3PLPA

Bovine trypsin variant x(tripleile227) in complex with small molecule inhibitor
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGIYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3plpA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3plpA02
1G30B 1CA0C 1O2IA 2Z9IA 2AYWA 4THNH 2C8XB 1SGTA 2Z9LA 1PPBH 2QA9E 1LCYA 4DIHH 1HIAB 1TALA 2BQWB 1EQ9A 2EI8A 2PGQB 4NG9H 1QB1A 2H5DA 4E06H 1Z6JH 1C2FA 2A31A 3E90B 4LZ1H 3RC4A 2FWWA 4KTUA 2P59A 2A5IA 1TPPA 1K1JA 2EI7A 5GDSH 3H7OA 1A61H 2ZG0H 1ANBA 1C5NH 4WH6A 5E0HA 5DP4A 1GCTC 3MNBA 1FPHH 2XTTB 1O2OA 1U6QA 5JBCS 4KP0A 1P2MA 1T31A 3LJOA 1TPOA 1C5UA 1THPB 3LC3A 1FONA 1T8LA 3ZZ8A 1ZYOA 9ESTA 3GOVB 1O2QA 1FN8A 1Q3XA 4CREA 2G4UA 3ZVFA 5EQSA 3RXRA 3K65B 4DY7B 2LNCA 1VGCC 1HXEH 2ZFQH 3KF2A 1T8MA 3N7OA 3ZVEA 1EAWA 3ZVAA 1O5CB 8GCHG 2ANKH 3VB4A 4JYTA 1Z1IA 1IQHA 4YT7H 1HAXB 1VJ9U 5HM2A 2XBXA 5AFYH 1JRTA 5LGOA 3EGKH 1UCYK 3SZNA 2VIPA 1TRNA 1X7AC 1F5LA 1QTFA 4U30A 2B8OH 1ZR0A 1XXDA 1S83A 5FAHA 2GD4B 4RN6A 1MH0A 1N1LA 3JZ2B 2FOHA 1C5RA 3A88A 3LGTA 2XC4A 2A5KA 2BXUH 1C9TA 3A8BA 2HALA 5A09A 2QV1A 2BOHB 1C2LA 1W2KH 1V3XA 1PYTD 3U9AH 3P70B 4X6NA 4K1EA 1UCYE 3FANA 1C4Y2 3BN9A 4ISOA 4JMYA 1XKAC 4VGCC 1KXBA 2V3OH 1W11U 4DOQA 4NZLA 4YOGA 2ZGBH 1F92A 4H42U 1TMTH 3LGVA 4I8KA 4BTUB 4CH8B 1TNHA 2ZFPH 1SGDE 1ACBE 3M5LA 2Y5FA 3BF6H 1MTWA 2BDIA 2BQ7B 3A84A 3VGCB 1C5QA 1GHAF 2B9LA 1G3EA 1OWIA 1BRCE 3PLBA 4FUEA 1O37A 1FDPA 3SORA 3ELAH 1ZGVA 1G37A 1A7SA 1SGEE 2BQ6B 3NXPA 3LGYA 3EA8A 3L6PA 4TPIZ 4B74A 3TJUA 4IMQA 1ABIH 2ZFSA 2ZWLH 1TIOA 5EPNA 3A87A 1PJPA 1K28D 4CRGA 1O3LA 3SUDA 1K1PA 2A1DB 4NFEA 4JZ1A 4WMDA 4I33A 1ELDE 5ABWA 2FLBH 3S9AA 1MBMA 1GI4A 1SQTA 4JZIA 3SU2A 3PMJA 2BDGA 3TJNA 4MPWA 1GHBF 2ULLA 5K0HA 3VB6A 3KL6A 5GPIB 2BVXH 1EATA 3P6ZB 1ETRH 2ZDMA 2B7DH 1YGCH 2AFQB 1AKSA 1FIZA 1O5FH 1GJ5H 1C2KA 1ZTLA 1H1BA 3BTGE 1BTPA 3T2NA 2WPLS 3W95A 3QLPH 1GJCB 1GBJA 3S9CA 1BTUA 3EDXB 1OWKA 2PWXA 3A8CA 4BTTB 1P04A 5JPMH 1PPHE 1DPOA 2RG3A 4NSVA 2GCTC 3UWIA 4CRDA 1O3GA 1QRWA 1SGFG 1OP8A 1S82A 4X8TH 5ESTE 2FI4E 2A7HA 1GG6B 1LVYA 3ATWA 1P05A 2ZHQH 1TRYA 2VWLA 3BEIB 3GY4A 4XSKU 1DITH 1EP5A 3PM3A 3BIUH 2ZDKA 2WUCA 4FUGA 3UWJH 1O39A 3ZZ6A 1K1IA 4WXVA 2GZ9A 1W12U 4CR9A 2VVCA 1BBRK 4RKJB 2SGFE 1O3JA 1QR3E 3VFEA 1ZJKA 1DE7H 3TPIZ 1WTHD 4NA8A 1WQSA 1A5HA 2AGIX 1A0JA 1ZGIA 3P8FA 5BRRE 1GJAB 1XUJA 1QURH 2RCEA 2C8WB 3PB1E 2CGAA 4BAHB 3ODDA 3RU4E 1NFXA 1SLWB 1UK2A 4GVUA 1BJVA 1GJBB 1QRZA 5T6DA 1HNEE 1GI5A 3NCLA 4XBDA 2ZPQA 2W26A 1QNJA 2ZKSA 1GMCF 1AKSB 3M3SA 2P16A 1C5VA 1ZZZA 1O38A 1ZMJA 4FUCA 3SQHE 2H5CA 2BD7A 1KXFA 4HGCA 1BBRE 3K6ZA 1O2JA 4ISLA 3BIVH 3D65E 4TYDA 4CRAA 3SU4A 4H4FA 4KKDA 4U01A 3RLWH 1FN6A 3UNSA 4HTCH 2ANWA 1LKAA 1EZQA 2BTCE 1RIWC 1JIMA 1THRH 4UE7H 1VR1H 1GMDG 3CS0A 2GX4A 2AIQA 1TB6H 1C1UH 2QYIA 1TOMH 5CMXH 3A8AA 3MWIU 4E7NA 1AD8H 1AIXH 1BRBE 2TPIZ 1QBOA 5A0BA 4A1VA 3URCA 1P10A 4YZUA 3SV7A 1G3DA 1AUJA 2WYJA 4GPGA 4NIWA 3AW0A 2A5AA 2A32A 2OLGA 2FESH 1LHGH 5A0CA 2Y7XA 4UFDH 4OS2A 1S6HA 3A81A 4I8HA 1BUIA 5G4BA 2BY5X 6ESTA 5C5OA 5DP8A 3M61U 2WINI 1GJ6A 4IBLH 1HJ9A 4X6PA 4ISIH 4I8JA 6LPRA 2PGBB 1O2WA 2FOCA 3P8NA 2G51A 2BMGB 1BCUH 1Z6EA 2VWMA 3LOXA 1SBWA 1SMFE 4Q7ZA 4BOHA 3ODFA 1DT2A 3BTWE 2G4TA 3RXVA 2VB0A 1G3BA 3RXOA 4A1XA 1BMNH 2R9PA 5E0JA 1V2UT 1O2YA 2HVXA 4E7RG 3KN2A 1A5IA 4XE4A 1WUNH 3UOUA 2V6NA 2Y5GA 1C1SA 1C5ZB 1PQ8A 1RTFB 3A7WA 4O97A 1FY5A 1GBEA 2C8YB 1ARCA 4MVNA 2FOAA 3KHVA 1LPGB 1Z8RA 5GCHF 4OS6A 2XW9A 3P92A 5A2MH 2HPPH 3T29A 1GBLA 2IJOB 1O5DH 2G52A 2W7UA 2D1JA 5GWZA 1QJ1B 4ABHA 1CT0E 1C1WH 2GDDA 1WOFA 3U8OH 4LXBH 3UFAA 1C1NA 5GJ4B 1F5RA 1O3PB 2B5TB 3MU4A 1CBWC 1GHBG 1YPJH 3GY3A 1YCPK 1DDJA 3S7HB 4YOJA 1QA7A 1THSH 3R0FA 3S0NA 2TGAA 2WV4A 4KGAA 2PKSC 2OTVA 4D7GA 4HI3A 4X8VH 3F6UH 2FI5E 2ZU3A 3LU9B 1KLTA 3S7KB 5L2ZH 3S69A 1NS3A 1ELAA 1GPZA 4HFPB 1BJUA 3QZQA 1XX9A 2G00A 8LPRA 1GHWH 2EEKA 4ABIA 1P8VC 1HFDA 2GP9B 4F4OC 2XCFA 1TQ0B 1QHRB 2ZEBA 4XFQA 1Z71A 1AN1E 1QBNA 4NA7A 2TRMA 3MMGA 4UDWH 3QTOH 1JMOH 2ZDAH 3RMOH 2HOBA 3GCOA 1GBCA 1EOLA 1IAUA 4Q7YA 1W0YH 2Z9JA 2HLCA 2G5VA 4DT7B 2VINA 3PMHB 5I25A 1HV7A 2HNTE 1P9UA 3SHCH 3ZV9A 3GDVA 1IQKA 3A7TA 1XM1A 1ELCA 1HAPH 3D49H 1Q2WA 1GGDB 2AMDA 3SU0A 1FY3A 5DP5A 1N8OB 4I32A 1MKXK 4LOYH 2W3IA 3A8DA 1IQJA 4YLUA 1IQEA 5GIBA 4JZEH 1BTYA 4INLA 4KTSA 1TBZH 4CBOA 4NGAH 1BQYA 3MI4A 2PW8H 1FY8E 2QN5T 3BTFE 1TA2A 2AS9A 2J38A 2G55A 4FVBA 3TGKE 3DFJA 1TBQH 1OWDA 2BDYA 5HYOA 3RM2H 3T5FH 1NT1A 3UNRA 4AB8A 1CGJE 3LPRA 1O32A 3A7XA 3TNTA 1ESBA 1ESAA 3VB5A 1O2KA 1D3DB 3BTME 1EKBB 3AAVA 4WY3A 3RXMA 1CHOF 3GYMA 3GY5A 1DY9A 1QCPA 4AORA 1RGQA 1QGFA 1O5BB 2FOEA 2VJ1A 1TGBA 5T6FA 2I6QA 2IPHA 2AGEX 4FU9A 1AB9B 3RXAA 4Z6AH 3K2UA 1GBTA 1G9IE 1V2JT 3C27B 4CH2B 4ZKRU 1GI8B 4Y7AA 2NU0E 1KLIH 2THFB 1CE5A 3CS7A 3SGBE 1VITF 1ZJDA 3GY7A 1JIRA 3Q3XA 2Q1JA 2ZCKP 1T4UH 1K1MA 3OX7U 4WJG2 3M35A 1AZ8A 1D6WA 5A8YA 4CRCA 1C1PA 5PTPA 3ZZ7A 1BMMH 3TNSA 2FPZA 3RXBA 3T28A 1KXCA 4XBCA 2A2XH 2F83A 2R2MB 4YOIA 1EAIA 3PO1B 1C2DA 1F0RA 3E0NB 4GLYA 1E37B 1FY1A 3DT0H 3EA7A 4R0IA 4DJZB 4Y0YE 4OGYA 1SOTA 1K1LA 2SGPE 1K22H 3BSQA 1C1RA 2JH0D 3GCTF 4DVAU 4NIVA 2UUYA 3ZZCA 3LIWA 3MNCA 2ZDVH 3A86A 1ZPZA 2BB4A 2FODA 1EZXC 3LONA 1FMGA 1Y59T 4FUDA 4X1QU 4AG1A 1Y3VA 2PUQH 3QUMP 2Q6GA 3UTUH 4NZQA 3A7YA 3K6YA 5GCHG 2ZNKH 1FLEE 1RD3B 2A2QH 1ZLRA 3GCHB 4GCHF 5CE1A 2PV9B 2BLWA 1QL8A 2FO9A 1FUJA 1NRNH 2CHAB 3F1SB 2G8TA 1O31A 2Z9KA 4X2WA 1EP6A 5AHGH 3MU0A 1S81A 3ZZAA 3RXFA 4CRFA 1WTGH 2A0QB 4FUFA 1PPZA 4ABFA 3BG4B 1BTHH 2VIWA 1C2IA 3RMNH 4JK5A 1GHYH 3BTQE 1G36A 1BB0B 2YNBA 2F91A 2R2WU 3E0PB 1P2NA 3LDXH 3RXSA 2AH4X 1AWHB 4BTIB 2A4QA 1Y3XA 3D62A 2RA3A 4AYVB 2QF3A 1MBQA 3F9EA 1C2MA 1IQNA 1TNKA 2OBQA 1NTPA 1GMDF 1UVSH 2WPIS 2VU8E 3KQCA 2NWNA 4UD9H 2Y5HA 3QZRA 5F8ZA 5HXFA 2ODYB 3ZZ9A 1S84A 1XXFA 1ZTJA 1P0SH 1QJ7B 2GV6A 2O8UA 1WCZA 3GDSA 2H9EH 1TPAE 5DP3A 1W7XH 1O34A 3A83A 2ZQ1A 4DURA 1SLVB 2ASUB 1NRPH 1BTZA 1SGIB 3F9FA 1JOUB 1LHCH 2FYQA 1WBGB 1AU8A 1HAHH 4AFZA 3RXQA 3LH1A 2A4OA 2HNTC 4K1SA 3MO9A 5DJ7A 1PPEE 3SJ9A 3AVZA 4CRBA 1SLUB 2R0KA 1P02A 3UIRA 3V0XA 2Z3CA 1C9PA 3O8DA 1FXYA 3SJKA 1SSXA 5DP6A 2JETB 2UUFB 2BM2A 2XC0A 3GY2A 5EGMA 1T7CA 4HZHA 2C8ZB 2XXLA 2D2DA 2VGCB 1TONA 3FZDA 3O8BA 1MKWH 1Y3YA 1LHEH 2ZFTA 3LGUA 3TJOA 3BEFB 3F68H 1TQ7B 4NIXA 2GKVE 3RXJA 3VB3A 3MOCA 1H4WA 1GJ4H 2FOFA 1EJMA 1QFKH 1PPCE 4FXGH 1N6XA 1C4U2 2ODQA 6GCHF 3M37A 1AVWA 1ORFA 3AAUA 1K2I1 1MCVA 1P03A 4X1RU 1ELEE 3MNSA 1CHOG 1W13U 1AE8H 1N6YA 4J2YB 2ZGJA 3EYDA 2CN0H 2UWLA 1VCPA 2FS9A 2Q6FA 2NU3E 4F49A 2OCVB 1O3MA 1C2GA 1JXPA 3P17H 4ZAEA 1GL0E 1MMJN 4ABGA 4BAMB 1MUEB 5JBBS 1O2ZA 1TGCA 1PPGE 2GT8A 5C5NA 1ARBA 1ANDA 1JRSA 1VITG 2DUCA 3A80A 1UO6A 1O36A 1A1RA 2Y6TA 3AASA 4Y79A 1MZAA 1FNIA 1TMUH 1OKXA 4K3JA 3VGCC 2SGQE 1SC8U 4O9VA 4UFGH 3MNXA 2JH5D 1O3KA 3C1KA 1WAYB 4WMEA 2QC2A 2A4RA 3GY8A 2H1UA 2WV5A 1GBMA 4NSYA 1Z8GA 3GDUA 3E1XB 1ELGA 5HM9A 2XNIA 2WUBA 2R3YA 2Y80A 3LGWA 1QBVH 3GCTG 1E34B 1CVWH 2AMQA 2Z9GA 2BDAA 1SFIA 3RXEA 2ZGCA 2BOKA 1J16A 2UWOA 1P9SA 1PQ7A 1IQFA 1UTMA 1LVBA 1NRQH 5AFZH 1O3NA 3UUZA 2VH6A 3M3VA 1OXGA 1QB6A 3SW2B 4CHAB 1YF4A 5EQQA 4MQAA 2BDHA 2CMYA 2FM2A 2P8OB 4GCHG 1QB9A 4X2VA 1J17T 2ZTZA 2GZ8A 1Y8TA 3ZYDA 1C5MD 3BTEE 4MPXA 4X2XA 1FJSA 1O2TA 1JBUH 1A4WH 2QAAA 3BG8A 3TVJB 4BAQB 3PV4A 5EOKA 3MTYA 1GJ7B 1UTPA 1PFXC 1H9LB 3NZIA 3RU4D 4ISHH 2A7CA 3BTHE 2P94A 1T8OA 1GG6C 3RXHA 4DW2U 1W10U 4QT8C 3RMLH 5TCAA 1C5PA 5CHAB 1FAKH 1AO5A 3NKKA 5IYTA 2ZA5A 2Z3EA 4AYYB 1UTJA 1RS0A 1V2TT 3U1IB 5C1UA 2FP7B 2GMTB 4OS7A 1GBIA 4WH8A 2BDCA 5L6NH 2IOTA 5DKMA 5FCKA 2BD5A 6CHAB 1DUAA 1V2MT 3SHAH 4X8UH 2J2UA 4X6OA 1LKBA 1CT2E 4MNYA 2ZHEH 3M5OA 1T8NA 5F8TA 3PLPA 3TLOA 1EPTA 3DA9B 1OPHB 4MPVA 3VXEH 3VPKA 2J94A 1P3EA 1VCWA 3ESTA 2ZFRH 2PSXA 3Q00A 3V7TA 3K9XB 2VWNA 4OS5A 1ZHPA 1ANCA 1Z7KA 1GBDA 2VWOA 1DFPA 3I29A 2RA0A 3Q3KA 2B0FA 2XWAA 2J4IA 1LHDH 1MAYA 5FCRA 2HWLB 1SGYE 1HAIH 4B76A 1S6FA 3MH5A 1C2HA 4WVPE 3ITIA 3RXCA 4BNRA 2QXJA 2BD4A 2GZ7A 1C1VH 1W14U 3ATMA 4M7GA 4AX9H 2BZAA 1GL1A 1TOCB 3T26A 2ZHDA 4DG4A 1EJAA 2H9HA 3HATH 3KGPA 1DSTA 4AFUA 2SGDE 4ZHLU 4MTBA 8KME2 3PWBA 2ZP0H 3ATIA 3SI3H 3I78A 3RDZA 3T25A 1A0LA 3B23B 1E0FD 2BY7X 1O2HA 2A4GA 3D23A 1DLEA 1GCDA 2QXIA 1BIOA 3SU1A 3RXKA 2YNAA 4UEHH 1K21H 1PYTC 1EB1H 1LVOA 1C5XB 1XKBC 2XWBI 3E6PH 2FYRA 3QGNB 1GI1A 5FX5A 4ABEA 6GCHG 2Q6DA 1XUIA 1DXWA 1MQ5A 1GBKA 1BTWA 3A89A 2Z94A 5LPEA 4IC5A 4UONA 1IOEA 3IITA 1EPTB 3SQEE 2P95A 1EZSC 1EUFA 2ANYA 1SGRE 5EU8A 2FDAA 3TK9A 5FX6A 1Y5BT 4IN2A 1O2XA 2JKHA 1C5LH 1IQMA 1GI0A 1KIGH 2UUKB 1MD7A 1YPKH 3TH3H 1QQUA 1NROH 3EE0B 3RXLA 4K2YA 3GY6A 4AFQA 1G2LA 2ILNA 2Y81A 4FU8A 2VNTA 1C2EA 1TX8A 4U2WA 2J9NA 1S85A 4K8YA 1C1OA 3ZYEA 4JYVH 2ZHFH 3QGJA 2OINA 2FOMB 5JYIA 2ZDLA 2P3FH 4Y8XA 1P11E 4AZ2B 2KAIA 2G5NA 3DHKH 4A92A 3SU5A 1QY6A 2TGDA 1YPHE 1DSUA 2EC9H 2C90B 3EQ0H 3FVFB 3U98H 2XCNA 3ZZBA 1DICA 1BMLA 4A6LA 1EJNA 1QIXB 5A8XA 3M7TA 4ZKOU 1D4PB 1NFUA 2FS8A 3UQVA 1K1NA 1SG8B 1HPGA 1SHYA 1D9IA 1HAYB 1GVZA 2HNTF 4D7FA 1V2LT 1AFQB 1KY9A 3QTVH 2WYGA 1EOJA 1MD8A 1BOQA 2K1QA 2BVRH 9LPRA 3A7VA 3GYLB 5C1XA 4AOQA 1UK4A 4K60A 2FZZA 1E38B 2AEIH 3O8RA 1TA6A 3QK1A 4YO9A 3HPTB 1YP9A 1YC0A 3PMBB 5A0AE 4AFSA 4FUJA 1MTUA 1ZHRA 1OWHA 3PROA 5JDUB 1NC6A 3TK6A 3W94A 1AVXA 4B71A 4A1TA 2JH6D 2TIOA 2RDLA 2O8MA 2IN2A 1GVLA 1O3HA 5K7RA 2QIQA 4X1PU 1WV7H 4ZHMU 1Z8JB 4WWYA 1ZMLA 1SOZA 1V2PT 3HK3B 4R8TB 4DCDA 3QO6A 1QQ4A 1LO6A 1HJAB 3M36A 4JYUH 4B75A 3FFGA 2ZCHP 3L3TA 1TRMA 3SU3A 1ZPBA 3R3GB 2KAIB 2BD3A 3IWMA 1C5TA 1EASA 1SGCA 3QWCH 1AFEH 4INHA 4ZHAA 1O2LA 1GGDC 4XOJA 1D6RA 1MU6B 1QJ6B 3QX5H 1N8OC 2XBVA 1D3QB 3SBKA 4MNXA 3P8OA 2BXTH 4Y11E 2PTCE 1ID5H 5HMAA 1NU7B 3E16B 3H5CB 1VITH 1W8BH 2V35A 5DGJA 3LKWA 2P3UB 3Q77A 1D3PB 4D76A 1WQVH 3F9GA 4NFFA 1TNGA 4Y76A 1TBRH 1UMAH 1J8AA 3SNAA 4TWYA 1O2VA 4D9RA 5JBAS 3HKIB 3UR9A 2Y82A 3UY9A 1BITA 1LQDB 1O3FA 5FPSA 3ZV8A 5JBTA 7ESTE 3SUEA 5DO4H 4SGAE 1EX3A 5C1YA 1CO7E 1HB0B 2I6SA 1SGNE 5C67A 4GHTA 1YPLH 1SQAA 3ATLA 4MLFB 1YM0A 1OP0A 3U1JB 3FP8E 4BAOB 1HRTH 4XDEA 1O3EA 2SNWA 1W7GH 1HCGA 3AW1A 3CENA 3SV2H 4BAKB 4D8NA 1HGTH 2ZPRA 1TYNA 1AB9C 2ZZUH 2ZTXA 1TGNA 3E91A 2ZF0H 2Y7ZA 1RTLA 3E8LA 3RXIA 1CA0B 1O0DH 3RXDA 3KQDA 1T4VH 2ANMH 4Y6DA 1NFYA 1SQOA 2XBYA 4GUXA 3UPEA 4H6TA 1ZHMA 2FTLE 2WPMS 1AI8H 4INKA 1GMHF 1DS2E 1KSNA 1NY22 1J14A 2V3HH 1FIWA 1GCTB 2XRCA 1LHFH 3P95A 1MTNB 2WPHS 4YT6H 3PO1C 3PYHA 3U8RH 5T6GA 1O33A 3TU7H 3PTBA 2BX4A 1H8IH 4OS1A 2AMPA 3RM0H 1VGCB 5LPRA 2EA3A 5J4SA 5FHTA 1GJDB 3SJOA 2TGTA 1J15A 1TAWA 4JK6A 1BHXB 4B2BA 2QCYA 7LPRA 1BA8B 4WF8A 2VVVA 1FZZA 5C2ZA 2H9TH 1INCA 3OYPA 5AVDA 1V2RT 1C5SA 1MAXA 3LC5A 1BRUP 1MTSA 3GCHC 1DM4B 3MYWA 3BV9B 3FAOA 1VZQH 1ZSKA 1KTSB 2CHAC 1SGQE 1ELBA 1ZSLA 1MTNC 1YPHC 1YCPM 1ZTKA 5SGAE 5DK1A 3GCNA 3SUFA 1UVPA 1OX1A 1O2RA 3UQOA 3RP2A 4FUIA 4BANB 1ZSJA 1A46H 3MH6A 1OS8A 4ZUHA 1O3AA 1UCYH 2CV3A 3BG4C 3JZ1B 1SL3A 1EB2A 1DWCH 4X2YA 1KXDA 1LQEA 1XUFA 1TFXA 1L1NA 1P57B 1IQIA 2XYAA 4B1TA 1IQGA 1BRAA 3SV8A 2O8LA 2TBSA 4VGCB 5LH8A 1P2IA 3ZVDA 1O2UA 1ZRBA 2ZI2H 2G81E 4O3UA 2QF0A 1DANH 2PLXA 1V2OT 2HRVA 1O35A 1KTTB 4ZKNU 3V13A 2C4FH 3HK6B 3Q3YA 4I8LA 3VXFH 1GWAA 4WMFA 5TCCA 1P2QA 4B2AA 4TPYA 5FBEA 1AGJA 2R0LA 2CF9H 1SGFA 7KMEH 3HKJB 3MO6A 1V2VT 3LH3A 4ZXXH 1NO9H 2ZGXH 1S0RA 1TNIA 5EPYA 8ESTE 2FOBA 5E8EH 1GBHA 2BYAX 2YOLA 1OWJA 2OQ5A 2VIQA 3H7TA 5BPEA 2WPKS 1DUEA 4Y0ZE 2STAE 2DE8A 2HPQH 2ZQ2A 5I46H 3NPSA 1F7ZA 1NZQH 1UK3A 1WSSH 3KQBA 1XMNB 2F9BH 2OC1A 3FP7E 3PMAB 1MKWK 3P8GA 2AIPA 4TWWA 1GI2A 1YLDA 1G2MA 3LT3A 1O5EH 1E36B 2A7JA 4YESB 2ODPA 2ZHWH 1GJ8B 1LDTT 1HJ8A 1AE5A 4K8BA 1AQ7A 1P3CA 1NN6A 1NRRH 2BVSH 2JETC 3MU5A 4Y8YA 1UTLM 2XC5A 5F6MA 4Y10E 3SV9A 1TLDA 2VGCC 2BD8A 2XBWA 1NPMA 1MQ6A 1SHHB 1FAXA 3KNXA 4O3TA 1AHTH 3U8TH 1GI3A 1H8DH 2AERH 1DXPA 1H9IE 2GDEH 4H6SB 2ZU1A 5DPAA 5E2PA 3KEEA 4IC6A 1L2EA 1VCQA 2ALVA 2GCTB 1NESE 3GICB 5EXLA 1HAOH 2O8WA 4ZXYH 3ZZDA 4AB9A 1UVOA 3FZZA 3TITA 2FOGA 1XVOA 1GBFA 1PPFE 1YPMH 2V0BA 1C1TA 2BZ6H 4RKOB 1YPGH 2OC7A 2OC0A 1W0ZU 3A85A 4MPUA 3T27A 1UVTH 2ESTE 4ZKSU 1TPSA 1P2KA 1F5KU 4JCNA 3B9FH 4X1SU 1V2KT 1DOJA 1AUTC 4IN1A 1ETTH 1AMHA 5F03A 2OUAA 1ABJH 1C1MA 1OYQA 1TWXB 4IS5A 4NWKA 1G32B 1ZMNA 2PFEA 1RRKA 4I7YH 1NFWA 1GDUA 4BXSA 1A3BH 3ZVGA 4KTCA 4TY6A 2UUJB 2PKAA 3RC5A 3TK5A 5A8ZA 1ZPCA 4YLQH 1Y5UT 1SLXB 1EZUC 2P93A 2H2ZA 1BBRH 3KQEA 3STIA 1F0SA 3NWUA 3SNCA 1IHSH 4YTAA 1BDAA 1GMHG 4U32A 1GDNA 1P2JA 2SFAA 3BTKE 1CU1A 1ANEA 2STBE 3OY5U 1CT4E 3SNBA 1MTVA 2R3UA 1TE0A 1P09A 4MNWA 5DP7A 1EXFA 2LPRA 1G3CA 1HAGE 5ETXA 2BX3A 4J1YA 1YLCA 1UTQA 1H9HE 2J34A 1CGHA 3M3TA 4OS4A 5DG6A 3TH4H 5FXLA 3SV6A 2P3TB 4DIIH 1JWTA 3MH4A 2OXSA 1RIWB 4TY7A 1HUTH 1O2MA 2Z3DA 5DP9A 4IMZA 1DWEH 5ESBA 1YKTA 4FVDA 4CR5A 5FPYA 1UHBA 1OSSA 5C3NA 2ZTYA 2FXRA 1ELTA 1XUKA 4IW4E 5FPTA 1XUGA 3HGNA 4CHAC 2BY9X 1MU8B 3BTDE 4D9QA 1DWDH 2P8OC 5E2OA 1O2GH 1AVGH 1ZOMA 1KDQA 1SVPA 2D26C 2FX6A 3U69H 3M7QA 1GI6A 2Z7FE 1OOKB 3GISB 5F8XA 1L1GA 5HGGA 7GCHF 4NWLA 3RXGA 5LPFA 3Q76A 1YYY1 2J95A 2VIDA 1HAVA 2F9OA 2WPJS 2C3SA 2F9PA 1UVUH 3OU0A 3SGAE 1C5YB 2PHBA 4LZ4B 2ZIQH 4NCYA 1O5GH 1BZXE 4ZROA 5E0GA 3RLYH 2GCHF 3PTNA 5CHAC 2PUXB 1B5GH 1VJAU 4ZH8A 1Y5AT 4IGDA 2PKAB 1SGPE 2M5TA 2BHGA 1DX5M 1A2CH 1TX6A 1DLKB 2ZPSA 2H6MA 2GMTC 1SFQB 2OD3B 1BMAA 1Z1JA 5AF9H 1GDQA 4AGJA 6CHAC 1V2WT 2ZGHA 3BEUA 1FQ3A 5GXPA 1FI8A 2SGEE 3RXUA 2QXHA 1UTOA 1YBWA 3SJIA 4ABBA 1LTOA 2NU2E 3QDZB 1D3TB 2BD2A 1K1OA 1Y3UA 1GBBA 4ABJA 3L33A 4ASHA 1BTXA 5L30H 4UFEH 4OGXA 3OSYA 3FP6E 1Y3WA 1M9UA 3CP7A 1EAUA 1F0UA 1QRXA 2ZU2A 3UNQA 3E3TA 4A7IB 1UHBB 3IG6B 3VEQB 1L1JA 2BDBA 3SJ8A 1KXAA 1BT7A 4O03A 3RXTA 3SOSA 1AZZA 1WYKA 1HYLA 1CBWB 2DE9A 1HXFH 1B0FA 3TIUA 1KDQB 1SR5C 5EW1H 1FPCH 3G01A 1PQ5A 2FIRH 2PKSB 4K5ZA 1HAVB 1KYNA 1OWEA 1CHGA 4ABAA 1GHAG 4Y8ZA 2OBOA 2NU4E 2QXGA 2VIVA 1HAZB 3NUMA 3RC6A 1QL9A 2FTMA 5JB8S 3ATKA 1HLTH 5EODA 1C5OH 1O3IA 1A5GH 2BD9A 3WY8A 3SI4H 1ETSH 1V6DA 1YCPH 4WXIA 3TH2H 2ZDNA 1O30A 2BY8X 3DD2H 1A3EH 4X1NU 4XBBA 3ZVBA 1DVAH 4RSPA 1CGIE 1AY6H 1PQAA 2W5EA 3SGQE 3OTJE 4I31A 3T62A 2CF8H 2C93B 2A45B 1UJ1A 1B7XB 3ZZ3A 1KXEA 4A5TS 1TGSZ 4B73A 3ENSB 1C2JA 3SUGA 3PLKA 2VH0A 2OQUA 1MCTA 1J9CH 1RFNA 1KLJH 1ELVA 2PR3A 1ZRKA 2GGVB 1GJ9B 1EPTC 1BHXF 3A7ZA 3DFLA 4UFFH 4AGKA 1GI7B 2ZU5A 4MNVA 2ALPA 2O8TA 1E35B 1OYTH 3RU4T 1RXPA 3SU6A 1F0TA 1LPKB 1TMBH 1L4ZA 3MU8A 1ELFA 1HDTH 2F9UA 3M5MA 3M7UA 8GCHF 4K69A 4E05H 3SNEA 1LPZB 2SNVA 1Z8IB 2F9NA 1GHXH 3UR6A 1TNLA 2ZC9H 4I8GA 1OP2A 4ISNA 3S9BA 4ESTE 2FMJA 2VIOA 4FUBA 2F3CE 4AN7A 1P06A 4MG3A 1UTKA 2ZU4A 1MKXH 4ABDA 2AGGX 4X0WU 1K9OE 5B6OA 1GHVH 1FV9A 3SNDA 4GAWA 4K1TA 3VB7A 1P12E 1NM6A 2BLVA 2PTNA 3PWCA 4DGJA 1AFQC 4Q7XA 5EG4A 4Q80A 4KELA 3LJJA 5EXNA 1HBTH 3RUOA 2NU1E 1DY8A 3EA9A 1P2OA 5IDKA 3MH7A 3A82A 2CJIA 5TJXA 1RJXB 1W3CA 1F2SE 3QN7A 2BLQA 1QL7A 2UWPA 4Y71A 1SPJA 3V12A 2VVUA 3TGIE 5L2YH 4PROA 3I77A 1DWBH 3M5NA 5H4IB 5C20A 3F9HA 1C1QA 1SB1H 2FI3E 2ZECA 1GMCG 4ZMAH 3MHWU 4Q2KA 2FEQH 3KIDU 4Z0KA 1CQQA 2Z6BD 5T3HA 7GCHG 4GSOA 3ZZ5A 1O2PA 1O3DA 3TJVA 1CA8B 3V3MA 2OP9A 1S0QA 2PSYA 1S5SA 1YPEH 3STJA 1NRSH 2W3KA 2SGAA 2GT7A 1TNJA 1C5WB 1B0EA 1AWFH 1TX7A 2HGTH 2ZO3H 1O2NA 2GCHG 3B8JA 1O3BA 3BTTE 4LK4A 3NK8A 1HIAA 1HJAC 2FX4A 4FUHA 1XUHA 2TGPZ 1UTNA 2F9VA 3MO3A 3DUXH 1GBAA 1XVMA 3RXPA 1L0ZA 1LVMA 1V2QT 2GVFA 1A0HB 2BY6X 2FLRH 5FBIA 4AG2A 2O9QA 3SN8A 1O2SA 4B2CA 3RMMH 2GV7A 4NA9H 5EW2H 1FY4A 4BXWA 3MFJA 2D8WA 2OC8A 5EQRA 1O3CA 3ZVCA 5J4QA 1MZDA 1P01A 3URDA 4GHQA 1QA0A 5EXMA 3OY6U 3TGJE 1O3OA 3EAJA 4FU7A 1TABE 4X8SH 1SI5H 3ZZ4A 2QY0B 2ZCLP 2ZFFH 1Q31A 1L4DA 1GI9B 1IQLA 1EAXA 2BLOA 1TGTA 5JB9S 2J92A 3HGPA 3LGIA 3UREA 1NU9A 1O5AB 2W7SA 2CXVA 3MU1A 3KCGH 3O8CA 4CBNA 4JZDH 2GTBA 1RTKA 1C4V2 1LMWB 4JZFH 3SO3A 4Y7BA 1V2ST 4SGBE 1V2NT 1ESTA 1IHTH 4NIYA 1GVKB 2EI6A 4YM9A 1WU1A 1GHZA 4MDSA 3UOPA 1CSOE 4X6MA 1T32A 2QGRA
chains in the Genus database with same CATH superfamily
1G30B 1CA0C 1O2IA 2Z9IA 2AYWA 4THNH 2C8XB 1SGTA 3WWBA 2Z9LA 1PPBH 2QA9E 1LCYA 4DIHH 1HIAB 1TALA 2BQWB 1EQ9A 2EI8A 2PGQB 4NG9H 1QB1A 2H5DA 4E06H 1Z6JH 1C2FA 2A31A 3E90B 4LZ1H 3RC4A 2FWWA 4KTUA 2P59A 2A5IA 1TPPA 1K1JA 2EI7A 2J5UA 3H7OA 5GDSH 1A61H 2ZG0H 1ANBA 1C5NH 4WH6A 5E0HA 5DP4A 1GCTC 3DSPA 3MNBA 1FPHH 2XTTB 1O2OA 1U6QA 5JBCS 4KP0A 1P2MA 1T31A 3LJOA 1TPOA 1C5UA 1THPB 3LC3A 2OK5A 1FONA 1T8LA 3ZZ8A 1ZYOA 9ESTA 3GOVB 1O2QA 1FN8A 1Q3XA 4CREA 2G4UA 3ZVFA 5EQSA 3RXRA 3K65B 4DY7B 2LNCA 1VGCC 1HXEH 2ZFQH 3KF2A 1T8MA 3N7OA 3ZVEA 1EAWA 3ZVAA 1O5CB 8GCHG 2ANKH 3VB4A 4JYTA 1Z1IA 1IQHA 4YT7H 1HAXB 1VJ9U 2KZ4A 5HM2A 2XBXA 5AFYH 1JRTA 2L6OA 5LGOA 3EGKH 1UCYK 3SZNA 2VIPA 1TRNA 1X7AC 1F5LA 1QTFA 4U30A 5EJ1A 2B8OH 1ZR0A 1XXDA 1S83A 5FAHA 2GD4B 4RN6A 1MH0A 1N1LA 3JZ2B 2FOHA 1C5RA 3A88A 3LGTA 2XC4A 2A5KA 2BXUH 1C9TA 3A8BA 5CHBA 2HALA 5A09A 2QV1A 2BOHB 1C2LA 1W2KH 1V3XA 1PYTD 3U9AH 3P70B 4X6NA 4K1EA 1UCYE 3FANA 1C4Y2 3BN9A 4ISOA 1VKYA 4JMYA 1XKAC 4VGCC 1KXBA 2V3OH 1W11U 4DOQA 4NZLA 4YOGA 2ZGBH 1F92A 4H42U 1TMTH 3LGVA 4I8KA 3WW7A 4BTUB 4CH8B 1TNHA 2ZFPH 1SGDE 1ACBE 3M5LA 2Y5FA 3BF6H 1MTWA 2BDIA 2BQ7B 3A84A 3VGCB 1C5QA 1GHAF 2B9LA 1G3EA 1OWIA 1BRCE 3PLBA 4FUEA 1O37A 1FDPA 3SORA 3ELAH 1ZGVA 1G37A 1A7SA 3SYJA 1SGEE 2BQ6B 3NXPA 3LGYA 3EA8A 3L6PA 4TPIZ 4B74A 3TJUA 4IMQA 1ABIH 2ZFSA 2ZWLH 1TIOA 5EPNA 3A87A 1PJPA 1K28D 4CRGA 1O3LA 3SUDA 1K1PA 2A1DB 4NFEA 4JZ1A 4WMDA 4I33A 1ELDE 5ABWA 2FLBH 3S9AA 1MBMA 1GI4A 1SQTA 4JZIA 4I86A 3PMJA 2BDGA 3SU2A 3TJNA 4MPWA 1GHBF 2ULLA 5K0HA 3VB6A 3KL6A 5GPIB 2BVXH 1EATA 3P6ZB 1ETRH 2ZDMA 2B7DH 1YGCH 2AFQB 1AKSA 1FIZA 1O5FH 1GJ5H 1C2KA 1ZTLA 1H1BA 3BTGE 3OE7D 1BTPA 3T2NA 2WPLS 3W95A 3QLPH 5KGOA 3F0PA 1GJCB 1GBJA 3S9CA 1BTUA 3EDXB 1OWKA 2PWXA 4P02A 3A8CA 3OFND 4BTTB 1P04A 5JPMH 1PPHE 1DPOA 2RG3A 4NSVA 2GCTC 3UWIA 3ZIAD 4CRDA 3W1EA 1O3GA 1QRWA 1SGFG 1OP8A 1S82A 4X8TH 5ESTE 2FI4E 2A7HA 1GG6B 1LVYA 3ATWA 1P05A 2ZHQH 2JIZD 1TRYA 2VWLA 3BEIB 3GY4A 3EE7A 4XSKU 1DITH 1EP5A 3PM3A 3BIUH 2ZDKA 2WUCA 4FUGA 3UWJH 1O39A 2KCAA 1K1IA 3ZZ6A 4WXVA 2GZ9A 1W12U 3FOAA 4CR9A 2VVCA 1BBRK 4RKJB 2SGFE 1O3JA 1QR3E 2YMSC 3VFEA 1ZJKA 1DE7H 3TPIZ 1WTHD 4NA8A 1WQSA 1A5HA 2AGIX 1A0JA 1ZGIA 3P8FA 5BRRE 1GJAB 5HIZA 1XUJA 1QURH 2RCEA 1SQRA 2C8WB 3PB1E 2CGAA 4BAHB 3ODDA 3RU4E 1NFXA 1SLWB 1UK2A 4GVUA 1BJVA 1GJBB 1QRZA 5T6DA 1HNEE 1GI5A 3NCLA 4XBDA 2ZPQA 2W26A 1QNJA 4P00A 2LELA 2ZKSA 1GMCF 1AKSB 3M3SA 2P16A 1C5VA 1ZZZA 1O38A 1ZMJA 4FUCA 2QE7D 3SQHE 2H5CA 2HVYB 2BD7A 1KXFA 4HGCA 1BBRE 3K6ZA 1O2JA 4ISLA 3BIVH 3D65E 3GS9A 4TYDA 4CRAA 3SU4A 4H4FA 4KKDA 4U01A 3RLWH 1FN6A 3UNSA 4HTCH 2ANWA 1LKAA 1EZQA 2BTCE 1RIWC 1JIMA 1THRH 4UE7H 1VR1H 1GMDG 3CS0A 2GX4A 2AIQA 3NRLA 1TB6H 1C1UH 2QYIA 1TOMH 5CMXH 3A8AA 3MWIU 4E7NA 1AD8H 1AIXH 1BRBE 2TPIZ 1QBOA 5A0BA 4A1VA 5GNDA 3URCA 1P10A 4YZUA 3SV7A 3KYGA 1G3DA 1AUJA 2WYJA 4GPGA 4NIWA 3AW0A 2A5AA 2A32A 2OLGA 2FESH 1LHGH 2IJD1 5A0CA 2Y7XA 4UFDH 4FETA 1S6HA 3A81A 4I8HA 4OS2A 1BUIA 5G4BA 2BY5X 6ESTA 5C5OA 5DP8A 3M61U 2WINI 1GJ6A 4IBLH 3DSOA 1HJ9A 1H8HD 4X6PA 4ISIH 4I8JA 6LPRA 2PGBB 1O2WA 2FOCA 3P8NA 2G51A 2BMGB 1BCUH 1Z6EA 2VWMA 3LOXA 1SBWA 1SMFE 4Q7ZA 4BOHA 3ODFA 1DT2A 3BTWE 2G4TA 3RXVA 2VB0A 1G3BA 3RXOA 4A1XA 1BMNH 2R9PA 5E0JA 1V2UT 1O2YA 2HVXA 4E7RG 3KN2A 1A5IA 4XE4A 1WUNH 3FO8D 3UOUA 2V6NA 2Y5GA 1C1SA 1C5ZB 3N99A 1PQ8A 1RTFB 3A7WA 4O97A 1FY5A 1GBEA 2C8YB 1ARCA 4MVNA 2FOAA 5DN6D 3KHVA 1LPGB 1Z8RA 5GCHF 4OS6A 2XW9A 3P92A 5A2MH 2HPPH 2J98B 1WDIA 3T29A 1GBLA 2IJOB 1O5DH 2G52A 2W7UA 2D1JA 2KM0A 5GWZA 1QJ1B 4ABHA 1CT0E 1C1WH 2GDDA 2W6ID 1WOFA 3U8OH 4LXBH 3UFAA 1C1NA 5GJ4B 1F5RA 1O3PB 2B5TB 3MU4A 1CBWC 1GHBG 1YPJH 3N7EA 3GY3A 4Q4LA 1YCPK 1DDJA 3S7HB 4YOJA 1QA7A 1THSH 3R0FA 3S0NA 2TGAA 2WV4A 4KGAA 2PKSC 2OTVA 4D7GA 4HI3A 4X8VH 3F6UH 2CK3D 2FI5E 3H09A 2ZU3A 3LU9B 1KLTA 3S7KB 5L2ZH 3S69A 1NS3A 1ELAA 1GPZA 4HFPB 1BJUA 3QZQA 1XX9A 2G00A 8LPRA 1GHWH 2EEKA 4ABIA 1P8VC 1HFDA 2GP9B 4F4OC 4HG6A 2XCFA 1TQ0B 1QHRB 2ZEBA 4XFQA 1Z71A 1AN1E 1QBNA 4NA7A 2TRMA 3MMGA 4UDWH 3QTOH 1JMOH 2ZDAH 3RMOH 2HOBA 3GCOA 1GBCA 1EOLA 1IAUA 4Q7YA 1W0YH 2Z9JA 2HLCA 2G5VA 2V7QD 2VINA 4DT7B 3PMHB 5I25A 1HV7A 2HNTE 1P9UA 3SHCH 3ZV9A 3GDVA 1IQKA 3A7TA 1XM1A 1ELCA 1HAPH 3D49H 1Q2WA 1GGDB 2AMDA 3SU0A 1FY3A 5DP5A 1N8OB 4I32A 1MKXK 4LOYH 5KECA 2W3IA 3A8DA 1IQJA 4YLUA 1IQEA 5GIBA 4JZEH 1BTYA 4INLA 4KTSA 4F55A 1TBZH 4CBOA 4NGAH 1BQYA 3MI4A 2PW8H 1FY8E 2QN5T 3BTFE 1TA2A 2AS9A 2J38A 2G55A 4FVBA 3TGKE 3DFJA 1TBQH 1OWDA 2BDYA 5HYOA 3RM2H 3T5FH 1NT1A 3UNRA 4AB8A 1CGJE 3LPRA 1O32A 3A7XA 4ACBA 3TNTA 1ESBA 5HKKD 1ESAA 3VB5A 1O2KA 1D3DB 3BTME 1EKBB 3AAVA 4WY3A 3RXMA 1CHOF 3GYMA 3GY5A 1DY9A 1QCPA 4AORA 1RGQA 1QGFA 1O5BB 2FOEA 2VJ1A 1TGBA 5T6FA 2I6QA 2IPHA 2AGEX 4FU9A 1AB9B 3F2GA 3RXAA 4Z6AH 3K2UA 1NBMD 1GBTA 1G9IE 2K8IA 1V2JT 3C27B 4CH2B 4ZKRU 1GI8B 4Y7AA 1KLIH 2NU0E 2THFB 1KMHB 1CE5A 3CS7A 3SGBE 1VITF 1ZJDA 3GY7A 1JIRA 3Q3XA 2Q1JA 2ZCKP 1T4UH 1K1MA 3OX7U 4WJG2 3M35A 1AZ8A 1D6WA 5A8YA 4CRCA 3AK5A 1C1PA 5PTPA 3ZZ7A 1BMMH 3TNSA 2FPZA 3RXBA 3T28A 1KXCA 1WXRA 4XBCA 2A2XH 2F83A 2R2MB 4YOIA 1EAIA 3PO1B 1C2DA 1F0RA 3E0NB 4GLYA 1E37B 1FY1A 3DT0H 3EA7A 4R0IA 4DJZB 4Y0YE 4OGYA 1SOTA 1K1LA 2SGPE 1K22H 3BSQA 1C1RA 2JH0D 3GCTF 4DVAU 4NIVA 2UUYA 3ZZCA 3LIWA 3MNCA 2ZDVH 3A86A 1ZPZA 4ACAA 2BB4A 2FODA 1EZXC 3LONA 1FMGA 1Y59T 4FUDA 4X1QU 4AG1A 1Y3VA 2PUQH 3QUMP 2Q6GA 3UTUH 4NZQA 4ZCNA 3A7YA 3K6YA 5GCHG 1E1RD 2ZNKH 1FLEE 1RD3B 2A2QH 1ZLRA 3GCHB 4GCHF 5CE1A 2PV9B 2BLWA 2EQNA 1QL8A 2FO9A 1FUJA 1NRNH 2CHAB 3F1SB 2G8TA 1O31A 2Z9KA 4X2WA 1EP6A 5AHGH 3MU0A 1S81A 3ZZAA 3RXFA 4CRFA 1WTGH 2A0QB 4FUFA 1PPZA 4OM9A 4ABFA 3BG4B 1BTHH 2VIWA 1C2IA 3RMNH 4JK5A 1GHYH 3BTQE 1G36A 1BB0B 2YNBA 2F91A 2R2WU 3MQKC 3E0PB 1P2NA 3LDXH 1K0HA 3RXSA 2AH4X 1AWHB 4BTIB 3PV5A 2A4QA 1Y3XA 3D62A 2RA3A 4AYVB 2QF3A 1MBQA 3F9EA 1C2MA 1IQNA 1TNKA 2OBQA 1NTPA 1GMDF 1UVSH 2WPIS 2VU8E 3KQCA 2NWNA 4UD9H 2Y5HA 3QZRA 5F8ZA 5HXFA 2ODYB 3F3BA 3ZZ9A 1S84A 1XXFA 1ZTJA 1P0SH 1QJ7B 2GV6A 2O8UA 1WCZA 3GDSA 2H9EH 1TPAE 5DP3A 1W7XH 1O34A 3A83A 2ZQ1A 4DURA 1SLVB 2ASUB 1UW7A 1NRPH 1BTZA 1SGIB 3F9FA 1JOUB 1LHCH 3VG8A 2FYQA 1WBGB 1AU8A 1HAHH 4AFZA 3RXQA 3LH1A 2A4OA 2HNTC 4K1SA 3MO9A 5DJ7A 1PPEE 3SJ9A 3AVZA 4CRBA 1SLUB 5FL7D 2F4LA 1P02A 2R0KA 3UIRA 3V0XA 2Z3CA 1C9PA 3O8DA 1FXYA 3SJKA 1SSXA 5DP6A 2JETB 5C94A 2UUFB 2BM2A 2XC0A 3GY2A 5EGMA 1MABB 1T7CA 4HZHA 2C8ZB 2XXLA 2D2DA 2VGCB 1TONA 3FZDA 3O8BA 1MKWH 1Y3YA 1LHEH 2ZFTA 3LGUA 3TJOA 3BEFB 3F68H 1TQ7B 4NIXA 2GKVE 3RXJA 3VB3A 3MOCA 1H4WA 1GJ4H 2FOFA 1EJMA 1QFKH 1PPCE 4FXGH 1N6XA 1C4U2 2ODQA 6GCHF 3M37A 1AVWA 5C0TA 1ORFA 3AAUA 1K2I1 1MCVA 1P03A 4X1RU 1ELEE 3MNSA 2J97A 1CHOG 1W13U 2EY4C 1AE8H 1N6YA 4J2YB 2ZGJA 3EYDA 2CN0H 2UWLA 1VCPA 2FS9A 2Q6FA 2NU3E 4F49A 2OCVB 1O3MA 1C2GA 1JXPA 3P17H 4ZAEA 1GL0E 1MMJN 2XOKD 4ABGA 4BAMB 1MUEB 5JBBS 1O2ZA 1TGCA 1PPGE 2GT8A 5C5NA 1ARBA 1ANDA 1JRSA 1VITG 2DUCA 3A80A 5EJZA 1UO6A 1O36A 1A1RA 2Y6TA 3AASA 4Y79A 1MZAA 1FNIA 1TMUH 1OKXA 4K3JA 3VGCC 2SGQE 1SC8U 4O9VA 4UFGH 3MNXA 2JH5D 1O3KA 3C1KA 1WAYB 4WMEA 2QC2A 2A4RA 3GY8A 2H1UA 2WV5A 1GBMA 4NSYA 1Z8GA 3GDUA 3E1XB 1ELGA 5HM9A 2XNIA 2WUBA 2R3YA 2Y80A 3LGWA 1QBVH 3GCTG 1E34B 1CVWH 2AMQA 2Z9GA 2BDAA 5EJLA 1SFIA 3RXEA 3UB0A 2ZGCA 2BOKA 1J16A 2UWOA 1P9SA 1PQ7A 1OHHD 1IQFA 1UTMA 1LVBA 1NRQH 5AFZH 1O3NA 3UUZA 3F0OA 2VH6A 3M3VA 1OXGA 1QB6A 5F53A 3SW2B 4CHAB 1YF4A 5EQQA 4MQAA 2BDHA 2CMYA 2FM2A 2P8OB 4GCHG 1QB9A 4X2VA 1J17T 2ZTZA 2GZ8A 1Y8TA 3ZYDA 1C5MD 3BTEE 4MPXA 4X2XA 1FJSA 1O2TA 1JBUH 1A4WH 2QAAA 3BG8A 3TVJB 4BAQB 3PV4A 5EOKA 3MTYA 1GJ7B 1UTPA 1PFXC 1BMFD 1H9LB 3NZIA 3RU4D 4ISHH 2A7CA 3BTHE 2P94A 1T8OA 1GG6C 3RXHA 4DW2U 1W10U 4QT8C 3RMLH 5TCAA 1C5PA 5CHAB 1FAKH 1AO5A 3NKKA 5IYTA 2ZA5A 2Z3EA 4AYYB 1UTJA 1RS0A 1V2TT 3KQ5A 3U1IB 5C1UA 2FP7B 2GMTB 4OS7A 1GBIA 4WH8A 4AC9A 2BDCA 5L6NH 2J98A 2IOTA 5DKMA 5FCKA 5C0UA 2BD5A 6CHAB 1DUAA 1V2MT 2WSSD 3SHAH 2WV9A 2J2UA 4X6OA 4X8UH 1LKBA 1CT2E 4MNYA 2ZHEH 3M5OA 1T8NA 5F8TA 3PLPA 3TLOA 1EPTA 3DA9B 3OAAD 1OPHB 4MPVA 3VXEH 3VPKA 2J94A 1P3EA 1VCWA 3ESTA 2ZFRH 2PSXA 3Q00A 4B6FA 3V7TA 3K9XB 2VWNA 4OS5A 1ZHPA 1ANCA 1Z7KA 1GBDA 2VWOA 1DFPA 3I29A 2RA0A 3Q3KA 2B0FA 2XWAA 2J4IA 1LHDH 1MAYA 5FCRA 2HWLB 1SGYE 1HAIH 4B76A 1S6FA 1S6LA 3MH5A 1C2HA 4WVPE 3ITIA 3RXCA 4BNRA 2QXJA 2BD4A 2GZ7A 1C1VH 1W14U 3ATMA 4M7GA 4AX9H 2BZAA 1GL1A 1TOCB 3T26A 2ZHDA 4DG4A 1EJAA 2H9HA 3HATH 3KGPA 1DSTA 4AFUA 2SGDE 4ZHLU 4MTBA 8KME2 3PWBA 2JJ1D 2ZP0H 3ATIA 3SI3H 3I78A 3RDZA 2KFWA 3T25A 1A0LA 3B23B 1E0FD 2BY7X 1O2HA 2A4GA 3D23A 3OEHD 1DLEA 1GCDA 2QXIA 1BIOA 3SU1A 4DT4A 2KR7A 2JDID 3RXKA 2YNAA 2WZQA 4UEHH 1K21H 1PYTC 4TSFD 1EB1H 1LVOA 1C5XB 1XKBC 2XWBI 3E6PH 2FYRA 3QGNB 1GI1A 5FX5A 4ABEA 4ASUD 2Q6DA 6GCHG 1XUIA 1DXWA 1MQ5A 1GBKA 4RI0A 1BTWA 3A89A 2Z94A 5LPEA 4IC5A 4UONA 1IOEA 3IITA 1EPTB 3SQEE 2P95A 1EZSC 1EUFA 2ANYA 1SGRE 5EU8A 2FDAA 3TK9A 5FX6A 1Y5BT 4IN2A 1O2XA 2JKHA 1C5LH 1IQMA 1GI0A 1KIGH 2UUKB 1MD7A 1YPKH 3TH3H 1QQUA 1NROH 3EE0B 3RXLA 4K2YA 3GY6A 4AFQA 1G2LA 2ILNA 2Y81A 4FU8A 2VNTA 1C2EA 1TX8A 2L74A 4U2WA 2J9NA 1S85A 4K8YA 2VBCA 1C1OA 3ZYEA 4JYVH 2ZHFH 3QGJA 2OINA 2FOMB 5JYIA 2ZDLA 2P3FH 4Y8XA 1P11E 4AZ2B 2KAIA 2G5NA 2F43B 3DHKH 4A92A 3SU5A 1QY6A 2TGDA 1YPHE 1DSUA 2EC9H 2C90B 3EQ0H 3FVFB 3U98H 2XCNA 3ZZBA 1DICA 1BMLA 4A6LA 1EJNA 1YWUA 1QIXB 5A8XA 3M7TA 4ZKOU 1D4PB 4XD7D 1NFUA 2FS8A 3UQVA 1K1NA 1SG8B 1HPGA 1SHYA 1D9IA 4RT1A 1HAYB 1GVZA 2HNTF 4D7FA 1V2LT 4B6EA 1AFQB 1KY9A 3QTVH 2KCYA 2WYGA 1EFRD 1EOJA 1MD8A 1BOQA 2K1QA 2BVRH 9LPRA 3A7VA 3GYLB 5C1XA 4AOQA 1UK4A 4K60A 1W0JD 2FZZA 1E38B 2AEIH 3O8RA 1TA6A 3QK1A 4YO9A 3HPTB 1YP9A 1YC0A 3PMBB 5A0AE 4AFSA 4FUJA 1MTUA 1ZHRA 1OWHA 3PROA 5JDUB 1NC6A 3TK6A 3W94A 1AVXA 1SKYE 4B71A 4A1TA 2JH6D 2TIOA 2RDLA 3PRDA 2O8MA 2IN2A 1GVLA 1O3HA 5K7RA 2QIQA 4X1PU 1WV7H 4ZHMU 1Z8JB 2W6JD 4WWYA 1ZMLA 1SOZA 1V2PT 3HK3B 4R8TB 5IK2D 4DCDA 3QO6A 1QQ4A 1LO6A 1HJAB 3M36A 4JYUH 4B75A 3FFGA 2ZCHP 3L3TA 4YXWD 1TRMA 3SU3A 1ZPBA 3R3GB 2KAIB 2BD3A 3IWMA 1C5TA 1EASA 1SGCA 3QWCH 1AFEH 4INHA 4ZHAA 1O2LA 1GGDC 4XOJA 1D6RA 1MU6B 1QJ6B 1YLNA 3QX5H 1N8OC 2XBVA 1D3QB 3SBKA 4MNXA 3P8OA 2BXTH 4Y11E 2PTCE 1ID5H 5HMAA 1NU7B 3E16B 3H5CB 1VITH 1W8BH 2V35A 5DGJA 3LKWA 2P3UB 3Q77A 1D3PB 4D76A 2V3MA 4TT3D 4XRNA 1WQVH 3F9GA 4NFFA 1TNGA 4Y76A 1TBRH 1UMAH 2K0QA 1J8AA 3SNAA 4TWYA 1O2VA 4D9RA 5JBAS 1W0KD 3HKIB 3UR9A 2Y82A 3UY9A 1BITA 1LQDB 1O3FA 5FPSA 3ZV8A 5JBTA 3F2FA 7ESTE 3SUEA 5DO4H 4SGAE 1EX3A 5C1YA 1CO7E 1HB0B 2I6SA 1SGNE 5C67A 4GHTA 1YPLH 1SQAA 3ATLA 4MLFB 1YM0A 1OP0A 3U1JB 3FP8E 4BAOB 1HRTH 4XDEA 3PV2A 1O3EA 2SNWA 1W7GH 1HCGA 3AW1A 3CENA 2LP6A 3SV2H 3U28C 1HGTH 4BAKB 4D8NA 2ZPRA 1TYNA 1AB9C 2ZZUH 2ZTXA 1TGNA 3E91A 2ZF0H 2Y7ZA 1RTLA 3E8LA 3RXIA 1CA0B 1O0DH 3RXDA 3KQDA 1T4VH 2ANMH 4Y6DA 1NFYA 1SQOA 2XBYA 1FX0B 4GUXA 3UPEA 4H6TA 1ZHMA 3FN8A 2FTLE 2WPMS 1AI8H 4INKA 2YMSD 1GMHF 1DS2E 1KSNA 1NY22 1J14A 2V3HH 1FIWA 1GCTB 2RDEA 2XRCA 1LHFH 3P95A 1MTNB 2WPHS 4YT6H 3PRBA 3PO1C 3PYHA 3U8RH 5T6GA 1O33A 2M2AA 3TU7H 3PTBA 2BX4A 1H8IH 4OS1A 2AMPA 5EIYA 3SZEA 3N7DA 3RM0H 1VGCB 5LPRA 2EA3A 5J4SA 5FHTA 1GJDB 3SJOA 2TGTA 1J15A 1TAWA 4JK6A 1BHXB 4B2BA 2QCYA 7LPRA 1BA8B 4WF8A 2VVVA 1FZZA 5C2ZA 2H9TH 1INCA 3OYPA 5AVDA 2IPQX 1V2RT 1C5SA 1MAXA 3LC5A 1BRUP 1MTSA 3GCHC 1DM4B 3MYWA 3BV9B 3FAOA 1VZQH 1ZSKA 1KTSB 2CHAC 1SGQE 1ELBA 1ZSLA 1MTNC 1QZ8A 1YPHC 1YCPM 1ZTKA 5SGAE 5DK1A 3GCNA 3SUFA 1UVPA 1OX1A 1O2RA 3UQOA 3RP2A 4FUIA 4BANB 1ZSJA 1A46H 3MH6A 1OS8A 4ZUHA 1O3AA 1UCYH 2CV3A 3BG4C 3JZ1B 1SL3A 1EB2A 1DWCH 4X2YA 1KXDA 1LQEA 1XUFA 3FKSD 1TFXA 1L1NA 1P57B 1IQIA 5DSFA 2XYAA 4B1TA 1IQGA 1BRAA 2PP6A 3SV8A 2O8LA 1COWD 2TBSA 4VGCB 1P2IA 5T1VA 1O2UA 3ZVDA 5LH8A 1ZRBA 2ZI2H 2G81E 4O3UA 2QF0A 1DANH 2PLXA 1V2OT 2HRVA 1O35A 1KTTB 4ZKNU 3V13A 2C4FH 5B6LA 3HK6B 3Q3YA 4I8LA 3VXFH 1GWAA 2XNDD 4WMFA 1P2QA 5TCCA 4B2AA 4TPYA 5FBEA 1AGJA 2R0LA 2CF9H 1SGFA 7KMEH 3HKJB 3MO6A 1V2VT 3LH3A 4ZXXH 1NO9H 2ZGXH 1S0RA 1TNIA 5EPYA 8ESTE 2FOBA 5E8EH 1GBHA 2BYAX 2YOLA 4M9FA 1OWJA 2OQ5A 2VIQA 3H7TA 5BPEA 2WPKS 1DUEA 4Y0ZE 2STAE 3DSGA 2DE8A 2HPQH 2ZQ2A 5I46H 3NPSA 2JJ2D 1F7ZA 1NZQH 1UK3A 1WSSH 3KQBA 1XMNB 2F9BH 2OC1A 3FP7E 3PMAB 1MKWK 3P8GA 2AIPA 5C17A 4TWWA 1GI2A 1YLDA 1G2MA 3LT3A 1O5EH 1E36B 2A7JA 4YESB 2ODPA 2ZHWH 1GJ8B 1LDTT 1HJ8A 1AE5A 1H8ED 4K8BA 1AQ7A 1P3CA 1NN6A 1NRRH 2BVSH 2JETC 3MU5A 4Y8YA 1UTLM 2XC5A 5F6MA 1E1QD 4RT0A 3KYFA 4Y10E 3SV9A 1TLDA 2VGCC 2BD8A 2XBWA 1NPMA 1MQ6A 1SHHB 1FAXA 3KNXA 4O3TA 1AHTH 3U8TH 1GI3A 1H8DH 2AERH 1DXPA 1H9IE 2GDEH 4H6SB 2ZU1A 5DPAA 5E2PA 3KEEA 3UAIC 4IC6A 1L2EA 1VCQA 2ALVA 2GCTB 1NESE 3GICB 5EXLA 2QF5A 1HAOH 2O8WA 4ZXYH 3ZZDA 4AB9A 1UVOA 3FZZA 3TITA 2FOGA 1XVOA 1GBFA 1PPFE 1YPMH 2V0BA 1C1TA 2BZ6H 4RKOB 1YPGH 2OC7A 2OC0A 1W0ZU 3A85A 4MPUA 3T27A 1UVTH 2ESTE 4ZKSU 1TPSA 1P2KA 1F5KU 4JCNA 3B9FH 4X1SU 1V2KT 1DOJA 2YMSB 1AUTC 4IN1A 1ETTH 1AMHA 5F03A 2GJGA 2OUAA 1ABJH 1C1MA 1OYQA 1TWXB 4IS5A 4NWKA 1G32B 1ZMNA 2PFEA 1RRKA 4I7YH 1NFWA 1GDUA 4BXSA 1A3BH 3ZVGA 4KTCA 4TY6A 2UUJB 2AHME 2PKAA 3RC5A 3TK5A 5A8ZA 1ZPCA 4YLQH 1Y5UT 1SLXB 1EZUC 2P93A 2H2ZA 1BBRH 3KQEA 3STIA 1F0SA 3NWUA 3SNCA 1IHSH 4YTAA 1BDAA 1GMHG 4U32A 1GDNA 1P2JA 2SFAA 3BTKE 1CU1A 1ANEA 2STBE 3CNRA 3OY5U 1CT4E 3SNBA 1MTVA 2R3UA 1TE0A 1P09A 4MNWA 5DP7A 1EXFA 2LPRA 1G3CA 1HAGE 5ETXA 2BX3A 4J1YA 1YLCA 1UTQA 1H9HE 2J34A 1CGHA 3M3TA 4OS4A 5DG6A 3TH4H 5FXLA 3SV6A 2P3TB 4DIIH 1JWTA 3MH4A 2OXSA 1RIWB 4TY7A 1HUTH 1O2MA 2Z3DA 5DP9A 4IMZA 1DWEH 5ESBA 1YKTA 4FVDA 4CR5A 5FPYA 1UHBA 1OSSA 5C3NA 2ZTYA 2FXRA 1ELTA 1XUKA 4IW4E 5FPTA 1XUGA 3HGNA 4CHAC 2BY9X 1MU8B 3BTDE 4D9QA 1DWDH 2P8OC 5E2OA 1O2GH 2WHXA 1AVGH 1ZOMA 1KDQA 1SVPA 2D26C 2FX6A 3U69H 3M7QA 1GI6A 2Z7FE 1OOKB 3GISB 5F8XA 1L1GA 5HGGA 7GCHF 4NWLA 3RXGA 5LPFA 3Q76A 1YYY1 2J95A 2VIDA 1HAVA 2F9OA 2WPJS 2C3SA 2F9PA 1UVUH 3OU0A 3SGAE 1C5YB 2PHBA 4LZ4B 2ZIQH 4NCYA 1O5GH 1BZXE 4ZROA 5E0GA 3RLYH 2GCHF 3PTNA 5CHAC 2PUXB 1B5GH 1VJAU 4ZH8A 1Y5AT 4IGDA 2PKAB 1SGPE 2M5TA 2BHGA 1DX5M 1A2CH 1TX6A 1DLKB 2ZPSA 2H6MA 2GMTC 1SFQB 2OD3B 1BMAA 1Z1JA 5AF9H 1GDQA 4AGJA 6CHAC 1V2WT 2ZGHA 3BEUA 1FQ3A 5GXPA 1FI8A 2SGEE 3RXUA 2QXHA 1UTOA 1YBWA 3SJIA 4ABBA 1LTOA 2NU2E 3QDZB 1D3TB 2BD2A 5KEDA 1K1OA 1Y3UA 1GBBA 4ABJA 3L33A 4ASHA 1BTXA 5L30H 4UFEH 4OGXA 3OSYA 3FP6E 1Y3WA 1M9UA 3CP7A 1EAUA 1F0UA 1QRXA 2ZU2A 3UNQA 3E3TA 3F2HA 4A7IB 1UHBB 3IG6B 3VEQB 1L1JA 2BDBA 3SJ8A 1KXAA 1BT7A 4O03A 3RXTA 3SOSA 1AZZA 1WYKA 3DCLA 1HYLA 1CBWB 2DE9A 1HXFH 1B0FA 3TIUA 1KDQB 1SR5C 1E79D 5EW1H 1FPCH 3G01A 1PQ5A 2FIRH 3WWFA 2PKSB 2QF4A 4K5ZA 1HAVB 1KYNA 1OWEA 1CHGA 4ABAA 1GHAG 4Y8ZA 2OBOA 2NU4E 2QXGA 2VIVA 1HAZB 3NUMA 3RC6A 1QL9A 2FTMA 5JB8S 3ATKA 1HLTH 5EODA 1C5OH 1O3IA 1A5GH 2BD9A 3WY8A 3SI4H 1ETSH 1V6DA 1YCPH 4WXIA 3TH2H 2ZDNA 1O30A 2BY8X 3DD2H 1A3EH 4X1NU 4XBBA 3ZVBA 1DVAH 4RSPA 1CGIE 1AY6H 1PQAA 2W5EA 3SGQE 3OTJE 4I31A 3T62A 2CF8H 2C93B 2A45B 3OEED 1UJ1A 1B7XB 3ZZ3A 1KXEA 4A5TS 1TGSZ 4B73A 3ENSB 1C2JA 3SUGA 3PLKA 4Z1MD 2VH0A 2OQUA 1MCTA 1J9CH 1RFNA 1KLJH 1ELVA 2PR3A 1ZRKA 2GGVB 1GJ9B 1EPTC 1BHXF 3A7ZA 3DFLA 4UFFH 4AGKA 1GI7B 2ZU5A 4MNVA 2ALPA 2O8TA 1E35B 1OYTH 3RU4T 1RXPA 3SU6A 1F0TA 1LPKB 1TMBH 1L4ZA 3MU8A 1ELFA 1HDTH 2F9UA 3M5MA 3M7UA 8GCHF 4K69A 4E05H 3SNEA 1LPZB 2SNVA 1Z8IB 2F9NA 1GHXH 3UR6A 1TNLA 2ZC9H 4I8GA 1OP2A 4ISNA 3S9BA 4ESTE 2FMJA 2VIOA 4FUBA 2F3CE 4AN7A 1P06A 4MG3A 1UTKA 2ZU4A 1MKXH 4FOUC 4ABDA 2AGGX 4X0WU 1K9OE 2HLDD 5B6OA 1GHVH 1FV9A 3SNDA 4GAWA 4K1TA 3VB7A 5CDFE 1P12E 1NM6A 2BLVA 2PTNA 3PWCA 4DGJA 1AFQC 4Q7XA 5EG4A 4Q80A 4KELA 3LJJA 5EXNA 1HBTH 3RUOA 2NU1E 1DY8A 3EA9A 1P2OA 5IDKA 3MH7A 3A82A 2CJIA 5TJXA 1RJXB 1W3CA 4F48B 1F2SE 3QN7A 2BLQA 1QL7A 2UWPA 4Y71A 1SPJA 3V12A 2VVUA 3TGIE 5L2YH 4PROA 3I77A 1DWBH 3M5NA 5H4IB 5C20A 3F9HA 1C1QA 1SB1H 2FI3E 2ZECA 1GMCG 4ZMAH 3MHWU 4Q2KA 2FEQH 3KIDU 4Z0KA 1CQQA 2Z6BD 5T3HA 7GCHG 4GSOA 5HIYA 3ZZ5A 1O2PA 1O3DA 3TJVA 1CA8B 3V3MA 2OP9A 1S0QA 2PSYA 1S5SA 1YPEH 3STJA 1NRSH 2W3KA 2SGAA 2GT7A 1TNJA 1C5WB 1B0EA 1AWFH 1TX7A 2HGTH 2ZO3H 1O2NA 2GCHG 2KCPA 3B8JA 1O3BA 3BTTE 4LK4A 3NK8A 1HIAA 1HJAC 2FX4A 4FUHA 1XUHA 2TGPZ 1UTNA 2F9VA 3MO3A 3DUXH 1GBAA 1XVMA 1NBME 3RXPA 1L0ZA 1LVMA 1V2QT 2GVFA 2KCOA 1A0HB 2BY6X 2FLRH 5FBIA 4AG2A 2O9QA 3SN8A 2KX4A 1O2SA 4B2CA 3RMMH 1YY3A 2GV7A 4NA9H 2WPDD 5EW2H 1FY4A 4BXWA 3MFJA 2D8WA 2OC8A 5EQRA 1O3CA 3ZVCA 5J4QA 1MZDA 1P01A 3URDA 4GHQA 1QA0A 5EXMA 3OY6U 3TGJE 1O3OA 3EAJA 4Q63A 4FU7A 1TABE 3OTPA 4X8SH 1SI5H 3ZZ4A 2QY0B 2ZCLP 2ZFFH 1Q31A 1L4DA 1GI9B 2RFKC 1IQLA 1EAXA 2BLOA 1TGTA 5JB9S 2J92A 3HGPA 3LGIA 3UREA 1NU9A 1O5AB 2W7SA 2CXVA 3MU1A 3KCGH 3O8CA 4CBNA 4JZDH 2GTBA 1RTKA 1C4V2 1LMWB 4JZFH 3SO3A 4Y7BA 1V2ST 4SGBE 1V2NT 1ESTA 1IHTH 4NIYA 1GVKB 2EI6A 4YM9A 1WU1A 1GHZA 4MDSA 3UOPA 1CSOE 4X6MA 1T32A 2QGRA
chains in the Genus database with same CATH topology
1G30B 1CA0C 1O2IA 2Z9IA 2AYWA 4THNH 2C8XB 1SGTA 2Z9LA 1PPBH 2QA9E 1LCYA 4DIHH 1HIAB 1TALA 2BQWB 1EQ9A 2EI8A 2PGQB 4NG9H 1QB1A 2H5DA 4E06H 1Z6JH 1C2FA 2A31A 3E90B 4LZ1H 3RC4A 2FWWA 4KTUA 2P59A 2A5IA 1TPPA 1K1JA 2EI7A 5GDSH 3H7OA 1A61H 2ZG0H 1ANBA 1C5NH 4WH6A 5E0HA 5DP4A 1GCTC 3MNBA 1FPHH 2XTTB 1O2OA 1U6QA 5JBCS 4KP0A 1P2MA 1T31A 3LJOA 1TPOA 1C5UA 1THPB 3LC3A 1FONA 1T8LA 3ZZ8A 1ZYOA 9ESTA 3GOVB 1O2QA 1FN8A 1Q3XA 4CREA 2G4UA 3ZVFA 5EQSA 3RXRA 3K65B 4DY7B 2LNCA 1VGCC 1HXEH 2ZFQH 3KF2A 1T8MA 3N7OA 3ZVEA 1EAWA 3ZVAA 1O5CB 8GCHG 2ANKH 3VB4A 4JYTA 1Z1IA 1IQHA 4YT7H 1HAXB 1VJ9U 5HM2A 2XBXA 5AFYH 1JRTA 5LGOA 3EGKH 1UCYK 3SZNA 2VIPA 1TRNA 1X7AC 1F5LA 1QTFA 4U30A 2B8OH 1ZR0A 1XXDA 1S83A 5FAHA 2GD4B 4RN6A 1MH0A 1N1LA 3JZ2B 2FOHA 1C5RA 3A88A 3LGTA 2XC4A 2A5KA 2BXUH 1C9TA 3A8BA 2HALA 5A09A 2QV1A 2BOHB 1C2LA 1W2KH 1V3XA 1PYTD 3U9AH 3P70B 4X6NA 4K1EA 1UCYE 3FANA 1C4Y2 3BN9A 4ISOA 4JMYA 1XKAC 4VGCC 1KXBA 2V3OH 1W11U 4DOQA 4NZLA 4YOGA 2ZGBH 1F92A 4H42U 1TMTH 3LGVA 4I8KA 4BTUB 4CH8B 1TNHA 2ZFPH 1SGDE 1ACBE 3M5LA 2Y5FA 3BF6H 1MTWA 2BDIA 2BQ7B 3A84A 3VGCB 1C5QA 1GHAF 2B9LA 1G3EA 1OWIA 1BRCE 3PLBA 4FUEA 1O37A 1FDPA 3SORA 3ELAH 1ZGVA 1G37A 1A7SA 1SGEE 2BQ6B 3NXPA 3LGYA 3EA8A 3L6PA 4TPIZ 4B74A 3TJUA 4IMQA 1ABIH 2ZFSA 2ZWLH 1TIOA 5EPNA 3A87A 1PJPA 1K28D 4CRGA 1O3LA 3SUDA 1K1PA 2A1DB 4NFEA 4JZ1A 4WMDA 4I33A 1ELDE 5ABWA 2FLBH 3S9AA 1MBMA 1GI4A 1SQTA 4JZIA 3SU2A 3PMJA 2BDGA 3TJNA 4MPWA 1GHBF 2ULLA 5K0HA 3VB6A 3KL6A 5GPIB 2BVXH 1EATA 3P6ZB 1ETRH 2ZDMA 2B7DH 1YGCH 2AFQB 1AKSA 1FIZA 1O5FH 1GJ5H 1C2KA 1ZTLA 1H1BA 3BTGE 1BTPA 3T2NA 2WPLS 3W95A 3QLPH 1GJCB 1GBJA 3S9CA 1BTUA 3EDXB 1OWKA 2PWXA 3A8CA 4BTTB 1P04A 5JPMH 1PPHE 1DPOA 2RG3A 4NSVA 2GCTC 3UWIA 4CRDA 1O3GA 1QRWA 1SGFG 1OP8A 1S82A 4X8TH 5ESTE 2FI4E 2A7HA 1GG6B 1LVYA 3ATWA 1P05A 2ZHQH 1TRYA 2VWLA 3BEIB 3GY4A 4XSKU 1DITH 1EP5A 3PM3A 3BIUH 2ZDKA 2WUCA 4FUGA 3UWJH 1O39A 3ZZ6A 1K1IA 4WXVA 2GZ9A 1W12U 4CR9A 2VVCA 1BBRK 4RKJB 2SGFE 1O3JA 1QR3E 3VFEA 1ZJKA 1DE7H 3TPIZ 1WTHD 4NA8A 1WQSA 1A5HA 2AGIX 1A0JA 1ZGIA 3P8FA 5BRRE 1GJAB 1XUJA 1QURH 2RCEA 2C8WB 3PB1E 2CGAA 4BAHB 3ODDA 3RU4E 1NFXA 1SLWB 1UK2A 4GVUA 1BJVA 1GJBB 1QRZA 5T6DA 1HNEE 1GI5A 3NCLA 4XBDA 2ZPQA 2W26A 1QNJA 2ZKSA 1GMCF 1AKSB 3M3SA 2P16A 1C5VA 1ZZZA 1O38A 1ZMJA 4FUCA 3SQHE 2H5CA 2BD7A 1KXFA 4HGCA 1BBRE 3K6ZA 1O2JA 4ISLA 3BIVH 3D65E 4TYDA 4CRAA 3SU4A 4H4FA 4KKDA 4U01A 3RLWH 1FN6A 3UNSA 4HTCH 2ANWA 1LKAA 1EZQA 2BTCE 1RIWC 1JIMA 1THRH 4UE7H 1VR1H 1GMDG 3CS0A 2GX4A 2AIQA 1TB6H 1C1UH 2QYIA 1TOMH 5CMXH 3A8AA 3MWIU 4E7NA 1AD8H 1AIXH 1BRBE 2TPIZ 1QBOA 5A0BA 4A1VA 3URCA 1P10A 4YZUA 3SV7A 1G3DA 1AUJA 2WYJA 4GPGA 4NIWA 3AW0A 2A5AA 2A32A 2OLGA 2FESH 1LHGH 5A0CA 2Y7XA 4UFDH 4OS2A 1S6HA 3A81A 4I8HA 1BUIA 5G4BA 2BY5X 6ESTA 5C5OA 5DP8A 3M61U 2WINI 1GJ6A 4IBLH 1HJ9A 4X6PA 4ISIH 4I8JA 6LPRA 2PGBB 1O2WA 2FOCA 3P8NA 2G51A 2BMGB 1BCUH 1Z6EA 2VWMA 3LOXA 1SBWA 1SMFE 4Q7ZA 4BOHA 3ODFA 1DT2A 3BTWE 2G4TA 3RXVA 2VB0A 1G3BA 3RXOA 4A1XA 1BMNH 2R9PA 5E0JA 1V2UT 1O2YA 2HVXA 4E7RG 3KN2A 1A5IA 4XE4A 1WUNH 3UOUA 2V6NA 2Y5GA 1C1SA 1C5ZB 1PQ8A 1RTFB 3A7WA 4O97A 1FY5A 1GBEA 2C8YB 1ARCA 4MVNA 2FOAA 3KHVA 1LPGB 1Z8RA 5GCHF 4OS6A 2XW9A 3P92A 5A2MH 2HPPH 3T29A 1GBLA 2IJOB 1O5DH 2G52A 2W7UA 2D1JA 5GWZA 1QJ1B 4ABHA 1CT0E 1C1WH 2GDDA 1WOFA 3U8OH 4LXBH 3UFAA 1C1NA 5GJ4B 1F5RA 1O3PB 2B5TB 3MU4A 1CBWC 1GHBG 1YPJH 3GY3A 1YCPK 1DDJA 3S7HB 4YOJA 1QA7A 1THSH 3R0FA 3S0NA 2TGAA 2WV4A 4KGAA 2PKSC 2OTVA 4D7GA 4HI3A 4X8VH 3F6UH 2FI5E 2ZU3A 3LU9B 1KLTA 3S7KB 5L2ZH 3S69A 1NS3A 1ELAA 1GPZA 4HFPB 1BJUA 3QZQA 1XX9A 2G00A 8LPRA 1GHWH 2EEKA 4ABIA 1P8VC 1HFDA 2GP9B 4F4OC 2XCFA 1TQ0B 1QHRB 2ZEBA 4XFQA 1Z71A 1AN1E 1QBNA 4NA7A 2TRMA 3MMGA 4UDWH 3QTOH 1JMOH 2ZDAH 3RMOH 2HOBA 3GCOA 1GBCA 1EOLA 1IAUA 4Q7YA 1W0YH 2Z9JA 2HLCA 2G5VA 4DT7B 2VINA 3PMHB 5I25A 1HV7A 2HNTE 1P9UA 3SHCH 3ZV9A 3GDVA 1IQKA 3A7TA 1XM1A 1ELCA 1HAPH 3D49H 1Q2WA 1GGDB 2AMDA 3SU0A 1FY3A 5DP5A 1N8OB 4I32A 1MKXK 4LOYH 2W3IA 3A8DA 1IQJA 4YLUA 1IQEA 5GIBA 4JZEH 1BTYA 4INLA 4KTSA 1TBZH 4CBOA 4NGAH 1BQYA 3MI4A 2PW8H 1FY8E 2QN5T 3BTFE 1TA2A 2AS9A 2J38A 2G55A 4FVBA 3TGKE 3DFJA 1TBQH 1OWDA 2BDYA 5HYOA 3RM2H 3T5FH 1NT1A 3UNRA 4AB8A 1CGJE 3LPRA 1O32A 3A7XA 3TNTA 1ESBA 1ESAA 3VB5A 1O2KA 1D3DB 3BTME 1EKBB 3AAVA 4WY3A 3RXMA 1CHOF 3GYMA 3GY5A 1DY9A 1QCPA 4AORA 1RGQA 1QGFA 1O5BB 2FOEA 2VJ1A 1TGBA 5T6FA 2I6QA 2IPHA 2AGEX 4FU9A 1AB9B 3RXAA 4Z6AH 3K2UA 1GBTA 1G9IE 1V2JT 3C27B 4CH2B 4ZKRU 1GI8B 4Y7AA 2NU0E 1KLIH 2THFB 1CE5A 3CS7A 3SGBE 1VITF 1ZJDA 3GY7A 1JIRA 3Q3XA 2Q1JA 2ZCKP 1T4UH 1K1MA 3OX7U 4WJG2 3M35A 1AZ8A 1D6WA 5A8YA 4CRCA 1C1PA 5PTPA 3ZZ7A 1BMMH 3TNSA 2FPZA 3RXBA 3T28A 1KXCA 4XBCA 2A2XH 2F83A 2R2MB 4YOIA 1EAIA 3PO1B 1C2DA 1F0RA 3E0NB 4GLYA 1E37B 1FY1A 3DT0H 3EA7A 4R0IA 4DJZB 4Y0YE 4OGYA 1SOTA 1K1LA 2SGPE 1K22H 3BSQA 1C1RA 2JH0D 3GCTF 4DVAU 4NIVA 2UUYA 3ZZCA 3LIWA 3MNCA 2ZDVH 3A86A 1ZPZA 2BB4A 2FODA 1EZXC 3LONA 1FMGA 1Y59T 4FUDA 4X1QU 4AG1A 1Y3VA 2PUQH 3QUMP 2Q6GA 3UTUH 4NZQA 3A7YA 3K6YA 5GCHG 2ZNKH 1FLEE 1RD3B 2A2QH 1ZLRA 3GCHB 4GCHF 5CE1A 2PV9B 2BLWA 1QL8A 2FO9A 1FUJA 1NRNH 2CHAB 3F1SB 2G8TA 1O31A 2Z9KA 4X2WA 1EP6A 5AHGH 3MU0A 1S81A 3ZZAA 3RXFA 4CRFA 1WTGH 2A0QB 4FUFA 1PPZA 4ABFA 3BG4B 1BTHH 2VIWA 1C2IA 3RMNH 4JK5A 1GHYH 3BTQE 1G36A 1BB0B 2YNBA 2F91A 2R2WU 3E0PB 1P2NA 3LDXH 3RXSA 2AH4X 1AWHB 4BTIB 2A4QA 1Y3XA 3D62A 2RA3A 4AYVB 2QF3A 1MBQA 3F9EA 1C2MA 1IQNA 1TNKA 2OBQA 1NTPA 1GMDF 1UVSH 2WPIS 2VU8E 3KQCA 2NWNA 4UD9H 2Y5HA 3QZRA 5F8ZA 5HXFA 2ODYB 3ZZ9A 1S84A 1XXFA 1ZTJA 1P0SH 1QJ7B 2GV6A 2O8UA 1WCZA 3GDSA 2H9EH 1TPAE 5DP3A 1W7XH 1O34A 3A83A 2ZQ1A 4DURA 1SLVB 2ASUB 1NRPH 1BTZA 1SGIB 3F9FA 1JOUB 1LHCH 2FYQA 1WBGB 1AU8A 1HAHH 4AFZA 3RXQA 3LH1A 2A4OA 2HNTC 4K1SA 3MO9A 5DJ7A 1PPEE 3SJ9A 3AVZA 4CRBA 1SLUB 2R0KA 1P02A 3UIRA 3V0XA 2Z3CA 1C9PA 3O8DA 1FXYA 3SJKA 1SSXA 5DP6A 2JETB 2UUFB 2BM2A 2XC0A 3GY2A 5EGMA 1T7CA 4HZHA 2C8ZB 2XXLA 2D2DA 2VGCB 1TONA 3FZDA 3O8BA 1MKWH 1Y3YA 1LHEH 2ZFTA 3LGUA 3TJOA 3BEFB 3F68H 1TQ7B 4NIXA 2GKVE 3RXJA 3VB3A 3MOCA 1H4WA 1GJ4H 2FOFA 1EJMA 1QFKH 1PPCE 4FXGH 1N6XA 1C4U2 2ODQA 6GCHF 3M37A 1AVWA 1ORFA 3AAUA 1K2I1 1MCVA 1P03A 4X1RU 1ELEE 3MNSA 1CHOG 1W13U 1AE8H 1N6YA 4J2YB 2ZGJA 3EYDA 2CN0H 2UWLA 1VCPA 2FS9A 2Q6FA 2NU3E 4F49A 2OCVB 1O3MA 1C2GA 1JXPA 3P17H 4ZAEA 1GL0E 1MMJN 4ABGA 4BAMB 1MUEB 5JBBS 1O2ZA 1TGCA 1PPGE 2GT8A 5C5NA 1ARBA 1ANDA 1JRSA 1VITG 2DUCA 3A80A 1UO6A 1O36A 1A1RA 2Y6TA 3AASA 4Y79A 1MZAA 1FNIA 1TMUH 1OKXA 4K3JA 3VGCC 2SGQE 1SC8U 4O9VA 4UFGH 3MNXA 2JH5D 1O3KA 3C1KA 1WAYB 4WMEA 2QC2A 2A4RA 3GY8A 2H1UA 2WV5A 1GBMA 4NSYA 1Z8GA 3GDUA 3E1XB 1ELGA 5HM9A 2XNIA 2WUBA 2R3YA 2Y80A 3LGWA 1QBVH 3GCTG 1E34B 1CVWH 2AMQA 2Z9GA 2BDAA 1SFIA 3RXEA 2ZGCA 2BOKA 1J16A 2UWOA 1P9SA 1PQ7A 1IQFA 1UTMA 1LVBA 1NRQH 5AFZH 1O3NA 3UUZA 2VH6A 3M3VA 1OXGA 1QB6A 3SW2B 4CHAB 1YF4A 5EQQA 4MQAA 2BDHA 2CMYA 2FM2A 2P8OB 4GCHG 1QB9A 4X2VA 1J17T 2ZTZA 2GZ8A 1Y8TA 3ZYDA 1C5MD 3BTEE 4MPXA 4X2XA 1FJSA 1O2TA 1JBUH 1A4WH 2QAAA 3BG8A 3TVJB 4BAQB 3PV4A 5EOKA 3MTYA 1GJ7B 1UTPA 1PFXC 1H9LB 3NZIA 3RU4D 4ISHH 2A7CA 3BTHE 2P94A 1T8OA 1GG6C 3RXHA 4DW2U 1W10U 4QT8C 3RMLH 5TCAA 1C5PA 5CHAB 1FAKH 1AO5A 3NKKA 5IYTA 2ZA5A 2Z3EA 4AYYB 1UTJA 1RS0A 1V2TT 3U1IB 5C1UA 2FP7B 2GMTB 4OS7A 1GBIA 4WH8A 2BDCA 5L6NH 2IOTA 5DKMA 5FCKA 2BD5A 6CHAB 1DUAA 1V2MT 3SHAH 4X8UH 2J2UA 4X6OA 1LKBA 1CT2E 4MNYA 2ZHEH 3M5OA 1T8NA 5F8TA 3PLPA 3TLOA 1EPTA 3DA9B 1OPHB 4MPVA 3VXEH 3VPKA 2J94A 1P3EA 1VCWA 3ESTA 2ZFRH 2PSXA 3Q00A 3V7TA 3K9XB 2VWNA 4OS5A 1ZHPA 1ANCA 1Z7KA 1GBDA 2VWOA 1DFPA 3I29A 2RA0A 3Q3KA 2B0FA 2XWAA 2J4IA 1LHDH 1MAYA 5FCRA 2HWLB 1SGYE 1HAIH 4B76A 1S6FA 3MH5A 1C2HA 4WVPE 3ITIA 3RXCA 4BNRA 2QXJA 2BD4A 2GZ7A 1C1VH 1W14U 3ATMA 4M7GA 4AX9H 2BZAA 1GL1A 1TOCB 3T26A 2ZHDA 4DG4A 1EJAA 2H9HA 3HATH 3KGPA 1DSTA 4AFUA 2SGDE 4ZHLU 4MTBA 8KME2 3PWBA 2ZP0H 3ATIA 3SI3H 3I78A 3RDZA 3T25A 1A0LA 3B23B 1E0FD 2BY7X 1O2HA 2A4GA 3D23A 1DLEA 1GCDA 2QXIA