5E 3KGPA 4WJG2 1G3DA 2JIZD 2AEIH 1PFXC 1YPJH 1P09A 2A1DB 2VJ1A 1AVXA 1FPCH 2KR7A 1O30A 4BAQB 4DIIH 3ATKA 4JMYA 2QF0A 2EQNA 2QXGA 2OXSA 3D65E 1DM4B 1QB1A 1TIOA 3OEED 2Q6GA 2OK5A 1ETSH 4K1TA 2OC1A 1G36A 3KQ5A 4FU8A 2QXJA 2RDEA 2VBCA 1L1GA 3SJ9A 2Z6BD 1C1MA 1OYQA 2PUQH 2Y82A 4I8KA 4E06H 3BTDE 2YMSB 4X2VA 3SV8A 2FODA 3MO6A 4FUJA 2QIQA 4Q4LA 1GJAB 3F9FA 3SJ8A 5GXPA 3P8NA 3D49H 1BTYA 1A7SA 1S6FA 3FFGA 5DP9A 2EI8A 1BHXB 1MTVA 1J8AA 1O2WA 4ZAEA 3T27A 2Y6TA 1O2GH 2B7DH 1BRAA 1YCPK 2JETC 2QN5T 4MG3A 1EPTC 2OTVA 1IQEA 1BTXA 2NU0E 1QFKH 1FY1A 1S81A 3A8BA 4D7GA 1SGEE 2HPQH 1IHTH 1MKXK 3O8RA 1EAWA 2ZFQH 1V2TT 5DP4A 1RGQA 2EY4C 3H09A 1Z1IA 3LC3A 3VB6A 4X1NU 1TAWA 1SGIB 2JH5D 4NSYA 1Z8JB 1O33A 3QGNB 3S0NA 1UTJA 3SN8A 2Z9LA 1C5VA 2CMYA 4OS7A 1NM6A 3DSOA 4DOQA 3S7KB 1GDUA 4I8LA 1AB9C 2BQWB 1TPPA 3KHVA 5T1VA 1TFXA 4HI3A 1P3EA 2WPIS 3WY8A 2P8OC 2FZZA 3F68H 1LO6A 3QZQA 2HGTH 1SOTA 1EP5A 3FAOA 2J2UA 2ANWA 2ZF0H 3DHKH 5A09A 1O2PA 5KECA 3Q3XA 1Z7KA 1C2FA 1W2KH 1VCPA 2UWLA 2V0BA 3PMJA 4OS5A 2ZDVH 3CS0A 1QHRB 2FESH 4WH8A 2GT8A 1OWEA 3N7OA 1A0LA 4XRNA 3FOAA 1BQYA 2FXRA 1C1QA 1LHCH 1CHOG 5GJ4B 1EXFA 1J15A 1ARCA 1D3QB 1SQTA 2W3IA 3VB7A 4CHAC 2OCVB 2ZIQH 1O3HA 2NWNA 4TPYA 3SUFA 3UUZA 3ATMA 2QE7D 1YPLH 2FOBA 2RA3A 3BG4B 2R2WU 4BXSA 1BTPA 1DY8A 2BY7X 1UCYK 2ZCLP 3FZZA 1W8BH 1CU1A 1HAGE 2BZ6H 3QWCH 1AHTH 2ZFPH 4NWKA 2WUCA 1W0KD 1T4VH 3TVJB 1ANEA 1UTNA 1C5PA 4MPWA 4K8YA 2TIOA 4F55A 2C93B 1BMMH 3A84A 1KYNA 1TOCB 2F9OA 3RXRA 4CBNA 1RIWC 2F91A 1YWUA 1FUJA 4X1RU 4UONA 4HZHA 1P2NA 3F9EA 1CQQA 2J97A 2SGDE 2QF5A 2ZDKA 4K1SA 4B74A 6CHAC 1O2OA 3BIVH 1AUTC 4B73A 1GBEA 4K69A 2F9NA 2ZTXA 5AFZH 1T8NA 2GVFA 4X1PU 3A89A 1LHDH 3ZZ6A 2KCAA 2OD3B 4ABBA 1G30B 1SMFE 1HAHH 1EZQA 1K21H 1DFPA 2ZU1A 1ZTJA 5DGJA 1ELBA 5LPEA 1O3EA 1O2TA 2ZGHA 3P8OA 4A1VA 2R3YA 2ZCKP 2LELA 4Q2KA 1WQVH 1SL3A 3FO8D 2WSSD 1AFQB 3FZDA 3M61U 4WVPE 3ZZ8A 2VIDA 1PQ7A 2TGPZ 3K6ZA 1TRMA 2ZU4A 2FI3E 1CHOF 1OOKB 1KSNA 2Q6DA 3MMGA 4DURA 2C8YB 2ILNA 1C2KA 1PPCE 2OBQA 4OS4A 2M2AA 3DFJA 4KKDA 2AFQB 1OP0A 1P06A 2QYIA 1HDTH 3I29A 3M7QA 1O34A 2ZPSA 3VB5A 1LPKB 4X6OA 4FU7A 4FOUC 1SFQB 4HFPB 4OS1A 4BTUB 3ZVAA 1RXPA 1O3CA 5HGGA 4FUBA 2ZHEH 1O35A 1B0FA 2WV5A 3R0FA 2Z94A 1CSOE 1LCYA 3V0XA 1S5SA 1SQOA 2DUCA 2LNCA 3EYDA 2OUAA 3RXAA 5T6GA 2P59A 2TRMA 5GCHG 4ABAA 1KTTB 1WUNH 3SNDA 1C4Y2 1H9IE 3EE0B 5DO4H
chains in the Genus database with same CATH topology
1L2EA 1DWBH 4OS2A 2D2DA 2DE9A 3UR9A 5EU8A 3T25A 3P8FA 2JH0D 1EASA 1P2MA 1MU8B 1HJAB 2ANMH 2F9UA 3EAJA 1UHBB 2PHBA 2P93A 1A0JA 3BTQE 4AB8A 8KME2 3TGKE 2I6QA 3PLBA 4KTUA 1O36A 1WV7H 1E34B 1IOEA 1GJ8B 3GYLB 1JRSA 1ZJKA 4CH8B 1FIWA 5ABWA 4NIVA 1GI2A 2GTBA 3ZV9A 1T7CA 4MNYA 1JXPA 1Z6EA 1O5FH 1SI5H 1WOFA 2GCTC 3QK1A 1CGIE 3OTJE 4WH6A 1QY6A 3UNQA 1GHAG 1O2ZA 3BV9B 5AF9H 1ZRKA 3SNCA 1B7XB 3ZYEA 1LPZB 2AMPA 3MH6A 1HNEE 1CA0C 1BITA 5DP8A 2IOTA 4TY7A 3IITA 1QBOA 3E90B 1TQ0B 2VH0A 2ZHFH 2C3SA 3MI4A 1MTSA 2RDLA 1K1JA 4AFZA 4Q80A 2Z3DA 2OC0A 5G4BA 1HBTH 2A7JA 1XUGA 1P2KA 4MQAA 1C2IA 1QRXA 1ANCA 1E35B 1UTQA 4CH2B 1AO5A 3D23A 1HAVA 1ZZZA 4JYVH 3PMAB 1GJ6A 1QBNA 1THRH 4FVBA 4KTSA 2GKVE 2ZEBA 1XM1A 1C4U2 2JETB 3TK9A 3OYPA 1AVWA 1EPTB 4GAWA 2THFB 3SJOA 8LPRA 1NN6A 1P02A 1ZR0A 2A4RA 1XUFA 5EQRA 2Z9GA 2HNTC 1W0YH 2WYJA 4Y71A 4SGBE 1S6HA 1DDJA 1Z71A 3A80A 2VVUA 1V2PT 1O2VA 3UFAA 4Y7BA 3RMLH 3P6ZB 1C5UA 3PMHB 4ZKOU 1AB9B 5DG6A 1P2IA 2BD7A 4B2CA 4JZFH 1V3XA 4WWYA 1A61H 1NRSH 2B5TB 2P8OB 3V13A 3A82A 4ZHLU 1GHAF 1A5HA 4XBDA 5DKMA 1OWJA 1FAKH 3ENSB 2Z9JA 1C5WB 3RXFA 1TPSA 3KQDA 1FONA 4DJZB 1ACBE 3QTOH 3LH3A 1G3BA 1U6QA 3VPKA 3VB3A 2AYWA 1YKTA 4GSOA 1GVZA 3RC5A 1BA8B 1MQ6A 4H6SB 1Z8RA 2R2MB 1FY5A 2C8WB 4ISNA 1GHXH 2BVXH 1KXFA 1OS8A 1BMAA 4INLA 2J92A 1F5RA 1NFYA 4Y8YA 2XNIA 1XUJA 3F1SB 1RS0A 1SVPA 4CHAB 5EPYA 4YO9A 1V2WT 1G37A 1AD8H 1VGCC 1FLEE 3JZ1B 4FUCA 1D4PB 5EPNA 1ESAA 2GZ8A 1BUIA 1TNIA 3BTFE 5EG4A 2SGFE 1Y5UT 5ESBA 3LKWA 1LPGB 3JZ2B 4DW2U 4WMFA 1O5AB 2GMTC 2PR3A 1H8IH 1DXWA 3OY6U 2UWOA 2FPZA 4ESTE 2QAAA 1W7XH 1P04A 1RIWB 2OC7A 4HTCH 1DVAH 2BDCA 1YYY1 4FUFA 2P3TB 3SUGA 2BM2A 4Y8XA 4K1EA 6CHAB 2WPJS 3MU1A 1K9OE 1QJ7B 3ZZBA 1P2JA 2G52A 3PO1C 3QLPH 1JIRA 1RTKA 1O2SA 3TIUA 1EJAA 1TABE 2EEKA 2B9LA 1HJ9A 3DUXH 4JYUH 3P92A 1BTHH 4ZXYH 2STAE 2PKSC 4Z0KA 1GJ5H 3SU1A 3LGWA 4HGCA 1GHBG 1OPHB 1CBWC 1GBFA 1MTWA 4KP0A 5AHGH 4YT7H 5GDSH 2VWOA 2BD4A 1QJ1B 2G4UA 3S9BA 1CO7E 2O8WA 4NFFA 2V35A 1TMBH 1ZSJA 3U1IB 2R3UA 4NZLA 3SQEE 2ZU3A 3BN9A 5LH8A 2FOHA 4X2YA 3L6PA 1AIXH 1ESTA 3MU5A 1EZUC 4DGJA 4MPXA 3O8DA 1MU6B 2OQUA 3HGNA 1C2GA 1MAYA 3LGTA 1ETTH 2BTCE 4ABGA 1GVKB 3LGUA 2Q1JA 1LQEA 1INCA 1O31A 1VITF 4TYDA 4RKJB 4I31A 2FOGA 3E0NB 1P8VC 3F9GA 1GJDB 1AUJA 1ZGIA 2YNBA 4IMQA 4THNH 3T62A 3AAVA 1TWXB 4BTTB 1ANDA 5GIBA 2H1UA 4Y11E 2CHAB 4ABIA 3QN7A 3ZYDA 1EOJA 1ZPCA 2ZFRH 2BDBA 1SGQE 3RXJA 3SJKA 1OX1A 2Z9IA 4NIWA 2WINI 3H7OA 1FJSA 3V3MA 1ZMLA 4J2YB 1HLTH 2PKAA 4U2WA 4GLYA 2A5IA 2F9BH 4FVDA 1NY22 1KTSB 3SNBA 1GBIA 2G8TA 3I78A 4WF8A 1UTKA 1DE7H 2EI6A 4A1XA 2FOAA 1KY9A 1FDPA 1G3EA 3TITA 2G51A 5T6DA 1GHBF 4CRBA 1F92A 1MQ5A 1P05A 3EA7A 1NRPH 2D26C 2ALPA 1T8MA 3LGVA 4LOYH 1UVPA 1YLDA 1D3DB 1Y3WA 3PTBA 2WPMS 2GCTB 1A2CH 1TMUH 2OC8A 5FPSA 4CRDA 2VU8E 3UR6A 1E0FD 3EA8A 1ZTKA 2AH4X 4K60A 1NRRH 1Y3YA 5C3NA 1CHGA 4F4OC 4IC5A 3FVFB 7ESTE 5FCKA 1CA0B 1F0SA 4H42U 4E7RG 2V6NA 3DT0H 5EXMA 2PGBB 2BD3A 1ZHRA 4CREA 2D1JA 3RC6A 3SU5A 1NC6A 3DA9B 1W12U 1EOLA 3SORA 1Y3VA 1GI4A 1J17T 5A0CA 1BRCE 1C5MD 3RM0H 5EXLA 3P8GA 1PYTC 2ZWLH 3BEIB 3DD2H 2ZDLA 4Y0YE 1LVOA 2ANKH 4O97A 1O2LA 2BDGA 2GD4B 1DICA 1XKAC 3K65B 1UTOA 1K1LA 1P3CA 2AGEX 4K5ZA 4O3TA 4UDWH 3A88A 1FY8E 3RXEA 1DWDH 1AZ8A 1UJ1A 1S83A 2WV4A 5DP3A 1O2RA 1QURH 3PTNA 2QGRA 1VITH 1GHYH 1Q3XA 1V2ST 1CE5A 1BZXE 2G55A 4XFQA 1SGFA 3HK3B 1A1RA 4UFGH 3SV2H 4E05H 1W14U 2Y7ZA 3T2NA 3M3TA 1V2KT 3MO9A 1TONA 2FM2A 1J9CH 2B8OH 3UOUA 1O2YA 1TA6A 1JRTA 2UUJB 2YOLA 1UK2A 4WXVA 3MH4A 2Y5HA 3PV4A 4INKA 4LZ4B 3NCLA 1P0SH 5E8EH 1LHEH 2ZHQH 4J1YA 3ATWA 4FU9A 4IMZA 1IQKA 2ZC9H 1SLVB 1A3EH 1PPBH 2J95A 1BRBE 3UOPA 4ABHA 1ZSKA 1DSUA 2OLGA 4JZ1A 3TNSA 4AN7A 3RXQA 1WBGB 3PWBA 1L0ZA 2SNVA 3E6PH 4ZHAA 1V2LT 1LVMA 3P95A 5C1UA 1D9IA 2VIOA 1SLUB 4RSPA 1VJAU 1BTZA 3RM2H 1UVSH 1GJ4H 1GPZA 1AFEH 3SUDA 1YPKH 3SV7A 1KDQA 1GWAA 1HAVB 1SOZA 2BDAA 3E0PB 4YESB 1S84A 3RXTA 1H8DH 3V7TA 1TPAE 2GZ7A 2XTTB 1IQLA 3TK6A 2VIPA 1W0ZU 2XBYA 5EW1H 2Y7XA 1TNGA 2H9TH 3LOXA 2P3FH 1O2KA 1ZSLA 1M9UA 1SGTA 5C5OA 1GI9B 1K1MA 2VWMA 2KAIA 1QTFA 1G2LA 4X6NA 3RXLA 4AFUA 2BY8X 2FOEA 3BEUA 3ZVFA 1FY4A 1BRUP 3BTTE 1BJVA 2TGDA 1UTLM 1VCWA 1ESBA 1ELCA 1O3KA 3BTEE 4Y7AA 4CR5A 1C1NA 1ABIH 3C1KA 1BMLA 1NZQH 3ZZ7A 3PO1B 2BD5A 3ZZCA 1C5ZB 1E38B 2V3HH 1TX8A 3UPEA 2GV7A 1TGBA 2CF8H 1D6WA 3RMOH 3STIA 1O3NA 2PKSB 3RXGA 3RXHA 1RD3B 3RXBA 3HKJB 1CBWB 4ZROA 3EGKH 1P03A 5JBBS 4MDSA 1S82A 3P70B 5C1XA 3NUMA 1YBWA 1GI0A 1PQAA 1CT0E 1L4ZA 2A4GA 1ZMJA 1CA8B 2TGAA 2CN0H 2BVRH 2HLCA 1Y59T 1GBJA 2VGCC 4YM9A 1TMTH 2ZPRA 4X8TH 1O3AA 3B23B 4DY7B 1QBVH 2O8UA 1RRKA 1LKBA 4IC6A 1PYTD 4X0WU 3KF2A 5HMAA 1TLDA 2A7CA 3TH4H 2SGAA 2BLWA 2F3CE 3EDXB 3PLPA 3GY2A 1SC8U 1K1PA 2FLRH 2W7UA 1YPGH 3KL6A 1RTLA 3KN2A 3MWIU 1QA0A 1K1OA 5ETXA 1IQMA 5E2OA 1HAYB 4OGXA 1CVWH 5JBAS 1DWEH 1EAUA 3GOVB 1P01A 1XUIA 2A45B 3GICB 4D8NA 2Y81A 4D9QA 4TY6A 1TYNA 1QL9A 1A5IA 2FLBH 3OU0A 1B5GH 4ASHA 1GHZA 2BOHB 1OKXA 3GY6A 1P57B 2HNTF 2ODYB 1H9LB 3MNCA 3SU6A 1YPHC 2HPPH 5C67A 4ZXXH 1PPHE 1YC0A 4AYYB 1GBMA 4KGAA 2Z3CA 1TGTA 1LDTT 5HXFA 2M5TA 1ZGVA 1AGJA 2H6MA 2A0QB 1E37B 1ZLRA 1C5XB 2PTCE 4ZUHA 1AKSB 3SI3H 3SW2B 5DJ7A 1NPMA 2GGVB 4I33A 2J94A 4BAMB 4BOHA 2FP7B 2B0FA 1FY3A 2HVXA 4WXIA 3SU4A 2XWBI 1AZZA 1O2IA 3KQEA 4GUXA 9ESTA 4B2AA 4MNWA 2BD8A 3LIWA 3KCGH 4GHTA 4UE7H 3BTWE 2H5CA 2H9HA 1K2I1 1EQ9A 1JBUH 2CXVA 4A92A 1TPOA 4O03A 5ESTE 2C8ZB 1XVMA 3F9HA 1O3MA 1C1UH 4NFEA 3A8DA 4BAHB 1DANH 1A3BH 2WPHS 1QRWA 3LJJA 6ESTA 2VVVA 2ZZUH 3E91A 2FOCA 1ETRH 1KLJH 1MTNC 3OY5U 2HALA 3A85A 2A4QA 1O2NA 1GBDA 3L3TA 1BTUA 2NU2E 1HJ8A 3BTHE 4NA8A 1AQ7A 2A2XH 2TGTA 2PKAB 2QY0B 1Z8IB 1SSXA 3MNXA 1AWHB 1HYLA 1YM0A 2ZGJA 3DFLA 5GPIB 1CT2E 4AB9A 3K6YA 3TPIZ 4ZH8A 1IQJA 2FTLE 1O3DA 1EATA 1CT4E 2BD9A 1GL0E 4TWYA 1O3PB 1A0HB 1THSH 1FXYA 1GI1A 1GJCB 2BDHA 2XBWA 3D62A 2A5AA 3UQVA 1V2UT 2BHGA 3GDVA 1IHSH 5DP5A 1Z8GA 1HAPH 3RMNH 1QRZA 4A7IB 3E1XB 2BDYA 1C9TA 3ZVGA 2CF9H 4ZKNU 1GDQA 1TX7A 4O9VA 2GZ9A 1IQNA 2ZU5A 1AWFH 2IJOB 2FEQH 3RXDA 1C5NH 4BANB 2I6SA 2UUFB 1HIAA 2VIVA 5A2MH 1F2SE 2RG3A 1EZXC 2NU1E 2ZFSA 5E0HA 1MZAA 1XUHA 3MNBA 5A8XA 1IQFA 1IQHA 2FDAA 2XCFA 1N6XA 1GHWH 1RTFB 3A81A 3VGCC 3Q76A 2A4OA 3A8CA 1JOUB 1EJMA 1WU1A 2ZTZA 3SUEA 1SGNE 4MNXA 1K1IA 2XBVA 3QTVH 1XXDA 5I46H 1V2RT 4YOGA 2XC0A 4A1TA 1PPFE 5K0HA 4GHQA 4Y0ZE 3ESTA 3HKIB 4JK5A 2XXLA 4BAKB 1S85A 1TNKA 3EA9A 2OINA 4RN6A 1UK3A 2GV6A 2QC2A 1P12E 1O3JA 1OXGA 2A5KA 1QQUA 1ZHMA 1FN6A 3M3SA 3E16B 2ZNKH 4D9RA 2ZTYA 1O0DH 1VJ9U 4ABDA 1PJPA 1ANBA 1NTPA 1Y3UA 1K28D 4DT7B 2BXTH 1PPZA 2ZQ2A 3SZNA 3OX7U 1TBQH 5JYIA 1KIGH 1HGTH 2G5NA 1VITG 3ZZAA 4M7GA 1BTWA 1GBKA 1L4DA 1HAZB 1MMJN 4I32A 2G00A 3HK6B 1EAXA 2AIPA 4NGAH 2BX3A 1PPGE 3HPTB 3LDXH 1SGDE 2JKHA 3I77A 3W94A 2A31A 2R9PA 1AVGH 3ZVEA 2RA0A 1W7GH 3TH3H 3M36A 4NIYA 4DCDA 3ZVCA 1YF4A 1C1RA 3SHCH 4R8TB 3R3GB 1YP9A 2JH6D 4ABEA 2FX4A 4XE4A 1UK4A 5FXLA 5JB8S 3E3TA 1QNJA 1GL1A 2NU4E 3CP7A 3MOCA 4YTAA 3MFJA 5HM9A 1MD8A 1V2QT 1KDQB 3T29A 4UFFH 1OSSA 1FV9A 2FIRH 1EZSC 2K1QA 2VGCB 5JDUB 1AN1E 2BQ6B 3UWIA 5A0BA 2PTNA 1HUTH 5HYOA 3O8BA 1GBTA 3TJVA 2PSXA 3GY8A 1EX3A 3IWMA 4XOJA 4X8UH 2A2QH 5CHAC 2KAIB 3SGBE 1J14A 4TWWA 1F0UA 2FMJA 3LGIA 5EQSA 1AU8A 4YLQH 3A87A 3TGIE 3QUMP 4YT6H 2XWAA 2SNWA 4AG2A 1V2MT 3SBKA 4X1SU 2HRVA 1F0TA 3BEFB 1TALA 1MKXH 4IW4E 1SGFG 1O39A 1N6YA 1OWDA 1G32B 1KXCA 1C1TA 4NG9H 7KMEH 1TB6H 5IDKA 3M5LA 1C2MA 1UMAH 2FWWA 1ZOMA 4IS5A 4Y76A 2QV1A 2J4IA 3LC5A 1KLIH 1TGCA 5C5NA 4YOIA 1C2LA 4XBBA 4F49A 1ZPBA 2FYQA 1AE5A 4UEHH 1V6DA 1SHHB 4UFEH 4DG4A 1G9IE 5JBTA 1SPJA 3SO3A 1MUEB 2VVCA 1XKBC 1NFWA 4FUDA 4IN2A 2J38A 2HNTE 5E0JA 4X8VH 1QL8A 3K2UA 4AYVB 1BCUH 1ELVA 1LMWB 1N8OC 3GY4A 3QGJA 4GPGA 2IN2A 1QA7A 2UUYA 1T4UH 1BJUA 2O8MA 2ZG0H 1F7ZA 1YPMH 5F8ZA 2ASUB 1L1NA 3U69H 4NCYA 1C1WH 4YZUA 1UO6A 3BTKE 1TNLA 4BTIB 4RKOB 3E8LA 2OQ5A 4WMEA 4XBCA 1HXFH 4XDEA 2R0KA 2QXHA 1G3CA 3LH1A 1C1OA 3ZZ9A 1L1JA 1C2HA 1EB1H 1XX9A 4NZQA 4SGAE 3GCNA 3SU2A