3PLPA

Bovine trypsin variant x(tripleile227) in complex with small molecule inhibitor
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGIYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3plpA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3plpA02
1KLTA 3OX7U 4ZAEA 5A0BA 1O2YA 1LPZB 5DG6A 3LGUA 4SGBE 1P2OA 1FPCH 4Y0YE 3EDXB 1S0QA 2JH0D 3ZZCA 2ANMH 2XRCA 5LGOA 1FY5A 3JZ2B 3SNCA 2ANYA 3Q00A 2ULLA 1P9SA 3LGYA 4Y76A 1SGQE 1BZXE 2IOTA 1ZGIA 1S84A 4XBCA 3ESTA 2FI5E 1UMAH 1V2OT 2BD3A 3ATIA 1ANEA 4ZH8A 2OP9A 1P12E 1TONA 1IQKA 2TRMA 2FOEA 4GPGA 2UWOA 1LHFH 1OWDA 3MWIU 1O2IA 1Q2WA 1D4PB 1O3IA 1C2EA 3PMJA 2ZNKH 1KXCA 2XC4A 2QF0A 1SLVB 4FU7A 1SHHB 2D2DA 3QUMP 3MOCA 1PYTC 2GCTB 2EA3A 5IDKA 1P2KA 1QL8A 3SJ9A 1P3EA 3OYPA 5DP9A 3K9XB 2VIDA 2ZTXA 4D9RA 1TMUH 3EQ0H 2ZO3H 4LOYH 2HPQH 4ABJA 4ABIA 1V2WT 1PQ8A 2XBVA 4X8SH 4WMDA 3UREA 1YKTA 2DUCA 1HAOH 4X2YA 3FP8E 2ZP0H 1HAHH 1V2PT 1V2KT 8LPRA 3K65B 1Y8TA 2QY0B 3L6PA 1EAXA 1V2NT 4NGAH 3MYWA 3LGTA 2QCYA 1ANBA 4YOGA 1FN8A 4BAHB 1PPHE 4X8TH 4IN1A 3PTNA 1SQAA 2C4FH 1MU8B 2UUJB 4NA8A 1VITH 4ZMAH 1EJMA 1ID5H 3K6ZA 1N8OC 2ZFPH 3TK9A 1XUJA 4K1SA 4DOQA 5FCRA 1YPMH 1MQ5A 3BTME 3ZVBA 4A1XA 1O39A 3GISB 3LH1A 2SGQE 3H5CB 1CHOG 1RTKA 3TNTA 2G5VA 4WXIA 1BTWA 4BXSA 2WPKS 3NXPA 1C5XB 2H1UA 4JZFH 4YOJA 1EJNA 1ZMNA 2B8OH 2H9TH 4KP0A 1AKSA 1Y5BT 1SOTA 1C1RA 1EASA 2H9HA 1IQFA 2Z9JA 2J34A 2BM2A 3KL6A 2BDBA 1GMHF 4BXWA 2FEQH 3S9AA 1OX1A 4KTUA 2ZDAH 2J94A 1H9LB 2F83A 1SI5H 3SNBA 4CRDA 3O8BA 1EPTC 2A7HA 3BTWE 4MVNA 5C3NA 1OS8A 1TA6A 5DP5A 2FWWA 1C1TA 1HPGA 3ZYDA 4OS5A 3SZNA 1RIWB 4X2WA 2FI3E 4FUHA 4JZDH 1GJ4H 1UTLM 2FO9A 3E1XB 3QDZB 2P3TB 1BTUA 3S69A 1LPKB 1UJ1A 1G2MA 1SGTA 1KY9A 2Y6TA 2XBWA 2FTLE 2SGPE 1A0JA 2D8WA 3PLBA 1GDUA 1H9IE 3HKJB 4A6LA 5ABWA 3TK5A 4IS5A 3BIVH 4X6OA 1RXPA 4GHTA 3KNXA 1HAVB 1WBGB 3VGCB 5C1YA 1NO9H 4ZKSU 2AGGX 3JZ1B 1ABJH 1V2MT 3DA9B 1RRKA 4AGJA 1TNLA 2AS9A 4ISIH 1XUGA 3A88A 1O3PB 1YPJH 1NRPH 2G4TA 3T25A 3KN2A 1XUKA 4K1EA 1VZQH 4DW2U 1L1GA 5FXLA 4XFQA 3SV2H 1ZJDA 2CMYA 2BZ6H 4AG1A 2ZU4A 1HBTH 1NU9A 2XBXA 2GV7A 3MMGA 1JIMA 5DO4H 2ZDNA 4WH8A 3S7HB 1T4UH 1UVTH 1T7CA 3ENSB 1HAXB 4CREA 2PTNA 2G5NA 2NU4E 4K60A 1KDQB 3P92A 1SGRE 5A8YA 2A4QA 1F0RA 1W2KH 4AB8A 1QRZA 1O34A 1NM6A 1UTPA 1LDTT 2BTCE 2AMQA 2VIPA 1VITG 3S7KB 1TRYA 1RTLA 1D9IA 2PSXA 3P70B 2WPMS 5FX6A 1AVGH 3U1IB 4MPVA 2Y81A 2TBSA 1DUAA 1K21H 3SJKA 1DM4B 3HPTB 3U1JB 1WYKA 1P02A 1SBWA 4F49A 2Q6FA 1A5GH 2P3FH 1L4DA 1SR5C 5E8EH 2BD4A 5I25A 4ABBA 1QIXB 1GI2A 2WV5A 2P16A 5DPAA 1SC8U 3W95A 1AGJA 3LIWA 2A7JA 1DXWA 1VGCC 1LVBA 4AB9A 1PPFE 1W10U 2TGTA 2BQWB 4X6PA 4HTCH 1AVXA 1J8AA 1BA8B 2SFAA 1TIOA 1TNGA 3QK1A 3SJIA 2XCNA 4UDWH 3P8OA 4Y8YA 3ZVCA 1ETSH 1YPEH 4E7NA 1GJ9B 3MH6A 1QY6A 4I8HA 3SV6A 1TPOA 1HDTH 1TA2A 1A46H 3D23A 4AFSA 2GX4A 3N7OA 1HFDA 2NU2E 1TFXA 2GZ9A 2BDCA 1RJXB 2SGAA 4I31A 4DIIH 1TBZH 5BRRE 4ZHMU 3LH3A 4DVAU 3FFGA 2J38A 3MU4A 4IC5A 4DY7B 1ZJKA 2QA9E 1AVWA 3PYHA 2HNTE 1C5MD 1S6FA 1G3BA 4CR9A 3VB5A 2OQ5A 3MNBA 3PO1C 4IW4E 1BTPA 2WINI 1VITF 2GTBA 2FMJA 2M5TA 1W8BH 1NN6A 3E6PH 1V2JT 2JKHA 1GGDC 3TGKE 1LPGB 1KXEA 3OY6U 1OWEA 3I77A 1DY9A 2ZU2A 3ZZ8A 2FODA 4XSKU 1ZGVA 2FYRA 4CBNA 1HAYB 4YM9A 2R9PA 4NSVA 4WF8A 3PMHB 3RP2A 1GJDB 1J15A 1GJ6A 2G81E 1LQDB 3MNXA 1OPHB 1DVAH 1NU7B 1SG8B 3NKKA 3RMNH 2XYAA 3SQHE 3EA8A 1CA0C 1VJAU 1MTUA 5JPMH 2BY6X 2CF9H 1ABIH 1O5GH 1V2QT 1ZHPA 3SNDA 3FP6E 1LQEA 3Q77A 4JYVH 3KQEA 1B0EA 5DP8A 1LHCH 2HWLB 2BY8X 4DURA 1Y3UA 1ZPZA 2ZEBA 1NRNH 4AG2A 1FMGA 2WPIS 1O2WA 2P8OB 1GHAG 3KHVA 1F0UA 5F03A 2GP9B 1CBWC 1HJ8A 5FPYA 2O8LA 3A87A 1SQTA 1T8NA 1KLJH 1KYNA 1SVPA 1TNIA 1ZPBA 2Z94A 3UQVA 1EZQA 1K1MA 1TX6A 4O03A 4KTCA 1C2FA 2OBOA 1C9TA 1AWFH 1GI8B 2Y5FA 4O3UA 1H1BA 3ATLA 4ABDA 2J92A 5L6NH 1C2LA 1O3BA 1O33A 1DSTA 3SBKA 4BNRA 1C4Y2 4OGYA 5EPNA 4GCHG 1O5AB 3UNSA 1O3CA 3RXJA 4CBOA 4YLQH 4AYVB 1FZZA 3SV8A 1OXGA 1SHYA 1GVKB 1E34B 1ZLRA 2BDYA 2C8WB 5DJ7A 2JETB 1AUJA 1BTZA 5JB8S 1NROH 2VJ1A 3V13A 1TNJA 1FIZA 1F5KU 5E2OA 6GCHG 3UOUA 4Y7BA 5EQSA 1B5GH 2FLRH 2IPHA 2O8UA 3SO3A 2Z6BD 3UQOA 3QLPH 1P06A 4B75A 2BD9A 3LPRA 4X1RU 3PM3A 3NWUA 1NT1A 2ZGHA 5BPEA 2B0FA 3R0FA 4ZROA 3P95A 1BRBE 2SNWA 3UR9A 1INCA 1WAYB 2VVCA 1MCTA 1BMAA 1GBTA 1ZSJA 2VVUA 1HJAB 2FOGA 1O30A 2OBQA 1P04A 1FN6A 1N6XA 3P6ZB 2WPHS 5CMXH 1BCUH 1C4U2 1EOJA 4Y10E 1KTSB 5TCAA 3LC5A 1C5UA 1O2UA 2ZCHP 4B74A 3UFAA 6ESTA 1VCWA 1YBWA 1H9HE 2B9LA 2VWNA 3H7OA 4M7GA 4MPUA 3U8RH 2PKAA 5CHAC 4AFQA 4Z6AH 3RXAA 4D7FA 1Y3WA 3TH3H 2F9VA 2SNVA 1SGIB 1P11E 1FI8A 3RXRA 4X2VA 1SL3A 4IN2A 4IMQA 2VVVA 3SV7A 1C2HA 1WCZA 1UCYK 3V0XA 2BD2A 3NZIA 1GI4A 2HLCA 3A80A 3GCTG 3M5LA 3OTJE 1VCQA 2IN2A 4SGAE 2FZZA 2O8WA 1XXFA 4YLUA 1QA7A 4BTTB 3S0NA 3Q3XA 1TB6H 4BANB 3TNSA 3GCHC 3A85A 4Y71A 1PYTD 1YF4A 2BQ7B 3RDZA 2G8TA 1ESAA 4U01A 1GI5A 1OWHA 1MZDA 1BRUP 3MU0A 2QV1A 4Y0ZE 1O2NA 2GD4B 1TNKA 1JBUH 2ZHDA 5DP7A 5T6GA 5SGAE 1ETTH 2ZPQA 1MZAA 1BMMH 5TCCA 4I7YH 5AFYH 3U69H 4CHAC 1GG6C 1FLEE 3S9CA 2H5CA 2GV6A 1NS3A 2OC1A 2ZFTA 3VPKA 4RSPA 1C2IA 1ZTKA 2ZDKA 4LZ1H 3FZDA 3FANA 1DWDH 5HYOA 4K1TA 4WXVA 2ZA5A 5JDUB 3A7YA 2G55A 3Q76A 1V2RT 1T4VH 3RXLA 4YTAA 2UUYA 3GYLB 3TJUA 4ABGA 1Z71A 1NRQH 3TLOA 2VGCB 1UHBB 2ZWLH 1J16A 3ZV8A 1SPJA 1Y5AT 3I29A 4OS6A 3F9GA 4GAWA 1AFQB 2PKSC 1AWHB 1CT4E 1LHDH 1RGQA 1A61H 1GHWH 2PLXA 3UUZA 1CT0E 1O2XA 1SLXB 1F92A 3SU2A 3K2UA 2O9QA 1YCPK 3NK8A 1C5NH 1P9UA 1YYY1 1GBBA 2ODYB 4NIXA 1DXPA 1FJSA 2Z3CA 4CR5A 1XM1A 2B5TB 2VWLA 4GLYA 2RG3A 4A7IB 1L0ZA 2PTCE 5I46H 1O2TA 1ZRKA 1HGTH 3A81A 1FUJA 3QWCH 2ZCKP 1YM0A 2ZECA 1ELDE 1W12U 2ZGJA 4INLA 1SGEE 2O8TA 2KAIA 2GKVE 1UCYH 2NWNA 2QYIA 3ZZ6A 2R0LA 5EODA 1IHTH 2RA0A 4UEHH 1GVZA 3RXOA 1PJPA 2FOFA 4D76A 6CHAB 2BLQA 5IYTA 1O2OA 3RLYH 3AW0A 1QR3E 2GMTC 1TGCA 3BIUH 2LNCA 3STJA 1W13U 3STIA 1GJAB 1W0YH 1FDPA 1MU6B 1MKXK 2ZDMA 3LGWA 2ZHWH 3F1SB 4NIVA 2J4IA 1GBHA 5DP6A 1EP6A 1F2SE 2ILNA 4TY6A 5F8ZA 1XX9A 1W0ZU 4YO9A 3ZYEA 1UHBA 1C1PA 3RC4A 1T32A 5F6MA 4OS1A 1NTPA 3GY3A 3VFEA 2ZFQH 3M7TA 5FPSA 3NPSA 1UTJA 3QX5H 1YPHC 2XC0A 2EEKA 5TJXA 4UFGH 1ESBA 2AGEX 4JZ1A 1BOQA 1YGCH 2NU1E 4XE4A 3HATH 5GJ4B 2VB0A 2D26C 1QBNA 1TGBA 1WU1A 2ZF0H 4ZXXH 3T2NA 1MAXA 3SW2B 1TMTH 1TBRH 1F0TA 1Z8GA 2BB4A 1BJVA 1AZ8A 1DOJA 4K5ZA 4TY7A 1TWXB 1GI7B 1O2ZA 1KXDA 4I33A 4RN6A 1AN1E 2EC9H 4VGCC 3LGIA 3HK3B 1AMHA 3E8LA 5C67A 4NA9H 1AU8A 1IQEA 2I6SA 2FOBA 1OP0A 3A86A 3LT3A 1MTNB 3BEIB 4MNWA 1ZYOA 1C2DA 3CS0A 1EX3A 2XWBI 3A83A 1AI8H 3ZV9A 1GBCA 2FI4E 3ZZ9A 4KGAA 4WH6A 1HAPH 5JBTA 1OWJA 2QIQA 4GVUA 2EI7A 2H9EH 4K69A 1G3DA 1IQNA 2F9NA 2GT8A 3SU5A 1GCTC 2FDAA 4Q2KA 2BXTH 3Q3YA 1EAWA 4NCYA 1YCPH 2Z9LA 1ZHMA 4GHQA 5EG4A 1L4ZA 4JCNA 1UO6A 1AB9C 5J4QA 1V2ST 4JMYA 1E36B 1W14U 4NFEA 2Y82A 4NWLA 3CS7A 2YOLA 2CGAA 3KEEA 1C5VA 3RC6A 1ZSKA 1HXEH 2OQUA 2ZHEH 2VNTA 3MO9A 1CO7E 1ORFA 4NIWA 2OC0A 2XNIA 5HM9A 1DX5M 2XXLA 1Z1JA 5JB9S 4B76A 2ZPRA 2GZ7A 2BD8A 4X1SU 3L3TA 1OWIA 3IITA 3RMMH 4ISNA 1CHOF 4OS2A 1W7XH 4FUIA 2C93B 1EZXC 4O3TA 5EU8A 5A8ZA 1Q3XA 2FOMB 1BJUA 2P3UB 2FS9A 2CJIA 1VJ9U 1ZSLA 1XVMA 3E91A 2ZFFH 4GSOA 1V2VT 3SJ8A 1EAUA 4AORA 3BG8A 1G3EA 2AFQB 3MU1A 1HJ9A 1CU1A 1F5LA 1MKXH 2Z3DA 1A4WH 4I8GA 4KKDA 4JK5A 2G51A 1BRAA 1KTTB 1GI9B 2A2XH 3M36A 2BQ6B 2XWAA 4X1PU 3U9AH 2PR3A 1J17T 2F9UA 4FUGA 1AE5A 3ODFA 2A4OA 1NFYA 1VR1H 1QHRB 2Y7ZA 2CHAC 3NUMA 2ZTYA 3SU3A 4CRCA 4PROA 4INHA 1KXFA 2HNTF 1UK3A 1UTMA 5ESBA 3SV9A 4X1QU 1HB0B 4O9VA 1TGSZ 3W94A 3ZZAA 4R0IA 5DKMA 1SGCA 4CRBA 1O5CB 4K8BA 4CRFA 3RM2H 2R3UA 4NZLA 3P8NA 1WSSH 1PPBH 2G4UA 3M3VA 1PPGE 7GCHG 3KQCA 5EXLA 3E0NB 4WMEA 2BOKA 1O3FA 2F91A 4GUXA 4NA7A 1AFEH 3RXPA 1Z7KA 4QT8C 3FZZA 2BXUH 4XOJA 1C1MA 3AAVA 2XBYA 2F9BH 2ZU3A 2PSYA 1UTKA 1FV9A 1MUEB 2OTVA 1HAVA 1GCDA 4ASHA 1LVMA 1WQVH 3LJJA 2V3OH 1EKBB 1O0DH 4E06H 1A3BH 5K0HA 5LPEA 1WV7H 2BMGB 2HOBA 2D1JA 1D3PB 2O8MA 1K28D 3PB1E 1OSSA 3RM0H 1DPOA 3MI4A 1HAZB 2J95A 4AZ2B 3A82A 5GDSH 1DWBH 1DWEH 5AFZH 1J9CH 1L1NA 1LMWB 1JRSA 1TQ7B 2OD3B 3MH5A 3V3MA 1AHTH 1CGHA 2TGDA 4Y79A 1ELTA 1HIAB 2BZAA 3A7TA 3URCA 5E2PA 1DSUA 1EP5A 1PQ5A 4X8VH 4H6TA 3SU0A 3SOSA 1C5WB 1C5TA 3NCLA 1G36A 3RU4D 3TPIZ 3V12A 3PLKA 9ESTA 1BTYA 3BTQE 3TK6A 2BX3A 4LXBH 1AE8H 2BOHB 2WPJS 2G00A 3VXEH 1SQOA 1TPAE 1KDQA 1YP9A 3K6YA 4X2XA 3RC5A 1ARBA 5HMAA 1QRXA 1NESE 5AHGH 1C5PA 4YESB 1P2MA 2A32A 1XKBC 2VU8E 1G9IE 3CP7A 1W3CA 3BEFB 2OC8A 1S83A 5G4BA 2Q6DA 1ZZZA 2BDGA 2B7DH 4I8JA 4I8LA 1TPPA 4Y8ZA 3UWJH 5HM2A 1ZMLA 4JZEH 8GCHG 1QNJA 1V2LT 3M5MA 1WQSA 2BX4A 3MTYA 3SI4H 4A1TA 2GCTC 2LPRA 3D65E 1IHSH 3QZQA 2HVXA 1ELCA 1CVWH 1GHVH 1YC0A 2AIPA 2FXRA 2ZKSA 3SNAA 1UCYE 3A84A 1TAWA 2C8XB 3GOVB 2AMDA 3MU8A 4D8NA 1OOKB 5FBEA 1B7XB 2A1DB 3D49H 7LPRA 1GJBB 2FESH 3S9BA 1P57B 1C1UH 3LDXH 1D6WA 2FOAA 1N8OB 1NZQH 4UFFH 3SNEA 1LHEH 2C8ZB 1K1IA 4UFDH 4CH2B 2CN0H 3EE0B 2FYQA 3ZZDA 1MTVA 2H2ZA 5J4SA 1YCPM 1QGFA 4DGJA 4X6MA 2VIVA 1H8DH 1DITH 5E0HA 1MBQA 3RXQA 1GBAA 2ANKH 4D9QA 2P94A 2V3HH 1C2KA 4YZUA 1JWTA 1P05A 4A92A 4FUCA 1V2TT 3QZRA 1HAGE 1C1WH 3GCOA 1WOFA 4TWYA 3SU1A 5DP4A 1O2MA 4ABFA 3ATWA 4JZIA 4Q7YA 3GYMA 5CE1A 3ZVFA 4WMFA 3LC3A 2A4GA 2AH4X 2JH5D 3DFLA 2PGQB 2R2MB 1EPTB 1O3AA 2OUAA 4K8YA 3GY7A 1K22H 2PHBA 2GCHG 1K1NA 2ALPA 1A5IA 3LKWA 4FUEA 2A45B 4CH8B 3I78A 2H5DA 1BRCE 5GCHG 1TOMH 2BDIA 1MQ6A 1TGTA 3RXMA 3ZZ5A 3BTKE 1GHBG 1GBLA 3QGNB 3MH4A 2P59A 3BV9B 3QO6A 1BDAA 3SHCH 2TPIZ 4BAOB 3TJOA 1UK2A 1GMCG 1ZR0A 3OU0A 2ZQ1A 4UD9H 2A31A 1TX8A 1TNHA 2W26A 1FY8E 3P8GA 4MPXA 5EW1H 1O5BB 2CV3A 2Y5HA 4MNXA 3PTBA 2ZHFH 3GDVA 2DE8A 1BTXA 1S6HA 3V7TA 1O3NA 1D6RA 1L2EA 2FX4A 1O3GA 1QB6A 1Y3VA 1FXYA 1HCGA 1UVUH 5JBCS 2F9PA 1RIWC 2R3YA 1K1PA 4RKOB 1EUFA 3MH7A 2VWMA 2WYJA 1GHAF 1A5HA 3RXCA 2WV4A 2FM2A 1E37B 1MCVA 2A7CA 1C5RA 3GY4A 1TMBH 2FOHA 2FX6A 3QN7A 4HZHA 1BITA 1O2VA 1SGPE 4BTIB 2ZPSA 5LPFA 1AO5A 1BT7A 1MKWK 3M35A 1BMLA 4AN7A 1GBEA 1ELVA 1O2RA 3EA7A 3ZVDA 3BN9A 3A8DA 3UTUH 3TGJE 2Q6GA 2J2UA 3BTDE 4D7GA 2QXJA 1O37A 2ZIQH 1O3LA 2ZFRH 1O2GH 4E05H 1GJCB 1RTFB 4GCHF 5L2ZH 1BHXB 3VGCC 3HGPA 3RXDA 3UPEA 2ASUB 1NRSH 1C2GA 4HFPB 3SGAE 1SGNE 4ABAA 3LJOA 1QBVH 3RXTA 2GCHF 2I6QA 6GCHF 1WTGH 1C5YB 1X7AC 3DFJA 4FUFA 4DJZB 1GI6A 1EZSC 2C8YB 5GCHF 1SLWB 4OS4A 4NWKA 5HXFA 1QJ1B 4MTBA 1O31A 4LZ4B 2BYAX 3LONA 1P03A 3OY5U 5GXPA 1PPZA 5ETXA 1GMCF 3RXGA 1ESTA 3BF6H 3TH4H 3Q3KA 1F5RA 1XKAC 2ZGXH 3IG6B 4JK6A 4THNH 2Q1JA 4RKJB 2Y7XA 1GHXH 1O2HA 1PFXC 1MAYA 1JXPA 1LVYA 1NFXA 1IAUA 4FU9A 4Q7ZA 1Z1IA 4IGDA 2W5EA 3EAJA 4Q80A 3GDSA 1B0FA 4TPYA 1SB1H 1G37A 5A0AE 4Y8XA 1QQUA 1TBQH 3A7ZA 3T26A 3O8DA 1VGCB 3TH2H 1QCPA 2P93A 1H8IH 3VXFH 1Z6EA 3ZZ4A 2ZCLP 3DHKH 4NG9H 1P8VC 5F8XA 2ZGBH 3BG4C 4INKA 1LKBA 1T31A 2ZDVH 3SUGA 3VB3A 1Y3XA 3A89A 4YT7H 1EOLA 3RXHA 1O5DH 4ZKRU 5GIBA 4X0WU 2AIQA 1H4WA 1GHZA 3ZVGA 4X6NA 1AUTC 1QQ4A 1L1JA 3QGJA 1G2LA 5LH8A 1Y59T 5DGJA 1HXFH 3GCTF 3GDUA 4AYYB 1SGFG 1QJ6B 1HAIH 1G30B 2TIOA 5JYIA 1ZMJA 3WY8A 2A5IA 2C90B 1SGYE 1O2LA 4O97A 5EQRA 2THFB 4I8KA 5A8XA 3SUDA 3A7XA 1ETRH 1O3OA 1KLIH 3T28A 3SHAH 4B71A 2ZZUH 3M5OA 4FUBA 1W7GH 2FTMA 1A0HB 1IQHA 2XC5A 3T29A 5AF9H 3M37A 1IOEA 4FVDA 3LOXA 3PO1B 1DT2A 1XVOA 3T5FH 4WY3A 5EPYA 4BAQB 5B6OA 1IQIA 5A09A 2PUQH 4ABEA 3F9FA 1IQJA 4B2CA 1O2KA 2QXIA 1GGDB 1MKWH 3B23B 3O8RA 3SU6A 5JBAS 1GHYH 3RXFA 2HALA 1AKSB 3HK6B 2CXVA 1S5SA 2PUXB 3FVFB 3RMOH 2OLGA 3ELAH 1XUIA 2Z9IA 3AASA 1S82A 1EAIA 2ZDLA 2V35A 3GCNA 4OGXA 1YLCA 1C1VH 1CA0B 4AOQA 3UIRA 1GL1A 1MD8A 5L2YH 1GMHG 2HNTC 2WUCA 1MBMA 4FUJA 3MNSA 1OYTH 1A2CH 3BTFE 1BB0B 1T8OA 4Y11E 1TPSA 1NFUA 1FY3A 1BUIA 1BBRH 1C2JA 1Y5UT 4LK4A 2QC2A 1NC6A 3PWCA 2NU3E 1V6DA 2Z9GA 1GJ8B 3MO6A 3UNRA 1LCYA 2A4RA 1CHGA 1K1LA 4A5TS 1G3CA 3C27B 3MHWU 4TWWA 1ARCA 1CBWB 3T27A 1F0SA 2TGAA 2PV9B 4U32A 1ELGA 1GVLA 2A5AA 4ISLA 1N1LA 1LHGH 1C9PA 3ZVEA 4AGKA 2VIOA 5K7RA 1FY4A 1P09A 5T3HA 1LTOA 3KCGH 2HPPH 3UR6A 4F4OC 1FAXA 3HGNA 1SFIA 7ESTE 3RU4E 1S0RA 1EXFA 1OYQA 1GMDG 1PPEE 1WUNH 3TJNA 1SGDE 1C1QA 2OINA 3GY5A 4FVBA 3GY8A 2Y5GA 1BTHH 1JOUB 2ZTZA 1D3DB 2BDAA 1O3MA 2A0QB 1DS2E 2WPLS 2K1QA 2P8OC 2GVFA 1THSH 1HNEE 2UWLA 1O2QA 4IC6A 2AERH 1O35A 1W11U 4MQAA 3TGIE 1TE0A 2VWOA 3H7TA 3E90B 4JYUH 1FQ3A 1FONA 1C1NA 4YT6H 3TIUA 5FAHA 2JH6D 5GPIB 3ZZ3A 1CQQA 1O36A 5HGGA 3SN8A 3VB7A 2WYGA 2AGIX 1O5EH 4XBDA 1FIWA 2YNBA 1RFNA 3MU5A 1KXBA 1TRMA 2ODQA 3BSQA 3QTOH 3U8TH 1SMFE 4HGCA 1OP2A 1UVOA 2PGBB 3CENA 4CRGA 3FP7E 1JIRA 1HUTH 5T6DA 3TJVA 1AZZA 2JETC 2PWXA 2W7UA 1UTOA 3B9FH 3RMLH 1O2PA 2BDHA 1AY6H 2BD7A 1UTQA 1BIOA 1DICA 3AW1A 2BVXH 1CA8B 1A7SA 3GICB 4MNVA 1GBFA 2V6NA 4AX9H 1Z8IB 5E0JA 1HV7A 4ZUHA 1JRTA 2R0KA 4A1VA 1O3HA 1MH0A 2SGEE 3DUXH 5FHTA 2DE9A 2C3SA 1O3DA 2GGVB 3EA9A 5CHAB 1SSXA 4K2YA 2QXGA 2BY9X 3UOPA 3SI3H 3SORA 4ZXYH 1QB9A 3URDA 2J9NA 3QTVH 1BMNH 2GT7A 3LU9B 2W3IA 3M61U 1GMDF 4BAKB 1K1JA 2NU0E 5FBIA 2P95A 3IWMA 1HJAC 3PROA 2ZI2H 2PFEA 1THRH 1GI1A 3M5NA 3P17H 4Z0KA 1QURH 4IBLH 3U8OH 2PW8H 5T6FA 1IQLA 1GI3A 3A8BA 2Z7FE 3T62A 2FS8A 1ACBE 3SGQE 1RS0A 4BAMB 3GCHB 2GDEH 1HRTH 2XTTB 7KMEH 4X8UH 1C1SA 5PTPA 3AVZA 2BD5A 4BOHA 4BTUB 1SLUB 2EI6A 3E3TA 1BQYA 3AAUA 4DIHH 1Q31A 3F6UH 3M7QA 2ZG0H 4DCDA 2BY5X 4MDSA 4E7RG 3GY2A 3A8CA 1DUEA 2GDDA 4CHAB 1GG6B 1EZUC 1P2IA 3VEQB 1NPMA 1NRRH 1C5SA 5A2MH 2HRVA 2V0BA 3MFJA 4ZKOU 2WUBA 8KME2 4AFZA 9LPRA 1EATA 1HLTH 2XCFA 2ALVA 1UVSH 1PQ7A 5FX5A 1FAKH 3F9HA 1V3XA 2FIRH 1YPKH 1C2MA 1XUHA 4MLFB 3SUFA 1K1OA 3BG4B 1K2I1 2R2WU 2OC7A 2OXSA 2UWPA 4H4FA 1V2UT 1GL0E 1QL7A 1FY1A 5FPTA 4J1YA 4OS7A 4UFEH 1VCPA 1SGFA 3A7WA 5C5NA 1DFPA 3GY6A 1GDQA 2Z3EA 1C5LH 1J14A 4UONA 4H6SB 2ZFSA 2PKSB 3UY9A 4U2WA 1ZHRA 5FCKA 4MG3A 3KIDU 1OKXA 2HGTH 1SOZA 1MTSA 2VGCC 1CE5A 4AFUA 3ZZBA 4Q7XA 1NFWA 5F8TA 4B2BA 1NY22 1F7ZA 1IQMA 1DLKB 4DT7B 4IMZA 2ZU5A 2RDLA 2F3CE 1AFQC 1D3TB 1O32A 3G01A 1D3QB 2ZQ2A 1TX7A 1A3EH 2BLOA 2FPZA 1E35B 2A2QH 1TALA 2ZHQH 3O8CA 5E0GA 1XMNB 4MNYA 3SU4A 3PWBA 1P01A 3A7VA 1C4V2 7GCHF 5DP3A 3B8JA 1UK4A 2UUKB 4KTSA 3VB6A 1IQGA 1TOCB 1ELBA 3UWIA 2GMTB 4TPIZ 2QXHA 4DG4A 1MD7A 2STBE 1S81A 1N6YA 4X1NU 1ZRBA 2VIWA 1ANDA 4ZHLU 5C1XA 2VINA 3R3GB 3BTEE 1GBIA 1O3EA 1O5FH 1YPHE 1DY8A 1GBJA 2G52A 3D62A 3SGBE 1DE7H 2OCVB 2BY7X 1CGJE 3HKIB 4ABHA 1AIXH 3RXVA 1ZOMA 1TLDA 3KF2A 6CHAC 1MTWA 1EB1H 3LGVA 1Z8JB 3KGPA 4ISOA 1G32B 3M3TA 2W7SA 1FPHH 4CRAA 1P2NA 4U30A 3RXKA 5L30H 1BBRE 1CGIE 1YPGH 3EGKH 1TYNA 5AVDA 3E16B 2UUFB 1C5OH 3ZZ7A 1PQAA 1A0LA 2Z9KA 1GPZA 1HYLA 4WVPE 1HIAA 3RXIA 1UTNA 4YOIA 3M3SA 4B2AA 1M9UA 4VGCB 2BHGA 2PKAB 1BHXF 1P0SH 3PMAB 8ESTE 1E38B 2FP7B 1THPB 4B73A 3RUOA 2A5KA 1TQ0B 4MPWA 3U98H 2BVRH 1EQ9A 2AEIH 1LO6A 1C5QA 1DLEA 1DWCH 5GWZA 1QL9A 1ANCA 5JBBS 1O2SA 3RU4T 3OSYA 1JMOH 1DDJA 1T8LA 4UE7H 4ESTE 8GCHF 1GCTB 3TITA 3BEUA 3ITIA 2TGPZ 3RXEA 5C2ZA 1EB2A 2BLVA 4I32A 2VH6A 5EW2H 3RLWH 1OP8A 4ISHH 3ATMA 3SQEE 1AB9B 2QGRA 2ODPA 1KXAA 3L33A 1MTNC 3BTGE 5A0CA 3A8AA 1O3JA 3PMBB 4FUDA 1GBMA 1QBOA 3F9EA 1P3CA 1LVOA 1GI0A 3DD2H 1QFKH 1RD3B 2FLBH 3E0PB 1Z6JH 2F9OA 3PV4A 1ELAA 2STAE 3M7UA 1O38A 1QRWA 1ZPCA 4FU8A 1ELEE 2SGFE 4FXGH 4ZHAA 1YPLH 3BTHE 2RCEA 3MNCA 2QF3A 4WWYA 5DK1A 3TVJB 1TRNA 2H6MA 1P2QA 2VH0A 2BVSH 1TABE 1GJ5H 1SFQB 3KQBA 6LPRA 3PLPA 1GDNA 1WTHD 4NZQA 5ESTE 2ZU1A 3ZVAA 1C5ZB 4R8TB 1Y3YA 4J2YB 3RXUA 2FOCA 1QB1A 3MO3A 3TU7H 5EXNA 4Y7AA 4XDEA 1CT2E 1KIGH 2AYWA 1O2JA 3ATKA 3EYDA 2ZC9H 1ZTJA 2GZ8A 4H42U 3RXBA 1EJAA 4TYDA 1QA0A 1AD8H 1MMJN 1Z8RA 5C5OA 2W3KA 4WJG2 2CHAB 4KELA 4ZKNU 3SUEA 1BBRK 5EOKA 1EPTA 1DANH 1ZTLA 3DT0H 1GHBF 5EGMA 3ODDA 4B1TA 4NIYA 1T8MA 2Y80A 2EI8A 5EQQA 1UVPA 5LPRA 1E0FD 5H4IB 3F68H 1K9OE 1QTFA 1O3KA 3BTTE 2VIQA 1U6QA 2AMPA 2ESTE 1YLDA 4HI3A 3C1KA 2CF8H 1OWKA 1FNIA 2YNAA 3RXSA 1P2JA 2SGDE 2ANWA 3UNQA 1CSOE 2XW9A 2QAAA 4JYTA 1XXDA 1S85A 2BLWA 4XBBA 1KSNA 3P8FA 3SJOA 2KAIB 1ELFA 1LKAA 5EXMA 4K3JA 1AQ7A 1C1OA 3KQDA 3VB4A 2IJOB 1GJ7B 2QN5T 4NFFA 1XUFA 2ZGCA 5C1UA 1A1RA 4Y6DA 1TGNA 2RA3A 5C20A 1GWAA 1PPCE 1GBKA 1QJ7B 1P10A 4NSYA 1GBDA 3FAOA
chains in the Genus database with same CATH superfamily
1KLTA 3OX7U 4ZAEA 2WZQA 5A0BA 1O2YA 1LPZB 5DG6A 3LGUA 4SGBE 1P2OA 1FPCH 4Y0YE 3EDXB 1S0QA 2JH0D 3ZZCA 2ANMH 2XRCA 5LGOA 1FY5A 3JZ2B 3SNCA 2ANYA 3Q00A 2ULLA 1P9SA 3LGYA 4Y76A 3UB0A 1SGQE 1BZXE 2IOTA 1ZGIA 1S84A 4XBCA 3ESTA 2FI5E 3PV2A 1UMAH 1V2OT 2BD3A 3ATIA 1ANEA 4ZH8A 2J98B 2OP9A 1P12E 4I86A 1TONA 1IQKA 2TRMA 2FOEA 4GPGA 2UWOA 1LHFH 1OWDA 3MWIU 1O2IA 1Q2WA 1D4PB 1O3IA 1C2EA 3PMJA 2ZNKH 1KXCA 5KECA 2XC4A 2QF0A 1SLVB 4FU7A 1SHHB 2D2DA 3QUMP 3MOCA 1PYTC 5CDFE 2GCTB 2EA3A 5IDKA 1P2KA 1QL8A 3SJ9A 1P3EA 2F4LA 3OYPA 5DP9A 2YMSB 3K9XB 2VIDA 2ZTXA 4XD7D 4D9RA 1TMUH 3EQ0H 2ZO3H 4LOYH 2HPQH 4ABJA 4ABIA 1V2WT 1PQ8A 2XBVA 4TT3D 4X8SH 4WMDA 3UREA 1YKTA 2DUCA 1HAOH 4X2YA 3FP8E 2ZP0H 1HAHH 1V2PT 1V2KT 8LPRA 3K65B 1Y8TA 2QY0B 3L6PA 1EAXA 1V2NT 4NGAH 5HIYA 3MYWA 3LGTA 2QCYA 1ANBA 2IJD1 1FN8A 4YOGA 4BAHB 1PPHE 4X8TH 4IN1A 3PTNA 1SQAA 2C4FH 1MU8B 2UUJB 4NA8A 1NBMD 1VITH 4ZMAH 1EJMA 4TSFD 1ID5H 3K6ZA 1N8OC 2ZFPH 3TK9A 1XUJA 4K1SA 4DOQA 5FCRA 1YPMH 1MQ5A 3BTME 3ZVBA 3F0PA 4A1XA 1O39A 3GISB 3LH1A 4RT1A 2SGQE 3H5CB 1CHOG 1RTKA 3TNTA 2G5VA 4WXIA 1BTWA 4BXSA 2WPKS 3NXPA 1C5XB 2H1UA 5IK2D 4JZFH 4YOJA 4Q63A 1EJNA 1ZMNA 2B8OH 2H9TH 4KP0A 1AKSA 1Y5BT 3OFND 3AK5A 1SOTA 1C1RA 1EASA 2H9HA 1IQFA 2Z9JA 2J34A 2BM2A 3KL6A 2BDBA 1GMHF 4BXWA 2FEQH 3S9AA 1OX1A 4KTUA 2ZDAH 2J94A 1H9LB 2F83A 1SI5H 3SNBA 4CRDA 3O8BA 1EPTC 2A7HA 3BTWE 4MVNA 5C3NA 1OS8A 1TA6A 5DP5A 2FWWA 1C1TA 1HPGA 3ZYDA 4OS5A 3SZNA 1RIWB 4X2WA 5C0TA 2FI3E 4FUHA 4JZDH 1GJ4H 1UTLM 2FO9A 3E1XB 3QDZB 2P3TB 1BTUA 3S69A 1LPKB 1UJ1A 1G2MA 1SGTA 1KY9A 2Y6TA 2XBWA 2WHXA 2FTLE 2SGPE 1A0JA 2D8WA 3PLBA 1GDUA 1H9IE 3HKJB 4A6LA 3UAIC 5ABWA 1QZ8A 3TK5A 4IS5A 3BIVH 4X6OA 1RXPA 4GHTA 3KNXA 1HAVB 1WBGB 3VGCB 5C1YA 1NO9H 4ZKSU 2AGGX 3JZ1B 1WXRA 1ABJH 1V2MT 3DA9B 1RRKA 4AGJA 1TNLA 2AS9A 4ISIH 3CNRA 1XUGA 3A88A 1O3PB 1YPJH 1NRPH 2G4TA 3T25A 3KN2A 1XUKA 4K1EA 1VZQH 4DW2U 1L1GA 5FXLA 4XFQA 3SV2H 1ZJDA 2CMYA 2BZ6H 4AG1A 2ZU4A 1HBTH 1NU9A 2XBXA 2GV7A 3MMGA 1JIMA 5DO4H 2ZDNA 4WH8A 3S7HB 1T4UH 1UVTH 1T7CA 3ENSB 1HAXB 4CREA 2PTNA 2G5NA 2NU4E 4K60A 1KDQB 3P92A 1SGRE 5A8YA 2A4QA 1F0RA 1W2KH 4AB8A 1QRZA 1O34A 1NM6A 1UTPA 1LDTT 2BTCE 2F43B 2AMQA 2VIPA 1VITG 3S7KB 3F0OA 1TRYA 5C0UA 1RTLA 1D9IA 2PSXA 3P70B 2WPMS 5FX6A 1AVGH 3U1IB 4MPVA 2Y81A 2TBSA 1DUAA 1K21H 4XRNA 3SJKA 1DM4B 3HPTB 3U1JB 1WYKA 1P02A 1SBWA 4F49A 2Q6FA 1A5GH 2P3FH 1L4DA 1SR5C 5E8EH 2BD4A 5I25A 4ABBA 1QIXB 1GI2A 2WV5A 2P16A 5DPAA 1SC8U 3W95A 1AGJA 3LIWA 2A7JA 1DXWA 1VGCC 1LVBA 4AB9A 1PPFE 1W10U 2TGTA 2BQWB 4X6PA 4HTCH 1AVXA 1J8AA 1BA8B 2SFAA 1TIOA 1TNGA 3QK1A 3SJIA 2XCNA 4UDWH 3P8OA 4Y8YA 3ZVCA 1ETSH 1YPEH 4E7NA 3NRLA 1GJ9B 3MH6A 1QY6A 4I8HA 3SV6A 1TPOA 1HDTH 1TA2A 1A46H 3D23A 4AFSA 2GX4A 3N7OA 1HFDA 2NU2E 4P02A 1TFXA 2GZ9A 2BDCA 1RJXB 2SGAA 4I31A 5EJ1A 4DIIH 1TBZH 5BRRE 4ZHMU 3LH3A 4DVAU 3FFGA 2J38A 3MU4A 4IC5A 4DY7B 1ZJKA 2CK3D 2QA9E 1AVWA 3PYHA 2HNTE 1C5MD 1S6FA 1G3BA 4CR9A 3VB5A 3SYJA 2OQ5A 3MNBA 3PO1C 4IW4E 1BTPA 2WINI 1VITF 2GTBA 2FMJA 2M5TA 1W8BH 1NN6A 3E6PH 1V2JT 2JKHA 1GGDC 3TGKE 1LPGB 1KXEA 3OY6U 1OWEA 3I77A 1DY9A 2ZU2A 3ZZ8A 2FODA 4XSKU 1ZGVA 2FYRA 4CBNA 1HAYB 4YM9A 2R9PA 4NSVA 4WF8A 3PMHB 3RP2A 1GJDB 1J15A 1GJ6A 2G81E 1LQDB 2LP6A 3MNXA 1OPHB 1DVAH 1NU7B 1SG8B 3NKKA 3RMNH 2XYAA 3SQHE 3EA8A 1CA0C 1VJAU 1MTUA 5JPMH 2BY6X 2LELA 2CF9H 1ABIH 1O5GH 1V2QT 1ZHPA 3SNDA 3FP6E 1LQEA 3Q77A 4JYVH 3KQEA 3W1EA 1B0EA 5DP8A 1LHCH 2HWLB 2BY8X 4DURA 1Y3UA 2KR7A 1ZPZA 2ZEBA 1H8HD 1NRNH 4AG2A 1FMGA 2WPIS 1O2WA 2K8IA 1GHAG 2P8OB 1F0UA 3KHVA 5F03A 2GP9B 3EE7A 1CBWC 1HJ8A 5FPYA 2O8LA 3A87A 1SQTA 1T8NA 1KLJH 1KYNA 1SVPA 1TNIA 2EQNA 1ZPBA 2Z94A 3UQVA 1EZQA 1K1MA 1TX6A 4O03A 4HG6A 4KTCA 1C2FA 2OBOA 1C9TA 1AWFH 1GI8B 2Y5FA 4O3UA 1H1BA 3ATLA 4ABDA 2J92A 5L6NH 1C2LA 1O3BA 1O33A 1DSTA 3SBKA 4BNRA 1C4Y2 3MQKC 4OGYA 5EPNA 4GCHG 1O5AB 3UNSA 1O3CA 2KCOA 3RXJA 4YLQH 4AYVB 1FZZA 4CBOA 3SV8A 1OXGA 1SHYA 1GVKB 1E34B 1ZLRA 2BDYA 2C8WB 5DJ7A 2JETB 1AUJA 1BTZA 5JB8S 1NROH 2VJ1A 3V13A 1TNJA 1FIZA 3KYGA 1F5KU 5E2OA 6GCHG 3UOUA 4Y7BA 5EQSA 1B5GH 2FLRH 2IPHA 2O8UA 3SO3A 2Z6BD 3UQOA 3QLPH 5HIZA 1P06A 4B75A 2BD9A 3LPRA 4X1RU 3OEED 3PM3A 3NWUA 3DSPA 1NT1A 2KCYA 2ZGHA 5BPEA 2B0FA 3R0FA 4ZROA 3P95A 1BRBE 2SNWA 3UR9A 1INCA 1WAYB 2VVCA 1MCTA 1BMAA 1GBTA 1ZSJA 2VVUA 1HJAB 2V3MA 2FOGA 1O30A 2OBQA 1P04A 1FN6A 4B6EA 1N6XA 3P6ZB 2WPHS 5CMXH 1BCUH 1C4U2 1EOJA 4Y10E 1KTSB 5TCAA 3LC5A 1C5UA 1O2UA 2ZCHP 4B74A 3UFAA 6ESTA 1VCWA 1YBWA 1H9HE 2B9LA 2VWNA 3H7OA 4M7GA 4MPUA 3FN8A 3U8RH 2PKAA 5CHAC 4AFQA 4Z6AH 3RXAA 4D7FA 1Y3WA 3TH3H 2F9VA 2SNVA 1SGIB 1P11E 1FI8A 3RXRA 4X2VA 1SL3A 4IN2A 4IMQA 2VVVA 3SV7A 2RFKC 1C2HA 1WCZA 1UCYK 3V0XA 2BD2A 3NZIA 1GI4A 2HLCA 3A80A 3GCTG 3M5LA 3OTJE 1VCQA 2IN2A 4SGAE 2FZZA 2O8WA 1XXFA 4YLUA 1QA7A 4BTTB 4Z1MD 3Q3XA 3S0NA 1TB6H 4BANB 3TNSA 3GCHC 3A85A 4Y71A 1PYTD 1YF4A 2BQ7B 3RDZA 2G8TA 1ESAA 4U01A 1GI5A 1OWHA 1MZDA 1BRUP 3MU0A 2QV1A 2KCPA 4Y0ZE 1O2NA 2GD4B 1TNKA 1JBUH 1KMHB 2ZHDA 5DP7A 5T6GA 5SGAE 1ETTH 2ZPQA 4RI0A 2GJGA 1MZAA 1BMMH 5TCCA 4I7YH 5AFYH 3U69H 4CHAC 1GG6C 1FLEE 3S9CA 2H5CA 2GV6A 1NS3A 2OC1A 2ZFTA 3OAAD 3VPKA 4RSPA 1C2IA 1ZTKA 2ZDKA 4LZ1H 3FZDA 3FANA 5HKKD 1DWDH 5HYOA 4K1TA 4WXVA 2ZA5A 5JDUB 3A7YA 2G55A 3Q76A 1V2RT 1T4VH 3RXLA 4YTAA 2UUYA 3GYLB 5EIYA 3TJUA 4ABGA 1Z71A 1FX0B 1NRQH 3TLOA 2VGCB 1UHBB 2ZWLH 1J16A 3ZV8A 1SPJA 1Y5AT 3I29A 4OS6A 3F9GA 4F55A 4GAWA 1AFQB 2PKSC 1AWHB 1CT4E 3WWFA 1LHDH 1RGQA 1A61H 1GHWH 2PLXA 3UUZA 1CT0E 1O2XA 1SLXB 1F92A 3SU2A 3K2UA 2O9QA 1YCPK 3NK8A 1C5NH 1K0HA 1P9UA 1YYY1 1GBBA 2ODYB 4NIXA 1DXPA 1FJSA 5DN6D 2Z3CA 4CR5A 1XM1A 2B5TB 2VWLA 4GLYA 2RG3A 4A7IB 1L0ZA 2PTCE 5I46H 1O2TA 1ZRKA 1HGTH 3A81A 1FUJA 3QWCH 2ZCKP 1YM0A 2ZECA 1ELDE 1W12U 2ZGJA 4INLA 1SGEE 2O8TA 2KAIA 2GKVE 1UCYH 2NWNA 2QYIA 3ZZ6A 2R0LA 5EODA 1IHTH 2RA0A 4UEHH 1GVZA 3RXOA 1PJPA 2FOFA 4D76A 6CHAB 2BLQA 5IYTA 1O2OA 3RLYH 3AW0A 1QR3E 2GMTC 5GNDA 1TGCA 1VKYA 3BIUH 2LNCA 3STJA 1W13U 3STIA 1GJAB 1W0YH 1FDPA 1MU6B 1MKXK 2ZDMA 3LGWA 2ZHWH 3F1SB 4NIVA 2J4IA 1GBHA 5DP6A 1EP6A 1F2SE 2ILNA 4TY6A 5F8ZA 1XX9A 1W0ZU 4YO9A 3ZYEA 1UHBA 1C1PA 3RC4A 1T32A 5F6MA 4OS1A 1NTPA 3GY3A 3VFEA 2ZFQH 3M7TA 2HLDD 3NPSA 5FPSA 1UTJA 3QX5H 1YPHC 2XC0A 2EEKA 5TJXA 4UFGH 1ESBA 2AGEX 4JZ1A 1BOQA 1YGCH 2NU1E 4XE4A 3HATH 5GJ4B 2VB0A 2D26C 1QBNA 1TGBA 1WU1A 2ZF0H 4ZXXH 3T2NA 1MAXA 3SW2B 1TMTH 2J98A 1TBRH 1F0TA 1Z8GA 2BB4A 1BJVA 1AZ8A 1DOJA 4K5ZA 4TY7A 1TWXB 1GI7B 1O2ZA 1KXDA 4I33A 4RN6A 1AN1E 2EC9H 4VGCC 3LGIA 3HK3B 1AMHA 3E8LA 5C67A 4NA9H 1AU8A 1IQEA 2I6SA 2FOBA 1OP0A 3A86A 3LT3A 1MTNB 4M9FA 3BEIB 4MNWA 1ZYOA 1C2DA 3CS0A 1EX3A 2XWBI 3A83A 1AI8H 3ZV9A 1GBCA 2FI4E 3ZZ9A 2WPDD 4KGAA 4WH6A 1HAPH 5JBTA 1OWJA 2QIQA 4GVUA 2EI7A 2H9EH 4K69A 3VG8A 1G3DA 1IQNA 2F9NA 2GT8A 3SU5A 1GCTC 2FDAA 4Q2KA 2BXTH 3Q3YA 1EAWA 4NCYA 1YCPH 2Z9LA 1ZHMA 4GHQA 5EG4A 1L4ZA 4JCNA 1UO6A 1AB9C 5J4QA 1V2ST 4JMYA 1E36B 1W14U 4NFEA 2Y82A 4NWLA 3CS7A 2YOLA 2CGAA 3KEEA 1C5VA 3RC6A 1ZSKA 1HXEH 2OQUA 2ZHEH 2VNTA 3MO9A 1CO7E 1ORFA 4NIWA 2OC0A 2XNIA 5HM9A 1DX5M 2JJ1D 2XXLA 1Z1JA 5JB9S 4B76A 2ZPRA 2GZ7A 5T1VA 2BD8A 4X1SU 3L3TA 1OWIA 3IITA 3RMMH 4ISNA 1CHOF 4OS2A 1W7XH 4FUIA 2C93B 1EZXC 4O3TA 5EU8A 5A8ZA 1Q3XA 3F3BA 2FOMB 1BJUA 2P3UB 2FS9A 2CJIA 1VJ9U 1ZSLA 2EY4C 1XVMA 3E91A 1E79D 2ZFFH 4GSOA 1V2VT 3SJ8A 1EAUA 4AORA 3BG8A 1G3EA 2AFQB 3MU1A 1HJ9A 1CU1A 1F5LA 1MKXH 2Z3DA 1A4WH 4I8GA 4KKDA 4JK5A 2G51A 1BRAA 1KTTB 1COWD 1GI9B 2A2XH 2BQ6B 2XWAA 3M36A 4FOUC 4X1PU 3U9AH 2PR3A 1J17T 2F9UA 4FUGA 1AE5A 3ODFA 3KQ5A 2A4OA 1NFYA 1VR1H 1QHRB 2Y7ZA 2CHAC 3NUMA 2ZTYA 3SU3A 4CRCA 4PROA 4INHA 1KXFA 2HNTF 3ZIAD 1UK3A 1UTMA 5ESBA 3SV9A 4X1QU 1HB0B 4O9VA 4ZCNA 1TGSZ 3W94A 3ZZAA 2AHME 4R0IA 5DKMA 1SGCA 4CRBA 1O5CB 4K8BA 1MABB 4CRFA 3RM2H 2R3UA 4NZLA 3P8NA 1WSSH 1PPBH 2G4UA 3M3VA 1PPGE 4ACBA 7GCHG 3KQCA 5EXLA 3E0NB 4WMEA 2BOKA 1O3FA 4P00A 2F91A 4GUXA 4NA7A 1AFEH 3RXPA 1Z7KA 4QT8C 3FZZA 2BXUH 4XOJA 2KCAA 1C1MA 3AAVA 2XBYA 2F9BH 2ZU3A 2PSYA 2XOKD 1UTKA 1FV9A 1MUEB 2OTVA 1HAVA 1GCDA 4ASHA 4ASUD 1LVMA 1WQVH 3LJJA 2V3OH 1EKBB 1O0DH 4E06H 1A3BH 5K0HA 5LPEA 1WV7H 2BMGB 2HOBA 2D1JA 1D3PB 2L6OA 2O8MA 1K28D 3PB1E 1OSSA 3RM0H 1DPOA 1S6LA 1HAZB 2J95A 3F2HA 3MI4A 4AZ2B 3A82A 3PV5A 5GDSH 1DWBH 1DWEH 5AFZH 1J9CH 1L1NA 1LMWB 1JRSA 1TQ7B 2OD3B 3MH5A 3V3MA 1AHTH 1CGHA 2QF5A 2TGDA 4Y79A 1ELTA 1HIAB 2BZAA 3A7TA 3URCA 5E2PA 1DSUA 1EP5A 1PQ5A 4RT0A 4X8VH 4H6TA 2L74A 3SU0A 3SOSA 1C5WB 1C5TA 3NCLA 1G36A 3RU4D 3TPIZ 3V12A 3PLKA 1W0KD 9ESTA 1BTYA 3BTQE 3TK6A 2BX3A 4LXBH 1AE8H 2BOHB 2WPJS 2G00A 3VXEH 1SQOA 1TPAE 1KDQA 1YP9A 3K6YA 4X2XA 3RC5A 1ARBA 5HMAA 1QRXA 1NESE 5AHGH 1C5PA 4YESB 1P2MA 2A32A 1XKBC 2VU8E 1G9IE 3CP7A 1W3CA 3BEFB 2OC8A 1S83A 5G4BA 2Q6DA 1ZZZA 2BDGA 2B7DH 4I8JA 4I8LA 1TPPA 4Y8ZA 3UWJH 5HM2A 1ZMLA 4JZEH 8GCHG 1QNJA 1V2LT 3M5MA 1WQSA 2BX4A 2XNDD 3MTYA 3SI4H 2GCTC 2LPRA 3D65E 4A1TA 1IHSH 3QZQA 2HVXA 1ELCA 1CVWH 1GHVH 1YC0A 2AIPA 2FXRA 2ZKSA 3SNAA 1UCYE 2YMSC 3A84A 1TAWA 2C8XB 3GOVB 2AMDA 3MU8A 4D8NA 1OOKB 5FBEA 1B7XB 2A1DB 3D49H 7LPRA 1GJBB 1H8ED 2FESH 3S9BA 1P57B 1C1UH 3LDXH 1D6WA 2FOAA 1N8OB 1NZQH 4UFFH 3SNEA 1LHEH 2C8ZB 1K1IA 4UFDH 4CH2B 2CN0H 3EE0B 2FYQA 3ZZDA 1MTVA 2H2ZA 5J4SA 1YCPM 1QGFA 4DGJA 4X6MA 2VIVA 1H8DH 1DITH 5E0HA 1MBQA 3DSOA 3RXQA 1GBAA 2ANKH 4D9QA 2P94A 2V3HH 1C2KA 4YZUA 1JWTA 1P05A 4A92A 4FUCA 1V2TT 3QZRA 1HAGE 1C1WH 3GCOA 1WOFA 2W6JD 4TWYA 3SU1A 5DP4A 1O2MA 4ABFA 3ATWA 4JZIA 4Q7YA 3GYMA 5CE1A 3ZVFA 2VBCA 4WMFA 3LC3A 2A4GA 2AH4X 2JH5D 3DFLA 2PGQB 2R2MB 1EPTB 1O3AA 2OUAA 4K8YA 3GY7A 3WWBA 1K22H 2PHBA 2GCHG 1K1NA 2ALPA 1A5IA 3LKWA 4FUEA 2A45B 4CH8B 3I78A 2H5DA 1BRCE 5GCHG 1TOMH 2BDIA 1MQ6A 1TGTA 1UW7A 3RXMA 3ZZ5A 3BTKE 1GHBG 1GBLA 3QGNB 3MH4A 2P59A 3BV9B 3QO6A 1BDAA 3SHCH 2TPIZ 4BAOB 3TJOA 1UK2A 1GMCG 1E1RD 1ZR0A 3OU0A 2ZQ1A 4UD9H 2A31A 1TX8A 1TNHA 2W26A 1FY8E 3P8GA 1OHHD 4MPXA 5EW1H 4OM9A 1O5BB 2CV3A 2Y5HA 4MNXA 3PTBA 2ZHFH 3GDVA 2DE8A 1BTXA 1S6HA 3V7TA 1O3NA 1D6RA 1L2EA 2FX4A 1O3GA 1QB6A 1Y3VA 1FXYA 1HCGA 1UVUH 5JBCS 1NBME 2F9PA 1RIWC 2R3YA 1K1PA 4RKOB 1EUFA 3MH7A 2VWMA 2WYJA 1GHAF 1A5HA 3RXCA 2WV4A 2FM2A 1E37B 1MCVA 2A7CA 1C5RA 3GY4A 1TMBH 2FOHA 2FX6A 3QN7A 4HZHA 1BITA 1O2VA 1SGPE 4BTIB 2ZPSA 5LPFA 1AO5A 1BT7A 1MKWK 5C17A 5B6LA 3M35A 1BMLA 4AN7A 1GBEA 1ELVA 3GS9A 1O2RA 3EA7A 3ZVDA 3BN9A 3A8DA 3UTUH 3TGJE 2Q6GA 2J2UA 3BTDE 4D7GA 2QXJA 1O37A 2ZIQH 1O3LA 2ZFRH 1O2GH 4E05H 1GJCB 1RTFB 4GCHF 5L2ZH 1BHXB 3VGCC 3HGPA 3RXDA 3UPEA 2ASUB 1NRSH 1C2GA 4HFPB 3SGAE 1SGNE 4ABAA 3LJOA 1QBVH 3RXTA 2GCHF 2I6QA 6GCHF 3FO8D 1WTGH 1C5YB 1X7AC 3DFJA 3DSGA 4FUFA 4DJZB 1GI6A 1EZSC 2C8YB 5GCHF 1SLWB 4OS4A 4NWKA 5HXFA 2IPQX 1QJ1B 4MTBA 1O31A 4LZ4B 2BYAX 3LONA 1P03A 3OY5U 5GXPA 1PPZA 5ETXA 1GMCF 3RXGA 1ESTA 3BF6H 3TH4H 3Q3KA 1F5RA 1XKAC 2ZGXH 3IG6B 4JK6A 4THNH 2Q1JA 4RKJB 2Y7XA 1GHXH 1O2HA 1PFXC 1MAYA 1JXPA 1LVYA 1NFXA 1IAUA 4FU9A 4Q7ZA 1Z1IA 4IGDA 2W5EA 3EAJA 4Q80A 3GDSA 1B0FA 4TPYA 1SB1H 1G37A 3F2GA 5A0AE 4Y8XA 1QQUA 1TBQH 3A7ZA 3T26A 3O8DA 1VGCB 3TH2H 1QCPA 2P93A 1H8IH 3VXFH 1Z6EA 3ZZ4A 2ZCLP 3DHKH 4NG9H 1P8VC 5F8XA 2ZGBH 3BG4C 4ACAA 4INKA 5F53A 1LKBA 1T31A 2ZDVH 3H09A 3SUGA 1Y3XA 3VB3A 3A89A 4YT7H 1EOLA 3RXHA 1O5DH 4ZKRU 5GIBA 4X0WU 2AIQA 1H4WA 2OK5A 1GHZA 3ZVGA 4X6NA 1AUTC 1QQ4A 1L1JA 3QGJA 1G2LA 2WV9A 5LH8A 1Y59T 5DGJA 1HXFH 3GCTF 3GDUA 4AYYB 1SGFG 1QJ6B 1HAIH 1G30B 2TIOA 2V7QD 5JYIA 1ZMJA 3WY8A 2A5IA 2C90B 1SGYE 1O2LA 4O97A 5EQRA 2THFB 4I8KA 5A8XA 3SUDA 3A7XA 1ETRH 1O3OA 1KLIH 3T28A 3SHAH 4B71A 2ZZUH 3M5OA 4FUBA 1W7GH 2FTMA 1A0HB 1IQHA 2XC5A 3T29A 5AF9H 3M37A 1IOEA 4FVDA 3LOXA 3PO1B 1DT2A 1XVOA 3T5FH 4WY3A 5EPYA 4BAQB 5B6OA 1IQIA 5A09A 2PUQH 4ABEA 3F9FA 1IQJA 4B2CA 1O2KA 2QXIA 4DT4A 1GGDB 1MKWH 3B23B 3O8RA 3SU6A 5JBAS 1GHYH 2JJ2D 3RXFA 2HALA 1AKSB 3HK6B 2CXVA 1S5SA 2PUXB 3FVFB 3RMOH 2OLGA 3ELAH 3F2FA 1XUIA 2Z9IA 3AASA 2KX4A 4F48B 1S82A 1EAIA 2ZDLA 2V35A 2QE7D 3GCNA 4OGXA 1YLCA 1C1VH 1CA0B 4AOQA 3UIRA 1GL1A 1MD8A 5L2YH 1GMHG 2HNTC 2WUCA 1EFRD 1MBMA 4B6FA 4FUJA 3MNSA 1OYTH 1A2CH 3BTFE 1BB0B 1T8OA 4Y11E 1TPSA 1NFUA 1FY3A 1BUIA 1BBRH 1C2JA 1Y5UT 4LK4A 4AC9A 2QC2A 1NC6A 3PWCA 2NU3E 1V6DA 2Z9GA 3FOAA 1GJ8B 3MO6A 4FETA 3UNRA 1LCYA 2A4RA 1CHGA 1E1QD 1K1LA 4A5TS 1G3CA 3C27B 3MHWU 4TWWA 1SQRA 1ARCA 1CBWB 3T27A 1F0SA 2TGAA 2PV9B 4U32A 1ELGA 1GVLA 2A5AA 4ISLA 1N1LA 1LHGH 1C9PA 3ZVEA 4AGKA 2VIOA 5K7RA 1FY4A 1P09A 2J5UA 5T3HA 1BMFD 1LTOA 3KCGH 2HPPH 3UR6A 4F4OC 1FAXA 3HGNA 1SFIA 7ESTE 3RU4E 1S0RA 1EXFA 1OYQA 1WUNH 1GMDG 1PPEE 3TJNA 1SGDE 1C1QA 2OINA 3GY5A 4FVBA 3GY8A 2Y5GA 1BTHH 1JOUB 2ZTZA 1D3DB 2BDAA 1O3MA 2A0QB 2J97A 1DS2E 2WPLS 2K1QA 2P8OC 2GVFA 1THSH 1HNEE 2UWLA 1O2QA 4IC6A 2AERH 5EJZA 1O35A 1W11U 4MQAA 3TGIE 1TE0A 2VWOA 3H7TA 3E90B 4JYUH 1FQ3A 1FONA 1C1NA 4YT6H 3TIUA 5FAHA 2JH6D 5GPIB 3ZZ3A 1CQQA 1O36A 5HGGA 3SN8A 3VB7A 2WYGA 2AGIX 1O5EH 4XBDA 1FIWA 2YNBA 1RFNA 3MU5A 1KXBA 1TRMA 2ODQA 5KEDA 3BSQA 3QTOH 3U8TH 1SMFE 4HGCA 1OP2A 1UVOA 2PGBB 3CENA 4CRGA 3FP7E 1JIRA 1HUTH 5T6DA 3TJVA 1AZZA 2JETC 2PWXA 2W7UA 1UTOA 3B9FH 3RMLH 1O2PA 2BDHA 1AY6H 2BD7A 1UTQA 1BIOA 2M2AA 1DICA 3AW1A 2BVXH 1CA8B 1A7SA 3GICB 4MNVA 1WDIA 1GBFA 2V6NA 4AX9H 1Z8IB 5E0JA 1HV7A 4ZUHA 1JRTA 2R0KA 4A1VA 1O3HA 1MH0A 2SGEE 3DUXH 5FHTA 2DE9A 2C3SA 1O3DA 2GGVB 3EA9A 5CHAB 1SSXA 4K2YA 2QXGA 2BY9X 3UOPA 3SI3H 3SORA 4ZXYH 3DCLA 1QB9A 3URDA 2J9NA 3QTVH 1BMNH 2GT7A 3LU9B 2W3IA 3M61U 1GMDF 4BAKB 1K1JA 2NU0E 5FBIA 2P95A 3IWMA 1HJAC 3PROA 2ZI2H 2PFEA 5KGOA 1THRH 2JDID 1GI1A 3M5NA 3P17H 4Z0KA 1QURH 4IBLH 3U8OH 2PW8H 5T6FA 1IQLA 1GI3A 3A8BA 2Z7FE 3T62A 2FS8A 1ACBE 3SGQE 1RS0A 4BAMB 3GCHB 2GDEH 1HRTH 2XTTB 3N99A 7KMEH 4X8UH 1C1SA 5PTPA 3AVZA 2BD5A 4BOHA 4BTUB 1SLUB 2EI6A 3E3TA 1BQYA 3AAUA 4DIHH 1Q31A 3F6UH 3M7QA 2ZG0H 4DCDA 2BY5X 4MDSA 4E7RG 2KFWA 3A8CA 3GY2A 1DUEA 2GDDA 4CHAB 1GG6B 1EZUC 1P2IA 3VEQB 1NPMA 1NRRH 1C5SA 5A2MH 2HRVA 2V0BA 3MFJA 4ZKOU 2WUBA 8KME2 4AFZA 9LPRA 1EATA 1HLTH 2XCFA 2ALVA 1UVSH 1PQ7A 5FX5A 1FAKH 2YMSD 3F9HA 1V3XA 3KYFA 2FIRH 1YPKH 1C2MA 1XUHA 4MLFB 3SUFA 1K1OA 3BG4B 1K2I1 2R2WU 2OC7A 2OXSA 2UWPA 4H4FA 1V2UT 1GL0E 1QL7A 1FY1A 5FPTA 4J1YA 4OS7A 4UFEH 1VCPA 1SGFA 3A7WA 5C5NA 1DFPA 3GY6A 1GDQA 2Z3EA 1C5LH 1J14A 4UONA 4H6SB 2ZFSA 2PKSB 2WSSD 3UY9A 4U2WA 1ZHRA 5FCKA 4MG3A 3KIDU 4YXWD 1OKXA 2HGTH 3N7DA 1SOZA 1MTSA 2VGCC 1CE5A 4AFUA 3ZZBA 4Q7XA 5C94A 1NFWA 5F8TA 4B2BA 1NY22 1F7ZA 1IQMA 1DLKB 4DT7B 4IMZA 2ZU5A 2RDLA 2F3CE 1AFQC 1D3TB 1O32A 3G01A 1D3QB 2ZQ2A 2HVYB 1TX7A 1A3EH 2BLOA 2FPZA 1E35B 2A2QH 1TALA 3WW7A 2ZHQH 2PP6A 3O8CA 5E0GA 1XMNB 4MNYA 3SZEA 3SU4A 3PWBA 1P01A 2KM0A 1C4V2 3A7VA 7GCHF 5DP3A 3B8JA 1UK4A 2UUKB 4KTSA 3VB6A 1IQGA 1TOCB 1ELBA 3UWIA 2GMTB 4TPIZ 2QXHA 4DG4A 1MD7A 2STBE 3U28C 1S81A 1N6YA 4X1NU 4Q4LA 2K0QA 1ZRBA 3PRDA 2VIWA 1ANDA 4ZHLU 5C1XA 2VINA 3R3GB 3BTEE 1GBIA 1O3EA 1O5FH 1YPHE 1DY8A 1GBJA 2G52A 3D62A 3SGBE 1DE7H 2OCVB 2BY7X 5DSFA 1CGJE 3HKIB 4ABHA 1AIXH 3RXVA 1W0JD 1TLDA 1ZOMA 3KF2A 6CHAC 1MTWA 1EB1H 3LGVA 1Z8JB 3KGPA 4ISOA 1G32B 3M3TA 2W7SA 1FPHH 4CRAA 1P2NA 4U30A 3RXKA 5L30H 1BBRE 3OEHD 1CGIE 1YPGH 3EGKH 1TYNA 5AVDA 3E16B 2UUFB 1C5OH 3ZZ7A 1PQAA 1A0LA 2Z9KA 1GPZA 1HYLA 4WVPE 1HIAA 3RXIA 1UTNA 4YOIA 3M3SA 4B2AA 1M9UA 4VGCB 2BHGA 2PKAB 1BHXF 1P0SH 3PMAB 8ESTE 1E38B 2FP7B 1THPB 4B73A 3RUOA 2A5KA 1TQ0B 4MPWA 3U98H 2BVRH 1YLNA 1EQ9A 2AEIH 1LO6A 1C5QA 1DLEA 1DWCH 5GWZA 1QL9A 1ANCA 5FL7D 5JBBS 3FKSD 1O2SA 1SKYE 3RU4T 3OSYA 1JMOH 2QF4A 1DDJA 1T8LA 4UE7H 4ESTE 8GCHF 1GCTB 3TITA 3BEUA 5CHBA 3ITIA 2TGPZ 3RXEA 5C2ZA 1EB2A 2BLVA 4I32A 2VH6A 5EW2H 3RLWH 1OP8A 4ISHH 3ATMA 3SQEE 1AB9B 2QGRA 2ODPA 1KXAA 3OE7D 3L33A 1MTNC 3BTGE 5A0CA 3A8AA 1O3JA 3PMBB 4FUDA 1GBMA 1QBOA 3F9EA 1P3CA 1LVOA 1GI0A 3DD2H 1QFKH 3OTPA 1YY3A 1RD3B 2FLBH 3E0PB 1Z6JH 1YWUA 2F9OA 3PV4A 1ELAA 2STAE 3M7UA 1O38A 1QRWA 1ZPCA 4FU8A 1ELEE 2SGFE 3N7EA 4FXGH 1YPLH 3BTHE 4ZHAA 2RCEA 3MNCA 2QF3A 4WWYA 5DK1A 3TVJB 1TRNA 2KZ4A 2H6MA 1P2QA 2VH0A 2BVSH 1TABE 1GJ5H 1SFQB 3KQBA 6LPRA 3PLPA 1GDNA 1WTHD 4NZQA 5ESTE 2ZU1A 3ZVAA 1C5ZB 4R8TB 1Y3YA 4J2YB 3RXUA 2FOCA 1QB1A 3MO3A 3TU7H 5EXNA 4Y7AA 4XDEA 5EJLA 1CT2E 1KIGH 2AYWA 1O2JA 3ATKA 3EYDA 2ZC9H 1ZTJA 2GZ8A 4H42U 3RXBA 1EJAA 4TYDA 2W6ID 1QA0A 2RDEA 1AD8H 1MMJN 1Z8RA 5C5OA 2W3KA 4WJG2 2CHAB 4KELA 4ZKNU 3SUEA 1BBRK 5EOKA 1EPTA 1DANH 1ZTLA 3DT0H 1GHBF 5EGMA 3ODDA 4B1TA 4NIYA 1T8MA 2Y80A 2JIZD 2EI8A 5EQQA 1UVPA 5LPRA 1E0FD 5H4IB 3F68H 1K9OE 1QTFA 1O3KA 3BTTE 2VIQA 1U6QA 2AMPA 2ESTE 1YLDA 4HI3A 3C1KA 2CF8H 1OWKA 1FNIA 2YNAA 3RXSA 1P2JA 2SGDE 2ANWA 3UNQA 1CSOE 2XW9A 2QAAA 4JYTA 1XXDA 1S85A 2BLWA 4XBBA 3PRBA 1KSNA 3P8FA 3SJOA 2KAIB 1ELFA 1LKAA 5EXMA 4K3JA 1AQ7A 1C1OA 3KQDA 3VB4A 2IJOB 1GJ7B 2QN5T 4NFFA 1XUFA 2ZGCA 5C1UA 1A1RA 4Y6DA 1TGNA 2RA3A 5C20A 1GWAA 1PPCE 1GBKA 1QJ7B 1P10A 4NSYA 1GBDA 3FAOA
chains in the Genus database with same CATH topology
1KLTA 3OX7U 4ZAEA 5A0BA 1O2YA 1LPZB 5DG6A 3LGUA 4SGBE 1P2OA 1FPCH 4Y0YE 3EDXB 1S0QA 2JH0D 3ZZCA 2ANMH 2XRCA 5LGOA 1FY5A 3JZ2B 3SNCA 2ANYA 3Q00A 2ULLA 1P9SA 3LGYA 4Y76A 1SGQE 1BZXE 2IOTA 1ZGIA 1S84A 4XBCA 3ESTA 2FI5E 1UMAH 1V2OT 2BD3A 3ATIA 1ANEA 4ZH8A 2OP9A 1P12E 1TONA 1IQKA 2TRMA 2FOEA 4GPGA 2UWOA 1LHFH 1OWDA 3MWIU 1O2IA 1Q2WA 1D4PB 1O3IA 1C2EA 3PMJA 2ZNKH 1KXCA 2XC4A 2QF0A 1SLVB 4FU7A 1SHHB 2D2DA 3QUMP 3MOCA 1PYTC 2GCTB 2EA3A 5IDKA 1P2KA 1QL8A 3SJ9A 1P3EA 3OYPA 5DP9A 3K9XB 2VIDA 2ZTXA 4D9RA 1TMUH 3EQ0H 2ZO3H 4LOYH 2HPQH 4ABJA 4ABIA 1V2WT 1PQ8A 2XBVA 4X8SH 4WMDA 3UREA 1YKTA 2DUCA 1HAOH 4X2YA 3FP8E 2ZP0H 1HAHH 1V2PT 1V2KT 8LPRA 3K65B 1Y8TA 2QY0B 3L6PA 1EAXA 1V2NT 4NGAH 3MYWA 3LGTA 2QCYA 1ANBA 4YOGA 1FN8A 4BAHB 1PPHE 4X8TH 4IN1A 3PTNA 1SQAA 2C4FH 1MU8B 2UUJB 4NA8A 1VITH 4ZMAH 1EJMA 1ID5H 3K6ZA 1N8OC 2ZFPH 3TK9A 1XUJA 4K1SA 4DOQA 5FCRA 1YPMH 1MQ5A 3BTME 3ZVBA 4A1XA 1O39A 3GISB 3LH1A 2SGQE 3H5CB 1CHOG 1RTKA 3TNTA 2G5VA 4WXIA 1BTWA 4BXSA 2WPKS 3NXPA 1C5XB 2H1UA 4JZFH 4YOJA 1EJNA 1ZMNA 2B8OH 2H9TH 4KP0A 1AKSA 1Y5BT 1SOTA 1C1RA 1EASA 2H9HA 1IQFA 2Z9JA 2J34A 2BM2A 3KL6A 2BDBA 1GMHF 4BXWA 2FEQH 3S9AA 1OX1A 4KTUA 2ZDAH 2J94A 1H9LB 2F83A 1SI5H 3SNBA 4CRDA 3O8BA 1EPTC 2A7HA 3BTWE 4MVNA 5C3NA 1OS8A 1TA6A 5DP5A 2FWWA 1C1TA 1HPGA 3ZYDA 4OS5A 3SZNA 1RIWB 4X2WA 2FI3E 4FUHA 4JZDH 1GJ4H 1UTLM 2FO9A 3E1XB 3QDZB 2P3TB 1BTUA 3S69A 1LPKB 1UJ1A 1G2MA 1SGTA 1KY9A 2Y6TA 2XBWA 2FTLE 2SGPE 1A0JA 2D8WA 3PLBA 1GDUA 1H9IE 3HKJB 4A6LA 5ABWA 3TK5A 4IS5A 3BIVH 4X6OA 1RXPA 4GHTA 3KNXA 1HAVB 1WBGB 3VGCB 5C1YA 1NO9H 4ZKSU 2AGGX 3JZ1B 1ABJH 1V2MT 3DA9B 1RRKA 4AGJA 1TNLA 2AS9A 4ISIH 1XUGA 3A88A 1O3PB 1YPJH 1NRPH 2G4TA 3T25A 3KN2A 1XUKA 4K1EA 1VZQH 4DW2U 1L1GA 5FXLA 4XFQA 3SV2H 1ZJDA 2CMYA 2BZ6H 4AG1A 2ZU4A 1HBTH 1NU9A 2XBXA 2GV7A 3MMGA 1JIMA 5DO4H 2ZDNA 4WH8A 3S7HB 1T4UH 1UVTH 1T7CA 3ENSB 1HAXB 4CREA 2PTNA 2G5NA 2NU4E 4K60A 1KDQB 3P92A 1SGRE 5A8YA 2A4QA 1F0RA 1W2KH 4AB8A 1QRZA 1O34A 1NM6A 1UTPA 1LDTT 2BTCE 2AMQA 2VIPA 1VITG 3S7KB 1TRYA 1RTLA 1D9IA 2PSXA 3P70B 2WPMS 5FX6A 1AVGH 3U1IB 4MPVA 2Y81A 2TBSA 1DUAA 1K21H 3SJKA 1DM4B 3HPTB 3U1JB 1WYKA 1P02A 1SBWA 4F49A 2Q6FA 1A5GH 2P3FH 1L4DA 1SR5C 5E8EH 2BD4A 5I25A 4ABBA 1QIXB 1GI2A 2WV5A 2P16A 5DPAA 1SC8U 3W95A 1AGJA 3LIWA 2A7JA 1DXWA 1VGCC 1LVBA 4AB9A 1PPFE 1W10U 2TGTA 2BQWB 4X6PA 4HTCH 1AVXA 1J8AA 1BA8B 2SFAA 1TIOA 1TNGA 3QK1A 3SJIA 2XCNA 4UDWH 3P8OA 4Y8YA 3ZVCA 1ETSH 1YPEH 4E7NA 1GJ9B 3MH6A 1QY6A 4I8HA 3SV6A 1TPOA 1HDTH 1TA2A 1A46H 3D23A 4AFSA 2GX4A 3N7OA 1HFDA 2NU2E 1TFXA 2GZ9A 2BDCA 1RJXB 2SGAA 4I31A 4DIIH 1TBZH 5BRRE 4ZHMU 3LH3A 4DVAU 3FFGA 2J38A 3MU4A 4IC5A 4DY7B 1ZJKA 2QA9E 1AVWA 3PYHA 2HNTE 1C5MD 1S6FA 1G3BA 4CR9A 3VB5A 2OQ5A 3MNBA 3PO1C 4IW4E 1BTPA 2WINI 1VITF 2GTBA 2FMJA 2M5TA 1W8BH 1NN6A 3E6PH 1V2JT 2JKHA 1GGDC 3TGKE 1LPGB 1KXEA 3OY6U 1OWEA 3I77A 1DY9A 2ZU2A 3ZZ8A 2FODA 4XSKU 1ZGVA 2FYRA 4CBNA 1HAYB 4YM9A 2R9PA 4NSVA 4WF8A 3PMHB 3RP2A 1GJDB 1J15A 1GJ6A 2G81E 1LQDB 3MNXA 1OPHB 1DVAH 1NU7B 1SG8B 3NKKA 3RMNH 2XYAA 3SQHE 3EA8A 1CA0C 1VJAU 1MTUA 5JPMH 2BY6X 2CF9H 1ABIH 1O5GH 1V2QT 1ZHPA 3SNDA 3FP6E 1LQEA 3Q77A 4JYVH 3KQEA 1B0EA 5DP8A 1LHCH 2HWLB 2BY8X 4DURA 1Y3UA 1ZPZA 2ZEBA 1NRNH 4AG2A 1FMGA 2WPIS 1O2WA 2P8OB 1GHAG 3KHVA 1F0UA 5F03A 2GP9B 1CBWC 1HJ8A 5FPYA 2O8LA 3A87A 1SQTA 1T8NA 1KLJH 1KYNA 1SVPA 1TNIA 1ZPBA 2Z94A 3UQVA 1EZQA 1K1MA 1TX6A 4O03A 4KTCA 1C2FA 2OBOA 1C9TA 1AWFH 1GI8B 2Y5FA 4O3UA 1H1BA 3ATLA 4ABDA 2J92A 5L6NH 1C2LA 1O3BA 1O33A 1DSTA 3SBKA 4BNRA 1C4Y2 4OGYA 5EPNA 4GCHG 1O5AB 3UNSA 1O3CA 3RXJA 4CBOA 4YLQH 4AYVB 1FZZA 3SV8A 1OXGA 1SHYA 1GVKB 1E34B 1ZLRA 2BDYA 2C8WB 5DJ7A 2JETB 1AUJA 1BTZA 5JB8S 1NROH 2VJ1A 3V13A 1TNJA 1FIZA 1F5KU 5E2OA 6GCHG 3UOUA 4Y7BA 5EQSA 1B5GH 2FLRH 2IPHA 2O8UA 3SO3A 2Z6BD 3UQOA 3QLPH 1P06A 4B75A 2BD9A 3LPRA 4X1RU 3PM3A 3NWUA 1NT1A 2ZGHA 5BPEA 2B0FA 3R0FA 4ZROA 3P95A 1BRBE 2SNWA 3UR9A 1INCA 1WAYB 2VVCA 1MCTA 1BMAA 1GBTA 1ZSJA 2VVUA 1HJAB 2FOGA 1O30A 2OBQA 1P04A 1FN6A 1N6XA 3P6ZB 2WPHS 5CMXH 1BCUH 1C4U2 1EOJA 4Y10E 1KTSB 5TCAA 3LC5A 1C5UA 1O2UA 2ZCHP 4B74A 3UFAA 6ESTA 1VCWA 1YBWA 1H9HE 2B9LA 2VWNA 3H7OA 4M7GA 4MPUA 3U8RH 2PKAA 5CHAC 4AFQA 4Z6AH 3RXAA 4D7FA 1Y3WA 3TH3H 2F9VA 2SNVA 1SGIB 1P11E 1FI8A 3RXRA 4X2VA 1SL3A 4IN2A 4IMQA 2VVVA 3SV7A 1C2HA 1WCZA 1UCYK 3V0XA 2BD2A 3NZIA 1GI4A 2HLCA 3A80A 3GCTG 3M5LA 3OTJE 1VCQA 2IN2A 4SGAE 2FZZA 2O8WA 1XXFA 4YLUA 1QA7A 4BTTB 3S0NA 3Q3XA 1TB6H 4BANB 3TNSA 3GCHC 3A85A 4Y71A 1PYTD 1YF4A 2BQ7B 3RDZA 2G8TA 1ESAA 4U01A 1GI5A 1OWHA 1MZDA 1BRUP 3MU0A 2QV1A 4Y0ZE 1O2NA 2GD4B 1TNKA 1JBUH 2ZHDA 5DP7A 5T6GA 5SGAE 1ETTH 2ZPQA 1MZAA 1BMMH 5TCCA 4I7YH 5AFYH 3U69H 4CHAC 1GG6C 1FLEE 3S9CA 2H5CA 2GV6A 1NS3A 2OC1A 2ZFTA 3VPKA 4RSPA 1C2IA 1ZTKA 2ZDKA 4LZ1H 3FZDA 3FANA 1DWDH 5HYOA 4K1TA 4WXVA 2ZA5A 5JDUB 3A7YA 2G55A 3Q76A 1V2RT 1T4VH 3RXLA 4YTAA 2UUYA 3GYLB 3TJUA 4ABGA 1Z71A 1NRQH 3TLOA 2VGCB 1UHBB 2ZWLH 1J16A 3ZV8A 1SPJA 1Y5AT 3I29A 4OS6A 3F9GA 4GAWA 1AFQB 2PKSC 1AWHB 1CT4E 1LHDH 1RGQA 1A61H 1GHWH 2PLXA 3UUZA 1CT0E 1O2XA 1SLXB 1F92A 3SU2A 3K2UA 2O9QA 1YCPK 3NK8A 1C5NH 1P9UA 1YYY1 1GBBA 2ODYB 4NIXA 1DXPA 1FJSA 2Z3CA 4CR5A 1XM1A 2B5TB 2VWLA 4GLYA 2RG3A 4A7IB 1L0ZA 2PTCE 5I46H 1O2TA 1ZRKA 1HGTH 3A81A 1FUJA 3QWCH 2ZCKP 1YM0A 2ZECA 1ELDE 1W12U 2ZGJA 4INLA 1SGEE 2O8TA 2KAIA 2GKVE 1UCYH 2NWNA 2QYIA 3ZZ6A 2R0LA 5EODA 1IHTH 2RA0A 4UEHH 1GVZA 3RXOA 1PJPA 2FOFA 4D76A 6CHAB 2BLQA 5IYTA 1O2OA 3RLYH 3AW0A 1QR3E 2GMTC 1TGCA 3BIUH 2LNCA 3STJA 1W13U 3STIA 1GJAB 1W0YH 1FDPA 1MU6B 1MKXK 2ZDMA 3LGWA 2ZHWH 3F1SB 4NIVA 2J4IA 1GBHA 5DP6A 1EP6A 1F2SE 2ILNA 4TY6A 5F8ZA 1XX9A 1W0ZU 4YO9A 3ZYEA 1UHBA 1C1PA 3RC4A 1T32A 5F6MA 4OS1A 1NTPA 3GY3A 3VFEA 2ZFQH 3M7TA 5FPSA 3NPSA 1UTJA 3QX5H 1YPHC 2XC0A 2EEKA 5TJXA 4UFGH 1ESBA 2AGEX 4JZ1A 1BOQA 1YGCH 2NU1E 4XE4A 3HATH 5GJ4B 2VB0A 2D26C 1QBNA 1TGBA 1WU1A 2ZF0H 4ZXXH 3T2NA 1MAXA 3SW2B 1TMTH 1TBRH 1F0TA 1Z8GA 2BB4A 1BJVA 1AZ8A 1DOJA 4K5ZA 4TY7A 1TWXB 1GI7B 1O2ZA 1KXDA 4I33A 4RN6A 1AN1E 2EC9H 4VGCC 3LGIA 3HK3B 1AMHA 3E8LA 5C67A 4NA9H 1AU8A 1IQEA 2I6SA 2FOBA 1OP0A 3A86A 3LT3A 1MTNB 3BEIB 4MNWA 1ZYOA 1C2DA 3CS0A 1EX3A 2XWBI 3A83A 1AI8H 3ZV9A 1GBCA 2FI4E 3ZZ9A 4KGAA 4WH6A 1HAPH 5JBTA 1OWJA 2QIQA 4GVUA 2EI7A 2H9EH 4K69A 1G3DA 1IQNA 2F9NA 2GT8A 3SU5A 1GCTC 2FDAA 4Q2KA 2BXTH 3Q3YA 1EAWA 4NCYA 1YCPH 2Z9LA 1ZHMA 4GHQA 5EG4A 1L4ZA 4JCNA 1UO6A 1AB9C 5J4QA 1V2ST 4JMYA 1E36B 1W14U 4NFEA 2Y82A 4NWLA 3CS7A 2YOLA 2CGAA 3KEEA 1C5VA 3RC6A 1ZSKA 1HXEH 2OQUA 2ZHEH 2VNTA 3MO9A 1CO7E 1ORFA 4NIWA 2OC0A 2XNIA 5HM9A 1DX5M 2XXLA 1Z1JA 5JB9S 4B76A 2ZPRA 2GZ7A 2BD8A 4X1SU 3L3TA 1OWIA 3IITA 3RMMH 4ISNA 1CHOF 4OS2A 1W7XH 4FUIA 2C93B 1EZXC 4O3TA 5EU8A 5A8ZA 1Q3XA 2FOMB 1BJUA 2P3UB 2FS9A 2CJIA 1VJ9U 1ZSLA 1XVMA 3E91A 2ZFFH 4GSOA 1V2VT 3SJ8A 1EAUA 4AORA 3BG8A 1G3EA 2AFQB 3MU1A 1HJ9A 1CU1A 1F5LA 1MKXH 2Z3DA 1A4WH 4I8GA 4KKDA 4JK5A 2G51A 1BRAA 1KTTB 1GI9B 2A2XH 3M36A 2BQ6B 2XWAA 4X1PU 3U9AH 2PR3A 1J17T 2F9UA 4FUGA 1AE5A 3ODFA 2A4OA 1NFYA 1VR1H 1QHRB 2Y7ZA 2CHAC 3NUMA 2ZTYA 3SU3A 4CRCA 4PROA 4INHA 1KXFA 2HNTF 1UK3A 1UTMA 5ESBA 3SV9A 4X1QU 1HB0B 4O9VA 1TGSZ 3W94A 3ZZAA 4R0IA 5DKMA 1SGCA 4CRBA 1O5CB 4K8BA 4CRFA 3RM2H 2R3UA 4NZLA 3P8NA 1WSSH 1PPBH 2G4UA 3M3VA 1PPGE 7GCHG 3KQCA 5EXLA 3E0NB 4WMEA 2BOKA 1O3FA 2F91A 4GUXA 4NA7A 1AFEH 3RXPA 1Z7KA 4QT8C 3FZZA 2BXUH 4XOJA 1C1MA 3AAVA 2XBYA 2F9BH 2ZU3A 2PSYA 1UTKA 1FV9A 1MUEB 2OTVA 1HAVA 1GCDA 4ASHA 1LVMA 1WQVH 3LJJA 2V3OH 1EKBB 1O0DH 4E06H 1A3BH 5K0HA 5LPEA 1WV7H 2BMGB 2HOBA 2D1JA 1D3PB 2O8MA 1K28D 3PB1E 1OSSA 3RM0H 1DPOA 3MI4A 1HAZB 2J95A 4AZ2B 3A82A 5GDSH 1DWBH 1DWEH 5AFZH 1J9CH 1L1NA 1LMWB 1JRSA 1TQ7B 2OD3B 3MH5A 3V3MA 1AHTH 1CGHA 2TGDA 4Y79A 1ELTA 1HIAB 2BZAA 3A7TA 3URCA 5E2PA 1DSUA 1EP5A 1PQ5A 4X8VH 4H6TA 3SU0A 3SOSA 1C5WB 1C5TA 3NCLA 1G36A 3RU4D 3TPIZ 3V12A 3PLKA 9ESTA 1BTYA 3BTQE 3TK6A 2BX3A 4LXBH 1AE8H 2BOHB 2WPJS 2G00A 3VXEH 1SQOA 1TPAE 1KDQA 1YP9A 3K6YA 4X2XA