3BEUA

Na+-dependent allostery mediates coagulation factor protease active site selectivity
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
224
structure length
224
Chain Sequence
VVGGTRAAQGEFPFMVRLSMGCGGALYAQDIVLTAAHCVSGSGNNTSITATGGVVDLQSSSAVKVRSTKVLQAPGFTKETYGKDWALIKLAQPINQPTLKIATTTAYNQGTFTVAGWGANREGGSQQRYLLKANVPFVSDAACRSSSSFILVANEMICAGYDTKQEDTCQGDSGGPMFRKDNADEWVQVGIVSWGEGCARKGKYGVYTEVSTFASAIASAARTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Trypsin
publication title Engineering protein allostery: 1.05 A resolution structure and enzymatic properties of a Na+-activated trypsin.
pubmed doi rcsb
source organism Streptomyces griseus
total genus 57
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2007-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3beuA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3beuA02
3TJVA 3OSYA 1TFXA 1S83A 5G4BA 3SJ9A 2WUBA 2G52A 1VCQA 1ANDA 2RDLA 2QY0B 4X6PA 3TVJB 2R0LA 3ZYDA 1CE5A 4D76A 2R3YA 1CO7E 2TRMA 2VIDA 2SNWA 2F9NA 3MNXA 1FN8A 2ODPA 1D6WA 1GJ7B 2FIRH 2W7SA 2ZECA 4KELA 1V3XA 1D3TB 1SLXB 2VWLA 4BAMB 1ZMLA 5FPSA 2DUCA 1YPMH 1C5NH 2BMGB 1GMDG 1Q31A 2P3UB 1J17T 3M37A 5EQRA 2AIQA 2HPQH 2WPKS 3ZZDA 3TPIZ 4ABJA 1FY4A 4YM9A 2O8MA 4ZHAA 2QN5T 1TALA 3SNEA 4ZXYH 2C90B 4JCNA 4Y8YA 4A1VA 4AZ2B 2QAAA 1WTHD 1GDQA 5DKMA 1ETTH 4FUFA 4BAHB 3PROA 4RKJB 5SGAE 3FAOA 1S0RA 1TRMA 1GBHA 1GI4A 1OWIA 1BBRE 4MDSA 2A7JA 1O3CA 3A81A 1QURH 1QBOA 2ZDNA 1ACBE 4ZHMU 1QY6A 1ZPZA 1ETRH 4B71A 2P94A 1Z7KA 2ZHQH 3SU1A 1O38A 4NWLA 3A86A 1AFQC 1VR1H 3FP7E 1O3JA 1SLUB 4BTIB 2WV5A 2Z9LA 2C8ZB 1O2YA 1A2CH 3TGKE 5FBEA 3KN2A 4XBDA 3NCLA 1BTYA 1JRTA 1OPHB 5A0BA 1O2HA 1O2ZA 3UQVA 4JK5A 2Y82A 3F9HA 3SJ8A 1GJ4H 3LGVA 1ELBA 1KYNA 3SU0A 3H7TA 4NIVA 1UVPA 1F0SA 2BVSH 2ZPQA 3F68H 3CP7A 4XBCA 1GGDC 1WUNH 8ESTE 3OX7U 3OY6U 4ESTE 2FMJA 2HLCA 2NU0E 1P2QA 3BTFE 1GGDB 2QXIA 4B2CA 1WBGB 4K1EA 3M7UA 4D9RA 4HZHA 2A5KA 2OP9A 3ZVEA 1H1BA 1HYLA 5FXLA 1HB0B 2ZCKP 1QJ1B 3I78A 2BY7X 3EDXB 1GCTB 3OU0A 5GDSH 4BAQB 1B5GH 1LQEA 1NFYA 2VWMA 2VVVA 4B74A 2BVRH 2FYQA 1EJNA 4IC5A 1GBAA 1LHCH 1UTNA 3UIRA 1AKSB 2VJ1A 3ZZAA 2PTCE 1SI5H 1DY8A 4KTUA 2Z9JA 4FUDA 4Y7AA 4DURA 4UEHH 2ZC9H 1ID5H 1RIWC 1V2OT 3CS7A 4CR5A 3RXSA 1SGPE 1AE5A 1F0RA 3G01A 3TNSA 1ANEA 1HGTH 4PROA 3RXLA 1GDUA 1C1QA 1OX1A 4WJG2 5JB9S 1GMCF 1H9IE 3ATMA 1C5VA 5HGGA 1GVLA 1NZQH 1FN6A 3BEFB 1VGCC 2A5AA 4BXSA 1QR3E 1K1LA 4SGBE 1PQAA 1QNJA 5CHAB 4YESB 3RXCA 5F8XA 1HNEE 1WYKA 1C2MA 4X2WA 3F9GA 5A0AE 3HGNA 4XOJA 3T25A 1ZOMA 1ELTA 2G8TA 3A8CA 2FOGA 2JKHA 1DM4B 1LCYA 1DICA 1GG6C 3DT0H 1OP0A 1E38B 2VIOA 1QRXA 3E16B 1L4ZA 1AIXH 3HK6B 1IQGA 4NA8A 2F3CE 4JZDH 2YNAA 2B9LA 2OCVB 1BTZA 1ZYOA 5C1XA 4GPGA 4GVUA 5JB8S 3STJA 2AEIH 2ODYB 1G37A 1ZTJA 3BN9A 3A82A 1ZGIA 1UCYK 3GY2A 4Q7YA 1MMJN 2HWLB 1B0FA 2WPHS 4X2YA 2PLXA 1BRCE 4UFDH 4DIIH 3SJIA 1VZQH 2G81E 2FZZA 3U9AH 1AY6H 1G2MA 1HAIH 3U8OH 1ZLRA 3DD2H 3O8BA 1OWHA 4ZKOU 3GDUA 3GDSA 1C5RA 1N8OB 2AERH 1C4U2 5DP8A 1ZRBA 2FLRH 3ZVFA 2H5CA 4X6NA 3N7OA 1O35A 1UTOA 1EOJA 1C2JA 2ZCLP 1ELDE 1SQOA 2ZU4A 2G4TA 2NWNA 2RG3A 1A0JA 1QBNA 2P3FH 4M7GA 4AN7A 1A5HA 2XBVA 1H9LB 1GMCG 1Y3VA 1GJAB 2EI6A 4MPWA 3RXAA 3SGQE 1ZTKA 1MQ6A 1KXEA 2W26A 4Y0YE 3SO3A 2O8TA 3GY8A 1V2JT 2AMDA 3T29A 1O5CB 2VU8E 2ZGCA 5ETXA 1A5IA 1EZXC 3QZQA 3Q3KA 2CF8H 4H4FA 3RP2A 4BANB 2Z9KA 1V2VT 2FO9A 4MNVA 1P01A 3BTTE 1C4V2 1SLWB 2KAIB 1ELCA 1NT1A 2F9VA 1LVMA 3U1JB 5DO4H 1SGRE 3LPRA 1F0TA 4F49A 1XMNB 2ZCHP 4X0WU 4NG9H 5L2ZH 2CF9H 2ILNA 1YCPH 1IQNA 4Y11E 5T3HA 1EUFA 1KXFA 1KY9A 2FWWA 1QL9A 2BLOA 4X8TH 1YBWA 1EX3A 4IBLH 1CGJE 1TRYA 1CVWH 1RRKA 4X8UH 3M3SA 2XC4A 1Z71A 1F5LA 1FY3A 3PLBA 2GGVB 1C5OH 1WOFA 3QN7A 1A0LA 1H8DH 4I8JA 5AVDA 1AWHB 4FUIA 1F5RA 2HALA 1PPBH 2A5IA 3TH3H 3SV9A 1C9TA 2PW8H 1ANCA 2PFEA 3BTGE 2UUKB 4YOJA 1Y8TA 3E8LA 1SBWA 3LGUA 4X6MA 1GHBG 2PV9B 3M5MA 4CH8B 1KLIH 1O3GA 1DT2A 1BA8B 3R3GB 2BD2A 1MAXA 2Y80A 2ZPSA 4CHAB 4JYVH 1HAOH 2PTNA 2XW9A 4K69A 1DLKB 3HKIB 1PPEE 1Y59T 1TNGA 2D2DA 3ATLA 3MNSA 4ISLA 1C2KA 3UUZA 2FX6A 3BG4C 1DY9A 2OBQA 3UWIA 1TNJA 3ZZ7A 1MTSA 2PHBA 2SGEE 3D49H 3BG4B 1UTPA 3SNCA 1IHTH 2GZ7A 4LXBH 4YTAA 4MTBA 4FUCA 1P9SA 2BTCE 1C5UA 1M9UA 2OC0A 3UNSA 3ZVAA 3S0NA 3RXJA 3MI4A 1RXPA 1TAWA 1UHBB 1ZZZA 2OBOA 1DWEH 3T62A 2IJOB 5FX6A 1GMHG 3I29A 3GCTG 4WF8A 1F2SE 2R3UA 2BD5A 2GD4B 4X1RU 3ZVGA 1C1MA 4E7RG 3A7TA 3RMLH 1KXBA 5LGOA 3E91A 4ISIH 1FV9A 3PWCA 2OLGA 2ZFQH 3KL6A 1C2LA 3KF2A 4FU9A 1DOJA 1EXFA 4NZLA 2XCNA 1Q2WA 5EXNA 4K60A 5LPEA 1INCA 1EZUC 1QB9A 4DIHH 2V6NA 3E3TA 1TGNA 3LGWA 5TCAA 1BCUH 2BVXH 2VIWA 1GL1A 4NIYA 1XVMA 1ZMNA 1B0EA 1C5MD 2VVUA 9LPRA 2XC0A 2UUFB 1V6DA 4WMFA 1AMHA 2ZTYA 1O37A 3SN8A 1KXAA 1XKAC 2BY8X 1SGNE 3JZ1B 3U8TH 2PUQH 3UFAA 1MTWA 1L1JA 2B7DH 4IMQA 2ALVA 3HKJB 1MTNC 5EXLA 1QA7A 3DFLA 2FOAA 3LONA 4OS1A 1NRSH 3WY8A 4CRAA 2V0BA 4THNH 1MTNB 1C2EA 3K2UA 5FBIA 1YCPK 3UOUA 1O3BA 1IQMA 4ABDA 4X8VH 1GVKB 3UTUH 1DVAH 2BB4A 1CT4E 1ETSH 2VNTA 1O3EA 1P2MA 2J92A 2UWPA 1GJDB 3D23A 2HVXA 2PKSB 4NSYA 2FX4A 4INHA 1EZQA 4ABFA 1GHZA 1OWKA 2TBSA 4JYUH 3RXMA 1TBZH 1TBRH 3FFGA 2XBXA 1YPKH 3RDZA 4AOQA 1ELFA 3VB7A 1SC8U 2JH0D 4AG2A 1K9OE 2ZWLH 1HAVB 1LMWB 3UQOA 2F9BH 2BDCA 1AU8A 1T8MA 2FOMB 3UWJH 4YZUA 1KLJH 5T6FA 1YGCH 1ESAA 1YPGH 3PLPA 2ZFFH 3TGJE 1HXFH 4X1QU 1D6RA 6LPRA 1HV7A 1O34A 3TITA 4GAWA 3KEEA 2A32A 5AHGH 3MO6A 1JMOH 2W5EA 3STIA 3BTQE 3GCHC 1MU6B 2HOBA 1MCTA 1GHXH 4OS5A 3SORA 2BZAA 4AFUA 1UVSH 1A3EH 3PMAB 5C20A 3S9CA 3UOPA 3U98H 1CT2E 5BPEA 3RXKA 4ZROA 2ULLA 4H42U 1OP2A 2ZG0H 1AWFH 5AFYH 1J9CH 3C1KA 5GPIB 3SNAA 3SI4H 1CA0C 4UFEH 3SGBE 4I31A 1A0HB 2GV7A 3ZZ5A 2C8YB 2LPRA 1O39A 2BYAX 1O3FA 2FI3E 1T4UH 5FPTA 2THFB 2A1DB 1THRH 2TGTA 4X2XA 3VEQB 5LH8A 2A0QB 4SGAE 3ODDA 5C1YA 1U6QA 7KMEH 4YO9A 1IQJA 2ZF0H 5DP6A 4X6OA 1FXYA 1GMDF 1ANBA 1ZR0A 2G5NA 5TJXA 3TJOA 1LVBA 4AGKA 3E0PB 1C5XB 5A0CA 4K2YA 4Y71A 3RMNH 1OS8A 2R2MB 1OXGA 3E1XB 2JH5D 1JRSA 1BRBE 1O3NA 3C27B 1P12E 1BRUP 4WVPE 1FAXA 2ZU1A 3RXOA 2GVFA 2ZZUH 3T2NA 1TMTH 2OINA 3A88A 4VGCC 2DE8A 2GT8A 1V2MT 1FIZA 1ELVA 5C5NA 1SGTA 4UFGH 1QA0A 3M36A 1D3DB 1A5GH 1BOQA 3T26A 1O2JA 1XUKA 3MU8A 2BLWA 5FX5A 4K3JA 2F9OA 1SMFE 2R2WU 4GCHF 1L0ZA 1MZAA 3LKWA 4U2WA 2ZGBH 3MFJA 4YLQH 1A61H 3ITIA 1GPZA 2PGBB 1TA2A 4MPVA 1CGIE 1G32B 2LNCA 1PPFE 3P6ZB 1KTTB 4BXWA 4JZIA 3RXBA 2BXTH 1O2KA 1TNIA 3K65B 3MU0A 3RC6A 1O3IA 1WTGH 3RM0H 1NO9H 1DUEA 1BTPA 4ABIA 1QRZA 3D62A 2JETC 1O3PB 1W7XH 2B5TB 1NRRH 2VGCC 1T7CA 1TNKA 2JETB 1E36B 1HJAC 1YPJH 1C5SA 1LKAA 4RSPA 5A2MH 1QRWA 3K9XB 3W95A 3U1IB 2BDHA 2TIOA 1O5AB 2BOHB 4MG3A 1HJAB 3A8DA 1TGBA 3RU4T 2HNTE 8KME2 4ZAEA 4YT7H 2ESTE 4TY7A 1FUJA 1MU8B 4FUHA 4I7YH 2ZFSA 1NROH 1V2TT 4MLFB 2OQ5A 1T31A 2QA9E 2ZFPH 4TWWA 2J95A 2G4UA 2Z3DA 1H9HE 2GCTC 4I8HA 1S6FA 3SJKA 3SHAH 3KGPA 1GJ8B 1LPGB 5FCKA 4NWKA 1QJ7B 1BHXF 2GCTB 1TGCA 3PWBA 1C1OA 1FONA 3LH3A 2AFQB 4GCHG 4Y7BA 3W94A 4XFQA 3QZRA 1UVTH 4XDEA 1YLCA 2SGPE 1TNHA 4MQAA 1GBBA 1AFQB 1BTWA 1RS0A 3R0FA 2AGGX 4I8LA 3MH5A 1G3BA 4KTCA 3D65E 1XUJA 1J15A 1FMGA 2AYWA 2GT7A 1BTXA 4YOGA 3B9FH 4CR9A 1C5YB 1EPTC 1AHTH 1FIWA 3L33A 1CHGA 2HNTF 2M5TA 5F6MA 1SSXA 5T6DA 1P2JA 2D1JA 1P05A 2TPIZ 2V3OH 3TH2H 2UWLA 3M5OA 2Q6DA 4X2VA 2GCHF 4ZKNU 1FY5A 1NN6A 3SU6A 2H5DA 1SGEE 1NRNH 3MO3A 2PGQB 2BX4A 1ZPBA 3RMMH 3P8OA 2CGAA 3UR9A 2Z9GA 1TWXB 1J8AA 2W3IA 3MH6A 1LHFH 4WY3A 2XTTB 1VITG 4A1TA 3CENA 2Z7FE 2NU1E 3P17H 3Q00A 2UUYA 1V2KT 1HAVA 1UTKA 1QQ4A 4D7GA 4MNXA 1RD3B 4JYTA 1O3OA 2SGFE 4AFSA 1Z8JB 2PUXB 1YLDA 4WH6A 3KNXA 1P2IA 3HGPA 1O2IA 1GI7B 1TPAE 1ZSJA 2HPPH 4Y10E 5GJ4B 1HLTH 1SGFA 4KP0A 1CHOF 1FPHH 1GHAF 1D9IA 1DITH 1PFXC 5EPNA 1TGTA 1O32A 1UMAH 2EA3A 4JZEH 1RIWB 4YT6H 5DP7A 2NU4E 5DP5A 3A89A 2WINI 3NZIA 3SUDA 1TX7A 3MU1A 4GSOA 3PV4A 2Y5FA 1Y3XA 3K6YA 3IG6B 3Q76A 1BHXB 3VXFH 1LHGH 3KQEA 1A3BH 2TGAA 4OS6A 1EB1H 1QCPA 1VGCB 5JBAS 1WAYB 1Q3XA 1MKWH 2GCHG 2G5VA 2XC5A 1BITA 1P09A 1XX9A 2BLVA 2ZKSA 3P8NA 4ABAA 1S6HA 1FDPA 4Y76A 3T27A 1GI2A 2FOFA 1DLEA 1IQIA 1W2KH 1A4WH 1OWEA 4NA9H 5C3NA 1V2UT 4CBOA 1GG6B 4AYYB 1P2OA 4LK4A 1O5GH 1ARBA 2HNTC 3BIUH 1GBEA 3NKKA 3RXVA 1IHSH 1YC0A 1P04A 1Y3YA 1ZRKA 2K1QA 1O2VA 1TPOA 1E0FD 4E05H 1G3EA 1IQFA 2B0FA 2P3TB 1YPEH 1AFEH 1UK4A 3I77A 1K1NA 1TLDA 4AFQA 2GZ9A 5ABWA 2WPJS 4DW2U 3EE0B 1GHVH 1K1PA 1ZPCA 5A8YA 1CU1A 1TA6A 1AE8H 1CHOG 1GHAG 3VFEA 1SGIB 4Y79A 3ZVBA 2RCEA 3EA8A 3ZVCA 2QYIA 4A6LA 3ZZ3A 1F0UA 1P11E 1THPB 1WU1A 2BD7A 1V2NT 2XWAA 2P59A 3MH4A 2VIQA 3A7VA 1P3CA 1GHBF 4DGJA 1LHEH 2BM2A 3AASA 2QIQA 3A8AA 5EXMA 1GBLA 1P10A 3M3TA 1O2LA 3HPTB 3RC4A 1O2RA 3M5LA 2F91A 1KDQB 1YM0A 5C2ZA 1ELEE 4X1SU 1AUJA 1GBDA 4A92A 2GDEH 1EAIA 2F83A 7LPRA 2Z6BD 3S9AA 2H9HA 3DUXH 3LDXH 1O5BB 4BNRA 2FP7B 5IDKA 1C1NA 3LOXA 1NU9A 2AGIX 3RXDA 2Y7ZA 3TJUA 3RM2H 1HAYB 1QHRB 1ABIH 3PMBB 3T5FH 2WPLS 3U8RH 1NFWA 1TOCB 4DJZB 1Y5AT 3SU4A 5J4SA 3H5CB 3BTDE 1GMHF 1TE0A 1O3MA 1BIOA 3GCTF 1HBTH 1LVYA 1W7GH 1C5QA 2J34A 3H7OA 3GCNA 5J4QA 1F92A 1BT7A 1DXWA 5DGJA 3P8FA 1HCGA 1YKTA 4O97A 2VH0A 1C4Y2 1PQ7A 1EAUA 1GJ9B 2XCFA 3GISB 1AVXA 3RXGA 5EW1H 1F7ZA 1K1MA 3SUGA 1RGQA 3UR6A 1VITH 1O2XA 1C2HA 2O8LA 2O9QA 1SGDE 5JBTA 1AUTC 2P8OC 5DP9A 1CSOE 2I6QA 4O3UA 5EGMA 4INKA 5FCRA 1MKWK 1MUEB 1GJ5H 2AGEX 1IQEA 3ENSB 1WV7H 2FOHA 3RLYH 1O2WA 2Q6FA 4KGAA 4K5ZA 2FS9A 4ABHA 1IOEA 4X1NU 1XUIA 4O03A 1ZMJA 2BD4A 1HAGE 2ALPA 1GBFA 1P02A 1ZSKA 2SGQE 1MKXH 3T28A 1NPMA 4WMEA 3RXUA 1V2LT 4UD9H 1OWDA 2NU2E 5K7RA 2QCYA 3BTEE 2A4RA 1O0DH 4Q2KA 2EI8A 1XUFA 3EQ0H 4WXIA 4DG4A 1C1SA 5LPRA 1FPCH 1AD8H 4DVAU 1EZSC 2QGRA 1LQDB 1X7AC 3A7YA 4IN1A 1F5KU 2XBWA 3BF6H 2ASUB 1NRQH 4TY6A 4NIWA 1SGCA 3ELAH 1L1NA 3P70B 3QWCH 2ZGHA 4UONA 1AKSA 1IQLA 1NM6A 1GBIA 1K1OA 4B2BA 3ZVDA 4Z0KA 1N1LA 3GCOA 3PB1E 1SOZA 3SW2B 1QL7A 1ZGVA 1EB2A 1GI6A 3QX5H 3TK6A 1V2PT 4GHQA 3RXEA 4NGAH 5BRRE 4OGXA 2GMTC 4A7IB 5JDUB 2OUAA 4ISNA 1FZZA 1S84A 4GUXA 3V3MA 2V3HH 3PO1C 2SGDE 7GCHG 3KHVA 1OOKB 3NUMA 3PMJA 3RU4E 1KLTA 3B23B 5B6OA 1MBMA 3SBKA 1P9UA 2ZHDA 1TPSA 1V2QT 1G30B 3GYMA 3RLWH 1SHYA 2C3SA 3EA9A 1XXDA 1D3QB 3TK5A 3QUMP 4OS2A 1XXFA 3NXPA 2UUJB 2WYGA 4FUBA 3EYDA 4KTSA 1UVOA 4BAKB 1J16A 2B8OH 8GCHF 3UPEA 1GBKA 3SUFA 3PTBA 4ABBA 2BY5X 3MYWA 4ISHH 2GV6A 1KSNA 6ESTA 1LHDH 5JPMH 1HAXB 4CH2B 5HXFA 2C8WB 3MWIU 4U32A 4K1SA 1L2EA 2OQUA 2ZFRH 2C4FH 1HJ8A 1VCWA 2BQ7B 4CRDA 1E37B 2ZTZA 1NU7B 5EW2H 3A7WA 1XUHA 1VCPA 1EJMA 3QO6A 1NC6A 1SGFG 2BDAA 1O2NA 3MU5A 4B75A 5E2PA 1K22H 1MD7A 3LC3A 4CRBA 5I46H 2XXLA 3ATKA 1Y3WA 3VXEH 1HIAB 2AMPA 2J94A 1O5FH 2Y5GA 3GOVB 1P8VC 1W14U 1KIGH 1YCPM 3ZZ8A 2Z3CA 3AVZA 3GCHB 1G3CA 3TGIE 2BD9A 3LU9B 1ZHRA 2PKAB 5E0GA 1WQSA 2BOKA 3AW1A 2KAIA 1KDQA 4AB8A 1S0QA 1MKXK 4RKOB 5HM2A 1RTLA 1PQ5A 1O30A 3SNBA 1MCVA 1UTJA 1HFDA 5AFZH 8GCHG 5A8XA 1C2DA 1CA0B 2PSXA 4CREA 4Y6DA 2FESH 1QGFA 1EP5A 1UK2A 1HPGA 1DSTA 2C93B 5HMAA 3SQHE 2R9PA 1EP6A 1FY1A 1YP9A 1LPKB 3F9FA 4HFPB 1QBVH 2HRVA 2UWOA 2BDBA 1AQ7A 2H1UA 4TWYA 4YLUA 3B8JA 3NK8A 2D26C 2QF3A 1JWTA 1C1UH 5GIBA 4K8BA 4MPUA 1HXEH 1L4DA 1UO6A 2STBE 3MTYA 4K1TA 1TRNA 1GVZA 1FLEE 2WV4A 1QB1A 1D4PB 3S7KB 5E2OA 2J38A 1T8LA 5DPAA 1DE7H 3QTOH 1HRTH 1SQAA 1H4WA 1BRAA 1CGHA 1SR5C 4VGCB 4K8YA 2FLBH 1PPCE 4FUGA 2G00A 3GY7A 3LH1A 1GHYH 2XWBI 3QTVH 3SOSA 3GYLB 1PJPA 2FXRA 1CT0E 1MAYA 1AVGH 3BTME 1W10U 1YPHE 1AN1E 2A45B 5E0HA 1O2UA 1NY22 2QF0A 1G3DA 7ESTE 1AGJA 1PPZA 1C2FA 4IGDA 2ZI2H 2ZFTA 4Y0ZE 1Z6JH 5DP3A 1Z8RA 1ARCA 1LTOA 1O33A 1S81A 4NFFA 3M3VA 2H9EH 2FPZA 3SI3H 1VJ9U 4FVBA 4B73A 3ZV8A 5EQSA 4OS7A 1G9IE 3K6ZA 4XSKU 5TCCA 4FU8A 3S69A 1WCZA 1GI3A 1Z8GA 1O36A 2CHAC 3Q3XA 2F9UA 4FUJA 1UHBA 1HDTH 2CMYA 2VGCB 3L3TA 1JXPA 3LJJA 1H8IH 4DOQA 4D8NA 1Y3UA 1JIMA 2TGPZ 3FANA 4U01A 3TH4H 1P57B 2CHAB 2VIPA 4ASHA 2BDIA 2VWNA 3PYHA 2O8UA 2Q6GA 1VITF 3O8CA 1DFPA 4ZH8A 1TOMH 4NFEA 3KCGH 2EI7A 4OGYA 1CA8B 1FNIA 3SV6A 4IS5A 1GI0A 4BTTB 4JZ1A 1SL3A 2ZDAH 1W11U 1T32A 3BG8A 1W3CA 1SQTA 3GY5A 2P16A 1OYQA 2FTLE 4TYDA 3LGTA 1TNLA 2ZTXA 4WMDA 4UE7H 1YPLH 1GBJA 2A2XH 1DWDH 5PTPA 1NS3A 3URDA 1NFUA 4I33A 1ZHPA 4XBBA 1UCYH 1K21H 3RXIA 3ESTA 2CN0H 1Z1IA 2A2QH 1T8OA 1TX6A 3V7TA 2CJIA 1LDTT 3SU2A 3LC5A 3FZDA 3QK1A 3LJOA 1B7XB 3TJNA 2GTBA 1E34B 2VB0A 4R8TB 5CMXH 3BTWE 1DWCH 2P95A 5A09A 4DY7B 2BHGA 1AI8H 4NA7A 1QTFA 1UVUH 3A83A 2EEKA 2OC7A 1EPTB 1GI1A 4I8KA 1W0ZU 2Z94A 1K1IA 3GICB 1LPZB 1EOLA 1C2GA 1K1JA 2F9PA 1NESE 2BDYA 4MVNA 3TU7H 1LKBA 5FPYA 3BTHE 1MQ5A 3SV7A 5FAHA 3MHWU 1AZ8A 3RXPA 3A85A 3GDVA 1G2LA 2TGDA 3ZYEA 1V2WT 1UTQA 1ABJH 4A1XA 4RN6A 4HTCH 1GJ6A 2AH4X 1QQUA 1ESBA 1ZTLA 1MBQA 3TLOA 2AMQA 1YF4A 1JIRA 1UTLM 1GCTC 5L6NH 1MH0A 4FXGH 2FI5E 1HIAA 1AB9C 5GWZA 1YPHC 1O2SA 1G36A 5A8ZA 4ZKRU 4OS4A 2FDAA 3ATIA 4X8SH 3UNRA 1UK3A 4AFZA 1AB9B 1SVPA 3FVFB 4AYVB 2W7UA 3JZ2B 2PKAA 3FP8E 3VB5A 3ZV9A 1GI9B 3BIVH 2VWOA 3MNCA 3MU4A 2VIVA 4I32A 3PLKA 1KXCA 1EAXA 1K28D 1THSH 1TMUH 5ESTE 3URCA 1PPGE 1SLVB 1TONA 4ZMAH 2YOLA 2J4IA 2VINA 3MO9A 4JMYA 2VVCA 1NTPA 2JH6D 1NFXA 4H6TA 4NCYA 5CHAC 5DJ7A 5IYTA 3FP6E 1BJVA 1XVOA 3LGYA 1TGSZ 4HI3A 2GDDA 1ZJDA 4AORA 1JOUB 3VPKA 4LZ1H 1A7SA 5GCHF 1CBWC 2BD8A 2ZEBA 1BDAA 1FI8A 3FZZA 1SGYE 2Y6TA 5EQQA 3QGJA 1RTFB 2A4QA 4U30A 4Z6AH 3O8DA 1BMAA 1CBWB 1TYNA 1C1VH 1C2IA 1S5SA 1BZXE 1SG8B 4O3TA 2ANWA 3L6PA 1MTVA 1TQ0B 3TIUA 1MZDA 1NRPH 3F1SB 1KTSB 2QC2A 1PPHE 5JBBS 3SZNA 2ZDKA 2ANKH 4AB9A 3OTJE 4JK6A 4HGCA 3VB4A 1OP8A 4J1YA 3SUEA 3OYPA 4Q80A 1ELAA 4MNWA 2A31A 2QV1A 3KQDA 2YNBA 4ZXXH 3ZZ9A 4CBNA 4I8GA 1N8OC 1ELGA 3IWMA 4UDWH 4IMZA 2BY9X 2SNVA 1VJAU 4LOYH 3M61U 4D7FA 4WXVA 1GBMA 3LIWA 2BLQA 1LVOA 1PYTD 2FODA 3DFJA 1DDJA 5EPYA 5JYIA 1W12U 4IN2A 2IPHA 1K2I1 1GI8B 3AAVA 1C9PA 1O3HA 1QB6A 1WQVH 3ODFA 4KKDA 3A87A 5C1UA 1RFNA 1Z6EA 1PYTC 2ANYA 2ODQA 2ZU5A 1HAZB 1ZSLA 1GDNA 4R0IA 2ZO3H 4CRFA 2GZ8A 2PR3A 2OD3B 4FVDA 1AVWA 1O3LA 1BMLA 2J9NA 3EAJA 4IC6A 5DG6A 5GCHG 3RXQA 2STAE 2ZQ2A 2FTMA 1N6YA 2ZHEH 1T8NA 4NIXA 3ATWA 3M35A 2FEQH 3M7TA 2A7CA 3V12A 3E90B 2WPMS 2ZIQH 1A1RA 1C5ZB 4MNYA 5ESBA 5H4IB 2AS9A 2XNIA 1RTKA 1V2ST 1W0YH 2G51A 4O9VA 4FU7A 1O2GH 1GWAA 1OSSA 8LPRA 2OC8A 4ISOA 1BQYA 3A80A 5JBCS 1UCYE 3SV8A 5E0JA 4WWYA 1KXDA 5C5OA 1S82A 3SQEE 2ZNKH 2RA3A 3ZZ6A 1O2TA 2G55A 2WPIS 1BJUA 2FI4E 4NZQA 4Q7ZA 1P0SH 1CQQA 3MNBA 1RJXB 1ZHMA 3A8BA 3A7XA 1W8BH 2VH6A 3BTKE 6CHAC 3Q3YA 2ZDMA 1GBCA 1AZZA 1EASA 5DK1A 4Y8XA 3GY6A 3F9EA 5L30H 6CHAB 3SJOA 1JBUH 2OC1A 2ZDLA 1EAWA 4NSVA 1DXPA 2BZ6H 2A7HA 3E6PH 1TX8A 2P8OB 5EU8A 2RA0A 5T6GA 4DCDA 7GCHF 4UFFH 4BTUB 3AAUA 2FOEA 1DPOA 2Y81A 2XBYA 1EPTA 1DX5M 3HATH 1HAPH 4DT7B 1P3EA 3UNQA 1UJ1A 4CHAC 1O3DA 3ZZBA 1BTUA 5HM9A 9ESTA 1C1WH 1YYY1 1TMBH 2WYJA 3BEUA 4ZKSU 5CE1A 3U69H 2FS8A 1SB1H 5L2YH 3IITA 1TPPA 2OTVA 2FOBA 1IAUA 3CS0A 1GCDA 2HGTH 2Y5HA 2XYAA 4B1TA 3RMOH 1TIOA 3QLPH 4ABGA 1C1PA 2AIPA 3S7HB 3RUOA 4IW4E 2Z9IA 6GCHF 4Y8ZA 1SFIA 1Y5BT 2H2ZA 1ZJKA 3BEIB 3AW0A 1O2OA 4AGJA 4X1PU 3SU5A 4YOIA 4ZUHA 2P93A 1O3AA 3SU3A 1C5PA 2ANMH 1QL8A 2WUCA 1OWJA 1EQ9A 1XM1A 3VB6A 3LGIA 1FY8E 2QXGA 4FUEA 1T4VH 3GY3A 4AX9H 1BBRH 1SGQE 4E06H 3TNTA 2GMTB 1O2PA 2NU3E 3M5NA 3DHKH 3DA9B 1FJSA 2ZA5A 3GY4A 1HAHH 3V0XA 1Y5UT 2H9TH 1TBQH 3PO1B 4TPYA 4A5TS 1D3PB 5DP4A 3KQBA 1O31A 1C5TA 5F8ZA 1SPJA 2A4OA 4ZHLU 1ORFA 2ZDVH 2ZU2A 1EKBB 1QIXB 3PMHB 3V13A 1HJ9A 2EC9H 3PTNA 3KIDU 3NPSA 1S85A 3S9BA 3O8RA 2ZGJA 3HK3B 3EA7A 4WH8A 3A84A 3P95A 3RXTA 2QXHA 2V35A 2PWXA 1A46H 3RXRA 1MD8A 3P92A 1IQHA 1DWBH 4XE4A 5EOKA 1TABE 3MH7A 3ZZCA 1N6XA 1FQ3A 2I6SA 2PKSC 3MMGA 1EJAA 1ESTA 1SOTA 2BDGA 6GCHG 2BY6X 5E8EH 3QGNB 4BAOB 1C1TA 2DE9A 1QFKH 2Z3EA 3F6UH 2H6MA 2BQ6B 3PM3A 1BMNH 4Q7XA 1W13U 3KQCA 2CV3A 1J14A 3BV9B 3VB3A 5GXPA 3A7ZA 1TQ7B 3ZZ4A 3RC5A 1EATA 5C67A 1GI5A 3TK9A 1Z8IB 1XKBC 1PQ8A 1GBTA 3LT3A 2W3KA 4E7NA 2Q1JA 1C5LH 4CRGA 1HUTH 4D9QA 4MPXA 1BB0B 1MTUA 1LO6A 2Y7XA 3MOCA 3NWUA 2IN2A 5EG4A 5F8TA 1SFQB 1GL0E 1O5EH 4CRCA 4TPIZ 3SNDA 2XRCA 2J2UA 2SFAA 2ZHWH 2BXUH 3EGKH 1BMMH 1GHWH 5FHTA 1P2KA 1AO5A 5K0HA 1BTHH 3SV2H 5F03A 2O8WA 2ZHFH 4ABEA 5AF9H 4BOHA 3QDZB 1DUAA 1GJBB 4QT8C 1P06A 3M7QA 1QJ6B 5EODA 4GHTA 3RXFA 2IOTA 3SGAE 2D8WA 4AG1A 3VGCC 1XUGA 2A4GA 4JZFH 1P03A 2OXSA 1C5WB 1O2MA 3VGCB 2C8XB 1OKXA 1E35B 1WSSH 2ZU3A 1TB6H 3Q77A 1O5DH 2ZPRA 1P2NA 2FM2A 2ZQ1A 2R0KA 3OY5U 4B76A 3BSQA 3UREA 1OYTH 3P8GA 2FYRA 2GKVE 5I25A 3RU4D 2FOCA 2BQWB 3E0NB 2ZP0H 2SGAA 4LZ4B 2PSYA 4F4OC 1DSUA 2QXJA 2ZGXH 1BBRK 1C1RA 1DANH 1UTMA 5HYOA 1Z1JA 2BX3A 4GLYA 1GJCB 2CXVA 4H6SB 5LPFA 1BUIA 4INLA 2GX4A 4B2AA 1L1GA 2GP9B 1SHHB 1V2RT 1O2QA 1DS2E 2BD3A 1FAKH 3SHCH 4J2YB 1O3KA 3RXHA 1IQKA 3UY9A
chains in the Genus database with same CATH superfamily
3TJVA 3OSYA 1TFXA 1S83A 5G4BA 3SJ9A 2WUBA 2G52A 1VCQA 1ANDA 2RDLA 2QY0B 4X6PA 3TVJB 2R0LA 3ZYDA 1CE5A 4D76A 2R3YA 1CO7E 2TRMA 2VIDA 2SNWA 2F9NA 3MNXA 1FN8A 2ODPA 1D6WA 1GJ7B 2FIRH 2W7SA 2ZECA 4KELA 1V3XA 1D3TB 1SLXB 2VWLA 3KYFA 4BAMB 1ZMLA 5FPSA 2DUCA 4F48B 1YPMH 1C5NH 2BMGB 4XRNA 1GMDG 4B6FA 1Q31A 2P3UB 1J17T 3M37A 5EQRA 2AIQA 2HPQH 2WPKS 3ZZDA 3TPIZ 4ABJA 1FY4A 4YM9A 2O8MA 4ZHAA 2QN5T 1TALA 3SNEA 4ZXYH 2C90B 4JCNA 4Y8YA 4A1VA 4AZ2B 4B6EA 2QAAA 1WTHD 1GDQA 5DKMA 1ETTH 4FUFA 4BAHB 3PROA 4RKJB 5SGAE 3FAOA 1S0RA 1TRMA 1GBHA 1GI4A 1OWIA 1BBRE 4MDSA 2A7JA 1O3CA 2HLDD 3A81A 1QURH 1QBOA 2ZDNA 1ACBE 4ZHMU 1QY6A 1ZPZA 1ETRH 4B71A 2P94A 1Z7KA 2QE7D 2ZHQH 3SU1A 1O38A 4NWLA 3A86A 1AFQC 1VR1H 3FP7E 1O3JA 1SLUB 4BTIB 2WV5A 2Z9LA 2C8ZB 1O2YA 1A2CH 3TGKE 3OEHD 5FBEA 3KN2A 4XBDA 3NCLA 1BTYA 1JRTA 1OPHB 5A0BA 1O2HA 1O2ZA 3UQVA 4JK5A 2Y82A 3F9HA 3SJ8A 1GJ4H 4OM9A 3LGVA 1ELBA 1KYNA 3SU0A 3H7TA 4NIVA 1UVPA 2LELA 5HIZA 1F0SA 2BVSH 2ZPQA 3F68H 3CP7A 4XBCA 1UW7A 1GGDC 1WUNH 8ESTE 3OX7U 3OY6U 4ESTE 2FMJA 2HLCA 2NU0E 1P2QA 3BTFE 1GGDB 2QXIA 4B2CA 1WBGB 4K1EA 3M7UA 4D9RA 4HZHA 2A5KA 2OP9A 1COWD 3ZVEA 1H1BA 1HYLA 5FXLA 1HB0B 2ZCKP 1QJ1B 3I78A 2BY7X 1YLNA 3EDXB 1GCTB 3OU0A 5GDSH 4BAQB 1B5GH 1LQEA 1NFYA 2VWMA 2VVVA 4B74A 2BVRH 2FYQA 1EJNA 4IC5A 1GBAA 1LHCH 1UTNA 3UIRA 1AKSB 2VJ1A 3ZZAA 2PTCE 1SI5H 1DY8A 4KTUA 2Z9JA 4FUDA 4Y7AA 4Z1MD 4DURA 4UEHH 2ZC9H 1ID5H 1RIWC 1V2OT 3CS7A 4CR5A 3RXSA 1SGPE 1AE5A 1F0RA 3G01A 3TNSA 1ANEA 1HGTH 4PROA 3RXLA 5CDFE 1GDUA 1C1QA 1OX1A 4WJG2 5JB9S 1GMCF 1H9IE 3ATMA 1C5VA 5HGGA 1WXRA 1GVLA 1NZQH 1FN6A 3BEFB 1VGCC 2A5AA 5GNDA 4BXSA 1QR3E 1K1LA 4SGBE 1PQAA 1QNJA 5CHAB 4YESB 3RXCA 5F8XA 1HNEE 3ZIAD 1WYKA 1C2MA 4X2WA 1BMFD 3F9GA 5A0AE 3HGNA 4XOJA 3T25A 1ZOMA 1ELTA 2G8TA 3A8CA 2FOGA 2JKHA 1DM4B 1LCYA 1DICA 1GG6C 3DT0H 1OP0A 1E38B 2VIOA 4TT3D 1QRXA 3E16B 1L4ZA 1AIXH 3HK6B 1IQGA 4NA8A 2F3CE 4JZDH 2YNAA 2B9LA 2OCVB 1BTZA 1ZYOA 5C1XA 4GPGA 4GVUA 5JB8S 3STJA 2AEIH 2ODYB 1G37A 1ZTJA 3BN9A 3A82A 1ZGIA 1UCYK 5F53A 1E79D 3GY2A 4Q7YA 3EE7A 1MMJN 2HWLB 1B0FA 2WPHS 4X2YA 2PLXA 1BRCE 4UFDH 4DIIH 3SJIA 1VZQH 2G81E 2FZZA 3U9AH 1AY6H 1G2MA 1HAIH 3U8OH 3VG8A 1ZLRA 3PRBA 3DD2H 3O8BA 1OWHA 4ZKOU 3GDUA 3GDSA 1C5RA 1N8OB 2AERH 1C4U2 5DP8A 1ZRBA 2FLRH 3ZVFA 2H5CA 4X6NA 3N7OA 1O35A 1UTOA 1EOJA 1C2JA 2ZCLP 1ELDE 1SQOA 2ZU4A 2G4TA 2NWNA 2RG3A 1A0JA 1QBNA 2P3FH 4M7GA 4AN7A 1A5HA 2XBVA 1H9LB 1GMCG 1Y3VA 1GJAB 2EI6A 4MPWA 3RXAA 4HG6A 3SGQE 1ZTKA 1MQ6A 1KXEA 2W26A 4Y0YE 3SO3A 2O8TA 3GY8A 1V2JT 2AMDA 3T29A 1O5CB 2VU8E 2ZGCA 5ETXA 1A5IA 1EZXC 3QZQA 3Q3KA 2CF8H 4H4FA 3RP2A 4BANB 2Z9KA 1V2VT 2FO9A 4MNVA 1P01A 3BTTE 1C4V2 1SLWB 2KAIB 1ELCA 1NT1A 2F9VA 2J97A 1LVMA 3U1JB 5DO4H 1SGRE 3LPRA 1F0TA 4F49A 1XMNB 2ZCHP 4X0WU 4NG9H 5L2ZH 2CF9H 2ILNA 1YCPH 2V7QD 2WPDD 1IQNA 4Y11E 5T3HA 1EUFA 1KXFA 2KX4A 1KY9A 2FWWA 1QL9A 2BLOA 4X8TH 1YBWA 1EX3A 4IBLH 1CGJE 1TRYA 1CVWH 1RRKA 4X8UH 3M3SA 4I86A 2XC4A 1Z71A 1F5LA 1FY3A 3PLBA 2GGVB 1C5OH 1WOFA 3QN7A 1A0LA 1H8DH 4I8JA 5AVDA 1AWHB 4FUIA 1F5RA 2HALA 1PPBH 2A5IA 3TH3H 3SV9A 1C9TA 2PW8H 1ANCA 2PFEA 3BTGE 2UUKB 4YOJA 1Y8TA 3E8LA 1SBWA 3LGUA 4X6MA 1GHBG 2PV9B 2JDID 3M5MA 4CH8B 1KLIH 1O3GA 1DT2A 1BA8B 1VKYA 3R3GB 2BD2A 1MAXA 2Y80A 2ZPSA 4CHAB 4JYVH 1HAOH 2PTNA 2XW9A 4K69A 1DLKB 4Q4LA 3HKIB 1PPEE 1Y59T 1TNGA 2D2DA 3ATLA 3MNSA 4ISLA 1C2KA 3UUZA 2FX6A 3BG4C 1DY9A 2WSSD 2OBQA 3UWIA 1TNJA 3ZZ7A 1MTSA 2PHBA 2SGEE 3D49H 3DCLA 3BG4B 1UTPA 3SNCA 1IHTH 2GZ7A 4LXBH 2RFKC 4YTAA 4MTBA 4FUCA 1P9SA 2BTCE 1C5UA 1M9UA 2OC0A 3UNSA 3ZVAA 3S0NA 3RXJA 3MI4A 1RXPA 1TAWA 1UHBB 1ZZZA 2OBOA 1DWEH 3T62A 2IJOB 5FX6A 1GMHG 3I29A 3GCTG 4WF8A 1F2SE 2R3UA 2BD5A 2GD4B 4X1RU 3ZVGA 1C1MA 4E7RG 3A7TA 3RMLH 1KXBA 5LGOA 3E91A 4ISIH 1FV9A 3PWCA 2OLGA 2ZFQH 3KL6A 1C2LA 3KF2A 4FU9A 1DOJA 1EXFA 4NZLA 2XCNA 1Q2WA 5EXNA 4K60A 5LPEA 1INCA 1EZUC 1QB9A 4DIHH 2V6NA 3E3TA 1TGNA 3LGWA 5TCAA 1BCUH 2BVXH 2VIWA 1GL1A 4NIYA 1XVMA 1ZMNA 1B0EA 5C17A 1C5MD 2VVUA 9LPRA 2XC0A 2UUFB 1V6DA 4WMFA 1AMHA 2ZTYA 1O37A 3SN8A 1KXAA 1XKAC 2BY8X 1SGNE 3JZ1B 3U8TH 2PUQH 3UFAA 1MTWA 1L1JA 2B7DH 4IMQA 2ALVA 3HKJB 1MTNC 5EXLA 1QA7A 3DFLA 2FOAA 3LONA 1H8HD 4OS1A 1NRSH 3WY8A 4CRAA 2V0BA 1MABB 4THNH 1MTNB 1C2EA 5HKKD 3K2UA 5FBIA 1YCPK 3UOUA 1O3BA 1IQMA 4ABDA 4X8VH 1GVKB 3UTUH 1DVAH 2BB4A 1CT4E 1ETSH 2VNTA 3F2HA 1O3EA 1P2MA 2J92A 2UWPA 1GJDB 3D23A 2HVXA 2PKSB 4NSYA 2FX4A 4INHA 1EZQA 2LP6A 4ABFA 1GHZA 1OWKA 2TBSA 4JYUH 3RXMA 1OHHD 1TBZH 1TBRH 3FFGA 2XBXA 1YPKH 3RDZA 4AOQA 1ELFA 3VB7A 1SC8U 2JH0D 4AG2A 1K9OE 2ZWLH 1HAVB 1LMWB 3UQOA 2F9BH 3KYGA 2BDCA 1AU8A 1T8MA 3KQ5A 2FOMB 3UWJH 4YZUA 1KLJH 5T6FA 1YGCH 1ESAA 1YPGH 3PLPA 2ZFFH 3TGJE 1HXFH 4X1QU 1D6RA 6LPRA 1HV7A 1O34A 3TITA 4GAWA 3KEEA 2A32A 5AHGH 3MO6A 1JMOH 2W5EA 3STIA 3BTQE 3GCHC 1MU6B 2HOBA 1MCTA 1GHXH 4OS5A 3SORA 2BZAA 2V3MA 3WW7A 4AFUA 1UVSH 1A3EH 1YY3A 2KZ4A 3PMAB 5C20A 3UOPA 3S9CA 3U98H 1CT2E 5BPEA 3RXKA 4ZROA 2ULLA 4H42U 1OP2A 2ZG0H 1AWFH 5AFYH 1J9CH 3C1KA 5GPIB 3SNAA 3SI4H 1CA0C 4UFEH 3SGBE 4I31A 1A0HB 2GV7A 3ZZ5A 2C8YB 2LPRA 1O39A 2BYAX 1O3FA 2FI3E 1T4UH 5FPTA 2THFB 2A1DB 1THRH 1K0HA 2TGTA 4X2XA 3VEQB 5LH8A 2A0QB 4SGAE 3ODDA 5C1YA 1U6QA 7KMEH 5IK2D 4YO9A 1IQJA 2ZF0H 5DP6A 4X6OA 1FXYA 1GMDF 1ANBA 1ZR0A 2G5NA 5TJXA 3TJOA 1LVBA 4AGKA 3E0PB 1C5XB 5A0CA 4K2YA 4Y71A 3RMNH 1OS8A 2R2MB 1OXGA 3E1XB 2JH5D 1JRSA 1BRBE 1O3NA 3C27B 1P12E 1S6LA 3SZEA 1BRUP 4WVPE 1FAXA 2ZU1A 3RXOA 2GVFA 2ZZUH 3T2NA 1TMTH 2OINA 3A88A 4VGCC 2DE8A 1EFRD 2GT8A 1V2MT 1FIZA 1ELVA 5C5NA 1SGTA 3NRLA 4UFGH 1QA0A 3M36A 1D3DB 1A5GH 1BOQA 3T26A 1O2JA 1XUKA 3MU8A 2BLWA 5FX5A 4K3JA 2F9OA 1SMFE 2R2WU 4GCHF 1L0ZA 1MZAA 3LKWA 4U2WA 2ZGBH 3MFJA 4YLQH 1A61H 3ITIA 1GPZA 2PGBB 1TA2A 4MPVA 1CGIE 1G32B 2LNCA 1PPFE 3P6ZB 1KTTB 3MQKC 4BXWA 4JZIA 3RXBA 2BXTH 1O2KA 1TNIA 5EIYA 3K65B 3MU0A 3RC6A 1O3IA 1WTGH 3RM0H 1NO9H 1DUEA 1BTPA 4ABIA 1QRZA 3D62A 2JETC 1O3PB 1W7XH 2B5TB 1NRRH 2VGCC 1T7CA 1TNKA 2JETB 1E36B 1HJAC 1YPJH 1C5SA 1LKAA 4RSPA 5A2MH 1QRWA 3K9XB 3W95A 3U1IB 3OAAD 2BDHA 2TIOA 1O5AB 2KCOA 2BOHB 4MG3A 1HJAB 3A8DA 1TGBA 3RU4T 2HNTE 2JJ1D 8KME2 4ZAEA 4YT7H 2ESTE 4TY7A 1FUJA 1MU8B 4FUHA 4I7YH 2ZFSA 1NROH 1V2TT 4MLFB 2OQ5A 1T31A 2QA9E 2ZFPH 4TWWA 2J95A 2G4UA 2Z3DA 1H9HE 2GCTC 4I8HA 1S6FA 3SJKA 3SHAH 3KGPA 1GJ8B 1LPGB 5FCKA 4NWKA 1QJ7B 2OK5A 1BHXF 2GCTB 1TGCA 3PWBA 1C1OA 4ACBA 1FONA 3LH3A 2AFQB 4GCHG 4Y7BA 3W94A 4XFQA 3QZRA 1UVTH 4XDEA 1YLCA 2SGPE 3W1EA 1TNHA 4MQAA 1GBBA 1AFQB 1BTWA 1RS0A 3R0FA 2AGGX 4I8LA 3MH5A 1G3BA 4KTCA 3D65E 1XUJA 3PRDA 1J15A 1FMGA 2AYWA 2GT7A 1BTXA 4YOGA 3B9FH 4CR9A 1C5YB 1EPTC 1AHTH 1FIWA 3L33A 4TSFD 1CHGA 2HNTF 2M5TA 5F6MA 1SSXA 5T6DA 1P2JA 2D1JA 1P05A 2TPIZ 2V3OH 3FN8A 3TH2H 2UWLA 3M5OA 2Q6DA 4X2VA 4DT4A 2GCHF 4ZKNU 1FY5A 1SQRA 2QF5A 1NN6A 3SU6A 2H5DA 1SGEE 1NRNH 3MO3A 2PGQB 2BX4A 1ZPBA 3RMMH 3P8OA 2CGAA 3UR9A 2Z9GA 1TWXB 1J8AA 2W3IA 3MH6A 1LHFH 4WY3A 2XTTB 1VITG 2F4LA 4A1TA 3CENA 2Z7FE 2NU1E 3P17H 3Q00A 2UUYA 1V2KT 1HAVA 1UTKA 1QQ4A 4D7GA 4MNXA 1RD3B 4JYTA 1O3OA 3F2GA 2SGFE 4AFSA 1Z8JB 2PUXB 1YLDA 2KCYA 3KNXA 4WH6A 1P2IA 3HGPA 1O2IA 2VBCA 1GI7B 1TPAE 1ZSJA 2HPPH 4Y10E 5GJ4B 1HLTH 1SGFA 4KP0A 1CHOF 1FPHH 1GHAF 1D9IA 1DITH 1PFXC 5EPNA 1TGTA 1O32A 1UMAH 2EA3A 4JZEH 1RIWB 4YT6H 5DP7A 2NU4E 5DP5A 3A89A 2W6JD 2WINI 3NZIA 3SUDA 1TX7A 3MU1A 4GSOA 3PV4A 2Y5FA 1Y3XA 3K6YA 3UB0A 3IG6B 3Q76A 1BHXB 3VXFH 1LHGH 3KQEA 1A3BH 2TGAA 4OS6A 1EB1H 1QCPA 1VGCB 5JBAS 1WAYB 1Q3XA 5FL7D 1MKWH 3FO8D 2GCHG 2G5VA 2XC5A 1BITA 1P09A 1XX9A 2BLVA 2ZKSA 3P8NA 4ABAA 1S6HA 1FDPA 4Y76A 3T27A 1GI2A 2FOFA 1W2KH 1DLEA 1IQIA 1A4WH 1OWEA 1H8ED 4NA9H 1V2UT 5C3NA 1GG6B 3GS9A 4CBOA 4AYYB 1P2OA 4LK4A 1O5GH 1ARBA 2HNTC 3BIUH 1GBEA 3NKKA 3RXVA 1IHSH 1YC0A 3FOAA 1P04A 1Y3YA 1ZRKA 2K1QA 1O2VA 1TPOA 1E0FD 3DSOA 4E05H 3F3BA 1G3EA 1IQFA 2B0FA 2P3TB 1YPEH 1AFEH 1UK4A 3I77A 1K1NA 1TLDA 4AFQA 2GZ9A 5ABWA 5DN6D 2WPJS 4DW2U 3EE0B 1GHVH 1K1PA 1ZPCA 5A8YA 1CU1A 1TA6A 1AE8H 1CHOG 1GHAG 3VFEA 1SGIB 4Y79A 3ZVBA 1YWUA 2RCEA 3EA8A 3ZVCA 2QYIA 4A6LA 3ZZ3A 1F0UA 5KEDA 1P11E 1THPB 1WU1A 2BD7A 1V2NT 2XWAA 2P59A 3MH4A 2VIQA 3A7VA 1P3CA 1GHBF 4DGJA 2IJD1 1LHEH 2BM2A 3AASA 2QIQA 3A8AA 5EXMA 1GBLA 1P10A 3M3TA 1O2LA 3HPTB 3RC4A 1O2RA 3U28C 3M5LA 2F91A 1KDQB 1YM0A 5C2ZA 4Q63A 1ELEE 4X1SU 1AUJA 1GBDA 4A92A 2GDEH 1EAIA 2F83A 7LPRA 4AC9A 2Z6BD 3S9AA 2H9HA 3DUXH 3LDXH 1O5BB 4BNRA 2FP7B 5IDKA 1C1NA 3LOXA 1NU9A 2AGIX 3RXDA 2Y7ZA 3TJUA 3RM2H 1HAYB 1QHRB 1ABIH 3PMBB 3T5FH 2WPLS 3U8RH 1NFWA 1TOCB 4DJZB 1Y5AT 3SU4A 5J4SA 3H5CB 3BTDE 1GMHF 1TE0A 1O3MA 1BIOA 3GCTF 1HBTH 1LVYA 2XNDD 1W7GH 4XD7D 1C5QA 2J34A 3H7OA 3GCNA 5J4QA 1F92A 1BT7A 1DXWA 5DGJA 3P8FA 1HCGA 2EY4C 1YKTA 4O97A 2VH0A 1C4Y2 1PQ7A 1EAUA 1GJ9B 2XCFA 3GISB 1AVXA 3RXGA 5EW1H 1F7ZA 3WWFA 1K1MA 3SUGA 1RGQA 3UR6A 1VITH 1O2XA 1C2HA 2O8LA 2O9QA 1SGDE 5JBTA 1AUTC 2P8OC 5DP9A 1CSOE 2I6QA 4O3UA 5EGMA 4INKA 5FCRA 1MKWK 1MUEB 1GJ5H 2AGEX 1IQEA 3ENSB 1WV7H 2FOHA 3RLYH 5EJLA 1O2WA 2KM0A 2Q6FA 4KGAA 4K5ZA 2FS9A 4ABHA 1IOEA 4X1NU 1XUIA 5KGOA 4O03A 1ZMJA 2BD4A 1HAGE 2ALPA 1GBFA 1P02A 1ZSKA 2SGQE 1MKXH 4RT0A 3T28A 1NPMA 4WMEA 3RXUA 1V2LT 4UD9H 3DSPA 1OWDA 2NU2E 5K7RA 2QCYA 3BTEE 2A4RA 1O0DH 4Q2KA 2EI8A 1XUFA 3EQ0H 4WXIA 4DG4A 1C1SA 5LPRA 1FPCH 1AD8H 4DVAU 1EZSC 2QGRA 1LQDB 1X7AC 3N7EA 3A7YA 4IN1A 1F5KU 2XBWA 3BF6H 2ASUB 1NRQH 4TY6A 4NIWA 1SGCA 3ELAH 1L1NA 3P70B 3QWCH 2ZGHA 4UONA 1AKSA 1IQLA 1E1QD 1NM6A 1GBIA 1K1OA 4B2BA 3ZVDA 4Z0KA 1N1LA 2WV9A 3GCOA 3PB1E 4ASUD 1SOZA 3SW2B 1QL7A 1ZGVA 1EB2A 1GI6A 3QX5H 3TK6A 1V2PT 4GHQA 3RXEA 4NGAH 5BRRE 2EQNA 4OGXA 2GMTC 4A7IB 5JDUB 2OUAA 4ISNA 1FZZA 1S84A 4GUXA 3V3MA 2V3HH 3PO1C 2SGDE 7GCHG 3KHVA 1OOKB 3NUMA 3PMJA 3RU4E 1KLTA 3B23B 5B6OA 1MBMA 3SBKA 1P9UA 2ZHDA 1TPSA 1V2QT 1G30B 3GYMA 3RLWH 1SHYA 2C3SA 3EA9A 1XXDA 1D3QB 3TK5A 3QUMP 4OS2A 1XXFA 3NXPA 2UUJB 2WYGA 4FUBA 3EYDA 4KTSA 1UVOA 4BAKB 1J16A 2B8OH 8GCHF 3UPEA 1GBKA 3SUFA 3PTBA 4ABBA 2BY5X 2J5UA 3MYWA 4ISHH 2GV6A 1KSNA 6ESTA 1LHDH 5JPMH 1HAXB 4CH2B 5C0TA 3OE7D 5HXFA 2C8WB 3MWIU 4U32A 3AK5A 4K1SA 1L2EA 2OQUA 2ZFRH 2C4FH 1HJ8A 1VCWA 2BQ7B 4CRDA 1E37B 2ZTZA 1NU7B 5EW2H 3A7WA 1XUHA 1VCPA 1EJMA 3QO6A 1NC6A 1SGFG 2BDAA 1O2NA 3MU5A 4B75A 5E2PA 1K22H 2IPQX 1MD7A 3LC3A 4CRBA 5I46H 2XXLA 2QF4A 3ATKA 1Y3WA 3VXEH 1HIAB 2AMPA 2J94A 2KCPA 5EJ1A 1O5FH 2Y5GA 3GOVB 1P8VC 1W14U 2KFWA 1KIGH 1YCPM 4RI0A 5KECA 3ZZ8A 2Z3CA 3AVZA 3GCHB 1G3CA 3TGIE 2BD9A 3LU9B 1ZHRA 2PKAB 5E0GA 1WQSA 2BOKA 3AW1A 2KAIA 1KDQA 4AB8A 1S0QA 1MKXK 4RKOB 5HM2A 1RTLA 1PQ5A 1O30A 3SNBA 3OFND 1MCVA 1UTJA 1HFDA 5AFZH 8GCHG 5A8XA 1C2DA 1CA0B 2PSXA 4CREA 4Y6DA 2FESH 1QGFA 1EP5A 1UK2A 1HPGA 1DSTA 2C93B 5HMAA 3SQHE 2R9PA 1EP6A 4ACAA 1FY1A 1YP9A 1LPKB 3F9FA 4HFPB 1QBVH 2HRVA 2UWOA 2BDBA 1AQ7A 2H1UA 4TWYA 4YLUA 3B8JA 3NK8A 2D26C 2QF3A 1JWTA 1C1UH 5GIBA 4K8BA 2J98B 4MPUA 1HXEH 1L4DA 1UO6A 2STBE 3MTYA 4K1TA 1TRNA 1GVZA 1FLEE 2WV4A 1QB1A 1D4PB 3S7KB 5E2OA 2J38A 1T8LA 5DPAA 1DE7H 3QTOH 1HRTH 1SQAA 1H4WA 1KMHB 1BRAA 4FETA 1CGHA 1SR5C 4VGCB 4K8YA 2FLBH 1PPCE 4FUGA 2G00A 3GY7A 3LH1A 1GHYH 2XWBI 3QTVH 3SOSA 3GYLB 1PJPA 2FXRA 1CT0E 1MAYA 1AVGH 3BTME 1W10U 1YPHE 1AN1E 2A45B 5E0HA 1O2UA 1NY22 2QF0A 1G3DA 7ESTE 1AGJA 1PPZA 1C2FA 1WDIA 2ZI2H 2ZFTA 4IGDA 4Y0ZE 1Z6JH 5DP3A 1Z8RA 2KCAA 4M9FA 1ARCA 1LTOA 1O33A 1S81A 2W6ID 4NFFA 3M3VA 2H9EH 2FPZA 3SI3H 3WWBA 1VJ9U 4FVBA 4B73A 3ZV8A 5EQSA 4OS7A 1G9IE 3K6ZA 4XSKU 2F43B 4FU8A 5TCCA 3S69A 1WCZA 1FX0B 1GI3A 1Z8GA 1O36A 5T1VA 2CHAC 3Q3XA 3DSGA 2F9UA 4FUJA 1UHBA 1HDTH 2CMYA 2VGCB 3L3TA 1JXPA 3F0PA 1H8IH 3LJJA 4DOQA 4D8NA 1Y3UA 1JIMA 2TGPZ 3FANA 4U01A 3TH4H 1P57B 2CHAB 2VIPA 4ASHA 2BDIA 2VWNA 1SKYE 3PYHA 2O8UA 2Q6GA 1VITF 3O8CA 1DFPA 4ZH8A 1TOMH 4NFEA 3KCGH 2EI7A 4OGYA 1CA8B 1FNIA 3SV6A 4IS5A 1GI0A 4BTTB 4JZ1A 1SL3A 2ZDAH 1W11U 1T32A 3BG8A 1W3CA 2WZQA 1SQTA 3GY5A 2P16A 1OYQA 2FTLE 4TYDA 3LGTA 1TNLA 2ZTXA 4WMDA 4UE7H 1YPLH 5HIYA 1GBJA 2A2XH 1DWDH 5PTPA 1NS3A 3URDA 2L74A 1NFUA 4I33A 1ZHPA 4XBBA 1UCYH 1K21H 3RXIA 3ESTA 2CN0H 1Z1IA 2A2QH 1T8OA 3PV2A 1TX6A 2RDEA 4F55A 3V7TA 2CJIA 1LDTT 3N7DA 3SU2A 3LC5A 1NBME 3FZDA 3QK1A 3LJOA 1B7XB 5B6LA 3TJNA 2GTBA 1E34B 2VB0A 4R8TB 5CMXH 3BTWE 1DWCH 2P95A 5A09A 4DY7B 2BHGA 1AI8H 3F2FA 4NA7A 1QTFA 1UVUH 3A83A 2EEKA 2OC7A 1EPTB 4FOUC 1GI1A 4I8KA 1W0ZU 2Z94A 1K1IA 3GICB 1LPZB 1EOLA 2L6OA 1C2GA 1K1JA 2F9PA 1NESE 2BDYA 4MVNA 3TU7H 1LKBA 5FPYA 3BTHE 1MQ5A 3SV7A 5FAHA 3MHWU 1AZ8A 3RXPA 3A85A 3GDVA 1G2LA 2TGDA 2AHME 3ZYEA 1V2WT 1UTQA 1ABJH 2KR7A 4A1XA 2GJGA 4RN6A 4HTCH 1GJ6A 2AH4X 1QQUA 1ESBA 1ZTLA 1MBQA 3OTPA 3TLOA 2AMQA 1YF4A 1JIRA 1UTLM 1GCTC 3SYJA 5L6NH 1MH0A 4FXGH 2FI5E 1HIAA 1AB9C 5GWZA 1YPHC 1O2SA 1G36A 5A8ZA 4ZKRU 4OS4A 2FDAA 3ATIA 4X8SH 3UNRA 1UK3A 4AFZA 1AB9B 1SVPA 3FVFB 4AYVB 2W7UA 3JZ2B 2PKAA 3FP8E 3VB5A 3ZV9A 1GI9B 3BIVH 2VWOA 3MNCA 3MU4A 2VIVA 4I32A 3PLKA 1KXCA 1EAXA 1K28D 1THSH 1TMUH 5ESTE 3URCA 1PPGE 1SLVB 1TONA 4ZMAH 2YOLA 2J4IA 2VINA 3MO9A 4JMYA 2VVCA 1NTPA 2JH6D 1NFXA 4H6TA 4NCYA 5CHAC 5DJ7A 5IYTA 3FP6E 1BJVA 1XVOA 3LGYA 1TGSZ 4HI3A 2GDDA 1ZJDA 4AORA 1JOUB 3VPKA 4LZ1H 1A7SA 5GCHF 1CBWC 2BD8A 2ZEBA 1BDAA 1FI8A 3FZZA 1SGYE 2Y6TA 5EQQA 3QGJA 1RTFB 2A4QA 4U30A 4Z6AH 3O8DA 1BMAA 1CBWB 1TYNA 1C1VH 2J98A 1C2IA 1S5SA 1BZXE 1SG8B 4O3TA 2ANWA 3L6PA 1MTVA 1TQ0B 4P00A 3TIUA 1MZDA 1NRPH 3F1SB 1KTSB 1NBMD 2QC2A 1PPHE 5JBBS 3SZNA 2ZDKA 2ANKH 4AB9A 3OTJE 1W0KD 4HGCA 4JK6A 3VB4A 1OP8A 4J1YA 3SUEA 3OYPA 4Q80A 1ELAA 4MNWA 2A31A 2QV1A 3KQDA 2YNBA 4ZXXH 3ZZ9A 4CBNA 4I8GA 1N8OC 1ELGA 3IWMA 4UDWH 4IMZA 2BY9X 2SNVA 1VJAU 4LOYH 3M61U 4D7FA 4WXVA 1GBMA 3LIWA 2BLQA 1LVOA 1PYTD 2FODA 3DFJA 1DDJA 5EPYA 5JYIA 1W12U 4IN2A 2IPHA 1K2I1 5CHBA 4RT1A 2JIZD 1GI8B 3AAVA 1C9PA 1O3HA 1QB6A 1WQVH 3ODFA 4KKDA 3A87A 5C1UA 1RFNA 1Z6EA 1PYTC 2ANYA 2ODQA 2ZU5A 1HAZB 1ZSLA 1GDNA 4R0IA 2ZO3H 4CRFA 2GZ8A 2PR3A 2OD3B 4FVDA 1AVWA 1O3LA 1BMLA 2J9NA 3EAJA 2YMSD 4IC6A 5DG6A 5GCHG 4ZCNA 3RXQA 2STAE 2ZQ2A 2FTMA 1N6YA 2ZHEH 1T8NA 4NIXA 3ATWA 3M35A 3N99A 2FEQH 3M7TA 2A7CA 3V12A 2M2AA 3E90B 2WPMS 2ZIQH 1A1RA 1C5ZB 4MNYA 5ESBA 5H4IB 2AS9A 2XNIA 1RTKA 1V2ST 1W0YH 2G51A 2YMSC 1E1RD 4O9VA 4FU7A 1O2GH 1GWAA 1OSSA 8LPRA 2OC8A 4ISOA 2YMSB 1BQYA 3A80A 5JBCS 1UCYE 3SV8A 5E0JA 4WWYA 1KXDA 5C5OA 1S82A 3SQEE 2ZNKH 2RA3A 3ZZ6A 1O2TA 2G55A 2WPIS 1BJUA 2FI4E 3OEED 4NZQA 4Q7ZA 1P0SH 1CQQA 3MNBA 1RJXB 1ZHMA 3A8BA 3A7XA 1W8BH 2VH6A 3BTKE 6CHAC 3Q3YA 2ZDMA 1GBCA 1AZZA 1EASA 5DK1A 4Y8XA 3GY6A 3F9EA 5L30H 6CHAB 3SJOA 1JBUH 2OC1A 2ZDLA 1EAWA 4NSVA 1DXPA 2BZ6H 2A7HA 3E6PH 1TX8A 2P8OB 5EU8A 2RA0A 5T6GA 4DCDA 7GCHF 4UFFH 4BTUB 3AAUA 2FOEA 1DPOA 2Y81A 2XBYA 1EPTA 1DX5M 3HATH 1HAPH 4DT7B 1P3EA 3UNQA 1UJ1A 4CHAC 1O3DA 3ZZBA 1BTUA 5HM9A 9ESTA 1C1WH 1YYY1 2WHXA 1TMBH 2WYJA 3BEUA 4ZKSU 5CE1A 3U69H 2FS8A 1SB1H 5L2YH 3IITA 1TPPA 2OTVA 2FOBA 1IAUA 3CS0A 1GCDA 2HGTH 2Y5HA 2XYAA 4B1TA 3RMOH 1TIOA 5C94A 3QLPH 4ABGA 3F0OA 1C1PA 2AIPA 3S7HB 3RUOA 4IW4E 2Z9IA 2K0QA 6GCHF 4Y8ZA 1SFIA 1Y5BT 2H2ZA 1ZJKA 3BEIB 3AW0A 1O2OA 4AGJA 4X1PU 3SU5A 4YOIA 4ZUHA 2P93A 1O3AA 3SU3A 1C5PA 2ANMH 2K8IA 2HVYB 1QL8A 2WUCA 1OWJA 1EQ9A 1XM1A 3VB6A 3LGIA 1FY8E 2QXGA 4FUEA 1T4VH 3GY3A 4AX9H 1BBRH 1SGQE 4E06H 3TNTA 2GMTB 1O2PA 2NU3E 3M5NA 3DHKH 3DA9B 1FJSA 2ZA5A 3GY4A 1HAHH 3V0XA 5C0UA 1Y5UT 3UAIC 2H9TH 1TBQH 3PO1B 4TPYA 1W0JD 4A5TS 1D3PB 5DP4A 3KQBA 1O31A 1C5TA 5F8ZA 1SPJA 3FKSD 2A4OA 4ZHLU 1ORFA 2ZDVH 2ZU2A 1EKBB 1QIXB 3PMHB 3V13A 1HJ9A 2EC9H 3PTNA 3KIDU 3NPSA 1S85A 3S9BA 3O8RA 2ZGJA 3HK3B 3EA7A 4WH8A 3A84A 3P95A 3RXTA 2QXHA 2V35A 2PWXA 1A46H 3RXRA 1MD8A 3P92A 1IQHA 3CNRA 1DWBH 4XE4A 5EOKA 1TABE 3MH7A 3ZZCA 2PP6A 3PV5A 1N6XA 1FQ3A 2I6SA 2PKSC 3MMGA 1EJAA 1ESTA 1SOTA 2BDGA 6GCHG 2BY6X 5E8EH 2CK3D 3QGNB 4BAOB 1C1TA 2DE9A 1QFKH 2Z3EA 3F6UH 2H6MA 2BQ6B 3PM3A 1BMNH 4Q7XA 1W13U 3KQCA 2CV3A 1J14A 3BV9B 3VB3A 5GXPA 3A7ZA 1TQ7B 3ZZ4A 3RC5A 4P02A 1EATA 5C67A 1GI5A 3TK9A 1Z8IB 1XKBC 1PQ8A 1GBTA 3LT3A 2W3KA 4E7NA 2Q1JA 1C5LH 4CRGA 3H09A 1HUTH 4D9QA 4MPXA 1BB0B 1MTUA 1LO6A 2Y7XA 3MOCA 3NWUA 2IN2A 5EG4A 5F8TA 1SFQB 1GL0E 1O5EH 4CRCA 4TPIZ 3SNDA 2XRCA 2J2UA 2SFAA 2ZHWH 5DSFA 2BXUH 3EGKH 2JJ2D 1BMMH 1GHWH 5FHTA 1P2KA 1AO5A 5K0HA 1BTHH 3SV2H 5F03A 2O8WA 2ZHFH 4ABEA 5AF9H 4BOHA 3QDZB 1DUAA 1GJBB 4QT8C 1P06A 3M7QA 1QJ6B 5EODA 4GHTA 3RXFA 2IOTA 3SGAE 2D8WA 4AG1A 3VGCC 1XUGA 2A4GA 4JZFH 1P03A 2OXSA 1C5WB 1O2MA 1QZ8A 3VGCB 2C8XB 1OKXA 1E35B 1WSSH 2ZU3A 1TB6H 3Q77A 1O5DH 2ZPRA 1P2NA 2FM2A 2ZQ1A 2R0KA 3OY5U 4B76A 3BSQA 3UREA 1OYTH 3P8GA 2FYRA 2GKVE 5I25A 3RU4D 2FOCA 2BQWB 3E0NB 2ZP0H 2SGAA 4LZ4B 2PSYA 4F4OC 1DSUA 2QXJA 2ZGXH 1BBRK 1C1RA 1DANH 1UTMA 4YXWD 5HYOA 1Z1JA 2BX3A 4GLYA 1GJCB 2CXVA 4H6SB 5EJZA 5LPFA 1BUIA 4INLA 2GX4A 4B2AA 1L1GA 2GP9B 1SHHB 1V2RT 1O2QA 1DS2E 2BD3A 1FAKH 2XOKD 3SHCH 4J2YB 1O3KA 3RXHA 1IQKA 3UY9A
chains in the Genus database with same CATH topology
3TJVA 3OSYA 1TFXA 1S83A 5G4BA 3SJ9A 2WUBA 2G52A 1VCQA 1ANDA 2RDLA 2QY0B 4X6PA 3TVJB 2R0LA 3ZYDA 1CE5A 4D76A 2R3YA 1CO7E 2TRMA 2VIDA 2SNWA 2F9NA 3MNXA 1FN8A 2ODPA 1D6WA 1GJ7B 2FIRH 2W7SA 2ZECA 4KELA 1V3XA 1D3TB 1SLXB 2VWLA 4BAMB 1ZMLA 5FPSA 2DUCA 1YPMH 1C5NH 2BMGB 1GMDG 1Q31A 2P3UB 1J17T 3M37A 5EQRA 2AIQA 2HPQH 2WPKS 3ZZDA 3TPIZ 4ABJA 1FY4A 4YM9A 2O8MA 4ZHAA 2QN5T 1TALA 3SNEA 4ZXYH 2C90B 4JCNA 4Y8YA 4A1VA 4AZ2B 2QAAA 1WTHD 1GDQA 5DKMA 1ETTH 4FUFA 4BAHB 3PROA 4RKJB 5SGAE 3FAOA 1S0RA 1TRMA 1GBHA 1GI4A 1OWIA 1BBRE 4MDSA 2A7JA 1O3CA 3A81A 1QURH 1QBOA 2ZDNA 1ACBE 4ZHMU 1QY6A 1ZPZA 1ETRH 4B71A 2P94A 1Z7KA 2ZHQH 3SU1A 1O38A 4NWLA 3A86A 1AFQC 1VR1H 3FP7E 1O3JA 1SLUB 4BTIB 2WV5A 2Z9LA 2C8ZB 1O2YA 1A2CH 3TGKE 5FBEA 3KN2A 4XBDA 3NCLA 1BTYA 1JRTA 1OPHB 5A0BA 1O2HA 1O2ZA 3UQVA 4JK5A 2Y82A 3F9HA 3SJ8A 1GJ4H 3LGVA 1ELBA 1KYNA 3SU0A 3H7TA 4NIVA 1UVPA 1F0SA 2BVSH 2ZPQA 3F68H 3CP7A 4XBCA 1GGDC 1WUNH 8ESTE 3OX7U 3OY6U 4ESTE 2FMJA 2HLCA 2NU0E 1P2QA 3BTFE 1GGDB 2QXIA 4B2CA 1WBGB 4K1EA 3M7UA 4D9RA 4HZHA 2A5KA 2OP9A 3ZVEA 1H1BA 1HYLA 5FXLA 1HB0B 2ZCKP 1QJ1B 3I78A 2BY7X 3EDXB 1GCTB 3OU0A 5GDSH 4BAQB 1B5GH 1LQEA 1NFYA 2VWMA 2VVVA 4B74A 2BVRH 2FYQA 1EJNA 4IC5A 1GBAA 1LHCH 1UTNA 3UIRA 1AKSB 2VJ1A 3ZZAA 2PTCE 1SI5H 1DY8A 4KTUA 2Z9JA 4FUDA 4Y7AA 4DURA 4UEHH 2ZC9H 1ID5H 1RIWC 1V2OT 3CS7A 4CR5A 3RXSA 1SGPE 1AE5A 1F0RA 3G01A 3TNSA 1ANEA 1HGTH 4PROA 3RXLA 1GDUA 1C1QA 1OX1A 4WJG2 5JB9S 1GMCF 1H9IE 3ATMA 1C5VA 5HGGA 1GVLA 1NZQH 1FN6A 3BEFB 1VGCC 2A5AA 4BXSA 1QR3E 1K1LA 4SGBE 1PQAA 1QNJA 5CHAB 4YESB 3RXCA 5F8XA 1HNEE 1WYKA 1C2MA 4X2WA 3F9GA 5A0AE 3HGNA 4XOJA 3T25A 1ZOMA 1ELTA 2G8TA 3A8CA 2FOGA 2JKHA 1DM4B 1LCYA 1DICA 1GG6C 3DT0H 1OP0A 1E38B 2VIOA 1QRXA 3E16B 1L4ZA 1AIXH 3HK6B 1IQGA 4NA8A 2F3CE 4JZDH 2YNAA 2B9LA 2OCVB 1BTZA 1ZYOA 5C1XA 4GPGA 4GVUA 5JB8S 3STJA 2AEIH 2ODYB 1G37A 1ZTJA 3BN9A 3A82A 1ZGIA 1UCYK 3GY2A 4Q7YA 1MMJN 2HWLB 1B0FA 2WPHS 4X2YA 2PLXA 1BRCE 4UFDH 4DIIH 3SJIA 1VZQH 2G81E 2FZZA 3U9AH 1AY6H 1G2MA 1HAIH 3U8OH 1ZLRA 3DD2H 3O8BA 1OWHA 4ZKOU 3GDUA 3GDSA 1C5RA 1N8OB 2AERH 1C4U2 5DP8A 1ZRBA 2FLRH 3ZVFA 2H5CA 4X6NA 3N7OA 1O35A 1UTOA 1EOJA 1C2JA 2ZCLP 1ELDE 1SQOA 2ZU4A 2G4TA 2NWNA 2RG3A 1A0JA 1QBNA 2P3FH 4M7GA 4AN7A 1A5HA 2XBVA 1H9LB 1GMCG 1Y3VA 1GJAB 2EI6A 4MPWA 3RXAA 3SGQE 1ZTKA 1MQ6A 1KXEA 2W26A 4Y0YE 3SO3A 2O8TA 3GY8A 1V2JT 2AMDA 3T29A 1O5CB 2VU8E 2ZGCA 5ETXA 1A5IA 1EZXC 3QZQA 3Q3KA 2CF8H 4H4FA 3RP2A 4BANB 2Z9KA 1V2VT 2FO9A 4MNVA 1P01A 3BTTE 1C4V2 1SLWB 2KAIB 1ELCA 1NT1A 2F9VA 1LVMA 3U1JB 5DO4H 1SGRE 3LPRA 1F0TA 4F49A 1XMNB 2ZCHP 4X0WU 4NG9H 5L2ZH 2CF9H 2ILNA 1YCPH 1IQNA 4Y11E 5T3HA 1EUFA 1KXFA 1KY9A 2FWWA 1QL9A 2BLOA 4X8TH 1YBWA 1EX3A 4IBLH 1CGJE 1TRYA 1CVWH 1RRKA 4X8UH 3M3SA 2XC4A 1Z71A 1F5LA 1FY3A 3PLBA 2GGVB 1C5OH 1WOFA 3QN7A 1A0LA 1H8DH 4I8JA 5AVDA 1AWHB 4FUIA 1F5RA 2HALA 1PPBH 2A5IA 3TH3H 3SV9A 1C9TA 2PW8H 1ANCA 2PFEA 3BTGE 2UUKB 4YOJA 1Y8TA 3E8LA 1SBWA 3LGUA 4X6MA 1GHBG 2PV9B 3M5MA 4CH8B 1KLIH 1O3GA 1DT2A 1BA8B 3R3GB 2BD2A 1MAXA 2Y80A 2ZPSA 4CHAB 4JYVH 1HAOH 2PTNA 2XW9A 4K69A 1DLKB 3HKIB 1PPEE 1Y59T 1TNGA 2D2DA 3ATLA 3MNSA 4ISLA 1C2KA 3UUZA 2FX6A 3BG4C 1DY9A 2OBQA 3UWIA 1TNJA 3ZZ7A 1MTSA 2PHBA 2SGEE 3D49H 3BG4B 1UTPA 3SNCA 1IHTH 2GZ7A 4LXBH 4YTAA 4MTBA 4FUCA 1P9SA 2BTCE 1C5UA 1M9UA 2OC0A 3UNSA 3ZVAA 3S0NA 3RXJA 3MI4A 1RXPA 1TAWA 1UHBB 1ZZZA 2OBOA 1DWEH 3T62A 2IJOB 5FX6A 1GMHG 3I29A 3GCTG 4WF8A 1F2SE 2R3UA 2BD5A 2GD4B 4X1RU 3ZVGA 1C1MA 4E7RG 3A7TA 3RMLH 1KXBA 5LGOA 3E91A 4ISIH 1FV9A 3PWCA 2OLGA 2ZFQH 3KL6A 1C2LA 3KF2A 4FU9A 1DOJA 1EXFA 4NZLA 2XCNA 1Q2WA 5EXNA 4K60A 5LPEA 1INCA 1EZUC 1QB9A 4DIHH 2V6NA 3E3TA 1TGNA 3LGWA 5TCAA 1BCUH 2BVXH 2VIWA 1GL1A 4NIYA 1XVMA 1ZMNA 1B0EA 1C5MD 2VVUA 9LPRA 2XC0A 2UUFB 1V6DA 4WMFA 1AMHA 2ZTYA 1O37A 3SN8A 1KXAA 1XKAC 2BY8X 1SGNE 3JZ1B 3U8TH 2PUQH 3UFAA 1MTWA 1L1JA 2B7DH 4IMQA 2ALVA 3HKJB 1MTNC 5EXLA 1QA7A 3DFLA 2FOAA 3LONA 4OS1A 1NRSH 3WY8A 4CRAA 2V0BA 4THNH 1MTNB 1C2EA 3K2UA 5FBIA 1YCPK 3UOUA 1O3BA 1IQMA 4ABDA 4X8VH 1GVKB 3UTUH 1DVAH 2BB4A 1CT4E 1ETSH 2VNTA 1O3EA 1P2MA 2J92A 2UWPA 1GJDB 3D23A 2HVXA 2PKSB 4NSYA 2FX4A 4INHA 1EZQA 4ABFA 1GHZA 1OWKA 2TBSA 4JYUH 3RXMA 1TBZH 1TBRH 3FFGA 2XBXA 1YPKH 3RDZA 4AOQA 1ELFA 3VB7A 1SC8U 2JH0D 4AG2A 1K9OE 2ZWLH 1HAVB 1LMWB 3UQOA 2F9BH 2BDCA 1AU8A 1T8MA 2FOMB 3UWJH 4YZUA 1KLJH 5T6FA 1YGCH 1ESAA 1YPGH 3PLPA 2ZFFH 3TGJE 1HXFH 4X1QU 1D6RA 6LPRA 1HV7A 1O34A 3TITA 4GAWA 3KEEA 2A32A 5AHGH 3MO6A 1JMOH 2W5EA 3STIA 3BTQE 3GCHC 1MU6B 2HOBA 1MCTA 1GHXH 4OS5A 3SORA 2BZAA 4AFUA 1UVSH 1A3EH 3PMAB 5C20A 3S9CA 3UOPA 3U98H 1CT2E 5BPEA 3RXKA 4ZROA 2ULLA 4H42U 1OP2A 2ZG0H 1AWFH 5AFYH 1J9CH 3C1KA 5GPIB 3SNAA 3SI4H 1CA0C 4UFEH 3SGBE 4I31A 1A0HB 2GV7A 3ZZ5A 2C8YB 2LPRA 1O39A 2BYAX 1O3FA 2FI3E 1T4UH 5FPTA 2THFB 2A1DB 1THRH 2TGTA 4X2XA 3VEQB 5LH8A 2A0QB 4SGAE 3ODDA 5C1YA 1U6QA 7KMEH 4YO9A 1IQJA 2ZF0H 5DP6A 4X6OA 1FXYA 1GMDF 1ANBA 1ZR0A 2G5NA 5TJXA 3TJOA 1LVBA 4AGKA 3E0PB 1C5XB 5A0CA 4K2YA 4Y71A 3RMNH 1OS8A 2R2MB 1OXGA 3E1XB 2JH5D 1JRSA 1BRBE 1O3NA 3C27B 1P12E 1BRUP 4WVPE 1FAXA 2ZU1A 3RXOA 2GVFA 2ZZUH 3T2NA 1TMTH 2OINA 3A88A 4VGCC 2DE8A 2GT8A 1V2MT 1FIZA 1ELVA 5C5NA 1SGTA 4UFGH 1QA0A 3M36A 1D3DB 1A5GH 1BOQA 3T26A 1O2JA 1XUKA 3MU8A 2BLWA 5FX5A 4K3JA 2F9OA 1SMFE 2R2WU 4GCHF 1L0ZA 1MZAA 3LKWA 4U2WA 2ZGBH 3MFJA 4YLQH 1A61H 3ITIA 1GPZA 2PGBB 1TA2A 4MPVA 1CGIE 1G32B 2LNCA 1PPFE 3P6ZB 1KTTB 4BXWA 4JZIA 3RXBA 2BXTH 1O2KA 1TNIA 3K65B 3MU0A 3RC6A 1O3IA 1WTGH 3RM0H 1NO9H 1DUEA 1BTPA 4ABIA 1QRZA 3D62A 2JETC 1O3PB 1W7XH 2B5TB 1NRRH 2VGCC 1T7CA 1TNKA 2JETB 1E36B 1HJAC 1YPJH 1C5SA 1LKAA 4RSPA 5A2MH 1QRWA 3K9XB 3W95A 3U1IB 2BDHA 2TIOA 1O5AB 2BOHB 4MG3A 1HJAB 3A8DA 1TGBA 3RU4T 2HNTE 8KME2 4ZAEA 4YT7H 2ESTE 4TY7A 1FUJA 1MU8B 4FUHA 4I7YH 2ZFSA 1NROH 1V2TT 4MLFB 2OQ5A 1T31A 2QA9E 2ZFPH 4TWWA 2J95A 2G4UA 2Z3DA 1H9HE 2GCTC 4I8HA 1S6FA 3SJKA 3SHAH 3KGPA 1GJ8B 1LPGB 5FCKA 4NWKA 1QJ7B 1BHXF 2GCTB 1TGCA 3PWBA 1C1OA 1FONA 3LH3A 2AFQB 4GCHG 4Y7BA 3W94A 4XFQA 3QZRA 1UVTH 4XDEA 1YLCA 2SGPE 1TNHA 4MQAA 1GBBA 1AFQB 1BTWA 1RS0A 3R0FA 2AGGX 4I8LA 3MH5A 1G3BA 4KTCA 3D65E 1XUJA 1J15A 1FMGA 2AYWA 2GT7A 1BTXA 4YOGA 3B9FH 4CR9A 1C5YB 1EPTC 1AHTH 1FIWA 3L33A 1CHGA 2HNTF 2M5TA 5F6MA 1SSXA 5T6DA 1P2JA 2D1JA 1P05A 2TPIZ 2V3OH 3TH2H 2UWLA 3M5OA 2Q6DA 4X2VA 2GCHF 4ZKNU 1FY5A 1NN6A 3SU6A 2H5DA 1SGEE 1NRNH 3MO3A 2PGQB 2BX4A 1ZPBA 3RMMH 3P8OA 2CGAA 3UR9A 2Z9GA 1TWXB 1J8AA 2W3IA 3MH6A 1LHFH 4WY3A 2XTTB 1VITG 4A1TA 3CENA 2Z7FE 2NU1E 3P17H 3Q00A 2UUYA 1V2KT 1HAVA 1UTKA 1QQ4A 4D7GA 4MNXA 1RD3B 4JYTA 1O3OA 2SGFE 4AFSA 1Z8JB 2PUXB 1YLDA 4WH6A 3KNXA 1P2IA 3HGPA 1O2IA 1GI7B 1TPAE 1ZSJA 2HPPH 4Y10E 5GJ4B 1HLTH 1SGFA 4KP0A 1CHOF 1FPHH 1GHAF 1D9IA 1DITH 1PFXC 5EPNA 1TGTA 1O32A 1UMAH 2EA3A 4JZEH 1RIWB 4YT6H 5DP7A 2NU4E 5DP5A 3A89A 2WINI 3NZIA 3SUDA 1TX7A 3MU1A 4GSOA 3PV4A 2Y5FA 1Y3XA 3K6YA 3IG6B 3Q76A 1BHXB 3VXFH 1LHGH 3KQEA 1A3BH 2TGAA 4OS6A 1EB1H 1QCPA 1VGCB 5JBAS 1WAYB 1Q3XA 1MKWH 2GCHG 2G5VA 2XC5A 1BITA 1P09A 1XX9A 2BLVA 2ZKSA 3P8NA 4ABAA 1S6HA 1FDPA 4Y76A 3T27A 1GI2A 2FOFA 1DLEA 1IQIA 1W2KH 1A4WH 1OWEA 4NA9H 5C3NA 1V2UT 4CBOA 1GG6B 4AYYB 1P2OA 4LK4A 1O5GH 1ARBA 2HNTC 3BIUH 1GBEA 3NKKA 3RXVA 1IHSH 1YC0A 1P04A 1Y3YA 1ZRKA 2K1QA 1O2VA 1TPOA 1E0FD 4E05H 1G3EA 1IQFA 2B0FA 2P3TB 1YPEH 1AFEH 1UK4A 3I77A 1K1NA 1TLDA 4AFQA 2GZ9A 5ABWA 2WPJS 4DW2U 3EE0B 1GHVH 1K1PA 1ZPCA 5A8YA 1CU1A 1TA6A 1AE8H 1CHOG 1GHAG 3VFEA 1SGIB 4Y79A 3ZVBA 2RCEA 3EA8A 3ZVCA 2QYIA 4A6LA 3ZZ3A 1F0UA 1P11E 1THPB 1WU1A 2BD7A 1V2NT 2XWAA 2P59A 3MH4A 2VIQA 3A7VA 1P3CA 1GHBF 4DGJA 1LHEH 2BM2A 3AASA 2QIQA 3A8AA 5EXMA 1GBLA 1P10A 3M3TA 1O2LA 3HPTB 3RC4A 1O2RA 3M5LA 2F91A 1KDQB 1YM0A 5C2ZA 1ELEE 4X1SU 1AUJA 1GBDA 4A92A 2GDEH 1EAIA 2F83A 7LPRA 2Z6BD 3S9AA 2H9HA 3DUXH 3LDXH 1O5BB 4BNRA 2FP7B 5IDKA 1C1NA 3LOXA 1NU9A 2AGIX 3RXDA 2Y7ZA 3TJUA 3RM2H 1HAYB 1QHRB 1ABIH 3PMBB 3T5FH 2WPLS 3U8RH 1NFWA 1TOCB 4DJZB 1Y5AT