4AGKA

Crystal structure of capsid protein (110-267) from aura virus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
152
structure length
152
Chain Sequence
b'DRTFAVKNEDGKIMGYAVAMEGKVIKPLHVKGTIDHPALAKLKFTKSSSYDMEFAKLPTEMKSDAFGYTTEHPEGFYNWHHGAVQFSGGRFTIPTGAGGPGDSGRPILDNSGKVVAIVLGGANEGARTALSVVTWNKKGAAIKTTHEDTVEW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAPSID PROTEIN
publication title Crystal Structure of Aura Virus Capsid Protease and its Complex with Dioxane: New Insights Into Capsid-Glycoprotein Molecular Contacts
pubmed doi rcsb
source organism Aura virus
molecule tags Hydrolase
total genus 35
structure length 152
sequence length 152
ec nomenclature ec 3.4.21.90: Togavirin.
pdb deposition date 2012-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4agkA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4agkA01
5T3HA 2GZ7A 1ZTKA 1C2EA 2BDIA 4ZKRU 1O35A 4SGBE 4BANB 8ESTE 3T62A 2G55A 3OYPA 3UR6A 1F0TA 1QBOA 2AEIH 1MKXK 2AGGX 3VB5A 1LPGB 1WQVH 1QURH 2VIVA 1SVPA 4FVBA 1GI6A 3I78A 3GDVA 1RIWB 4IN1A 3UIRA 5DJ7A 1TGBA 3QTVH 3ZZ3A 2ZCKP 3MFJA 4ABDA 1ZR0A 2R3YA 3DFLA 3A8DA 4ABBA 1P03A 5C2ZA 1X7AC 1BBRE 4O9VA 4D76A 1O2QA 4AORA 4GLYA 2H5CA 2J38A 4K1TA 1XXDA 1ID5H 3RMMH 4LZ1H 1BMMH 4I8GA 2CHAC 3SJOA 1K22H 3M5MA 1C9TA 4NIYA 3QDZB 2BB4A 2ZQ2A 4FUFA 1FY1A 1QQUA 3STJA 2RA3A 1O2OA 3NKKA 1O5FH 1LQDB 1ELEE 2STBE 3NZIA 3NCLA 1S5SA 3VGCC 1FONA 1MBQA 3RXKA 2Y5GA 1DWCH 5GIBA 3SU2A 4NFEA 8GCHF 2ZIQH 3TU7H 4KTCA 1KTTB 3ZZAA 1UTKA 4KKDA 1TMUH 2XC4A 3V0XA 1FI8A 5A0AE 1EAXA 1O3CA 1HAVA 3A86A 2ZFRH 1FY8E 2BDAA 2A0QB 1DT2A 1CU1A 3W94A 1O5DH 2VGCC 1A46H 1BRAA 1A3EH 1EB2A 1AFQB 3EAJA 4A5TS 1Q31A 3ZVCA 1V2UT 1Y3YA 2PR3A 1F0RA 1MCTA 2HWLB 2XYAA 2BX4A 1DWDH 1GJ7B 5JB8S 1O5GH 2AFQB 4IS5A 2FEQH 2JH5D 1SLVB 1H8IH 2Z6BD 1MQ5A 3SJ8A 1ABJH 2VJ1A 2HRVA 4CRDA 1NRNH 2J9NA 2A7HA 1DOJA 1BRCE 4Q80A 2RA0A 3KN2A 3EA9A 1W3CA 4JZEH 2C8YB 4XBCA 1AD8H 3GCHB 2VIQA 1NU9A 1C5XB 2NU4E 3URCA 2ZCHP 2ZGCA 1EASA 1GHXH 1TWXB 4X2XA 1ZJDA 3M3TA 4I32A 5HMAA 1LHCH 2UWLA 1EP5A 3LONA 2Q6FA 1PPBH 1C1MA 2PW8H 2PHBA 3QO6A 4ISOA 1GCTB 3W95A 3A7VA 4NIWA 2BD9A 2A32A 2A4RA 1Z8JB 1A1RA 3E90B 4DJZB 4UFFH 1MTWA 2XC5A 1GBBA 1UHBA 1IQEA 2H9TH 2A5AA 5A0CA 1SG8B 3V13A 2A1DB 2PKSC 4X6PA 1MD8A 3AW1A 3BTFE 1YKTA 2Z7FE 4BAHB 3ATMA 3BSQA 1O2TA 2GCHF 4WJG2 1SHYA 1Q2WA 3ATKA 1G30B 3MU1A 1MAXA 1QRWA 4HGCA 3ZZBA 2Y5FA 1GL1A 1MZDA 1SGCA 3MU5A 1GI0A 2HLCA 2TGTA 5EOKA 2A45B 2DE8A 5DP3A 4GUXA 2G8TA 4FU9A 4FVDA 5ETXA 2BTCE 3T5FH 3O8BA 3UR9A 3U1IB 3HKIB 1C1PA 1GBFA 1ZHRA 1PJPA 1C2KA 1HDTH 2P59A 3E0NB 1TOCB 4KP0A 4ZXXH 4DIHH 1C1RA 5G4BA 1SQAA 4X8UH 5DKMA 1LVBA 2FOHA 4UE7H 1XM1A 1THSH 1O2YA 1IQKA 4MLFB 1NO9H 2BVSH 5C1UA 5LPRA 2Y7XA 4B2BA 4BXWA 3RXSA 1UMAH 1BBRK 2GZ9A 3KEEA 4U32A 4Y6DA 2YNAA 1BTUA 1OS8A 4AX9H 1O32A 2P16A 2G81E 1SGFG 4AGKA 4K60A 3K2UA 2CV3A 3KQCA 2FX4A 1S0QA 1Z8RA 3RMNH 5J4SA 1S6HA 3ZVBA 3ZVAA 2OC1A 1A7SA 4BNRA 3HK3B 5EODA 1P01A 4NWLA 1HRTH 3A7ZA 1CHOF 3ZYDA 2EI8A 1SGRE 1U6QA 5CHAC 2HALA 3PMBB 2AMPA 4Y8ZA 3MNCA 1GJ6A 4X8TH 1E34B 6GCHG 1CA8B 2ZHFH 1AFEH 3LKWA 2QXGA 1EB1H 1KLIH 1S85A 1EZXC 1NN6A 1Z71A 5FCRA 4E05H 3T28A 1O3BA 1EAWA 1VITF 2FMJA 1LQEA 1G3EA 4X8VH 2TPIZ 4ABJA 3RMLH 1D6WA 3RXJA 1PQ8A 1O0DH 2V35A 5CE1A 1J15A 4INLA 2GMTB 1E0FD 4Y71A 2GDEH 1XUKA 1H8DH 4AB9A 1EQ9A 1EOLA 3A82A 3BG8A 4E7RG 2WUBA 3M3VA 1NRPH 1LMWB 3PO1B 2XW9A 3F6UH 1N8OB 1MBMA 3ZZ6A 5F6MA 4JZFH 3O8DA 1KYNA 1GBEA 1TQ0B 2CN0H 1SSXA 3O8RA 1HJAC 1CE5A 1SL3A 2HPPH 3SJIA 3BF6H 5K7RA 1S83A 1YF4A 5ESTE 1Y3UA 5K0HA 4I8JA 5A09A 1O3NA 1AQ7A 1GBMA 2XBXA 3DUXH 1C5TA 1ELCA 2XWBI 3SORA 4MPUA 1FDPA 2ZECA 2FI5E 1EUFA 1FQ3A 4MQAA 3UNQA 4LXBH 1XUGA 1BCUH 1P9SA 4Y7AA 3VXFH 1W14U 3GCNA 1T4UH 4JZ1A 1QJ7B 1C2DA 1O3GA 1ZMJA 1E36B 1CGIE 5DP8A 1JRSA 3EE0B 3PWCA 1UJ1A 5FAHA 1AMHA 1CBWC 3QLPH 4DOQA 3KQEA 2PSYA 2BMGB 3I77A 2C8ZB 1JMOH 2GT8A 2Z3DA 4MTBA 3FAOA 2BD7A 1RD3B 3BTQE 1TABE 1UVTH 1BTHH 3BTME 1GBTA 1H9IE 2P3FH 3BIVH 3M5OA 1AUJA 3VGCB 3M36A 1QRXA 1WTHD 3ELAH 2C3SA 4CBOA 1P05A 2Y6TA 2B0FA 4JYTA 4AYVB 2CJIA 1KXAA 1AZ8A 2WPLS 2WYJA 2NU0E 1JWTA 2ZEBA 3ZV8A 5DO4H 1SB1H 4FXGH 1OP0A 2VVUA 3SI4H 3SNAA 1TIOA 1EP6A 1UTLM 3BTGE 3ESTA 2O8LA 1P12E 2WV4A 2UWOA 3VB7A 3UQVA 4Q7ZA 2VGCB 2F3CE 2XCFA 2A31A 1TPSA 3P95A 2TRMA 1GHVH 3TIUA 4B76A 1UTPA 2ZU2A 1K1NA 1BB0B 1DUEA 1TRMA 1OYQA 3K6YA 1CT4E 1S0RA 3SNEA 3M7UA 4M7GA 5AVDA 4Z0KA 4NWKA 1EXFA 3FP7E 1TPPA 1A61H 1PPZA 1V2RT 3P8GA 4MG3A 2F83A 3RXVA 2W26A 2F9OA 3LPRA 4TWWA 1BTXA 1ELBA 3BEIB 3BV9B 4WF8A 4X1QU 1QR3E 2LNCA 3A84A 4A6LA 4A1VA 4ABGA 4GPGA 2A5KA 1AY6H 1A0JA 1IQNA 4Y11E 1A5GH 4K8YA 2O8WA 5FHTA 1GBIA 1B0FA 1UK4A 4RN6A 1O3JA 5C3NA 2QA9E 1WUNH 3GDUA 4ZAEA 1IQMA 5E2OA 3RXDA 2SFAA 3A7XA 1DX5M 1H9LB 3A89A 3CENA 4OS6A 1G3CA 4CRAA 1YPEH 1P02A 1YLDA 2ALVA 4CBNA 1K9OE 4F49A 1SMFE 1KTSB 4YLUA 4DURA 5DP7A 2VIPA 2CF8H 2XBYA 3M7TA 1C5OH 3S9BA 1FNIA 4X1SU 3VB3A 4O3TA 1O2XA 1CVWH 1XKAC 2ZGJA 1MD7A 1C4V2 1QRZA 1SGNE 2FPZA 1LO6A 3E1XB 3MO3A 3V3MA 1DSTA 1PQAA 1P3EA 1ZJKA 3SW2B 3IITA 1Y3WA 1LCYA 1AB9C 1RFNA 8LPRA 1ZZZA 2CMYA 1UCYH 3ZVGA 1LVOA 1D3TB 1GJBB 2ZZUH 1TNHA 3U8RH 1QB9A 4GCHG 3K6ZA 1FIWA 2H5DA 1YYY1 3P8OA 1PPCE 3RXPA 2Z9IA 1OX1A 3D23A 3D49H 4X1RU 2J34A 3UFAA 1GHBG 3QZQA 1V2NT 2GZ8A 1GMHF 1NFWA 2ZQ1A 1PPEE 1HYLA 1SGTA 4JZDH 2GTBA 1TNJA 2Z9GA 2ANKH 1L1NA 4UFEH 1EPTA 1HFDA 1TPAE 2RG3A 2ZTXA 1AE5A 4ZROA 2VIOA 3VB6A 2BDYA 1ETRH 2OXSA 4LK4A 1NS3A 3OTJE 1V2ST 2VB0A 1DANH 3UNSA 1ZGIA 2V6NA 1QL9A 3IWMA 1B7XB 5C67A 5HM9A 3SGQE 2ZGBH 2AIQA 2QC2A 2VWOA 4CRCA 2BLWA 2FOGA 4RKOB 3RXUA 3BEFB 1W2KH 2ZDLA 1IOEA 3ENSB 1C2JA 1OWEA 2BHGA 3BG4C 1MTVA 1O5BB 5A2MH 1HAZB 3HKJB 4FUIA 2BDHA 1M9UA 2KAIB 2EC9H 2PTNA 1PYTD 4U01A 1TPOA 1NFXA 5ESBA 4H4FA 4AG2A 3T27A 1ESBA 4BXSA 4D8NA 1AWFH 1AZZA 1AWHB 1O2SA 1GMCG 2ZDKA 5EG4A 1XXFA 4BAOB 2ODQA 3MI4A 1P2NA 2Y82A 1O2LA 3AASA 5FPTA 4K1SA 1VZQH 1C2IA 2BLOA 1C1QA 4B75A 2HOBA 3SV2H 1P2QA 3TJNA 4CR9A 4SGAE 3SUGA 3T26A 1GVLA 1EJMA 2J94A 3M35A 3HATH 1DY9A 2P3UB 2VH6A 1GI1A 4ABEA 5LGOA 1O2WA 4ZKSU 1AN1E 1HAHH 1O30A 1NY22 1KDQA 2P93A 7GCHF 3P6ZB 3MH6A 1PYTC 2C8WB 4IGDA 1VGCC 3U9AH 5EPYA 1YPLH 4NCYA 2R2WU 2TBSA 1HUTH 1A0HB 1LTOA 2GGVB 3UY9A 1Y8TA 3LGYA 4Z6AH 3MNXA 5GCHG 3H7OA 4ISIH 1TRYA 3SO3A 1MTSA 5I25A 1CBWB 1B0EA 1GI3A 2FS8A 2SGFE 2ZDMA 2H6MA 3RU4D 1H9HE 5E2PA 2PUQH 4MDSA 4UFGH 1C5SA 1ELVA 2R0LA 1BITA 2NU1E 3L33A 1UVSH 3T2NA 4B2CA 3FP6E 2FOEA 2C8XB 3BIUH 2XCNA 4I33A 2FXRA 1O36A 1OKXA 2ANMH 1EJAA 1WTGH 2XBVA 4WH8A 2SNVA 3ATWA 1F5KU 4DW2U 3P92A 3C1KA 1DM4B 2OINA 3Q76A 1MKXH 1C5LH 4OGXA 3RXOA 1B5GH 1L4ZA 5TCCA 3N7OA 1PFXC 3MWIU 4FUHA 4E06H 1SFQB 4A1XA 6ESTA 1Z7KA 3GICB 1NM6A 1UTOA 1EATA 4IW4E 3BTDE 3TH4H 4UONA 1C4Y2 4JMYA 2ODPA 2HVXA 1IHSH 1WOFA 2OLGA 3GY4A 1O2VA 2JETC 4U2WA 1GJAB 1O3DA 1HAYB 4ZH8A 2ZFSA 1NPMA 1SBWA 1O2JA 1TE0A 3ODDA 5EPNA 3BTEE 2A7CA 1AVGH 1K1IA 3KCGH 1Y5AT 3KF2A 2GCTC 3BEUA 2K1QA 5DP9A 2R0KA 1QA0A 4R8TB 1BIOA 4J2YB 1C1WH 2J92A 1RTLA 1GPZA 2F9UA 1YPKH 4NA9H 4ZKOU 3P17H 1NESE 2Y80A 1GJ5H 1VJ9U 2AH4X 2ZFPH 4YOJA 3M7QA 5FPSA 1GI7B 1SLXB 1J14A 1LHDH 2OQUA 2P3TB 4XFQA 2BZ6H 5T6DA 1AKSB 1OYTH 4NZLA 5EQSA 1P2MA 1TONA 3T25A 2SGAA 5C5NA 1G2LA 1C9PA 3K65B 4WY3A 4Y76A 3FZZA 4O3UA 5GJ4B 3TJUA 8KME2 1GBLA 1TX7A 2LPRA 1MZAA 5L6NH 1Y59T 3EGKH 1GWAA 1GBAA 3PMAB 3V12A 2FYRA 5ABWA 1VCQA 1FN6A 2ZHEH 2A7JA 1F5LA 2PKAA 2ZTYA 4UD9H 1C5NH 1YC0A 4UEHH 2I6QA 2ZKSA 1QHRB 5L2ZH 2BY7X 1GMDG 5C20A 1UVPA 2WUCA 4B71A 5EW1H 3Q3KA 3SUEA 1GG6B 1P8VC 4MPXA 1Z1JA 1EJNA 1IQHA 1HB0B 1V2KT 2SGEE 2G5VA 4MNVA 4CHAB 4GSOA 2GDDA 3SV8A 4H6TA 1ESTA 1OPHB 5F03A 1W12U 2AMQA 1ELGA 5CMXH 4YTAA 1ZHPA 1XVOA 3RLYH 2QYIA 3L3TA 2TGAA 5TCAA 4ISHH 2STAE 5I46H 1UTMA 3PROA 1ZRKA 1O3OA 5SGAE 5F8XA 1LPZB 1GHZA 5C1XA 2C4FH 4LZ4B 3D65E 2QGRA 5BPEA 1J16A 1MMJN 3UQOA 1GI2A 4X1PU 2C93B 3UWJH 5JDUB 4FU7A 2OC8A 2PLXA 1FZZA 3B23B 1EKBB 1SGEE 2QXHA 5TJXA 2GCHG 5JYIA 4JYUH 3H7TA 1GDNA 1EAIA 3BN9A 4NG9H 3DHKH 3LH1A 3RXMA 2ZU3A 3PLKA 2D8WA 2ZHWH 3M61U 1VCWA 4ZHLU 1THRH 7LPRA 2FLBH 3GCTF 5EXNA 1D3QB 1IAUA 2VVVA 2ZPQA 4WWYA 6LPRA 1TMBH 2H9EH 1VR1H 2XC0A 4MNWA 2BD8A 2XRCA 1FXYA 3GY7A 3A83A 1N1LA 1K1JA 1CGJE 2GP9B 3M5LA 1ESAA 2VH0A 4A7IB 4NGAH 5FX6A 3TPIZ 6GCHF 2P8OB 3MO6A 1O3IA 1BBRH 1PQ5A 4I8HA 2FOMB 5F8ZA 1GJ9B 1O2ZA 4PROA 1TRNA 1TGSZ 1HIAB 4DG4A 1BOQA 1TBZH 1UVOA 4X2VA 1K1MA 2HNTF 3E6PH 2PWXA 2BM2A 4K8BA 2VU8E 5GWZA 1YCPH 2EA3A 1ANEA 1XMNB 1CQQA 2ZGHA 3PWBA 3K9XB 4NIVA 3M3SA 1GHAF 2QAAA 2WPMS 1WBGB 3GY3A 5DP6A 1G32B 1CHOG 1OP2A 1JRTA 1H1BA 5C1YA 4OS4A 3RC5A 1DXWA 2ODYB 2D2DA 1ZGVA 1AVWA 1GVZA 1W7GH 3LJOA 2R9PA 2WPJS 3SN8A 1WYKA 2VIWA 5DPAA 2ZPRA 1VITG 3SNBA 4WMEA 3GY5A 1C1NA 2F91A 1OWKA 2ULLA 3SBKA 1F7ZA 2Z3CA 1CT2E 5A8XA 4QT8C 5EU8A 4BTUB 3SV9A 3U69H 1FY5A 3L6PA 1D3DB 1K28D 2QV1A 1QL7A 3EQ0H 2BY8X 4Y79A 5LH8A 4ABHA 5E0GA 1BTPA 4DVAU 7KMEH 3Q77A 5BRRE 2UUJB 2BLVA 1TYNA 3NPSA 1KIGH 4K5ZA 1T7CA 1KXEA 3U98H 3ATLA 1SGDE 3R3GB 4WVPE 4KELA 2FP7B 1BRUP 2IOTA 1SGQE 1P11E 2ASUB 1NFYA 3RU4T 2F9PA 5HGGA 2CHAB 1DWBH 1QB6A 1HAOH 1C5RA 2F9VA 1O3KA 4AYYB 1S6FA 2WPHS 4X1NU 1GBJA 1G37A 4NZQA 3QX5H 3LGTA 1RIWC 2EI7A 2VWMA 4FUGA 2O8MA 4YM9A 1BZXE 4Q7XA 2WPIS 2TIOA 2V3HH 1Z8IB 1YPGH 3SNCA 1EAUA 1ZPCA 3RXBA 3GYLB 4ZHMU 1F5RA 1SOZA 3GDSA 1QFKH 1O3AA 4MNXA 4DCDA 4KTUA 2VVCA 1KSNA 1V2MT 3QTOH 3OU0A 2BLQA 2PTCE 1ZTLA 3OY5U 1T31A 1KXCA 2ZFTA 4NIXA 1TALA 1C1VH 1D6RA 4I7YH 2BD4A 2ILNA 5FXLA 1BHXF 2ZHDA 3WY8A 1WQSA 3QWCH 1P10A 5AF9H 2Q1JA 5C5OA 3QGNB 2GVFA 1WCZA 3F9FA 1EZQA 3H5CB 2FODA 4X2WA 3M37A 1LKAA 1RTFB 2ZPSA 3M5NA 1C2MA 1HAVB 4YOIA 1O3HA 1GBDA 4R0IA 1THPB 1UK2A 3HPTB 1DS2E 1BA8B 3ITIA 4MPVA 1EZUC 4JK6A 1AFQC 2OBOA 1OP8A 1TAWA 4O03A 1YPJH 1SPJA 1RJXB 7ESTE 2ZNKH 3A80A 3NWUA 1P04A 1BMAA 1YPHC 3SHCH 4I31A 4OGYA 1MKWK 1FAKH 3Q3YA 1ELTA 1ARCA 2W3IA 3LU9B 5T6FA 2QY0B 1LVMA 3SHAH 2WYGA 4TWYA 1V3XA 3MTYA 2A4GA 1MU8B 3E16B 3GCHC 3T29A 3LGVA 5FBIA 1HXFH 2FYQA 3UOPA 3PTBA 1Z8GA 2PKSB 5JBAS 3ZZDA 1BTWA 1HAGE 1YCPM 4LOYH 1JIRA 3HGNA 2NU2E 1Y5BT 3TK5A 4KTSA 1O2GH 1O2IA 2GT7A 1XUJA 3A7YA 5E8EH 4D7GA 2RDLA 3TK9A 1GCTC 1TOMH 1HJ8A 1TMTH 3ODFA 1NRSH 1BMNH 4YLQH 2GD4B 4GCHF 1QTFA 4XSKU 4ZKNU 1UHBB 4CRGA 2XXLA 1O3LA 2BD3A 1AUTC 1FLEE 1SGFA 3ZZ9A 1DWEH 1WSSH 3UUZA 4AFQA 5AFZH 2GV7A 1GI9B 3RC6A 5EXMA 1IQFA 6CHAC 1F2SE 3TJOA 4JYVH 3D62A 3HGPA 1HAIH 2BY5X 1O5EH 1UTQA 1O2MA 3U8OH 5EXLA 3A88A 1G3BA 1GJ8B 3E3TA 2ZF0H 1FJSA 1EZSC 2FTLE 2GV6A 4BTIB 3MNBA 4FUCA 1FY4A 1J9CH 2BY9X 2OCVB 3A85A 1VCPA 1D3PB 1MU6B 2D26C 3CS0A 4K3JA 1AVXA 4ABAA 1TLDA 1CO7E 1QGFA 3LC5A 2B9LA 5JPMH 5CHAB 3SU1A 2OP9A 4RSPA 1GMHG 2A4QA 2PSXA 1GBKA 3ZZ8A 1O5CB 3NXPA 1TNKA 1GHWH 1JOUB 2Z9LA 1KXFA 2UUKB 5JBTA 1GI8B 1NTPA 1DITH 3ZZ5A 1DVAH 3TNTA 3S7HB 4XOJA 3Q3XA 1WU1A 1AU8A 1P2IA 1EPTC 4X6NA 1YP9A 3RUOA 1NROH 1SOTA 1V2WT 2AGIX 5EW2H 1OWJA 1RS0A 2G52A 1A5IA 4Y0YE 5LPFA 4O97A 3FZDA 3TNSA 3LGIA 3SU0A 3RXIA 3GOVB 3FANA 1O3EA 2Z9JA 4FUDA 2AIPA 1A5HA 1C5ZB 1UK3A 1KLJH 3RXAA 5EQQA 5A0BA 5PTPA 3U1JB 1HJAB 1DICA 2DE9A 3KL6A 4IBLH 1ELDE 1GL0E 2VIDA 1T4VH 4AZ2B 3S0NA 1YBWA 1NZQH 2G51A 2Y81A 3HK6B 1O37A 2GMTC 1DSUA 2BXTH 1E35B 5GPIB 1IQGA 4JK5A 3SU6A 1TA2A 1C5UA 1ZPBA 3PO1C 1Y3VA 3IG6B 3PTNA 1N8OC 2ZFFH 3MH5A 2JH6D 3GYMA 1QNJA 3TVJB 2ZG0H 1C5QA 2FOAA 3A8CA 4NA8A 3AAUA 4INHA 3ZYEA 7GCHG 2BDCA 1SC8U 1P0SH 4BAMB 5A8ZA 1RGQA 5IYTA 1HXEH 2BDGA 1L0ZA 2D1JA 1CT0E 1ZHMA 3PMHB 2AERH 1V2OT 1L1JA 3GISB 1YM0A 3TH2H 1YGCH 1G3DA 3CS7A 2AMDA 4ESTE 3MH7A 4WMFA 1QQ4A 1T8MA 1AGJA 2F9BH 2ZDAH 4CH8B 1G9IE 1O38A 1O39A 1O3MA 1C5MD 2B5TB 2ZP0H 4Y7BA 3QGJA 2FS9A 1DPOA 2CF9H 4X6MA 1QB1A 2NU3E 4BOHA 1F0SA 3RXCA 1W0YH 1MTNC 3EA7A 4AFUA 4FUEA 4IMZA 4ZMAH 1ZLRA 4XDEA 1FPHH 5B6OA 2QCYA 4I8KA 2ZDVH 1HGTH 1TQ7B 1DFPA 4TPIZ 1LDTT 4OS1A 3P8NA 1K21H 2AYWA 3QK1A 8GCHG 4BAQB 3SZNA 1T32A 1FV9A 3S7KB 1QJ6B 3ZVDA 1HCGA 1Z6EA 3AVZA 1L1GA 2ZI2H 3ZZCA 2HNTE 1CA0C 1TB6H 3TGJE 1A4WH 1OWIA 4KGAA 2SGQE 1MTUA 2FI3E 2XBWA 1NC6A 1QA7A 4CH2B 1KXDA 1BT7A 4AOQA 1C1TA 2H2ZA 2VWLA 2ZU4A 4K2YA 1EOJA 3A7TA 1KLTA 1DDJA 1LHEH 3RXLA 4ABIA 1N6XA 1UTNA 2ZTZA 2FI4E 1ARBA 1O2UA 1QCPA 4BAKB 1GMDF 4MPWA 5JB9S 1XUFA 2BD5A 1V2TT 2QF0A 4AG1A 2Q6GA 4A1TA 2P94A 2G5NA 3ATIA 2ZO3H 2ZFQH 3EYDA 3TGIE 1CHGA 1DUAA 3LIWA 1O2HA 2QXJA 4D7FA 5FPYA 2OC7A 3JZ1B 3RM0H 2CXVA 1O2NA 2ZWLH 4VGCC 1MAYA 1ANBA 2Q6DA 1H4WA 3S69A 2M5TA 1TNIA 1O3FA 1KXBA 4YO9A 1O2PA 1XUHA 4IMQA 3SQHE 3SU4A 2DUCA 3PLPA 1AB9B 4ISNA 4B2AA 1W8BH 2VINA 2NWNA 5EQRA 2Z3EA 2IJOB 4WXVA 1MUEB 3JZ2B 4XBBA 1ETSH 3MNSA 1YPMH 3F9EA 2FZZA 6CHAB 1C2HA 1ZSLA 1AE8H 1GCDA 4JCNA 2FWWA 1Q3XA 3KHVA 4NFFA 1K1PA 1QBNA 3UTUH 1QL8A 2Y5HA 2W7UA 1IQJA 3E8LA 2G4TA 2QIQA 3RU4E 5DK1A 1BTYA 1TNGA 2PFEA 4AB8A 4OS5A 1ELAA 3FFGA 3PYHA 1MH0A 4ABFA 4X2YA 3SUDA 2V3OH 1O34A 1O5AB 2ANYA 4YESB 1AI8H 2FX6A 1N6YA 1LPKB 3LT3A 2O9QA 4X6OA 4CRFA 1A2CH 1G36A 1PPHE 1TBRH 3P8FA 3SV7A 1V2JT 3UREA 1HNEE 1T8NA 1SGYE 2BQ7B 1XX9A 1CSOE 1SQOA 3A87A 3DFJA 1QY6A 4B1TA 1C5VA 3UPEA 2ZGXH 2OTVA 3LC3A 2EEKA 2YNBA 2J2UA 1OOKB 1GGDC 3I29A 4AFZA 2FDAA 3MYWA 2ESTE 3BG4B 2BVRH 3PMJA 3GY6A 3LGUA 3GCTG 1EPTB 2KAIA 1SGPE 5JBBS 1CGHA 1YCPK 4HTCH 2ZA5A 4GHQA 3AW0A 5AFYH 2BYAX 1MCVA 4MVNA 3ZZ7A 1TBQH 4UFDH 1UTJA 1T8LA 4YZUA 4XE4A 5DGJA 3LDXH 3BTKE 4THNH 1ANCA 3B8JA 2ZU5A 3MU4A 2XNIA 1W7XH 4FUBA 4YT7H 2V0BA 3CP7A 1ABIH 1BQYA 4ISLA 1W10U 1TGCA 1KY9A 3S9AA 1K2I1 2PUXB 3UWIA 1V2VT 3RXEA 2BOKA 2P95A 3ZV9A 2HPQH 3VEQB 1DY8A 1VGCB 1AO5A 1ZMNA 2TGPZ 2H9HA 4WXIA 3O8CA 1HAXB 1O31A 2ZDNA 5DG6A 2I6SA 1ACBE 1LHFH 2J95A 1FMGA 1P09A 1GHAG 1UCYE 2O8TA 3DD2H 2BXUH 1D9IA 1W11U 1VITH 3A81A 1E38B 2B8OH 1E37B 3MOCA 5HYOA 1HAPH 1S81A 2FOCA 2R2MB 2TGDA 3MMGA 3RDZA 1SFIA 2CGAA 4FU8A 1W13U 3STIA 2PGBB 3OX7U 4MNYA 2ALPA 1PPFE 1FN8A 4AGJA 2HGTH 1KDQB 3S9CA 1XUIA 1G2MA 3F9GA 2BX3A 4XBDA 5LPEA 2G4UA 4IN2A 5FBEA 4TY7A 3AAVA 4JZIA 3V7TA 3F9HA 2W7SA 1P06A 1ZPZA 3BTTE 4D9QA 1ANDA 1HLTH 4TPYA 4YOGA 3SI3H 2VWNA 4ZHAA 1LKBA 3KQBA 4CR5A 1P2JA 2O8UA 3SGBE 3SOSA 2BVXH 3KGPA 1XVMA 5L30H 2FOFA 2ZHQH 3RM2H 3TJVA 1LVYA 3MU0A 2AS9A 5EGMA 1DE7H 1IQIA 2GX4A 3RLWH 1TGNA 1DLKB 2JETB 2Z94A 3SUFA 4BTTB 1VJAU 1PQ7A 1UVUH 3KQDA 3TLOA 4Q2KA 4HI3A 1GI4A 2GCTB 1MTNB 3VPKA 3EA8A 3SJ9A 1TFXA 1TX8A 2WPKS 1L2EA 1SR5C 1HJ9A 3E91A 1GJDB 1PPGE 1DXPA 1GI5A 3Q00A 5GDSH 4H6SB 5T6GA 3G01A 2FM2A 1C2LA 2W3KA 1BHXB 3DT0H 1P3CA 4CRBA 1O3PB 1SQTA 1V2QT 2BZAA 2FESH 5DP5A 3OSYA 1FAXA 1CA0B 1OWDA 5JBCS 1LHGH 1OXGA 9LPRA 3MH4A 1AKSA 2XWAA 2A5IA 1ETTH 3RP2A 1NT1A 4HFPB 2QF3A 1P2KA 1FIZA 3P70B 2BOHB 1SI5H 3GY2A 4FUJA 1K1LA 1FY3A 4Y10E 4NSVA 1GDUA 4H42U 3RXFA 4YT6H 1C5PA 1J17T 1SLUB 1Y3XA 2FO9A 3B9FH 4U30A 4AN7A 3SJKA 1C2GA 2OQ5A 3SQEE 3RMOH 3ZVEA 1HV7A 1C5YB 4E7NA 4Y0ZE 3QZRA 1ELFA 1BMLA 1EX3A 4ZXYH 4WH6A 5HM2A 1QBVH 3SU5A 4NA7A 4DY7B 3GCOA 3MU8A 1F0UA 1V2LT 4INKA 3C27B 2ZCLP 3ZVFA 4K1EA 2UUFB 2J4IA 1TGTA 4OS2A 1RXPA 3VFEA 1Y5UT 1C5WB 1UO6A 4VGCB 1C1SA 4B74A 3SV6A 1NFUA 4RKJB 5AHGH 5HXFA 3OY6U 3UNRA 4ZUHA 1BTZA 2PGQB 1GDQA 3E0PB 1MKWH 2BQWB 1SHHB 3NK8A 2PKAB 5F8TA 3TH3H 1C1OA 4UDWH 1ZRBA 2FOBA 2WV5A 2A4OA 5A8YA 1UCYK 1AIXH 4HZHA 2BQ6B 1GG6C 2GKVE 4Y8XA 3TGKE 1JIMA 3FP8E 5E0HA 3PB1E 4K69A 2A2QH 4CHAC 1P9UA 1F92A 1NRQH 2A2XH 1O2KA 1GHBF 1ZTJA 2ZC9H 2EI6A 3KNXA 4DGJA 1V2PT 4DIIH 4NSYA 3DA9B 1HBTH 5FX5A 1D4PB 1QJ1B 5DP4A 2IN2A 4Y8YA 1GJ4H 4GVUA 2UUYA 2XTTB 3KIDU 1GVKB 1GBHA 2JH0D 4A92A 4I8LA 1BDAA 4GHTA 3VXEH 1TX6A 2IPHA 3A8AA 3QN7A 1ZSJA 2SGPE 1L4DA 4DT7B 1INCA 4J1YA 4TYDA 2BY6X 3BTHE 2QN5T 3URDA 1P57B 1O33A 1NRRH 1A3BH 1ZMLA 1BRBE 1Z1IA 2B7DH 2OUAA 3SNDA 2ZU1A 2W5EA 1GGDB 1GJCB 2OD3B 3U8TH 4B73A 3FVFB 1C4U2 1T8OA 1ZYOA 4OS7A 1XKBC 2FLRH 4X8SH 9ESTA 1O2RA 1SLWB 5J4QA 1HIAA 3BTWE 5E0JA 1MQ6A 1WV7H 3F68H 3A7WA 2OC0A 4IC6A 1BJVA 2SNWA 1W0ZU 1OWHA 1GBCA 1GMCF 3SU3A 1JBUH 3QUMP 1TNLA 3VB4A 1IQLA 4WMDA 3GY8A 1BUIA 1S82A 1A0LA 1TA6A 2QXIA 3F1SB 3LH3A 2OBQA 4CREA 5FCKA 1YPHE 3RXHA 4F4OC 1ORFA 1RRKA 1SGIB 2P8OC 2JKHA 1HPGA 1YLCA 2H1UA 3TK6A 2BDBA 3R0FA 3LJJA 3RXQA 1S84A 3TITA 2G00A 4X0WU 2ANWA 1ZSKA 1C2FA 4Q7YA 1RTKA 2WINI 1AHTH 3A8BA 5GXPA 3RC4A 3UOUA 1ZOMA 3LGWA 3NUMA 1IHTH 2PV9B 1K1OA 2HNTC 4TY6A 1C1UH 4D9RA 1V6DA 1Z6JH 1GHYH 2SGDE 5L2YH 2FIRH 2C90B 1WAYB 1QIXB 2FTMA 3PV4A 3RXTA 5IDKA 1NU7B 3MO9A 2Y7ZA 1BJUA 2YOLA 2R3UA 1FPCH 5GCHF 3LOXA 2VNTA 1DLEA 1JXPA 3ZZ4A 4ASHA 5H4IB 2UWPA 4AFSA 3EDXB 4GAWA 3PM3A 3SGAE 3RXGA 1FUJA 1J8AA 2RCEA 1OSSA 2BD2A 2THFB 3PLBA 2Z9KA 1P2OA 2AGEX 3RXRA 4IC5A 2F9NA 3MHWU
chains in the Genus database with same CATH superfamily
5T3HA 2GZ7A 1ZTKA 1C2EA 2BDIA 4ZKRU 1O35A 4SGBE 4BANB 8ESTE 3T62A 2G55A 3OYPA 2LELA 3UR6A 1F0TA 1QBOA 2AEIH 1MKXK 2AGGX 3VB5A 1LPGB 1WQVH 1QURH 2VIVA 1SVPA 5KEDA 4FVBA 1GI6A 3I78A 3GDVA 1RIWB 4IN1A 3UIRA 5DJ7A 1TGBA 3QTVH 3ZZ3A 2ZCKP 3MFJA 4ABDA 1ZR0A 2R3YA 3DFLA 3A8DA 4ABBA 1P03A 5C2ZA 1X7AC 1BBRE 4O9VA 4D76A 1O2QA 4AORA 4GLYA 2H5CA 2J38A 3PRDA 4K1TA 1XXDA 1ID5H 3RMMH 4LZ1H 1BMMH 4I8GA 2CHAC 3SJOA 1K22H 3M5MA 1C9TA 4NIYA 3QDZB 1BMFD 2BB4A 2ZQ2A 4FUFA 1FY1A 1QQUA 3STJA 2RA3A 1O2OA 3NKKA 1O5FH 1LQDB 1ELEE 2STBE 3NZIA 3NCLA 1S5SA 3VGCC 1FONA 4ACBA 1MBQA 3RXKA 2Y5GA 1DWCH 5GIBA 3SU2A 4NFEA 8GCHF 2ZIQH 3TU7H 3N7DA 4KTCA 1KTTB 3ZZAA 1UTKA 4KKDA 1TMUH 2XC4A 3V0XA 1FI8A 5A0AE 2XNDD 1EAXA 1O3CA 1HAVA 3A86A 2ZFRH 1FY8E 5F53A 2IPQX 2BDAA 2A0QB 1DT2A 1CU1A 3W94A 1H8ED 1O5DH 2VGCC 1A46H 1BRAA 1A3EH 1EB2A 1AFQB 3EAJA 4A5TS 1Q31A 3ZVCA 1W0KD 1V2UT 3AK5A 1Y3YA 2PR3A 1F0RA 1MCTA 2HWLB 2XYAA 2BX4A 1DWDH 1GJ7B 5JB8S 1O5GH 2AFQB 4IS5A 2FEQH 2JH5D 1SLVB 1H8IH 2Z6BD 1MQ5A 3SJ8A 1ABJH 2VJ1A 2HRVA 4CRDA 1NRNH 2J9NA 2A7HA 1DOJA 1BRCE 4Q80A 2RA0A 3KN2A 3EA9A 1W3CA 4JZEH 2C8YB 4XBCA 1AD8H 3GCHB 2VIQA 1NU9A 1C5XB 2NU4E 3URCA 2ZCHP 2ZGCA 2YMSC 1EASA 1GHXH 1TWXB 4X2XA 1ZJDA 3M3TA 4I32A 5HMAA 1LHCH 2UWLA 1EP5A 3LONA 2Q6FA 1PPBH 1C1MA 2PW8H 2PHBA 3QO6A 4ISOA 1GCTB 3W95A 3A7VA 4NIWA 2BD9A 2A32A 2A4RA 1Z8JB 1A1RA 3E90B 4DJZB 1K0HA 5C0UA 4UFFH 1MTWA 2XC5A 1GBBA 1UHBA 1IQEA 2H9TH 2A5AA 5A0CA 1SG8B 3V13A 2A1DB 2PKSC 4X6PA 1MD8A 3AW1A 3BTFE 1YKTA 2Z7FE 4BAHB 3ATMA 3BSQA 1O2TA 2GCHF 4WJG2 1SHYA 1Q2WA 3ATKA 1G30B 3MU1A 1MAXA 1QRWA 4HGCA 3ZZBA 2Y5FA 1GL1A 1MZDA 1SGCA 3MU5A 1GI0A 2HLCA 1COWD 4ACAA 2TGTA 5EOKA 1QZ8A 2QF5A 2A45B 2DE8A 5DP3A 4GUXA 2G8TA 4FU9A 4FVDA 5ETXA 2BTCE 3T5FH 3O8BA 3UR9A 3U1IB 2EQNA 3HKIB 1C1PA 1GBFA 1ZHRA 1PJPA 1C2KA 1HDTH 2P59A 3E0NB 1TOCB 4KP0A 4ZXXH 4DIHH 1C1RA 5G4BA 1SQAA 4X8UH 5DKMA 1LVBA 2FOHA 4UE7H 1XM1A 1THSH 1O2YA 1IQKA 4MLFB 1NO9H 2BVSH 5C1UA 5LPRA 2Y7XA 4B2BA 4BXWA 3RXSA 1UMAH 1BBRK 2GZ9A 3KEEA 4U32A 4Y6DA 2YNAA 1BTUA 1OS8A 4AX9H 1O32A 2P16A 2G81E 1SGFG 4AGKA 4K60A 3K2UA 2CV3A 3KQCA 2FX4A 1S0QA 1Z8RA 3RMNH 5J4SA 1S6HA 3ZVBA 3ZVAA 2OC1A 1A7SA 4BNRA 3HK3B 5EODA 1P01A 4NWLA 1HRTH 3A7ZA 1CHOF 3ZYDA 2EI8A 1SGRE 4Q63A 1U6QA 5CHAC 2HALA 3PMBB 2AMPA 4Y8ZA 3MNCA 1GJ6A 4X8TH 4P00A 1E34B 6GCHG 1CA8B 2ZHFH 1AFEH 3LKWA 2QXGA 1EB1H 1KLIH 1S85A 1EZXC 1NN6A 1Z71A 5FCRA 4E05H 3T28A 1O3BA 1EAWA 1VITF 2FMJA 2M2AA 1LQEA 1G3EA 4X8VH 2TPIZ 4ABJA 3RMLH 1D6WA 3RXJA 1PQ8A 1O0DH 2V35A 5CE1A 4F48B 1J15A 4INLA 2GMTB 1E0FD 2KR7A 4Y71A 2GDEH 1XUKA 1H8DH 4AB9A 1EQ9A 1EOLA 3A82A 3BG8A 4I86A 2WUBA 4E7RG 3M3VA 1NRPH 1H8HD 1LMWB 3PO1B 2XW9A 3F6UH 1N8OB 1MBMA 3ZZ6A 5F6MA 4JZFH 3O8DA 1KYNA 1GBEA 1TQ0B 2CN0H 1SSXA 3O8RA 1HJAC 1CE5A 1SL3A 2HPPH 3SJIA 3BF6H 5K7RA 1S83A 1YF4A 5ESTE 1Y3UA 5K0HA 4I8JA 5A09A 1O3NA 1AQ7A 1GBMA 2XBXA 3DUXH 1C5TA 1ELCA 2XWBI 3SORA 4MPUA 1FDPA 2ZECA 2FI5E 1EUFA 5FL7D 1FQ3A 3PRBA 4MQAA 3UNQA 4LXBH 1XUGA 1BCUH 1P9SA 4Y7AA 3OEED 3VXFH 1W14U 3GCNA 1T4UH 4JZ1A 1QJ7B 1C2DA 1O3GA 1ZMJA 1E36B 1CGIE 5DP8A 1JRSA 3EE0B 3PWCA 5C0TA 1UJ1A 5FAHA 1AMHA 1CBWC 3QLPH 4DOQA 3KQEA 2PSYA 4TSFD 2BMGB 3I77A 3WWBA 2C8ZB 1JMOH 2GT8A 2Z3DA 4MTBA 5HKKD 3FAOA 2BD7A 1RD3B 3BTQE 1TABE 1UVTH 1BTHH 3BTME 1GBTA 1H9IE 2P3FH 2WSSD 3BIVH 3M5OA 1AUJA 3VGCB 3M36A 1OHHD 1QRXA 1WTHD 3ELAH 2C3SA 4CBOA 1P05A 2Y6TA 2B0FA 4JYTA 4AYVB 2CJIA 1KXAA 1AZ8A 2WPLS 2WYJA 2NU0E 1JWTA 2ZEBA 3ZV8A 5DO4H 1SB1H 4FXGH 1OP0A 2V3MA 2VVUA 3SI4H 3SNAA 1TIOA 1EP6A 1UTLM 3BTGE 3ESTA 2O8LA 1P12E 2WV4A 4TT3D 2UWOA 3VB7A 3UQVA 4Q7ZA 2VGCB 2F3CE 2XCFA 2A31A 1TPSA 3P95A 2TRMA 1GHVH 3TIUA 4B76A 1UTPA 2J97A 3F2FA 2ZU2A 1K1NA 1BB0B 1DUEA 1E1QD 1TRMA 1OYQA 3K6YA 3WW7A 1CT4E 1S0RA 3SNEA 3M7UA 4M7GA 5AVDA 4Z0KA 4NWKA 1EXFA 3FP7E 1TPPA 1A61H 1PPZA 1V2RT 3P8GA 4MG3A 2F83A 3RXVA 2W26A 2F9OA 3LPRA 4TWWA 1BTXA 1ELBA 3BEIB 3BV9B 4WF8A 4X1QU 1QR3E 2LNCA 3A84A 4A6LA 4A1VA 5CHBA 4ABGA 4GPGA 2A5KA 1AY6H 1A0JA 1IQNA 2J98B 4Y11E 1A5GH 4K8YA 2O8WA 5FHTA 1B0FA 1GBIA 1UK4A 4RN6A 1O3JA 5C3NA 2QA9E 1WUNH 3GDUA 4ZAEA 1IQMA 5E2OA 3RXDA 2SFAA 3A7XA 1DX5M 1H9LB 3A89A 3CENA 4OS6A 1G3CA 4CRAA 1YPEH 1P02A 1YLDA 2ALVA 4CBNA 1K9OE 4F49A 1SMFE 1KTSB 4YLUA 4DURA 5DP7A 2VIPA 2CF8H 2XBYA 3M7TA 1C5OH 3S9BA 1FNIA 4X1SU 3VB3A 2QF4A 4O3TA 1O2XA 1CVWH 1XKAC 2ZGJA 1MD7A 1C4V2 1QRZA 1SGNE 2FPZA 1LO6A 3E1XB 3MO3A 3V3MA 4DT4A 1DSTA 1PQAA 1P3EA 1ZJKA 3SW2B 3IITA 1W0JD 1Y3WA 1LCYA 1AB9C 1RFNA 8LPRA 1ZZZA 1FX0B 2CMYA 1UCYH 3ZVGA 1LVOA 1D3TB 1GJBB 2ZZUH 1TNHA 3U8RH 5B6LA 1QB9A 4GCHG 3K6ZA 1FIWA 2H5DA 1YYY1 3P8OA 1PPCE 3RXPA 2Z9IA 1OX1A 3CNRA 3D23A 3D49H 4X1RU 2J34A 3UFAA 1GHBG 3QZQA 1V2NT 2GZ8A 1GMHF 1NFWA 2ZQ1A 1PPEE 1HYLA 1SGTA 4JZDH 2GTBA 1TNJA 2Z9GA 2ANKH 1L1NA 4P02A 4UFEH 1EPTA 1HFDA 1TPAE 2RG3A 2ZTXA 1AE5A 4ZROA 3FN8A 2VIOA 3VB6A 2BDYA 2K8IA 1ETRH 2OXSA 4LK4A 1NS3A 3OTJE 1V2ST 2VB0A 2QE7D 1DANH 3UNSA 1ZGIA 2V6NA 1QL9A 3IWMA 1B7XB 5C67A 5HM9A 3SGQE 2ZGBH 2AIQA 2QC2A 2VWOA 4CRCA 2BLWA 2FOGA 4RKOB 3RXUA 3BEFB 1W2KH 2ZDLA 1IOEA 3ENSB 1C2JA 1OWEA 2BHGA 3BG4C 1MTVA 1O5BB 5A2MH 1HAZB 1S6LA 3HKJB 4FUIA 2BDHA 1M9UA 2KAIB 2EC9H 2PTNA 1PYTD 2W6ID 1TPOA 1NFXA 4U01A 5ESBA 4H4FA 4AG2A 3T27A 1ESBA 4BXSA 4D8NA 1AWFH 1AZZA 1AWHB 1O2SA 1GMCG 2L74A 2ZDKA 5EG4A 1XXFA 4BAOB 2ODQA 3MI4A 1P2NA 2Y82A 1O2LA 3AASA 5FPTA 4K1SA 1VZQH 1C2IA 2BLOA 1C1QA 4B75A 2HOBA 3SV2H 1P2QA 3FKSD 3TJNA 4CR9A 4SGAE 3SUGA 3T26A 1GVLA 1EJMA 2J94A 3M35A 3HATH 1DY9A 2P3UB 2VH6A 1GI1A 4ABEA 5LGOA 1O2WA 4ZKSU 1AN1E 1HAHH 2KCOA 1O30A 1E79D 1NY22 1KDQA 2P93A 7GCHF 3P6ZB 3MH6A 1PYTC 2C8WB 4IGDA 1VGCC 3U9AH 5EPYA 1YPLH 4NCYA 2R2WU 2TBSA 1HUTH 1A0HB 1LTOA 2GGVB 3UY9A 5EJ1A 1Y8TA 3LGYA 4Z6AH 3MNXA 4F55A 2HVYB 5GCHG 3H7OA 3OEHD 4ISIH 1TRYA 3SO3A 1MTSA 5I25A 1CBWB 1B0EA 1GI3A 2FS8A 2SGFE 2ZDMA 2H6MA 3RU4D 1H9HE 1KMHB 5E2PA 2PUQH 4MDSA 4UFGH 1C5SA 1ELVA 2R0LA 1BITA 2NU1E 3L33A 1UVSH 3T2NA 4B2CA 3FP6E 2FOEA 2C8XB 3BIUH 2XCNA 4I33A 2FXRA 1O36A 1OKXA 2ANMH 1EJAA 1WTGH 2XBVA 4WH8A 2SNVA 3ATWA 1F5KU 4DW2U 3P92A 3C1KA 1DM4B 2OINA 3Q76A 1MKXH 1C5LH 4OGXA 3RXOA 1B5GH 1L4ZA 5TCCA 3N7OA 1PFXC 3MWIU 4FUHA 4E06H 1SFQB 4A1XA 6ESTA 1Z7KA 2WV9A 3GICB 1NM6A 1UTOA 1EATA 4IW4E 3BTDE 3TH4H 4UONA 1MABB 1C4Y2 4JMYA 2ODPA 2HVXA 1IHSH 1WOFA 2OLGA 3GY4A 1O2VA 2JETC 2KFWA 4U2WA 1GJAB 1O3DA 1HAYB 4ZH8A 2ZFSA 1NPMA 1SBWA 1O2JA 1TE0A 3ODDA 5EPNA 3BTEE 2A7CA 1AVGH 1K1IA 2YMSD 1Y5AT 3KCGH 3KF2A 2GCTC 3BEUA 2K1QA 5DP9A 2R0KA 1QA0A 4R8TB 1BIOA 4J2YB 1C1WH 2J92A 1RTLA 1GPZA 2F9UA 1YPKH 4NA9H 4ZKOU 3P17H 1NESE 2Y80A 1GJ5H 1VJ9U 2AH4X 2ZFPH 4YOJA 3M7QA 5FPSA 1GI7B 1SLXB 1J14A 1LHDH 2OQUA 2P3TB 4XFQA 2BZ6H 5T6DA 2EY4C 1AKSB 1OYTH 4NZLA 5EQSA 1P2MA 1TONA 3T25A 2SGAA 5C5NA 1G2LA 1C9PA 3K65B 4WY3A 4Y76A 3FZZA 4O3UA 5GJ4B 3TJUA 8KME2 1GBLA 1TX7A 2LPRA 1MZAA 5L6NH 1Y59T 3EGKH 1GWAA 1GBAA 3PMAB 3V12A 2FYRA 5ABWA 2PP6A 1VCQA 1FN6A 2ZHEH 2A7JA 5C94A 1F5LA 2PKAA 2ZTYA 4UD9H 1C5NH 1YC0A 4UEHH 2I6QA 2ZKSA 1QHRB 5L2ZH 2BY7X 4ASUD 1GMDG 5C20A 1UVPA 2WUCA 4B71A 5EW1H 3Q3KA 3SUEA 1GG6B 1P8VC 4MPXA 1Z1JA 1EJNA 1IQHA 1HB0B 1V2KT 2SGEE 2G5VA 4MNVA 4CHAB 4GSOA 2GDDA 3SV8A 4H6TA 1ESTA 1OPHB 5F03A 1W12U 2AMQA 1ELGA 3F0PA 5CMXH 4YTAA 1ZHPA 1XVOA 5C17A 3RLYH 2QYIA 3L3TA 2TGAA 5TCAA 4ISHH 2STAE 5I46H 1UTMA 3PROA 1ZRKA 1O3OA 5SGAE 5F8XA 1LPZB 1GHZA 5C1XA 2C4FH 4LZ4B 3D65E 2QGRA 5BPEA 1J16A 1MMJN 3UQOA 1GI2A 4X1PU 2C93B 3UWJH 5JDUB 4FU7A 2OC8A 2PLXA 1FZZA 3B23B 1EKBB 1SGEE 2QXHA 5TJXA 2GCHG 5JYIA 4JYUH 3H7TA 1GDNA 1EAIA 3BN9A 4NG9H 3DHKH 3LH1A 3RXMA 2ZU3A 3PLKA 2D8WA 2ZHWH 3M61U 1VCWA 4ZHLU 1THRH 7LPRA 2FLBH 3GCTF 5EXNA 1D3QB 1IAUA 3OE7D 2VVVA 2ZPQA 4WWYA 6LPRA 1TMBH 2H9EH 1VR1H 2XC0A 4XD7D 4MNWA 2BD8A 2XRCA 1FXYA 3GY7A 3A83A 1N1LA 1K1JA 1CGJE 2KCAA 3MQKC 2GP9B 3M5LA 1ESAA 2VH0A 2F43B 4A7IB 4NGAH 5FX6A 3TPIZ 6GCHF 2P8OB 1YY3A 3MO6A 1O3IA 1BBRH 1PQ5A 4I8HA 2FOMB 5F8ZA 1GJ9B 1O2ZA 4PROA 1TRNA 1TGSZ 1HIAB 5KGOA 4DG4A 1BOQA 1TBZH 1UVOA 4X2VA 1K1MA 2HNTF 3E6PH 2PWXA 2BM2A 4K8BA 2HLDD 2VU8E 5GWZA 1YCPH 2EA3A 1ANEA 1XMNB 1CQQA 2ZGHA 3PWBA 3K9XB 4NIVA 3M3SA 1GHAF 2QAAA 2WPMS 1WBGB 2W6JD 3GY3A 5DP6A 1G32B 1CHOG 1OP2A 1JRTA 1H1BA 5C1YA 1E1RD 4OS4A 3RC5A 1DXWA 2ODYB 2D2DA 1ZGVA 5CDFE 1AVWA 1GVZA 2KZ4A 1W7GH 3SYJA 3LJOA 2R9PA 2WPJS 3SN8A 1WYKA 2VIWA 5DPAA 2ZPRA 1VITG 3SNBA 4WMEA 3GY5A 1C1NA 3U28C 2F91A 1OWKA 2ULLA 3SBKA 1F7ZA 2Z3CA 1CT2E 5A8XA 4QT8C 5EU8A 4BTUB 3SV9A 3U69H 1FY5A 3L6PA 1D3DB 1K28D 2JJ2D 2QV1A 1QL7A 3EQ0H 2BY8X 4Y79A 5LH8A 4ABHA 5E0GA 1BTPA 4DVAU 1SKYE 3Q77A 7KMEH 5BRRE 2UUJB 2BLVA 1TYNA 3NPSA 3OAAD 1KIGH 4K5ZA 1T7CA 2CK3D 1KXEA 3U98H 3ATLA 1SGDE 3R3GB 4FETA 4WVPE 3NRLA 2FP7B 1BRUP 2IOTA 4KELA 1SGQE 1P11E 2ASUB 1NFYA 3RU4T 2F9PA 5HGGA 2CHAB 1DWBH 2KM0A 1QB6A 1HAOH 1C5RA 2F9VA 1O3KA 4AYYB 1S6FA 2WPHS 4X1NU 1GBJA 1G37A 4NZQA 3QX5H 3LGTA 1RIWC 2EI7A 2VWMA 4FUGA 4HG6A 2O8MA 4YM9A 5EIYA 1BZXE 4Q7XA 2WPIS 2TIOA 2V3HH 1Z8IB 1YPGH 3SNCA 1EAUA 1ZPCA 3RXBA 3GYLB 4ZHMU 1F5RA 1SOZA 3GDSA 1QFKH 1O3AA 4MNXA 4DCDA 4KTUA 2VVCA 1KSNA 1V2MT 3QTOH 3OU0A 2BLQA 2PTCE 1ZTLA 3OY5U 1T31A 1KXCA 2ZFTA 4NIXA 1TALA 1C1VH 1D6RA 4B6EA 4I7YH 2BD4A 2ILNA 5FXLA 1BHXF 2ZHDA 3WY8A 1WQSA 3QWCH 1P10A 5AF9H 2Q1JA 5C5OA 3QGNB 2GVFA 1WCZA 3F9FA 1EZQA 3H5CB 2FODA 4X2WA 3M37A 1LKAA 1RTFB 2ZPSA 1SQRA 3M5NA 1C2MA 1HAVB 2RFKC 1WDIA 4YOIA 1O3HA 1GBDA 4R0IA 1THPB 1UK2A 3HPTB 1DS2E 1BA8B 3ITIA 4MPVA 1EZUC 4JK6A 2YMSB 1AFQC 2OBOA 1OP8A 3SZEA 1TAWA 4O03A 1YPJH 1SPJA 1RJXB 7ESTE 2ZNKH 3A80A 3NWUA 1P04A 1BMAA 1YPHC 2JIZD 3SHCH 4I31A 4OGYA 1MKWK 1FAKH 3Q3YA 1ELTA 1ARCA 2W3IA 3LU9B 5T6FA 2QY0B 1LVMA 3SHAH 2WYGA 4TWYA 1V3XA 3KYGA 3MTYA 2A4GA 1MU8B 3E16B 3GCHC 3T29A 3LGVA 5FBIA 1HXFH 2FYQA 3UOPA 3PTBA 1Z8GA 3VG8A 2PKSB 5JBAS 3ZZDA 1BTWA 5KECA 1HAGE 1YCPM 4LOYH 2JJ1D 1JIRA 3HGNA 2NU2E 1Y5BT 3TK5A 4KTSA 2XOKD 1O2GH 1O2IA 2GT7A 1XUJA 3A7YA 5E8EH 4D7GA 2RDLA 3TK9A 1GCTC 1TOMH 1HJ8A 1TMTH 3H09A 3ODFA 1NRSH 1BMNH 4YLQH 2GD4B 4GCHF 1QTFA 4XSKU 4ZKNU 1UHBB 4CRGA 2XXLA 1O3LA 2BD3A 1AUTC 1FLEE 1SGFA 3ZZ9A 1DWEH 1WSSH 3UUZA 4AFQA 5AFZH 2GV7A 1GI9B 3RC6A 5EXMA 1IQFA 6CHAC 1F2SE 3TJOA 3DSOA 4JYVH 3D62A 3HGPA 1HAIH 2BY5X 1O5EH 1UTQA 1O2MA 3U8OH 5EXLA 3A88A 1G3BA 1GJ8B 3E3TA 2ZF0H 1FJSA 1EZSC 2FTLE 2GV6A 4BTIB 3F3BA 3MNBA 4FUCA 1FY4A 1J9CH 2BY9X 2OCVB 3A85A 1VCPA 1D3PB 1MU6B 2D26C 3CS0A 4K3JA 1AVXA 4ABAA 1TLDA 1CO7E 1QGFA 3LC5A 2B9LA 5JPMH 5CHAB 3SU1A 2OP9A 4RSPA 1GMHG 2A4QA 2PSXA 1GBKA 3ZZ8A 1O5CB 3NXPA 3W1EA 1TNKA 1GHWH 1JOUB 2Z9LA 1KXFA 2UUKB 5JBTA 1GI8B 1NTPA 1DITH 3ZZ5A 1DVAH 3TNTA 3S7HB 4XOJA 3Q3XA 1WU1A 1AU8A 1P2IA 1EPTC 4X6NA 1YP9A 3RUOA 1NROH 1SOTA 3DSPA 1V2WT 2AGIX 5EW2H 1OWJA 1RS0A 2G52A 1A5IA 4Y0YE 5LPFA 2V7QD 4O97A 3FZDA 3TNSA 3LGIA 3SU0A 3RXIA 3GOVB 3FANA 1O3EA 2Z9JA 4FUDA 2AIPA 1A5HA 3F2GA 1C5ZB 1UK3A 1KLJH 3RXAA 5EQQA 5A0BA 5PTPA 3U1JB 3ZIAD 1HJAB 1DICA 2DE9A 3KL6A 4IBLH 1ELDE 1GL0E 2VIDA 1T4VH 4AZ2B 3S0NA 1YBWA 1NZQH 2G51A 2Y81A 3HK6B 3OTPA 1O37A 2GMTC 1DSUA 2BXTH 3N99A 1E35B 2GJGA 5GPIB 1IQGA 2LP6A 4JK5A 3SU6A 1TA2A 5EJZA 1C5UA 1ZPBA 3PO1C 1Y3VA 3IG6B 3PTNA 1N8OC 2ZFFH 3MH5A 2JH6D 3GYMA 1QNJA 5DN6D 3TVJB 2ZG0H 1C5QA 2FOAA 2K0QA 3A8CA 4NA8A 4RT1A 3AAUA 4INHA 3ZYEA 7GCHG 2BDCA 1SC8U 1P0SH 4BAMB 5A8ZA 1RGQA 5IYTA 1HXEH 2BDGA 1L0ZA 2D1JA 1CT0E 1ZHMA 3PMHB 2AERH 1V2OT 1L1JA 3GISB 1YM0A 3TH2H 1YGCH 1G3DA 3CS7A 2AMDA 4ESTE 3MH7A 1NBMD 4WMFA 1QQ4A 1T8MA 1AGJA 2F9BH 2ZDAH 4CH8B 1G9IE 1O38A 1O39A 1O3MA 1C5MD 3WWFA 2B5TB 2ZP0H 4Y7BA 3QGJA 2FS9A 1DPOA 2CF9H 4X6MA 1QB1A 2NU3E 4BOHA 1F0SA 3RXCA 1W0YH 1MTNC 3EA7A 4AFUA 4FUEA 4IMZA 4ZMAH 1ZLRA 4XDEA 1FPHH 5B6OA 2QCYA 4I8KA 2ZDVH 1HGTH 1TQ7B 1DFPA 4TPIZ 1LDTT 4OS1A 3P8NA 1K21H 2AYWA 3QK1A 8GCHG 4BAQB 3SZNA 1T32A 1FV9A 3S7KB 1QJ6B 3ZVDA 1HCGA 1Z6EA 3AVZA 1L1GA 2ZI2H 3ZZCA 2HNTE 1CA0C 1TB6H 3TGJE 1A4WH 1OWIA 4KGAA 2SGQE 1MTUA 2FI3E 2XBWA 2WZQA 1NC6A 1QA7A 4CH2B 1KXDA 1BT7A 2J98A 4AOQA 1C1TA 2H2ZA 2VWLA 2ZU4A 4K2YA 1EOJA 3A7TA 1KLTA 5HIYA 1DDJA 1LHEH 3RXLA 4ABIA 1N6XA 1UTNA 2ZTZA 2FI4E 3EE7A 1ARBA 1O2UA 1QCPA 4RT0A 4BAKB 1GMDF 4MPWA 5JB9S 1XUFA 2BD5A 1V2TT 2QF0A 4AG1A 2Q6GA 4A1TA 2P94A 2G5NA 3ATIA 2ZO3H 2ZFQH 3EYDA 3TGIE 1CHGA 1DUAA 3LIWA 1O2HA 2QXJA 4D7FA 3FO8D 2OC7A 5FPYA 3JZ1B 3RM0H 2CXVA 1O2NA 2ZWLH 4VGCC 1MAYA 1ANBA 2Q6DA 1H4WA 4XRNA 3S69A 2M5TA 1TNIA 1O3FA 1KXBA 4YO9A 1O2PA 1XUHA 4IMQA 3SQHE 3SU4A 2DUCA 3PLPA 1AB9B 4ISNA 4B2AA 1W8BH 2VINA 2NWNA 5EQRA 2Z3EA 2KCPA 2IJOB 4WXVA 1MUEB 3JZ2B 4XBBA 1ETSH 3MNSA 4OM9A 1VKYA 1YPMH 3F9EA 2FZZA 6CHAB 1C2HA 1ZSLA 1AE8H 1GCDA 4JCNA 2FWWA 1Q3XA 3KHVA 4NFFA 1K1PA 1QBNA 3UTUH 1QL8A 2Y5HA 2W7UA 1IQJA 3E8LA 2G4TA 2QIQA 3RU4E 5DK1A 1BTYA 1TNGA 2JDID 2PFEA 4AB8A 4OS5A 1ELAA 3UB0A 3FFGA 3PYHA 1MH0A 1UW7A 4ABFA 4X2YA 3SUDA 2V3OH 1O34A 1O5AB 2ANYA 2WPDD 4YESB 1AI8H 2FX6A 1N6YA 1LPKB 3LT3A 2O9QA 4X6OA 4CRFA 1A2CH 1G36A 1PPHE 1TBRH 3P8FA 3SV7A 2F4LA 1V2JT 3UREA 1HNEE 1T8NA 1SGYE 2BQ7B 1XX9A 1CSOE 1SQOA 3A87A 3DFJA 1QY6A 4B1TA 1C5VA 3UPEA 2ZGXH 1NBME 2OTVA 3LC3A 2EEKA 2YNBA 2J2UA 1OOKB 1GGDC 3I29A 5T1VA 4AFZA 2FDAA 3MYWA 2ESTE 3BG4B 2BVRH 3PMJA 3GY6A 3LGUA 3GCTG 1EPTB 2KAIA 1SGPE 5JBBS 1CGHA 1YCPK 4HTCH 2ZA5A 4AC9A 4GHQA 3AW0A 5AFYH 2KCYA 2BYAX 4B6FA 1MCVA 4MVNA 3ZZ7A 1TBQH 4UFDH 1UTJA 1T8LA 4YZUA 4XE4A 5DGJA 3LDXH 3BTKE 4THNH 1ANCA 3B8JA 2ZU5A 3MU4A 2XNIA 1W7XH 4FUBA 4YT7H 2V0BA 3CP7A 1ABIH 1BQYA 4ISLA 1W10U 1TGCA 1KY9A 3S9AA 1K2I1 2PUXB 3UWIA 3FOAA 1V2VT 3RXEA 2BOKA 2P95A 3ZV9A 2HPQH 3VEQB 1DY8A 1VGCB 1AO5A 1ZMNA 2TGPZ 2H9HA 4WXIA 3O8CA 1HAXB 1O31A 2ZDNA 5DG6A 2I6SA 1ACBE 1LHFH 2J95A 1FMGA 1P09A 2RDEA 1GHAG 1UCYE 2O8TA 3DD2H 2BXUH 1D9IA 1W11U 1VITH 3A81A 1E38B 2B8OH 1E37B 3MOCA 5HYOA 1HAPH 1S81A 2FOCA 2R2MB 2TGDA 3MMGA 3RDZA 1SFIA 2CGAA 4FU8A 1W13U 3STIA 5IK2D 3KYFA 2PGBB 3OX7U 4MNYA 2ALPA 1PPFE 1FN8A 4AGJA 2HGTH 1KDQB 1EFRD 3S9CA 1XUIA 1G2MA 3F9GA 2BX3A 4XBDA 5LPEA 2G4UA 4IN2A 5FBEA 4TY7A 3AAVA 4JZIA 3V7TA 2VBCA 3F9HA 2W7SA 1P06A 1ZPZA 4ZCNA 3BTTE 4D9QA 1ANDA 1HLTH 4TPYA 4YOGA 3SI3H 2VWNA 4ZHAA 1LKBA 3KQBA 4CR5A 1P2JA 2O8UA 3SGBE 3SOSA 2BVXH 3KGPA 1XVMA 3GS9A 5L30H 2FOFA 4YXWD 2ZHQH 3RM2H 3TJVA 1LVYA 3MU0A 2AS9A 5EGMA 1DE7H 1IQIA 2GX4A 3RLWH 1TGNA 1DLKB 2JETB 2Z94A 3SUFA 4BTTB 3F2HA 1VJAU 1PQ7A 1UVUH 3KQDA 3TLOA 4Q2KA 2OK5A 4HI3A 1GI4A 2GCTB 1MTNB 3VPKA 3EA8A 3SJ9A 1TFXA 1TX8A 2WPKS 1L2EA 1SR5C 4RI0A 1HJ9A 3E91A 1GJDB 1PPGE 1DXPA 1GI5A 3Q00A 5GDSH 2IJD1 3PV2A 4H6SB 5T6GA 3G01A 2FM2A 1C2LA 1YWUA 2W3KA 1BHXB 3DT0H 1P3CA 4CRBA 1O3PB 1SQTA 1V2QT 2BZAA 2FESH 5DP5A 3OSYA 1FAXA 1CA0B 1OWDA 5JBCS 1LHGH 1OXGA 9LPRA 3MH4A 1AKSA 4Z1MD 3N7EA 2XWAA 2A5IA 1ETTH 3UAIC 3RP2A 1NT1A 4HFPB 2QF3A 1P2KA 1FIZA 3P70B 2BOHB 1SI5H 3GY2A 4FUJA 1K1LA 1FY3A 4Y10E 4NSVA 1GDUA 4H42U 3RXFA 4YT6H 4M9FA 1C5PA 1J17T 1SLUB 1Y3XA 2FO9A 3B9FH 4U30A 4FOUC 4AN7A 3SJKA 1C2GA 2OQ5A 3SQEE 3RMOH 3OFND 1HV7A 3ZVEA 1WXRA 1C5YB 4E7NA 4Y0ZE 3F0OA 3KQ5A 3QZRA 1ELFA 1BMLA 1EX3A 4ZXYH 4WH6A 5DSFA 1QBVH 5HM2A 3SU5A 4NA7A 4DY7B 3GCOA 3MU8A 1F0UA 1V2LT 4INKA 3C27B 2ZCLP 2WHXA 3ZVFA 4K1EA 2UUFB 2J4IA 1TGTA 4OS2A 1RXPA 3VFEA 1Y5UT 1C5WB 1UO6A 3PV5A 4VGCB 1C1SA 4B74A 3SV6A 4Q4LA 1NFUA 4RKJB 5AHGH 5HXFA 3OY6U 3UNRA 4ZUHA 1BTZA 2PGQB 1GDQA 3E0PB 1MKWH 2BQWB 1SHHB 3NK8A 2PKAB 5F8TA 3TH3H 1C1OA 4UDWH 1ZRBA 2KX4A 2FOBA 2WV5A 2A4OA 5A8YA 1UCYK 1AIXH 4HZHA 2BQ6B 1GG6C 2GKVE 4Y8XA 3TGKE 1JIMA 3FP8E 5E0HA 3PB1E 4K69A 2A2QH 5EJLA 4CHAC 1P9UA 1F92A 1NRQH 2A2XH 1O2KA 1GHBF 1ZTJA 2ZC9H 2EI6A 3KNXA 4DGJA 1V2PT 4DIIH 4NSYA 3DA9B 1HBTH 5FX5A 1D4PB 1QJ1B 2AHME 5DP4A 2IN2A 4Y8YA 1GJ4H 4GVUA 2UUYA 2XTTB 3KIDU 1GVKB 1GBHA 2JH0D 4A92A 2L6OA 4I8LA 1BDAA 4GHTA 3VXEH 1TX6A 2IPHA 3A8AA 3QN7A 1ZSJA 2SGPE 1L4DA 4DT7B 1INCA 4J1YA 4TYDA 2BY6X 3BTHE 2QN5T 2J5UA 1P57B 3URDA 1O33A 1NRRH 1A3BH 1ZMLA 1BRBE 1Z1IA 2B7DH 2OUAA 3SNDA 2ZU1A 2W5EA 1GGDB 1GJCB 2OD3B 3U8TH 4B73A 3FVFB 1C4U2 1T8OA 1ZYOA 4OS7A 1XKBC 1YLNA 2FLRH 4X8SH 9ESTA 1O2RA 1SLWB 5J4QA 1HIAA 3BTWE 5E0JA 1MQ6A 1WV7H 3F68H 3A7WA 2OC0A 4IC6A 1BJVA 3DCLA 2SNWA 1W0ZU 1OWHA 1GBCA 1GMCF 3SU3A 1JBUH 3QUMP 1TNLA 3VB4A 1IQLA 4WMDA 3GY8A 1BUIA 1S82A 1A0LA 1TA6A 2QXIA 3F1SB 3LH3A 2OBQA 4CREA 5FCKA 1YPHE 3RXHA 4F4OC 1ORFA 1RRKA 1SGIB 2P8OC 2JKHA 1HPGA 1YLCA 2H1UA 3TK6A 2BDBA 3R0FA 3LJJA 3RXQA 1S84A 3TITA 2G00A 4X0WU 2ANWA 1ZSKA 1C2FA 4Q7YA 1RTKA 2WINI 1AHTH 3A8BA 5GXPA 3DSGA 3RC4A 3UOUA 1ZOMA 3LGWA 3NUMA 5HIZA 1IHTH 2PV9B 1K1OA 2HNTC 4TY6A 1C1UH 4D9RA 1V6DA 1Z6JH 1GHYH 2SGDE 5L2YH 2FIRH 2C90B 1WAYB 1QIXB 2FTMA 3PV4A 3RXTA 5IDKA 1NU7B 3MO9A 2Y7ZA 1BJUA 2YOLA 2R3UA 1FPCH 5GCHF 3LOXA 5GNDA 2VNTA 1DLEA 1JXPA 3ZZ4A 4ASHA 5H4IB 2UWPA 4AFSA 3EDXB 4GAWA 3PM3A 3SGAE 3RXGA 1FUJA 1J8AA 2RCEA 1OSSA 2BD2A 2THFB 3PLBA 2Z9KA 1P2OA 2AGEX 3RXRA 4IC5A 2F9NA 3MHWU
chains in the Genus database with same CATH topology
5T3HA 2GZ7A 1ZTKA 1C2EA 2BDIA 4ZKRU 1O35A 4SGBE 4BANB 8ESTE 3T62A 2G55A 3OYPA 3UR6A 1F0TA 1QBOA 2AEIH 1MKXK 2AGGX 3VB5A 1LPGB 1WQVH 1QURH 2VIVA 1SVPA 4FVBA 1GI6A 3I78A 3GDVA 1RIWB 4IN1A 3UIRA 5DJ7A 1TGBA 3QTVH 3ZZ3A 2ZCKP 3MFJA 4ABDA 1ZR0A 2R3YA 3DFLA 3A8DA 4ABBA 1P03A 5C2ZA 1X7AC 1BBRE 4O9VA 4D76A 1O2QA 4AORA 4GLYA 2H5CA 2J38A 4K1TA 1XXDA 1ID5H 3RMMH 4LZ1H 1BMMH 4I8GA 2CHAC 3SJOA 1K22H 3M5MA 1C9TA 4NIYA 3QDZB 2BB4A 2ZQ2A 4FUFA 1FY1A 1QQUA 3STJA 2RA3A 1O2OA 3NKKA 1O5FH 1LQDB 1ELEE 2STBE 3NZIA 3NCLA 1S5SA 3VGCC 1FONA 1MBQA 3RXKA 2Y5GA 1DWCH 5GIBA 3SU2A 4NFEA 8GCHF 2ZIQH 3TU7H 4KTCA 1KTTB 3ZZAA 1UTKA 4KKDA 1TMUH 2XC4A 3V0XA 1FI8A 5A0AE 1EAXA 1O3CA 1HAVA 3A86A 2ZFRH 1FY8E 2BDAA 2A0QB 1DT2A 1CU1A 3W94A 1O5DH 2VGCC 1A46H 1BRAA 1A3EH 1EB2A 1AFQB 3EAJA 4A5TS 1Q31A 3ZVCA 1V2UT 1Y3YA 2PR3A 1F0RA 1MCTA 2HWLB 2XYAA 2BX4A 1DWDH 1GJ7B 5JB8S 1O5GH 2AFQB 4IS5A 2FEQH 2JH5D 1SLVB 1H8IH 2Z6BD 1MQ5A 3SJ8A 1ABJH 2VJ1A 2HRVA 4CRDA 1NRNH 2J9NA 2A7HA 1DOJA 1BRCE 4Q80A 2RA0A 3KN2A 3EA9A 1W3CA 4JZEH 2C8YB 4XBCA 1AD8H 3GCHB 2VIQA 1NU9A 1C5XB 2NU4E 3URCA 2ZCHP 2ZGCA 1EASA 1GHXH 1TWXB 4X2XA 1ZJDA 3M3TA 4I32A 5HMAA 1LHCH 2UWLA 1EP5A 3LONA 2Q6FA 1PPBH 1C1MA 2PW8H 2PHBA 3QO6A 4ISOA 1GCTB 3W95A 3A7VA 4NIWA 2BD9A 2A32A 2A4RA 1Z8JB 1A1RA 3E90B 4DJZB 4UFFH 1MTWA 2XC5A 1GBBA 1UHBA 1IQEA 2H9TH 2A5AA 5A0CA 1SG8B 3V13A 2A1DB 2PKSC 4X6PA 1MD8A 3AW1A 3BTFE 1YKTA 2Z7FE 4BAHB 3ATMA 3BSQA 1O2TA 2GCHF 4WJG2 1SHYA 1Q2WA 3ATKA 1G30B 3MU1A 1MAXA 1QRWA 4HGCA 3ZZBA 2Y5FA 1GL1A 1MZDA 1SGCA 3MU5A 1GI0A 2HLCA 2TGTA 5EOKA 2A45B 2DE8A 5DP3A 4GUXA 2G8TA 4FU9A 4FVDA 5ETXA 2BTCE 3T5FH 3O8BA 3UR9A 3U1IB 3HKIB 1C1PA 1GBFA 1ZHRA 1PJPA 1C2KA 1HDTH 2P59A 3E0NB 1TOCB 4KP0A 4ZXXH 4DIHH 1C1RA 5G4BA 1SQAA 4X8UH 5DKMA 1LVBA 2FOHA 4UE7H 1XM1A 1THSH 1O2YA 1IQKA 4MLFB 1NO9H 2BVSH 5C1UA 5LPRA 2Y7XA 4B2BA 4BXWA 3RXSA 1UMAH 1BBRK 2GZ9A 3KEEA 4U32A 4Y6DA 2YNAA 1BTUA 1OS8A 4AX9H 1O32A 2P16A 2G81E 1SGFG 4AGKA 4K60A 3K2UA 2CV3A 3KQCA 2FX4A 1S0QA 1Z8RA 3RMNH 5J4SA 1S6HA 3ZVBA 3ZVAA 2OC1A 1A7SA 4BNRA 3HK3B 5EODA 1P01A 4NWLA 1HRTH 3A7ZA 1CHOF 3ZYDA 2EI8A 1SGRE 1U6QA 5CHAC 2HALA 3PMBB 2AMPA 4Y8ZA 3MNCA 1GJ6A 4X8TH 1E34B 6GCHG 1CA8B 2ZHFH 1AFEH 3LKWA 2QXGA 1EB1H 1KLIH 1S85A 1EZXC 1NN6A 1Z71A 5FCRA 4E05H 3T28A 1O3BA 1EAWA 1VITF 2FMJA 1LQEA 1G3EA 4X8VH 2TPIZ 4ABJA 3RMLH 1D6WA 3RXJA 1PQ8A 1O0DH 2V35A 5CE1A 1J15A 4INLA 2GMTB 1E0FD 4Y71A 2GDEH 1XUKA 1H8DH 4AB9A 1EQ9A 1EOLA 3A82A 3BG8A 4E7RG 2WUBA 3M3VA 1NRPH 1LMWB 3PO1B 2XW9A 3F6UH 1N8OB 1MBMA 3ZZ6A 5F6MA 4JZFH 3O8DA 1KYNA 1GBEA 1TQ0B 2CN0H 1SSXA 3O8RA 1HJAC 1CE5A 1SL3A 2HPPH 3SJIA 3BF6H 5K7RA 1S83A 1YF4A 5ESTE 1Y3UA 5K0HA 4I8JA 5A09A 1O3NA 1AQ7A 1GBMA 2XBXA 3DUXH 1C5TA 1ELCA 2XWBI 3SORA 4MPUA 1FDPA 2ZECA 2FI5E 1EUFA 1FQ3A 4MQAA 3UNQA 4LXBH 1XUGA 1BCUH 1P9SA 4Y7AA 3VXFH 1W14U 3GCNA 1T4UH 4JZ1A 1QJ7B 1C2DA 1O3GA 1ZMJA 1E36B 1CGIE 5DP8A 1JRSA 3EE0B 3PWCA 1UJ1A 5FAHA 1AMHA 1CBWC 3QLPH 4DOQA 3KQEA 2PSYA 2BMGB 3I77A 2C8ZB 1JMOH 2GT8A 2Z3DA 4MTBA 3FAOA 2BD7A 1RD3B 3BTQE 1TABE 1UVTH 1BTHH 3BTME 1GBTA 1H9IE 2P3FH 3BIVH 3M5OA 1AUJA 3VGCB 3M36A 1QRXA 1WTHD 3ELAH 2C3SA 4CBOA 1P05A 2Y6TA 2B0FA 4JYTA 4AYVB 2CJIA 1KXAA 1AZ8A 2WPLS 2WYJA 2NU0E 1JWTA 2ZEBA 3ZV8A 5DO4H 1SB1H 4FXGH 1OP0A 2VVUA 3SI4H 3SNAA 1TIOA 1EP6A 1UTLM 3BTGE 3ESTA 2O8LA 1P12E 2WV4A 2UWOA 3VB7A 3UQVA 4Q7ZA 2VGCB 2F3CE 2XCFA 2A31A 1TPSA 3P95A 2TRMA 1GHVH 3TIUA 4B76A 1UTPA 2ZU2A 1K1NA 1BB0B 1DUEA 1TRMA 1OYQA 3K6YA 1CT4E 1S0RA 3SNEA 3M7UA 4M7GA 5AVDA 4Z0KA 4NWKA 1EXFA 3FP7E 1TPPA 1A61H 1PPZA 1V2RT 3P8GA 4MG3A 2F83A 3RXVA 2W26A 2F9OA 3LPRA 4TWWA 1BTXA 1ELBA 3BEIB 3BV9B 4WF8A 4X1QU 1QR3E 2LNCA 3A84A 4A6LA 4A1VA 4ABGA 4GPGA 2A5KA 1AY6H 1A0JA 1IQNA 4Y11E 1A5GH 4K8YA 2O8WA 5FHTA 1GBIA 1B0FA 1UK4A 4RN6A 1O3JA 5C3NA 2QA9E 1WUNH 3GDUA 4ZAEA 1IQMA 5E2OA 3RXDA 2SFAA 3A7XA 1DX5M 1H9LB 3A89A 3CENA 4OS6A 1G3CA 4CRAA 1YPEH 1P02A 1YLDA 2ALVA 4CBNA 1K9OE 4F49A 1SMFE 1KTSB 4YLUA 4DURA 5DP7A 2VIPA 2CF8H 2XBYA 3M7TA 1C5OH 3S9BA 1FNIA 4X1SU 3VB3A 4O3TA 1O2XA 1CVWH 1XKAC 2ZGJA 1MD7A 1C4V2 1QRZA 1SGNE 2FPZA 1LO6A 3E1XB 3MO3A 3V3MA 1DSTA 1PQAA 1P3EA 1ZJKA 3SW2B 3IITA 1Y3WA 1LCYA 1AB9C 1RFNA 8LPRA 1ZZZA 2CMYA 1UCYH 3ZVGA 1LVOA 1D3TB 1GJBB 2ZZUH 1TNHA 3U8RH 1QB9A 4GCHG 3K6ZA 1FIWA 2H5DA 1YYY1 3P8OA 1PPCE 3RXPA 2Z9IA 1OX1A 3D23A 3D49H 4X1RU 2J34A 3UFAA 1GHBG 3QZQA 1V2NT 2GZ8A 1GMHF 1NFWA 2ZQ1A 1PPEE 1HYLA 1SGTA 4JZDH 2GTBA 1TNJA 2Z9GA 2ANKH 1L1NA 4UFEH 1EPTA 1HFDA 1TPAE 2RG3A 2ZTXA 1AE5A 4ZROA 2VIOA 3VB6A 2BDYA 1ETRH 2OXSA 4LK4A 1NS3A 3OTJE 1V2ST 2VB0A 1DANH 3UNSA 1ZGIA 2V6NA 1QL9A 3IWMA 1B7XB 5C67A 5HM9A 3SGQE 2ZGBH 2AIQA 2QC2A 2VWOA 4CRCA 2BLWA 2FOGA 4RKOB 3RXUA 3BEFB 1W2KH 2ZDLA 1IOEA 3ENSB 1C2JA 1OWEA 2BHGA 3BG4C 1MTVA 1O5BB 5A2MH 1HAZB 3HKJB 4FUIA 2BDHA 1M9UA 2KAIB 2EC9H 2PTNA 1PYTD 4U01A 1TPOA 1NFXA 5ESBA 4H4FA 4AG2A 3T27A 1ESBA 4BXSA 4D8NA 1AWFH 1AZZA 1AWHB 1O2SA 1GMCG 2ZDKA 5EG4A 1XXFA 4BAOB 2ODQA 3MI4A 1P2NA 2Y82A 1O2LA 3AASA 5FPTA 4K1SA 1VZQH 1C2IA 2BLOA 1C1QA 4B75A 2HOBA 3SV2H 1P2QA 3TJNA 4CR9A 4SGAE 3SUGA 3T26A 1GVLA 1EJMA 2J94A 3M35A 3HATH 1DY9A 2P3UB 2VH6A 1GI1A 4ABEA 5LGOA 1O2WA 4ZKSU 1AN1E 1HAHH 1O30A 1NY22 1KDQA 2P93A 7GCHF 3P6ZB 3MH6A 1PYTC 2C8WB 4IGDA 1VGCC 3U9AH 5EPYA 1YPLH 4NCYA 2R2WU 2TBSA 1HUTH 1A0HB 1LTOA 2GGVB 3UY9A 1Y8TA 3LGYA 4Z6AH 3MNXA 5GCHG 3H7OA 4ISIH 1TRYA 3SO3A 1MTSA 5I25A 1CBWB 1B0EA 1GI3A 2FS8A 2SGFE 2ZDMA 2H6MA 3RU4D 1H9HE 5E2PA 2PUQH 4MDSA 4UFGH 1C5SA 1ELVA 2R0LA 1BITA 2NU1E 3L33A 1UVSH 3T2NA 4B2CA 3FP6E 2FOEA 2C8XB 3BIUH 2XCNA 4I33A 2FXRA 1O36A 1OKXA 2ANMH 1EJAA 1WTGH 2XBVA 4WH8A 2SNVA 3ATWA 1F5KU 4DW2U 3P92A 3C1KA 1DM4B 2OINA 3Q76A 1MKXH 1C5LH 4OGXA 3RXOA 1B5GH 1L4ZA 5TCCA 3N7OA 1PFXC 3MWIU 4FUHA 4E06H 1SFQB 4A1XA 6ESTA 1Z7KA 3GICB 1NM6A 1UTOA 1EATA 4IW4E 3BTDE 3TH4H 4UONA 1C4Y2 4JMYA 2ODPA 2HVXA 1IHSH 1WOFA 2OLGA 3GY4A 1O2VA 2JETC 4U2WA 1GJAB 1O3DA 1HAYB 4ZH8A 2ZFSA 1NPMA 1SBWA 1O2JA 1TE0A 3ODDA 5EPNA 3BTEE 2A7CA 1AVGH 1K1IA 3KCGH 1Y5AT 3KF2A 2GCTC 3BEUA 2K1QA 5DP9A 2R0KA 1QA0A 4R8TB 1BIOA 4J2YB 1C1WH 2J92A 1RTLA 1GPZA 2F9UA 1YPKH 4NA9H 4ZKOU 3P17H 1NESE 2Y80A 1GJ5H 1VJ9U 2AH4X 2ZFPH 4YOJA 3M7QA 5FPSA 1GI7B 1SLXB 1J14A 1LHDH 2OQUA 2P3TB 4XFQA 2BZ6H 5T6DA 1AKSB 1OYTH 4NZLA 5EQSA 1P2MA 1TONA 3T25A 2SGAA 5C5NA 1G2LA 1C9PA 3K65B 4WY3A 4Y76A 3FZZA 4O3UA 5GJ4B 3TJUA 8KME2 1GBLA 1TX7A 2LPRA 1MZAA 5L6NH 1Y59T 3EGKH 1GWAA 1GBAA 3PMAB 3V12A 2FYRA 5ABWA 1VCQA 1FN6A 2ZHEH 2A7JA 1F5LA 2PKAA 2ZTYA 4UD9H 1C5NH 1YC0A 4UEHH 2I6QA 2ZKSA 1QHRB 5L2ZH 2BY7X 1GMDG 5C20A 1UVPA 2WUCA 4B71A 5EW1H 3Q3KA 3SUEA 1GG6B 1P8VC 4MPXA 1Z1JA 1EJNA 1IQHA 1HB0B 1V2KT 2SGEE 2G5VA 4MNVA 4CHAB 4GSOA 2GDDA 3SV8A 4H6TA 1ESTA 1OPHB 5F03A 1W12U 2AMQA 1ELGA 5CMXH 4YTAA 1ZHPA 1XVOA 3RLYH 2QYIA 3L3TA 2TGAA 5TCAA 4ISHH 2STAE 5I46H 1UTMA 3PROA 1ZRKA 1O3OA 5SGAE 5F8XA 1LPZB 1GHZA 5C1XA 2C4FH 4LZ4B 3D65E 2QGRA 5BPEA 1J16A 1MMJN 3UQOA 1GI2A 4X1PU 2C93B 3UWJH 5JDUB 4FU7A 2OC8A 2PLXA 1FZZA 3B23B 1EKBB 1SGEE 2QXHA 5TJXA 2GCHG 5JYIA 4JYUH 3H7TA 1GDNA 1EAIA 3BN9A 4NG9H 3DHKH 3LH1A 3RXMA 2ZU3A 3PLKA 2D8WA 2ZHWH 3M61U 1VCWA 4ZHLU 1THRH 7LPRA 2FLBH 3GCTF 5EXNA 1D3QB 1IAUA 2VVVA 2ZPQA 4WWYA 6LPRA 1TMBH 2H9EH 1VR1H 2XC0A 4MNWA 2BD8A 2XRCA 1FXYA 3GY7A 3A83A 1N1LA 1K1JA 1CGJE 2GP9B 3M5LA 1ESAA 2VH0A 4A7IB 4NGAH 5FX6A 3TPIZ 6GCHF 2P8OB 3MO6A 1O3IA 1BBRH 1PQ5A 4I8HA 2FOMB 5F8ZA 1GJ9B 1O2ZA 4PROA 1TRNA 1TGSZ 1HIAB 4DG4A 1BOQA 1TBZH 1UVOA 4X2VA 1K1MA 2HNTF 3E6PH 2PWXA 2BM2A 4K8BA 2VU8E 5GWZA 1YCPH 2EA3A 1ANEA 1XMNB 1CQQA 2ZGHA 3PWBA 3K9XB 4NIVA 3M3SA 1GHAF 2QAAA 2WPMS 1WBGB 3GY3A 5DP6A 1G32B 1CHOG 1OP2A 1JRTA 1H1BA 5C1YA 4OS4A 3RC5A 1DXWA 2ODYB 2D2DA 1ZGVA 1AVWA 1GVZA 1W7GH 3LJOA 2R9PA 2WPJS 3SN8A 1WYKA 2VIWA 5DPAA 2ZPRA 1VITG 3SNBA 4WMEA 3GY5A 1C1NA 2F91A 1OWKA 2ULLA 3SBKA 1F7ZA 2Z3CA 1CT2E 5A8XA 4QT8C 5EU8A 4BTUB 3SV9A 3U69H 1FY5A 3L6PA 1D3DB 1K28D 2QV1A 1QL7A 3EQ0H 2BY8X 4Y79A 5LH8A 4ABHA 5E0GA 1BTPA 4DVAU 7KMEH 3Q77