4AGKA

Crystal structure of capsid protein (110-267) from aura virus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
152
structure length
152
Chain Sequence
DRTFAVKNEDGKIMGYAVAMEGKVIKPLHVKGTIDHPALAKLKFTKSSSYDMEFAKLPTEMKSDAFGYTTEHPEGFYNWHHGAVQFSGGRFTIPTGAGGPGDSGRPILDNSGKVVAIVLGGANEGARTALSVVTWNKKGAAIKTTHEDTVEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CAPSID PROTEIN
publication title Crystal Structure of Aura Virus Capsid Protease and its Complex with Dioxane: New Insights Into Capsid-Glycoprotein Molecular Contacts
pubmed doi rcsb
source organism Aura virus
total genus 35
structure length 152
sequence length 152
ec nomenclature ec 3.4.21.90: Togavirin.
pdb deposition date 2012-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4agkA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4agkA01
1PPEE 1VR1H 3SU1A 1SGYE 2C8XB 2BDYA 3V3MA 5C3NA 2GMTC 2THFB 2QXIA 1GBMA 3RU4T 1GJ7B 3GY3A 3GY5A 1O5CB 2A2XH 3SU0A 1GJ8B 2FTMA 2PWXA 1FJSA 3RXVA 4ASHA 1XXDA 2FX6A 2QXGA 1EPTC 3RLYH 3FAOA 1TA2A 1C2FA 4ZUHA 3QLPH 4I33A 1IQHA 2Z3DA 1C2JA 1P2JA 3SUEA 1GI4A 3RXQA 3RXDA 1RIWB 3IITA 3SV8A 1G30B 4IGDA 2J4IA 2R3UA 1BMNH 3BG8A 3HGNA 2PSYA 1INCA 3UNQA 4VGCC 1VITG 1WSSH 2RA3A 3T26A 1C1QA 1BRCE 3NWUA 3OYPA 2EI7A 3GISB 1KDQA 4ZHMU 1QL7A 1W11U 1H8IH 3Q3YA 4BAOB 6ESTA 2ZGHA 2LNCA 3BTDE 3U69H 2ZDMA 2G5VA 1QCPA 1ZSLA 1C4U2 2TGTA 1K2I1 5E8EH 3BG4B 1ARCA 2A31A 3I29A 2AGGX 3SORA 1ZR0A 4Y79A 4MNWA 4CH2B 2H9TH 1HXEH 1MTVA 1NFYA 1N6YA 3UWIA 1T31A 1JOUB 3BIVH 2TIOA 1XUKA 2BXUH 2ALPA 3U8TH 3LJJA 3OTJE 1KXDA 2RA0A 3BTHE 4WH6A 2FLRH 1MU6B 5I46H 3AAVA 2Y81A 1OWEA 4FU9A 4MNYA 6GCHF 1P2NA 2Z7FE 5TCCA 3U1IB 1PFXC 1O5AB 5LH8A 2ZEBA 1O3NA 1TA6A 1Z8GA 3UQOA 2FS9A 3MH6A 3TK5A 1THPB 5LPFA 3SUDA 4FU7A 3A80A 1QY6A 1JXPA 2J94A 3OU0A 4NZLA 3SJ8A 4GCHG 4CH8B 5GCHG 1NFXA 1KLIH 4A1XA 2O8LA 2GDEH 4MTBA 1H1BA 1D6RA 3B23B 3RXMA 1ZGIA 3EAJA 1MQ6A 4Y0ZE 2HPPH 5HM2A 5A2MH 5A09A 1GCDA 2BQWB 2STAE 1DLEA 1UK4A 2P93A 3SO3A 5EOKA 3ATWA 4I31A 7ESTE 1NFWA 1O2KA 1SSXA 1L4DA 2BY9X 2EA3A 4BNRA 2JH0D 2ZKSA 3S7KB 1K9OE 1ZTLA 1IQGA 3SU3A 1LDTT 2AIQA 3MU1A 2ZDKA 3DA9B 4JZDH 5SGAE 2XW9A 1T8LA 2QGRA 5DP3A 4ZAEA 3SGAE 3A7VA 1O3MA 1T8MA 1F92A 4D7FA 1Q3XA 3RXFA 3RXHA 4ZKNU 1AFQC 3TLOA 5BRRE 1UMAH 2V3OH 1HAHH 4NIWA 1O3IA 5CE1A 1HXFH 2G4UA 2G81E 3P6ZB 1GBLA 2GCTC 1UVSH 1HJAB 1BRAA 1YCPH 2RDLA 3A89A 1ELEE 1T8OA 1D3QB 2RG3A 2YNAA 1DWDH 1MD8A 2ZC9H 5C5OA 4B1TA 3FP6E 1DWBH 2FOGA 1PPBH 1A3EH 1C5NH 2AMQA 3TJOA 1TRNA 2FOAA 3VB4A 4BAHB 3BEFB 2Y5GA 3T25A 1J15A 3MFJA 3FZDA 4TY6A 1FY8E 5ESTE 3ESTA 1ZMJA 3KQCA 5FX6A 4U30A 5K0HA 2FTLE 4X1SU 3C1KA 3O8BA 2PKSB 3SGBE 2AERH 2VGCB 1LHEH 1TGTA 1THSH 1O3HA 5DKMA 3MOCA 2ZWLH 1F5KU 1O36A 1YM0A 4FUHA 4LZ1H 1P12E 1SOTA 2P3UB 2ZQ2A 2OD3B 4IS5A 4GHQA 1ABIH 1AU8A 4UFGH 1J14A 1W8BH 1RTFB 1SLWB 4K3JA 1ESAA 4YTAA 1JMOH 4UFEH 3RMOH 1UJ1A 1SGTA 3SNAA 3ZVBA 3RXPA 1ELGA 4IMZA 3ZVCA 4IMQA 3MTYA 3SQHE 3UFAA 1GI6A 8KME2 1HJ8A 2GV6A 3NUMA 2UUFB 1KXFA 2BD3A 1BJUA 4INLA 4FUFA 3U8RH 1HAXB 2BLQA 2FOCA 3GCNA 1Z6EA 4AYVB 1K1LA 4ABBA 1UK2A 2AEIH 4BTIB 1L0ZA 1GDUA 5C1UA 3SJIA 3D49H 1MTUA 1S81A 4NIYA 2IPHA 2CMYA 9ESTA 1YPJH 1FN6A 2P8OC 1LMWB 3RXBA 3ZZCA 1QRZA 3F9HA 1KSNA 4IC6A 4JMYA 4YOGA 1TFXA 3S69A 7LPRA 3MNCA 2BZ6H 1VITH 2R0KA 1C2MA 3GDSA 1Z6JH 2QCYA 3SHAH 1B0FA 4FUCA 3C27B 2VIPA 1YBWA 2BX3A 1MQ5A 2R9PA 3HATH 3SN8A 4OGYA 3RU4E 1C5PA 2FLBH 2FYRA 4X8VH 1BA8B 3ATIA 1CHOF 2F9BH 1ACBE 2ZFQH 4TWWA 4IN2A 2F9PA 1IQNA 1GVKB 1F5LA 5HM9A 1W10U 1O2YA 1BHXB 1ANDA 1CA0B 1TRYA 1L1NA 4WMDA 3EDXB 1OYTH 1QBVH 3P70B 5AFYH 3GCTG 5GDSH 5DO4H 1S0QA 3RUOA 2GT8A 4I32A 4RN6A 3E90B 1O5FH 1ELBA 1W7GH 5EXNA 5AVDA 3TGKE 4WVPE 1TGCA 1WQSA 4WMFA 4K69A 3QTVH 1PPFE 3VB6A 2BB4A 3V12A 4AORA 2ZZUH 3LGTA 1ZPBA 3M5LA 1DS2E 1GHBG 2D26C 1FV9A 2Y7XA 3VGCB 1G32B 1W0YH 1BMMH 5LGOA 1XUFA 3DFJA 4M7GA 2OC1A 1A0JA 1MH0A 2ANMH 3UY9A 2FS8A 1GGDC 1Z8RA 4A1VA 2Z9KA 5EG4A 2J2UA 2PSXA 2R2MB 4A7IB 3BV9B 1KTSB 1ZZZA 1PPHE 2C8ZB 1Y3XA 1FLEE 1C1WH 1EZUC 1GMCG 2SFAA 1MTWA 2NU3E 4O9VA 1LHCH 1K1PA 1Y5BT 1GG6B 3ODDA 1CT4E 5CHAB 1AN1E 1SGQE 2A5IA 1P2MA 4O03A 5A0BA 5FPTA 5EW2H 3MHWU 1TYNA 1SGEE 2IOTA 1EASA 4DIIH 4CHAB 2B9LA 5AFZH 2A7JA 3DHKH 3RMLH 2ZA5A 3BEUA 3M61U 4NA9H 4K1SA 2OQ5A 2OXSA 4X6NA 3O8CA 4JYTA 1HDTH 4MPVA 2O8UA 2OC7A 1W14U 2OBOA 1YF4A 3SNBA 1BTYA 3GCOA 1GBKA 1LVBA 4LOYH 2OBQA 1DVAH 3STJA 2BD9A 1BOQA 1O5EH 3UUZA 1O2MA 1AZ8A 1GDNA 3NZIA 2BQ7B 3GY2A 4CRCA 1P2IA 2VB0A 1SFIA 1XUJA 4NSYA 2FWWA 1QB1A 2Z9JA 4F49A 1HNEE 3ZZ9A 2ODQA 1UHBA 2ZDNA 2NU2E 1SGIB 2A7CA 1MMJN 1TQ7B 3SOSA 5FBEA 4YOIA 2ULLA 2BLOA 1S85A 1NRQH 2W7SA 4ABFA 1QBOA 3TITA 1T8NA 3RC4A 4DGJA 1FY3A 2H5DA 4FUIA 3P8NA 2XBXA 3SJKA 2V3HH 1PJPA 1P10A 2F3CE 1WCZA 2BDIA 4R0IA 5T6FA 4INKA 4K8YA 1H9LB 1Y8TA 8ESTE 1NFUA 3TJVA 1BIOA 1GPZA 4THNH 1HUTH 1PQ7A 4BTTB 1QQ4A 1SGDE 1H9IE 1SMFE 2XC5A 1XM1A 1HPGA 1GI7B 1P01A 2PKAB 4JYVH 1P9SA 4ISIH 1B7XB 1ORFA 4YZUA 3SJOA 8GCHF 1EZSC 3UWJH 1TGSZ 4DCDA 4D8NA 1YKTA 1FQ3A 2H5CA 1FUJA 2C3SA 2ZPRA 1GHVH 1ZMNA 2GCHF 1ZYOA 4Y10E 4B2CA 1S5SA 1IQMA 1HV7A 2ZO3H 2VWMA 3PO1B 1A4WH 1TBRH 1DWEH 1EB2A 2A4GA 1DLKB 4KTSA 1XUHA 4XBCA 1EX3A 2ZQ1A 1FPHH 1RJXB 1J17T 2G5NA 4FU8A 2GTBA 3WY8A 5FHTA 1C5VA 3RP2A 2QF0A 1AIXH 3BG4C 4YT6H 5A8ZA 4NWLA 1FPCH 3DFLA 1CBWB 4YOJA 1BZXE 3QUMP 2DE8A 3PLKA 5E0HA 1SLVB 1GJBB 3TNSA 1J8AA 1RD3B 2D8WA 1JIRA 5BPEA 1Z8IB 1SI5H 1VCPA 3GICB 1ARBA 1TGBA 1C5LH 2BDAA 3HKJB 1TPOA 1C5YB 3KL6A 1XMNB 1IQFA 1HAVB 1SBWA 2FDAA 1TNLA 2Q6DA 4HFPB 5EPYA 4I8JA 1QL9A 1EOJA 1ETSH 1ZHMA 2HNTE 3GDUA 6GCHG 1P06A 4ISLA 1Y59T 2VH6A 1TX7A 1O2ZA 4MDSA 1WUNH 1ZHPA 1DX5M 5C2ZA 5IYTA 5E0GA 2XCNA 1P04A 3T62A 1J9CH 2B0FA 4ESTE 3M37A 1AB9B 2F9VA 1ZGVA 7KMEH 2WV5A 1IQJA 1YPKH 1C4Y2 2ZU1A 6CHAC 1BTPA 4KP0A 2ZDLA 5F6MA 1LTOA 4U32A 1O3EA 4DJZB 4JZIA 3AW1A 2VIQA 4J1YA 3G01A 4ZHAA 1GJ4H 1K1MA 1SQAA 3M7QA 2FOHA 4UFFH 4ABIA 2F9NA 2FESH 2UWPA 2BD7A 2GT7A 1GJDB 1DY9A 1QRWA 3CP7A 1YPHC 3TPIZ 3SU4A 3MH5A 1BHXF 3FFGA 3RU4D 4D7GA 3Q77A 4UFDH 1O0DH 1K1IA 1MKXK 5DP4A 3ZZAA 3PMJA 1TBZH 2QN5T 3I77A 2JH5D 2B7DH 2AMPA 2ESTE 4AOQA 1O3BA 4Q7ZA 1G2LA 2O8MA 3SV6A 2VU8E 1MBQA 3VPKA 3EYDA 1S0RA 4AN7A 3RXCA 3LGWA 1HAYB 2XRCA 3A86A 1Y5UT 4FUJA 2WV4A 3SU6A 1VGCB 3ZZ7A 1GBDA 3SV7A 1G3CA 4CR5A 1P03A 4RKOB 1OWJA 1DWCH 5L6NH 1C5RA 1LKBA 3SI4H 2AMDA 3K6ZA 1O2RA 1ZOMA 3EA7A 4X6OA 1HBTH 4HGCA 5JBAS 3A7YA 2V35A 2WPIS 3BTFE 2XCFA 1ZLRA 3T28A 3VEQB 4ABGA 2GP9B 5DJ7A 1NPMA 1XVMA 2BXTH 1O2SA 2OP9A 1AHTH 3MU5A 4BOHA 2ZHEH 2UWLA 3T2NA 4WJG2 3LIWA 1PQAA 4Q80A 1GMDF 4NFEA 2BD4A 4XE4A 1YPGH 4ZKSU 1OWDA 1EJNA 1KIGH 2PGBB 4FXGH 3V7TA 3TU7H 1GCTB 3UOPA 1C4V2 1WBGB 1OWIA 2FIRH 4XFQA 4ZHLU 2H6MA 1W0ZU 2ILNA 3GCHC 1T4VH 3ATMA 3A84A 3JZ2B 2W7UA 1TNHA 1PPCE 3K2UA 4MG3A 1EAUA 1V2QT 1GL1A 3E6PH 2F91A 1CGHA 3TIUA 4Y8YA 1LPGB 4E7NA 1V2PT 2BD8A 2TPIZ 2B8OH 4E7RG 4Q2KA 5JBTA 2ZFFH 1UVPA 3ODFA 1C2LA 1MKWK 4A92A 3HPTB 1CVWH 2C93B 1MTNC 3FP7E 3ZV9A 1RXPA 1D9IA 2ZCHP 3RXTA 1BB0B 1RTKA 4JCNA 5EQQA 3GY7A 1X7AC 1V2JT 1C1MA 1DE7H 3MO3A 2BQ6B 3RXAA 1P8VC 2YNBA 4Y6DA 5GJ4B 4I8HA 1GI5A 3EGKH 5K7RA 2PFEA 4AFQA 1V2WT 3TJUA 1O3LA 2OC0A 3M7UA 2ZFTA 2WUBA 4NGAH 1O2IA 1AI8H 3RXLA 4AZ2B 4IC5A 2GMTB 1MZDA 2GVFA 1TQ0B 1P11E 2NU0E 2V6NA 4XOJA 1AD8H 2OCVB 3K65B 4UEHH 1PPZA 2CXVA 2W5EA 4ZXXH 3TGIE 3BTWE 5E0JA 3QO6A 3K6YA 1XKBC 5DP8A 2VIDA 1EXFA 2SGAA 2FOMB 4X2WA 1ESBA 5GIBA 1F0SA 1RRKA 4J2YB 1EPTB 1YLCA 3GY6A 1GBJA 2A32A 4CREA 4ZKOU 1KLTA 1E36B 2WINI 2P59A 5DPAA 1C1TA 4NIXA 4K60A 1O32A 1C5SA 1C9TA 2C4FH 2QY0B 4I8KA 1CHOG 2QF3A 2SGFE 4X8SH 1CA0C 3BTGE 1NRNH 1BCUH 1WU1A 4QT8C 4VGCB 2A0QB 1HAGE 3W95A 1SR5C 1OYQA 2ZGBH 1GJ6A 1NRPH 1ETRH 1A46H 3L6PA 1RTLA 2ZU5A 3KQBA 3GYLB 1YCPM 4H6TA 2BY6X 3MU4A 1NZQH 4Y7BA 1BT7A 1FIZA 4K1EA 3BTME 3ZZ6A 1W13U 4CRDA 1MTSA 1O2XA 1D3DB 5F8TA 1NM6A 1XVOA 3A82A 1TRMA 1P0SH 3S9AA 3O8RA 3T29A 1TONA 5AHGH 1CGJE 2SGQE 2JKHA 2DUCA 4H42U 1GHWH 1P2OA 1DUEA 4DT7B 1GBIA 1WOFA 1O3FA 3A7WA 1WTHD 1UVTH 1F5RA 2EI8A 4X1QU 1AVWA 2W3IA 2OLGA 2G52A 4NG9H 2WYGA 3TGJE 3DD2H 1CT2E 4I8LA 1KXCA 2HNTF 3ELAH 2VIOA 1SGFG 4NCYA 3GY8A 4IW4E 5L30H 3CS0A 3M3VA 4MPUA 1IQIA 5DP7A 1O3DA 3SBKA 1OWHA 3SZNA 5ABWA 3ZZ8A 2WUCA 3LH3A 3RXJA 1A7SA 2GX4A 4K2YA 1HRTH 4E06H 3F1SB 2JETB 4XDEA 4JZEH 3NPSA 3LJOA 2PGQB 5F8XA 1TNJA 1C1RA 1DDJA 3LKWA 1LPKB 3SV9A 3F9EA 4HTCH 1N8OC 2IJOB 2ANKH 1VCQA 3TVJB 1MAYA 1GJ9B 2LPRA 2OINA 3M7TA 3MI4A 1T32A 4JK5A 1QURH 3VFEA 1ANCA 1EAXA 1HAZB 5EODA 1C2HA 2EC9H 1Y3VA 1T4UH 1EZQA 1UTLM 1O2VA 2KAIB 1OX1A 1EATA 3B8JA 4ZROA 2Y80A 3RLWH 1VCWA 2VIWA 2C8YB 4MQAA 1MZAA 1ID5H 1LHDH 2ZDAH 1UK3A 1A2CH 3URCA 1K1NA 1LKAA 1K1OA 2ZGXH 1V2OT 3PLBA 3BTTE 1GWAA 1AVGH 4X2XA 3ZVGA 3ZZ4A 1CHGA 3ZV8A 4WF8A 1SOZA 3SNDA 4ABHA 1OWKA 1PQ8A 2O9QA 1EJAA 1B0EA 1QRXA 4X2VA 1QFKH 2O8TA 3UREA 5C20A 3U1JB 3TNTA 1G9IE 3Q00A 2BD5A 1GHAF 1FIWA 1MD7A 2CF9H 1XXFA 1AKSB 2G4TA 3E3TA 2HALA 1JBUH 1UCYK 3KNXA 1GJCB 1K22H 3L33A 1BBRK 1O2WA 3TH3H 1O2NA 2J92A 3N7OA 1C2DA 1DY8A 2TGPZ 4LZ4B 1O5DH 2SNWA 2A5KA 1HCGA 2FMJA 1AFQB 2Y6TA 3OX7U 8GCHG 1GHXH 4WXIA 1SGFA 4B2AA 2ZFRH 3UR9A 1YYY1 3RXSA 1C2KA 1YLDA 1E37B 3PTNA 3E0PB 3LC3A 4K1TA 1ETTH 2GCHG 3VB7A 2GCTB 4FUBA 1AZZA 1FDPA 1L1JA 1QBNA 5T6GA 2Y5FA 2FXRA 1BMAA 3FZZA 4ABJA 2FPZA 2W26A 3MH7A 1S84A 1SGPE 3SU2A 2BTCE 3PV4A 2WPKS 1FXYA 3PWBA 1DANH 2GD4B 4CBOA 2FODA 1ZSKA 4B75A 2OQUA 4ABDA 1K1JA 1EKBB 3LOXA 3MNBA 3RXIA 2PUQH 4X1PU 4JZFH 2UUKB 1P05A 2GZ9A 3SNCA 1D4PB 1GHZA 1V2KT 5T3HA 6LPRA 2BOHB 3A8AA 4BTUB 3ENSB 1C5XB 5EGMA 1ELTA 3UR6A 2XYAA 2NWNA 2AS9A 1QIXB 4O97A 3V13A 3RXOA 1IQLA 3S9BA 1OP2A 4UE7H 4KELA 4Z6AH 1FN8A 2H9EH 1WAYB 1KDQB 1TOCB 2UUYA 1KYNA 2PHBA 1UVOA 2BY7X 2G55A 3M5OA 1ZHRA 1UO6A 2HNTC 3QTOH 1ZJDA 3D65E 3M3SA 1DSTA 2GV7A 1TNIA 2FOEA 1MAXA 1WTGH 1O5GH 3E16B 3PMBB 4CRFA 2Q6GA 4F4OC 1ZPZA 4NWKA 1C5UA 5ETXA 1AB9C 4Y7AA 4NIVA 1FY4A 1IHTH 3IWMA 4ABAA 4ABEA 3M5NA 2P8OB 1EP6A 1L2EA 2P16A 1AQ7A 1DXPA 1F0RA 5L2YH 1TMTH 2WYJA 2OTVA 1O3OA 1ELAA 4CRBA 2ZHDA 2STBE 2ZU3A 1A5HA 1ZRKA 5C1YA 2FI4E 1H9HE 2UWOA 1HAOH 5HGGA 1O2HA 1C2GA 1OKXA 4GHTA 1ZTKA 1PPGE 1RIWC 1BJVA 1Z71A 4X0WU 3KQDA 1Y5AT 4OS2A 1E38B 2EEKA 2CV3A 1G37A 1Z1JA 2SGPE 2WPHS 1P2QA 1LVMA 3MO6A 4YESB 3KGPA 5A0CA 1GMHF 1G3DA 2VINA 1BTWA 3E91A 4ZKRU 1GBFA 1VGCC 4RKJB 5FPYA 3ZVAA 3ZVDA 1BQYA 2IN2A 2BVRH 3A87A 2P94A 3EE0B 1DITH 2AIPA 5FXLA 3OY6U 1E0FD 3RMMH 4B73A 3MH4A 1JRSA 2BOKA 2ODPA 4NSVA 3ATLA 5T6DA 4GPGA 3T27A 4AG2A 1TPAE 3MU8A 1BMLA 3RXRA 2VH0A 1HIAA 1G3BA 2AYWA 2TGDA 1C5WB 1ZJKA 4CR9A 7GCHF 4B76A 1IQEA 2ZECA 3AW0A 4FUDA 3BSQA 4D76A 1GBTA 1GGDB 2ANYA 1QJ7B 4K5ZA 2GZ7A 2M5TA 4PROA 2PW8H 1C5MD 1AFEH 3QDZB 1GMDG 1Q2WA 3P8GA 3L3TA 1TGNA 2ZP0H 1SL3A 5PTPA 2R3YA 4YM9A 4MNXA 1XUIA 3ZZ5A 4GSOA 3KIDU 3AASA 2WPLS 5DP6A 3NXPA 1JWTA 1MCVA 5LPEA 1JIMA 1SQTA 1BUIA 2H2ZA 2Z3EA 3BTEE 1TIOA 2HOBA 3LONA 4AFUA 2I6SA 5J4QA 1UTPA 3PWCA 1C5QA 3LT3A 1GVLA 1O3KA 1TX8A 4NZQA 4X2YA 4HI3A 1MU8B 1C9PA 3EA9A 3M35A 1BDAA 5HXFA 1EZXC 4AYYB 1F0UA 4SGAE 2ZNKH 1A0LA 4GLYA 5B6OA 1O37A 4GVUA 1PYTD 3PYHA 2ZPQA 5C5NA 1V2ST 4Y0YE 1S82A 2A4OA 2BYAX 2BDCA 1UTOA 2ZHQH 4MLFB 2Z3CA 1RFNA 2ZPSA 3DT0H 1QQUA 1O2LA 3NCLA 5EQRA 3E0NB 2ZFPH 3BTQE 2H9HA 2QIQA 3M36A 4U2WA 2FO9A 1TPSA 2F9UA 4TY7A 1QB6A 1O31A 1THRH 1H4WA 2A2QH 2G00A 3GYMA 4B74A 2ZIQH 4DURA 2GKVE 1P3CA 2VWOA 4KKDA 3Q3XA 1TALA 3JZ1B 4AFZA 4OS5A 4DVAU 2FOBA 3SNEA 4OS6A 3NKKA 3OSYA 1HGTH 1SG8B 1TLDA 1LCYA 2QXJA 1QR3E 1UCYE 2FI3E 1BITA 1LO6A 1BBRE 1AUTC 2HPQH 1DICA 3PLPA 4SGBE 4KTCA 2BDHA 5TCAA 3SUFA 1L1GA 2BLWA 1SLUB 3A8CA 3QGJA 2Y7ZA 1GBHA 1V3XA 2D2DA 2ZTYA 3Q76A 5FAHA 3KCGH 4OGXA 4ZMAH 3MMGA 1CQQA 1HJAC 1OXGA 1VZQH 3NK8A 2FOFA 3RXKA 1GJAB 3SU5A 2I6QA 1GI2A 3SHCH 4CBNA 1EQ9A 1WYKA 3PTBA 3GOVB 4WH8A 1HFDA 1QA0A 4NA8A 2FM2A 2VNTA 4Y71A 1QHRB 1P57B 4O3UA 1AWFH 1P3EA 4FUEA 1O35A 1NRRH 2CHAB 2BHGA 1D3TB 1C1VH 1XUGA 3QK1A 3MYWA 1Z1IA 3VB5A 2ZGJA 1YCPK 1HYLA 5L2ZH 5G4BA 2PKSC 3A88A 1CO7E 1QL8A 2VGCC 3HGPA 2BY8X 1MUEB 2XBVA 2F83A 4I8GA 1DM4B 1VJAU 1NU7B 3UNSA 3PM3A 1Y3UA 1TOMH 3LPRA 1TBQH 2D1JA 2J95A 2OUAA 4ISHH 3K9XB 4O3TA 1YP9A 1HJ9A 1UVUH 4FVDA 1W12U 1C5OH 4BAKB 2XC0A 1EOLA 3LGYA 4NA7A 1GDQA 1UTJA 1NN6A 2JETC 2PKAA 3UIRA 1BTZA 1GI0A 1GJ5H 1Z8JB 1O2OA 2BZAA 1A5GH 3BN9A 1ZTJA 1Q31A 2GDDA 4KTUA 1O5BB 1UTNA 3A81A 4MPXA 1FI8A 2PTCE 4FUGA 1ELCA 3GY4A 1BRUP 1ANBA 3W94A 1MKXH 1EJMA 5E2OA 5TJXA 1N6XA 2HGTH 2Z94A 6CHAB 4DIHH 4MVNA 2ALVA 8LPRA 2GGVB 2A7HA 3URDA 2K1QA 1LVYA 1U6QA 1GBBA 2SGDE 1B5GH 1GVZA 1BRBE 1O38A 1TABE 1RS0A 4TPYA 3RM0H 1YPHE 5HYOA 2AH4X 3LGUA 1AWHB 3TJNA 4JZ1A 1PYTC 2CN0H 1DPOA 5EXLA 3RC6A 3P17H 1QJ1B 2ZCKP 1GBAA 2BDGA 1V2RT 4NFFA 3MU0A 2Q1JA 1TNGA 3VXFH 1OOKB 2QXHA 5I25A 3M5MA 2VVVA 4YLQH 1DSUA 1LQDB 1TMBH 1VITF 3F9GA 3LDXH 5EQSA 3ZZDA 2A45B 1IAUA 1HLTH 3H7OA 2A4RA 5E2PA 1SVPA 1PQ5A 5JBCS 1NTPA 4X6MA 3M3TA 5HMAA 4LXBH 1O2TA 1HAVA 5AF9H 4X1NU 1GHAG 3RXGA 4AGJA 1C5TA 1SFQB 4TYDA 5DG6A 4BXWA 2WPJS 3RDZA 2P95A 2BX4A 4H6SB 1UHBB 1A3BH 1YPMH 2ZTXA 5LPRA 3VXEH 1O2UA 4D9RA 3VGCC 1EAIA 3ZZ3A 2HWLB 3E1XB 1O3GA 1KY9A 2EI6A 1BTHH 4YO9A 5A0AE 1D6WA 1SGCA 3KQEA 3TH2H 2SNVA 1GI1A 3EA8A 2JH6D 2XC4A 1JRTA 2QAAA 3H7TA 2FI5E 3KF2A 2R0LA 1P2KA 3U9AH 1D3PB 1QGFA 3ZYEA 1A61H 1CSOE 4UDWH 2WPMS 4Y8ZA 5A8YA 1G3EA 2C8WB 2ZU4A 5FCRA 9LPRA 1DXWA 1GG6C 5CHAC 2Y5HA 3PMAB 2QC2A 5DGJA 1RGQA 1O3PB 1MKWH 1A5IA 1GI8B 2Z9GA 2BLVA 4IN1A 1TX6A 1NU9A 3GCHB 1KLJH 1DT2A 3BF6H 2DE9A 2TRMA 3GDVA 4CHAC 1XX9A 4Q7XA 4Y8XA 1N1LA 5C1XA 1HAIH 1OS8A 1KTTB 1E35B 1J16A 4E05H 2G8TA 1UTKA 2VJ1A 1NROH 1EUFA 4A5TS 1C1UH 1AO5A 1GBCA 4H4FA 1O2JA 4GCHF 1O30A 1KXEA 1V2UT 5GCHF 4WXVA 2A5AA 2Q6FA 2ZDVH 3MNSA 1A1RA 4JK6A 1MTNB 2CF8H 2HLCA 2NU1E 3EQ0H 4KGAA 3QX5H 4Y76A 2Z9LA 3CS7A 3U98H 1QB9A 5JB8S 3MNXA 1ELFA 1G2MA 4I7YH 1SLXB 1T7CA 4X1RU 1C1OA 1M9UA 4OS7A 1SGRE 2ASUB 1IQKA 1P9UA 2J9NA 1HIAB 1GHYH 1QTFA 4A1TA 5EPNA 1GBEA 1OSSA 1W7XH 3D23A 1GI3A 1KXBA 1NT1A 1A0HB 3A7TA 3R0FA 2A1DB 1ZRBA 4B71A 1GI9B 2J38A 5F03A 1Z7KA 1CGIE 2TGAA 3OY5U 3T5FH 3SUGA 1FONA 1O3AA 3QGNB 2Y82A 1BTXA 1VJ9U 1YC0A 3A83A 1TE0A 3R3GB 1W3CA 2QA9E 1QA7A 4B2BA 1NY22 4X6PA 1FAXA 1AMHA 1SHHB 2GZ8A 3PMHB 1O3JA 3D62A 3LC5A 3ITIA 1L4ZA 4BAQB 2V0BA 3AAUA 2G51A 4GAWA 4Z0KA 1C1PA 3LH1A 3FANA 1O2GH 1TPPA 1QJ6B 5CMXH 2FEQH 2BVSH 1NO9H 3PO1C 2W3KA 1GMHG 4WY3A 2NU4E 2ZG0H 1K28D 1TNKA 5JYIA 2ZCLP 2PR3A 5H4IB 3RM2H 2CJIA 3KEEA 1DFPA 3SQEE 3UQVA 1NRSH 2YOLA 1W2KH 4AGKA 1TB6H 2QV1A 1OP8A 1SQOA 3F6UH 2BM2A 3F9FA 3IG6B 4AG1A 3ATKA 3FP8E 3V0XA 1H8DH 1FNIA 1BTUA 1CBWC 3ZYDA 1AGJA 1LHGH 4U01A 2HVXA 3HKIB 5FX5A 1ESTA 7GCHG 5ESBA 3UNRA 2QYIA 3I78A 4K8BA 1AVXA 5J4SA 1WQVH 1OPHB 4TWYA 1EB1H 1LVOA 1DUAA 1FY5A 2XWBI 1TAWA 2FP7B 1ZSJA 1UTQA 2BMGB 2VWNA 2XBYA 3SW2B 4DOQA 1S6HA 1SB1H 5JBBS 1V2LT 3AVZA 3TK9A 3UOUA 1YGCH 3LGIA 3P8FA 1GL0E 3UTUH 1EPTA 2HRVA 1Y3YA 1LHFH 1C2IA 1SGNE 3A7XA 3HK3B 5FCKA 2ZU2A 2ZF0H 2Z9IA 4LK4A 3DUXH 4CRAA 3A7ZA 1MCTA 2R2WU 1Y3WA 5EU8A 1YPEH 3HK6B 1ANEA 2VIVA 3B9FH 3BIUH 5GPIB 2AGEX 3F68H 4BANB 1O33A 3E8LA 1N8OB 2VVUA 4BXSA 1EAWA 3VB3A 3A8BA 3O8DA 1IHSH 2F9OA 5GXPA 4YT7H 1OP0A 3MWIU 4OS1A 3S9CA 4YLUA 4ISOA 4UONA 4RSPA 2P3TB 4Q7YA 1V2VT 1ABJH 4IBLH 4BAMB 2B5TB 3UPEA 5IDKA 1XKAC 1K21H 4XBBA 3S7HB 3U8OH 3KHVA 3A8DA 2XBWA 4GUXA 3ZVEA 1DOJA 3RXEA 2BD2A 1NS3A 2OC8A 4MNVA 1S6FA 1ELVA 2AGIX 5FBIA 2PUXB 1TWXB 1UCYH 5EW1H 1AY6H 1BBRH 2FYQA 5DP5A 1E34B 3KN2A 5FPSA 4X8UH 1TMUH 1CT0E 5A8XA 3P92A 2XNIA 1NESE 3GCTF 1AUJA 1FMGA 2O8WA 2VWLA 4TPIZ 1LPZB 5DK1A 3H5CB 1LQEA 1NC6A 2ZHWH 3FVFB 3RMNH 3QN7A 2H1UA 3RXUA 1ZMLA 4FVBA 4AFSA 2ZI2H 4AX9H 5GWZA 1V2TT 3TK6A 1C5ZB 1S83A 2RCEA 3LGVA 1EP5A 3BTKE 4WWYA 1AE8H 2PV9B 2XXLA 1FY1A 3MO9A 2ODYB 1GHBF 4XBDA 5JDUB 2BDBA 2TBSA 2PTNA 4JYUH 2Z6BD 3Q3KA 3SGQE 4AB9A 1CE5A 3LU9B 1FAKH 4DY7B 2ZGCA 1V2NT 3CENA 4XSKU 1ZPCA 1SPJA 1HAPH 1AE5A 1O34A 1G36A 2VVCA 2A4QA 1GMCF 1P09A 1UTMA 1ELDE 4X8TH 3ZZBA 3BEIB 2CHAC 1C1NA 1F2SE 4ISNA 1GCTC 4MPWA 1C2EA 3SI3H 2BY5X 1WV7H 1SHYA 1QNJA 1CA8B 4R8TB 5C67A 1HB0B 2KAIA 1F7ZA 3ZVFA 3SJ9A 1YPLH 1P02A 3RC5A 2SGEE 4AB8A 3QWCH 1KXAA 4WMEA 1C1SA 3STIA 2C90B 4OS4A 1CU1A 2BVXH 2PLXA 4DW2U 2XWAA 3P8OA 3P95A 1O39A 2ZHFH 1SC8U 2ZFSA 2UUJB 4DG4A 3A85A 2FZZA 1V6DA 2ZTZA 1O3CA 1O2PA 3SV2H 4ZXYH 3TH4H 5JPMH 5DP9A 4Y11E 4D9QA 5JB9S 1F0TA 4UD9H 1AKSA 4ZH8A 2FX4A 2ANWA 4CRGA 4HZHA 4INHA 1V2MT 4A6LA 1MBMA 2XTTB 1IOEA 1FZZA 5F8ZA 3QZRA 3QZQA 5EXMA 2P3FH 3S0NA 1O2QA 2J34A 3PROA 2AFQB 3PB1E 2CGAA
chains in the Genus database with same CATH superfamily
3DSOA 1PPEE 1VR1H 3SU1A 5KEDA 2L6OA 1SGYE 2C8XB 2BDYA 3V3MA 5C3NA 2GMTC 2THFB 2QXIA 1GBMA 3RU4T 1GJ7B 3GY3A 3GY5A 5DN6D 1O5CB 2A2XH 3SU0A 1GJ8B 2FTMA 2PWXA 1FJSA 3RXVA 4ASHA 1XXDA 2FX6A 2QXGA 1EPTC 3RLYH 3FAOA 1TA2A 1C2FA 4ZUHA 3QLPH 4I33A 1IQHA 2Z3DA 1C2JA 1P2JA 3SUEA 1GI4A 3RXQA 3RXDA 1RIWB 3IITA 3SV8A 1G30B 4IGDA 2J4IA 2R3UA 1BMNH 3BG8A 3HGNA 2PSYA 1INCA 3UNQA 4HG6A 4VGCC 1VITG 1WSSH 2RA3A 3T26A 1C1QA 1BRCE 3NWUA 3OYPA 2EI7A 3GISB 1KDQA 4ZHMU 1QL7A 1W11U 1H8IH 3Q3YA 4BAOB 6ESTA 2ZGHA 2LNCA 3BTDE 3U69H 2ZDMA 2G5VA 1QCPA 1ZSLA 1C4U2 2TGTA 1K2I1 5E8EH 3BG4B 1ARCA 2A31A 3I29A 2AGGX 3SORA 1ZR0A 4Y79A 4MNWA 4CH2B 3CNRA 2H9TH 1HXEH 1MTVA 1NFYA 1N6YA 3UWIA 1T31A 1JOUB 3BIVH 2TIOA 1XUKA 2BXUH 2ALPA 3U8TH 3LJJA 3OTJE 1KXDA 2RA0A 3BTHE 4WH6A 2FLRH 1MU6B 4P02A 1VKYA 5I46H 3AAVA 2Y81A 1OWEA 4FU9A 4MNYA 6GCHF 1P2NA 2JIZD 2RFKC 2Z7FE 5TCCA 3U1IB 1PFXC 1O5AB 5LH8A 2ZEBA 1O3NA 1TA6A 1Z8GA 3UQOA 2FS9A 3MH6A 3TK5A 1THPB 5LPFA 3SUDA 4Q4LA 4FU7A 3A80A 1QY6A 1JXPA 2J94A 3OU0A 4NZLA 3SJ8A 4GCHG 4CH8B 5GCHG 1NFXA 1KLIH 4A1XA 2O8LA 2GDEH 4MTBA 5C17A 1H1BA 1D6RA 3B23B 3RXMA 1ZGIA 3EAJA 1MQ6A 4Y0ZE 2HPPH 5HM2A 5A2MH 5A09A 1GCDA 2BQWB 2STAE 1DLEA 1UK4A 2P93A 3SO3A 5EOKA 3ATWA 4I31A 7ESTE 1YLNA 1NFWA 1O2KA 4I86A 1SSXA 1L4DA 2BY9X 2EA3A 4BNRA 2JH0D 1FX0B 2ZKSA 3KQ5A 3S7KB 1K9OE 1ZTLA 1IQGA 3SU3A 1LDTT 2AIQA 3MU1A 2ZDKA 3DA9B 4JZDH 5SGAE 2XW9A 2W6JD 1T8LA 2QGRA 5DP3A 4ZAEA 3SGAE 2HLDD 3A7VA 1O3MA 1T8MA 1F92A 4D7FA 1Q3XA 3RXFA 3RXHA 4ZKNU 1AFQC 3TLOA 5BRRE 1UMAH 2V3OH 1HAHH 4NIWA 1O3IA 5CE1A 1HXFH 2K0QA 2G4UA 2G81E 3P6ZB 1GBLA 2GCTC 1UVSH 1HJAB 1BRAA 2EQNA 1YCPH 2RDLA 3A89A 1ELEE 1T8OA 1D3QB 2RG3A 2YNAA 1DWDH 1MD8A 2ZC9H 5C5OA 4B1TA 3FP6E 1DWBH 2FOGA 1PPBH 1A3EH 1C5NH 2AMQA 3TJOA 1TRNA 2FOAA 3VB4A 4BAHB 3BEFB 2Y5GA 3T25A 1J15A 3MFJA 3FZDA 4TY6A 1FY8E 5ESTE 3ESTA 1ZMJA 3KQCA 5FX6A 4U30A 5K0HA 2FTLE 4X1SU 3C1KA 3O8BA 2PKSB 3SGBE 2AERH 2VGCB 1LHEH 1TGTA 1THSH 1O3HA 5DKMA 3MOCA 2ZWLH 1F5KU 1O36A 1YM0A 4FUHA 4LZ1H 1P12E 1SOTA 2P3UB 2ZQ2A 2OD3B 4IS5A 4GHQA 1ABIH 1AU8A 4UFGH 1J14A 1W8BH 1RTFB 1SLWB 2KCAA 4K3JA 1ESAA 2KFWA 4YTAA 1JMOH 4UFEH 3RMOH 2JJ1D 1UJ1A 1SGTA 3SNAA 3ZVBA 3RXPA 1ELGA 4IMZA 3ZVCA 4IMQA 3MTYA 3SQHE 3UFAA 1GI6A 8KME2 1HJ8A 2GV6A 3NUMA 2UUFB 1KXFA 2BD3A 1BJUA 3DSGA 4INLA 4FUFA 3U8RH 1HAXB 2BLQA 2FOCA 3GCNA 1Z6EA 4AYVB 1K1LA 4ABBA 1UK2A 2AEIH 4BTIB 1L0ZA 1GDUA 2V3MA 5C1UA 3SJIA 3D49H 1MTUA 1S81A 4NIYA 2IPHA 2CMYA 9ESTA 1YPJH 1FN6A 2P8OC 4AC9A 1LMWB 3RXBA 3ZZCA 1QRZA 3F9HA 3GS9A 1KSNA 4IC6A 2VBCA 4JMYA 4YOGA 1TFXA 3S69A 7LPRA 3MNCA 2BZ6H 1VITH 2R0KA 1C2MA 3GDSA 1Z6JH 2QCYA 3SHAH 1B0FA 4FUCA 5CHBA 2QF5A 3C27B 4XRNA 2VIPA 1YBWA 2BX3A 1MQ5A 1E1QD 2R9PA 3HATH 3SN8A 4OGYA 3RU4E 1C5PA 2FLBH 2FYRA 4X8VH 1BA8B 3ATIA 1CHOF 2F9BH 1ACBE 2ZFQH 4Q63A 4TWWA 4IN2A 2F9PA 1IQNA 1GVKB 1F5LA 5DSFA 5HM9A 1W10U 1O2YA 1BHXB 1ANDA 1CA0B 1TRYA 2J97A 1L1NA 4WMDA 3EDXB 1OYTH 1QBVH 3P70B 5AFYH 3GCTG 5GDSH 2J98B 5DO4H 1S0QA 3N7DA 3RUOA 2GT8A 4I32A 4RN6A 3E90B 1O5FH 1ELBA 1W7GH 5EXNA 5AVDA 3TGKE 4WVPE 1TGCA 1WQSA 4WMFA 4K69A 3QTVH 1PPFE 3VB6A 2BB4A 3V12A 4AORA 4ACBA 2ZZUH 3LGTA 1ZPBA 3M5LA 1DS2E 1GHBG 2D26C 1FV9A 2Y7XA 3VGCB 1G32B 1W0YH 1BMMH 5LGOA 1XUFA 3DFJA 4M7GA 2OC1A 1A0JA 1MH0A 2ANMH 4Z1MD 3UY9A 2FS8A 1GGDC 1Z8RA 4A1VA 2Z9KA 5EG4A 4XD7D 2J2UA 2PSXA 2R2MB 4A7IB 1W0KD 3BV9B 1KTSB 1ZZZA 1PPHE 2C8ZB 1Y3XA 1FLEE 1C1WH 1EZUC 1GMCG 2SFAA 1MTWA 2NU3E 4O9VA 1LHCH 1K1PA 1Y5BT 1GG6B 3FO8D 3ODDA 1CT4E 5CHAB 1AN1E 1SGQE 2A5IA 1P2MA 4O03A 5A0BA 5FPTA 5EW2H 3MHWU 1TYNA 1SGEE 2IOTA 1EASA 4DIIH 4CHAB 2B9LA 5AFZH 2A7JA 4DT4A 3DHKH 3RMLH 2ZA5A 2K8IA 3BEUA 3M61U 4NA9H 4K1SA 2OQ5A 4RT0A 2OXSA 4X6NA 3O8CA 4JYTA 1HDTH 4MPVA 2O8UA 2OC7A 1W14U 2OBOA 1YF4A 3SNBA 1BTYA 3GCOA 1GBKA 1LVBA 4LOYH 2OBQA 3W1EA 1DVAH 3STJA 2BD9A 1BOQA 1O5EH 3UUZA 1O2MA 1AZ8A 1GDNA 3NZIA 2BQ7B 3GY2A 4CRCA 1P2IA 2VB0A 1SFIA 1XUJA 4NSYA 2FWWA 1QB1A 2Z9JA 4F49A 1HNEE 3ZZ9A 2ODQA 1UHBA 2ZDNA 2NU2E 1SGIB 2A7CA 1MMJN 1TQ7B 3SOSA 5FBEA 4YOIA 2ULLA 2BLOA 1S85A 1NRQH 2W7SA 4ABFA 1QBOA 3TITA 1T8NA 3RC4A 4DGJA 1FY3A 2H5DA 4FUIA 3P8NA 2XBXA 3SJKA 2V3HH 1PJPA 1P10A 2F3CE 1WCZA 2BDIA 4R0IA 5T6FA 4INKA 4K8YA 1H9LB 1Y8TA 8ESTE 1NFUA 3TJVA 1BIOA 1GPZA 4THNH 3UAIC 1HUTH 1PQ7A 4BTTB 1QQ4A 1SGDE 1H9IE 1SMFE 2XC5A 2XOKD 1XM1A 1HPGA 1GI7B 1P01A 2PKAB 4JYVH 1P9SA 4ISIH 1B7XB 1ORFA 4YZUA 3SJOA 8GCHF 1EZSC 3UWJH 1TGSZ 4DCDA 4D8NA 1YKTA 1FQ3A 2H5CA 1FUJA 2C3SA 2ZPRA 2YMSC 1GHVH 1ZMNA 2GCHF 1ZYOA 4Y10E 4B2CA 1S5SA 1IQMA 1HV7A 2ZO3H 2VWMA 3PO1B 1A4WH 1TBRH 1DWEH 3MQKC 1EB2A 2A4GA 1DLKB 4KTSA 1XUHA 4XBCA 1EX3A 2ZQ1A 1FPHH 1RJXB 1J17T 2G5NA 4FU8A 2GTBA 3WY8A 5FHTA 1C5VA 3RP2A 2QF0A 1AIXH 3BG4C 1SKYE 4YT6H 5A8ZA 4NWLA 1FPCH 3DFLA 1CBWB 4YOJA 1BZXE 3QUMP 2DE8A 3PLKA 5E0HA 1SLVB 1GJBB 3TNSA 1J8AA 1RD3B 2D8WA 1JIRA 5BPEA 1Z8IB 1COWD 1SI5H 1VCPA 1ARBA 3GICB 1TGBA 1C5LH 5KECA 2BDAA 3HKJB 1TPOA 1C5YB 2WPDD 3KL6A 1XMNB 1IQFA 1HAVB 1SBWA 2FDAA 1E79D 1TNLA 2Q6DA 4HFPB 5EPYA 1YY3A 4I8JA 1QL9A 4F55A 1EOJA 1ETSH 1ZHMA 2HNTE 3GDUA 6GCHG 1P06A 4ISLA 1Y59T 2VH6A 1TX7A 1O2ZA 4MDSA 1WUNH 1ZHPA 1DX5M 2RDEA 5C2ZA 5IYTA 4TSFD 5E0GA 1SQRA 2XCNA 1P04A 3T62A 1J9CH 2B0FA 4ESTE 3M37A 1AB9B 2F9VA 1ZGVA 7KMEH 2WV5A 1IQJA 1YPKH 1C4Y2 2ZU1A 6CHAC 1BTPA 4KP0A 2ZDLA 5F6MA 1LTOA 1W0JD 4U32A 1O3EA 4DJZB 4JZIA 3AW1A 2VIQA 3NRLA 4J1YA 3G01A 4ZHAA 1GJ4H 1K1MA 1SQAA 3M7QA 2FOHA 4UFFH 4ABIA 2F9NA 2WHXA 2FESH 2UWPA 2BD7A 2GT7A 1GJDB 1DY9A 3OE7D 1QRWA 3CP7A 1YPHC 3TPIZ 3SU4A 3MH5A 1BHXF 3FFGA 3RU4D 4D7GA 3Q77A 4UFDH 1O0DH 1K1IA 1MKXK 5DP4A 3ZZAA 3PMJA 1TBZH 2QN5T 3I77A 2JH5D 2B7DH 2AMPA 2ESTE 4AOQA 1O3BA 4Q7ZA 1G2LA 2O8MA 3SV6A 2VU8E 1MBQA 3VPKA 3EYDA 1S0RA 4AN7A 3RXCA 3LGWA 1HAYB 2XRCA 3A86A 2OK5A 1Y5UT 4FUJA 2WV4A 3SU6A 1VGCB 3ZZ7A 1GBDA 3SV7A 1G3CA 4CR5A 1P03A 4RKOB 5KGOA 1OWJA 1DWCH 5L6NH 1C5RA 1LKBA 3SI4H 2AMDA 3K6ZA 1O2RA 5EJ1A 1ZOMA 3EA7A 4X6OA 1HBTH 4HGCA 5JBAS 3A7YA 2V35A 2WPIS 2WSSD 3BTFE 2XCFA 4FETA 1ZLRA 3T28A 3VEQB 4ABGA 2GP9B 5DJ7A 1NPMA 1XVMA 2BXTH 1O2SA 2OP9A 1AHTH 3F2HA 5C94A 3MU5A 4BOHA 2ZHEH 2UWLA 3T2NA 4WJG2 3LIWA 1PQAA 4Q80A 1GMDF 4NFEA 2BD4A 4XE4A 1YPGH 4ZKSU 1OWDA 1EJNA 1KIGH 2PGBB 4FXGH 3V7TA 1UW7A 3TU7H 1GCTB 3UOPA 1C4V2 1WBGB 1OWIA 2FIRH 4XFQA 4ZHLU 2H6MA 1W0ZU 2ILNA 3GCHC 1T4VH 3ATMA 3A84A 3JZ2B 2W7UA 1TNHA 1PPCE 3K2UA 4MG3A 1EAUA 1V2QT 1GL1A 3E6PH 3DCLA 2F91A 1CGHA 3TIUA 4Y8YA 1LPGB 4E7NA 1V2PT 2BD8A 4B6FA 2TPIZ 2B8OH 4E7RG 4Q2KA 5JBTA 2ZFFH 1UVPA 3ODFA 1C2LA 1MKWK 3PV5A 4A92A 3HPTB 1CVWH 2C93B 1MTNC 3FP7E 3ZV9A 1RXPA 1D9IA 2ZCHP 3RXTA 1BB0B 1RTKA 4JCNA 5EQQA 3GY7A 1X7AC 1V2JT 1C1MA 1DE7H 3MO3A 2BQ6B 3RXAA 1P8VC 2YNBA 4Y6DA 5GJ4B 2KCPA 4I8HA 1GI5A 3EGKH 5K7RA 2PFEA 4AFQA 1V2WT 3TJUA 1O3LA 2OC0A 3M7UA 2ZFTA 2WUBA 4NGAH 1O2IA 1AI8H 3RXLA 2KZ4A 4AZ2B 4IC5A 2GMTB 1MZDA 2GVFA 1TQ0B 1P11E 2NU0E 2V6NA 4XOJA 1AD8H 2OCVB 3OTPA 3K65B 4UEHH 1PPZA 2CXVA 2W5EA 4ZXXH 3TGIE 3BTWE 5E0JA 3QO6A 3K6YA 1XKBC 5DP8A 2VIDA 1EXFA 2SGAA 2FOMB 4X2WA 1ESBA 5GIBA 1F0SA 1RRKA 4J2YB 1EPTB 1YLCA 3GY6A 1GBJA 2A32A 4CREA 4ZKOU 1KLTA 3F0PA 1E36B 2WINI 2P59A 5DPAA 1C1TA 4NIXA 3WWBA 4K60A 1O32A 5F53A 1C5SA 1C9TA 2C4FH 2QY0B 4I8KA 1CHOG 2QF3A 2SGFE 4X8SH 1CA0C 3BTGE 1NRNH 1BCUH 1WU1A 4QT8C 4VGCB 2A0QB 1HAGE 3W95A 1SR5C 1OYQA 2ZGBH 1GJ6A 1NRPH 1ETRH 1QZ8A 1A46H 3L6PA 1RTLA 2ZU5A 3KQBA 3GYLB 1YCPM 4H6TA 2BY6X 3MU4A 1NZQH 4Y7BA 1BT7A 1FIZA 4K1EA 3BTME 3ZZ6A 1W13U 4CRDA 1MTSA 1O2XA 1D3DB 5F8TA 1NM6A 1XVOA 3A82A 1TRMA 1E1RD 1P0SH 3S9AA 3O8RA 3T29A 1TONA 5AHGH 1CGJE 2SGQE 2JKHA 2DUCA 1H8HD 4H42U 1GHWH 1P2OA 1DUEA 4DT7B 1GBIA 1WOFA 1O3FA 3A7WA 1WTHD 1UVTH 1F5RA 1WXRA 2EI8A 4X1QU 1AVWA 1WDIA 2W3IA 2OLGA 1BMFD 2G52A 4NG9H 4P00A 2WYGA 3TGJE 3DD2H 1CT2E 4I8LA 1KXCA 2HNTF 3ELAH 2VIOA 1SGFG 4NCYA 3GY8A 4IW4E 5L30H 3CS0A 3M3VA 4MPUA 1IQIA 5DP7A 1O3DA 3SBKA 1OWHA 3SZNA 2EY4C 5ABWA 3ZZ8A 2WUCA 3LH3A 3RXJA 1A7SA 2GX4A 4K2YA 1HRTH 4E06H 3F1SB 2JETB 4XDEA 4JZEH 3NPSA 3LJOA 2PGQB 5F8XA 1TNJA 1C1RA 1DDJA 3LKWA 1LPKB 3SV9A 3F9EA 4HTCH 1N8OC 2IJOB 2ANKH 2V7QD 1VCQA 3TVJB 1MAYA 1GJ9B 2LPRA 2OINA 3M7TA 3MI4A 1T32A 4JK5A 1QURH 3VFEA 1ANCA 1EAXA 1HAZB 5EODA 1C2HA 2EC9H 1Y3VA 1T4UH 1EZQA 1UTLM 1O2VA 2KAIB 1OX1A 5EIYA 1EATA 3B8JA 4ZROA 2Y80A 3RLWH 1VCWA 2VIWA 2C8YB 4MQAA 1MZAA 1ID5H 1LHDH 2ZDAH 3AK5A 1UK3A 1A2CH 3URCA 1K1NA 1LKAA 1K1OA 2ZGXH 1V2OT 3PLBA 3BTTE 1GWAA 1AVGH 4X2XA 3ZVGA 3ZZ4A 1CHGA 1NBME 3ZV8A 4WF8A 1SOZA 3SNDA 2KR7A 1OWKA 1PQ8A 4ABHA 2O9QA 1EJAA 1B0EA 1QRXA 4X2VA 1QFKH 2O8TA 3UREA 5C20A 3U1JB 3TNTA 1G9IE 3Q00A 2BD5A 3PV2A 1GHAF 1FIWA 1MD7A 2CF9H 1XXFA 1AKSB 2G4TA 3E3TA 2HALA 1JBUH 1UCYK 3KNXA 1GJCB 1K22H 3L33A 1BBRK 5CDFE 1O2WA 3TH3H 1O2NA 2J92A 3N7OA 5B6LA 1C2DA 1DY8A 2TGPZ 4LZ4B 1O5DH 2SNWA 2A5KA 1HCGA 1K0HA 2FMJA 1AFQB 2Y6TA 3OX7U 8GCHG 1GHXH 4WXIA 1SGFA 4B2AA 2ZFRH 3UR9A 1YYY1 3RXSA 1C2KA 1YLDA 1E37B 3PTNA 3E0PB 3LC3A 4K1TA 2CK3D 1ETTH 2GCHG 3VB7A 2GCTB 4FUBA 2AHME 1AZZA 1FDPA 1L1JA 1QBNA 5T6GA 2Y5FA 2FXRA 1BMAA 3FZZA 4ABJA 2FPZA 2W26A 4M9FA 3MH7A 1S84A 1SGPE 3SU2A 2BTCE 4RT1A 3PV4A 2WPKS 1FXYA 3PWBA 1DANH 2GD4B 4CBOA 2FODA 1ZSKA 1YWUA 4B75A 2OQUA 4ABDA 1K1JA 1EKBB 3LOXA 3MNBA 3RXIA 2PUQH 4X1PU 2JJ2D 4JZFH 2UUKB 1P05A 2GZ9A 3SNCA 1D4PB 1GHZA 1V2KT 5T3HA 6LPRA 2BOHB 3A8AA 4BTUB 3ENSB 1C5XB 5EGMA 1ELTA 3EE7A 3UR6A 2XYAA 2NWNA 2AS9A 1QIXB 4O97A 3V13A 3RXOA 1IQLA 3S9BA 3KYFA 1OP2A 2LP6A 4UE7H 4KELA 4Z6AH 1FN8A 2H9EH 2LELA 1WAYB 1KDQB 1TOCB 2UUYA 1KYNA 2PHBA 1UVOA 2BY7X 2G55A 3M5OA 1ZHRA 1UO6A 2HNTC 3QTOH 3VG8A 1ZJDA 3D65E 3M3SA 1DSTA 3F2GA 2GV7A 1TNIA 2FOEA 1MAXA 1WTGH 1O5GH 3E16B 3PMBB 4CRFA 2Q6GA 4F4OC 1ZPZA 4NWKA 1C5UA 5ETXA 1AB9C 5HIZA 4Y7AA 4NIVA 1FY4A 1IHTH 3IWMA 4ABAA 4ABEA 3M5NA 2P8OB 1EP6A 1L2EA 2P16A 1AQ7A 1DXPA 1F0RA 5L2YH 1TMTH 2WYJA 2OTVA 1O3OA 2KX4A 1ELAA 4CRBA 2ZHDA 2STBE 2ZU3A 1A5HA 1ZRKA 5C1YA 2FI4E 1H9HE 2UWOA 1HAOH 5HGGA 1O2HA 1C2GA 1OKXA 2F4LA 3H09A 4GHTA 1ZTKA 1PPGE 1RIWC 1BJVA 1Z71A 4X0WU 3KQDA 1Y5AT 4OS2A 1E38B 2EEKA 2CV3A 1G37A 1Z1JA 2SGPE 2WPHS 1P2QA 1LVMA 3MO6A 4YESB 3KGPA 5A0CA 1GMHF 1G3DA 2VINA 1BTWA 3E91A 4ZKRU 1GBFA 1VGCC 4RKJB 5FPYA 3ZVAA 3ZVDA 1BQYA 2IN2A 2BVRH 3A87A 2P94A 3EE0B 1DITH 2AIPA 5FXLA 3OY6U 1E0FD 3RMMH 4B73A 3MH4A 1JRSA 2BOKA 3OEHD 2ODPA 3F3BA 4NSVA 5EJLA 3ATLA 5T6DA 4GPGA 3T27A 4AG2A 1TPAE 3MU8A 1BMLA 3RXRA 2VH0A 3F0OA 1HIAA 1G3BA 2AYWA 2TGDA 1C5WB 1ZJKA 4CR9A 7GCHF 4B76A 3FOAA 1IQEA 2ZECA 3AW0A 4FUDA 3BSQA 4D76A 1GBTA 1GGDB 2ANYA 1QJ7B 4K5ZA 2GZ7A 2M5TA 5T1VA 4PROA 2PW8H 1C5MD 1AFEH 3QDZB 1GMDG 1Q2WA 3P8GA 1EFRD 3L3TA 2IPQX 1TGNA 2ZP0H 1SL3A 5PTPA 2R3YA 4YM9A 4MNXA 1XUIA 3ZZ5A 4GSOA 3KIDU 3AASA 2WPLS 5DP6A 1MABB 3NXPA 3OEED 1JWTA 1MCVA 5LPEA 1JIMA 1SQTA 1BUIA 2H2ZA 2Z3EA 3BTEE 1TIOA 4ACAA 2HOBA 3LONA 4AFUA 2QE7D 2I6SA 5J4QA 1UTPA 2GJGA 3PWCA 1C5QA 3LT3A 1GVLA 1O3KA 1TX8A 4NZQA 2J98A 1KMHB 4X2YA 4HI3A 1MU8B 1C9PA 3EA9A 3M35A 1BDAA 5HXFA 1EZXC 4AYYB 1F0UA 4SGAE 2ZNKH 5FL7D 1A0LA 4GLYA 5B6OA 1O37A 4GVUA 1PYTD 3PYHA 2ZPQA 4ZCNA 5C5NA 1V2ST 3PRDA 4Y0YE 1S82A 2A4OA 2BYAX 3PRBA 2BDCA 1UTOA 2ZHQH 4MLFB 2Z3CA 1RFNA 2ZPSA 3DT0H 1QQUA 1O2LA 3NCLA 5EQRA 3E0NB 2ZFPH 1NBMD 3BTQE 2H9HA 2QIQA 3M36A 4U2WA 3WW7A 2FO9A 1TPSA 2F9UA 4TY7A 1QB6A 1O31A 1THRH 1H4WA 2A2QH 2G00A 3GYMA 4B74A 2ZIQH 2JDID 4DURA 2GKVE 1P3CA 3ZIAD 2VWOA 4KKDA 3Q3XA 1TALA 3JZ1B 4AFZA 4OS5A 5GNDA 4DVAU 2FOBA 3SNEA 4OS6A 3NKKA 3OSYA 1HGTH 1SG8B 1TLDA 1LCYA 2QXJA 1QR3E 4OM9A 1UCYE 2FI3E 1BITA 1LO6A 1BBRE 1AUTC 2HPQH 1DICA 3PLPA 4SGBE 4KTCA 2BDHA 5TCAA 3SUFA 1L1GA 2BLWA 1SLUB 3A8CA 3QGJA 2Y7ZA 1GBHA 1V3XA 2D2DA 2ZTYA 2YMSB 3Q76A 5FAHA 3KCGH 4OGXA 4ZMAH 3MMGA 1CQQA 1HJAC 1OXGA 1VZQH 3NK8A 2FOFA 3RXKA 1GJAB 3SU5A 2I6QA 3OFND 1GI2A 3SHCH 4CBNA 1EQ9A 1WYKA 3PTBA 3GOVB 4WH8A 1HFDA 1QA0A 4NA8A 2FM2A 2VNTA 4Y71A 1QHRB 1P57B 4O3UA 1AWFH 1P3EA 4FUEA 1O35A 1NRRH 2CHAB 2BHGA 1D3TB 1C1VH 1XUGA 3QK1A 3MYWA 1Z1IA 3VB5A 2ZGJA 1YCPK 1HYLA 5L2ZH 5G4BA 2PKSC 5IK2D 3A88A 1CO7E 1QL8A 2VGCC 3F2FA 3HGPA 2BY8X 1MUEB 2XBVA 2F83A 4I8GA 1DM4B 1VJAU 1NU7B 3UNSA 3PM3A 1Y3UA 1TOMH 3LPRA 1TBQH 2D1JA 2J95A 2OUAA 4ISHH 5HKKD 3K9XB 4O3TA 1YP9A 1HJ9A 1UVUH 4FVDA 1W12U 1C5OH 4BAKB 2XC0A 1EOLA 4F48B 3LGYA 4NA7A 1GDQA 1UTJA 1NN6A 2JETC 2PKAA 3UIRA 1BTZA 1GI0A 1GJ5H 1Z8JB 1O2OA 2BZAA 2W6ID 1A5GH 3BN9A 1ZTJA 1Q31A 2GDDA 4KTUA 1O5BB 1UTNA 3A81A 4MPXA 1FI8A 2PTCE 4FUGA 1ELCA 3GY4A 1BRUP 1ANBA 3W94A 1MKXH 1EJMA 5E2OA 5TJXA 1N6XA 2HGTH 2Z94A 6CHAB 4DIHH 3WWFA 4MVNA 2ALVA 8LPRA 2GGVB 2A7HA 3URDA 2K1QA 1LVYA 1U6QA 1GBBA 2SGDE 1B5GH 1GVZA 1BRBE 1O38A 1TABE 1RS0A 4TPYA 3RM0H 1YPHE 5HYOA 2AH4X 3LGUA 1AWHB 4YXWD 3TJNA 4JZ1A 1PYTC 2CN0H 1DPOA 5EXLA 3RC6A 3P17H 1QJ1B 1OHHD 2ZCKP 1GBAA 2BDGA 1V2RT 4NFFA 3MU0A 2Q1JA 1TNGA 3VXFH 1OOKB 2QXHA 5I25A 3M5MA 2VVVA 4YLQH 1DSUA 1LQDB 1TMBH 1VITF 3F9GA 3LDXH 5EQSA 3ZZDA 2A45B 1IAUA 1HLTH 3H7OA 2A4RA 5E2PA 1SVPA 1PQ5A 5JBCS 1NTPA 4X6MA 3M3TA 5HMAA 4LXBH 1O2TA 1HAVA 5AF9H 4X1NU 1GHAG 1S6LA 2KCYA 3RXGA 4AGJA 1C5TA 1SFQB 4TYDA 5DG6A 3U28C 4BXWA 2WPJS 3RDZA 2P95A 2BX4A 4H6SB 1UHBB 1A3BH 1YPMH 2ZTXA 5LPRA 3VXEH 1O2UA 4D9RA 3VGCC 1EAIA 3ZZ3A 2HWLB 3E1XB 1O3GA 1KY9A 2EI6A 1BTHH 4YO9A 5A0AE 1D6WA 1SGCA 3KQEA 3TH2H 2SNVA 1GI1A 3EA8A 2JH6D 2XC4A 1JRTA 2QAAA 3H7TA 2FI5E 3KF2A 2R0LA 1P2KA 3U9AH 1D3PB 1QGFA 3ZYEA 1A61H 1CSOE 4UDWH 2WPMS 4Y8ZA 5A8YA 1G3EA 2C8WB 2ZU4A 5FCRA 9LPRA 1DXWA 1GG6C 5CHAC 2Y5HA 3PMAB 2QC2A 5DGJA 1RGQA 1O3PB 1MKWH 1A5IA 1GI8B 2Z9GA 2BLVA 4IN1A 1TX6A 1NU9A 3GCHB 1KLJH 1DT2A 3BF6H 2DE9A 2TRMA 3GDVA 4CHAC 1XX9A 4Q7XA 4Y8XA 1N1LA 5C1XA 1HAIH 1OS8A 1KTTB 1E35B 1J16A 4E05H 2G8TA 1UTKA 2VJ1A 1NROH 2WV9A 1EUFA 4A5TS 1C1UH 1AO5A 1GBCA 2F43B 2IJD1 4H4FA 1O2JA 4GCHF 1O30A 1KXEA 1V2UT 5GCHF 4WXVA 2A5AA 2Q6FA 2ZDVH 3MNSA 1A1RA 4JK6A 1MTNB 2CF8H 2HLCA 2NU1E 3EQ0H 4KGAA 3QX5H 4Y76A 2Z9LA 3CS7A 3U98H 1QB9A 5JB8S 3MNXA 1ELFA 1G2MA 4I7YH 1SLXB 1T7CA 2KM0A 2L74A 4X1RU 1C1OA 1M9UA 4OS7A 1SGRE 2ASUB 1IQKA 1P9UA 2J9NA 1HIAB 5C0UA 1GHYH 1QTFA 4A1TA 5EPNA 1GBEA 1OSSA 1W7XH 3D23A 1GI3A 1KXBA 1NT1A 1A0HB 3A7TA 3R0FA 2A1DB 1ZRBA 4B71A 1GI9B 2J38A 5F03A 1Z7KA 1CGIE 2TGAA 3OY5U 3T5FH 3SUGA 1FONA 1O3AA 3QGNB 2Y82A 1BTXA 1VJ9U 1YC0A 3A83A 1TE0A 3R3GB 1W3CA 2QA9E 1QA7A 4B2BA 1NY22 4X6PA 1FAXA 1AMHA 1SHHB 2GZ8A 3PMHB 1O3JA 3D62A 2YMSD 3LC5A 4ASUD 3ITIA 1L4ZA 4BAQB 2V0BA 3AAUA 2G51A 4GAWA 4Z0KA 1C1PA 3LH1A 3FANA 1O2GH 1TPPA 1QJ6B 5CMXH 2FEQH 2BVSH 1NO9H 5C0TA 3PO1C 2W3KA 1GMHG 4WY3A 2NU4E 2ZG0H 1K28D 1TNKA 5JYIA 2XNDD 2ZCLP 2PR3A 5H4IB 3RM2H 2CJIA 3KEEA 1DFPA 3SQEE 3UQVA 1NRSH 2YOLA 1W2KH 4AGKA 1TB6H 2QV1A 1OP8A 1SQOA 3F6UH 2BM2A 3F9FA 3IG6B 4AG1A 3ATKA 3FP8E 3V0XA 1H8DH 1FNIA 1BTUA 1CBWC 3ZYDA 1AGJA 1LHGH 4U01A 2KCOA 2HVXA 3HKIB 5FX5A 1ESTA 7GCHG 5ESBA 3UNRA 2QYIA 3I78A 4K8BA 1AVXA 5J4SA 1WQVH 1OPHB 4TWYA 1EB1H 1LVOA 1DUAA 1FY5A 2XWBI 1TAWA 2FP7B 1ZSJA 1UTQA 2BMGB 2VWNA 2XBYA 3SW2B 4DOQA 1S6HA 1SB1H 5JBBS 1V2LT 3AVZA 3TK9A 3UOUA 3FN8A 1YGCH 3LGIA 3P8FA 1GL0E 3UTUH 1EPTA 2HRVA 1Y3YA 1LHFH 1C2IA 1SGNE 3A7XA 3HK3B 5FCKA 2ZU2A 2ZF0H 2Z9IA 4LK4A 3DUXH 4CRAA 3A7ZA 1MCTA 2R2WU 1Y3WA 4FOUC 5EU8A 1YPEH 3HK6B 1ANEA 5EJZA 2VIVA 3B9FH 3BIUH 5GPIB 2AGEX 3F68H 4BANB 1O33A 3E8LA 1N8OB 1H8ED 2VVUA 4BXSA 1EAWA 3VB3A 3A8BA 3O8DA 1IHSH 2F9OA 5GXPA 2M2AA 3N99A 4YT7H 1OP0A 3MWIU 3UB0A 4OS1A 3S9CA 4YLUA 4ISOA 4UONA 4RSPA 2P3TB 4Q7YA 1V2VT 1ABJH 4IBLH 4BAMB 2B5TB 3UPEA 5IDKA 1XKAC 1K21H 4XBBA 3S7HB 3U8OH 3KHVA 3A8DA 2XBWA 4GUXA 3ZVEA 1DOJA 3RXEA 2BD2A 1NS3A 2OC8A 4MNVA 1S6FA 1ELVA 2AGIX 5FBIA 2PUXB 1TWXB 1UCYH 5EW1H 1AY6H 1BBRH 2FYQA 5DP5A 1E34B 3KN2A 5FPSA 4X8UH 1TMUH 1CT0E 5A8XA 3P92A 2XNIA 1NESE 3GCTF 1AUJA 2J5UA 1FMGA 2O8WA 2VWLA 4TPIZ 1LPZB 5DK1A 3H5CB 1LQEA 1NC6A 2ZHWH 3FVFB 3RMNH 3QN7A 2H1UA 3RXUA 1ZMLA 4FVBA 4AFSA 2ZI2H 4AX9H 5GWZA 1V2TT 3TK6A 1C5ZB 1S83A 2RCEA 3LGVA 1EP5A 3BTKE 4WWYA 1AE8H 2PV9B 2XXLA 1FY1A 3MO9A 2PP6A 2ODYB 1GHBF 4XBDA 5JDUB 2BDBA 2TBSA 2PTNA 4JYUH 2Z6BD 3Q3KA 3SGQE 4AB9A 1CE5A 4TT3D 3LU9B 1FAKH 4DY7B 2ZGCA 1V2NT 3CENA 4XSKU 3SZEA 1ZPCA 1SPJA 1HAPH 1AE5A 1O34A 1G36A 2VVCA 2A4QA 1GMCF 1P09A 1UTMA 1ELDE 4X8TH 3ZZBA 2QF4A 3BEIB 2CHAC 1C1NA 1F2SE 4ISNA 1GCTC 4MPWA 1C2EA 3SI3H 3SYJA 2BY5X 1WV7H 1SHYA 1QNJA 1CA8B 4R8TB 5C67A 1HB0B 2KAIA 1F7ZA 3ZVFA 3SJ9A 1YPLH 1P02A 3DSPA 3RC5A 2SGEE 4AB8A 3QWCH 1KXAA 2WZQA 4WMEA 1C1SA 3N7EA 3STIA 2C90B 4OS4A 1CU1A 2BVXH 2PLXA 4DW2U 2XWAA 3P8OA 3P95A 3FKSD 1O39A 2ZHFH 1SC8U 2ZFSA 2UUJB 4DG4A 3A85A 2FZZA 1V6DA 2ZTZA 1O3CA 1O2PA 3SV2H 4RI0A 4ZXYH 3TH4H 5JPMH 5HIYA 5DP9A 4Y11E 4D9QA 5JB9S 1F0TA 4UD9H 2HVYB 1AKSA 4ZH8A 2FX4A 2ANWA 4CRGA 4HZHA 4INHA 1V2MT 4A6LA 3OAAD 1MBMA 2XTTB 3KYGA 1IOEA 4B6EA 1FZZA 5F8ZA 3QZRA 3QZQA 5EXMA 2P3FH 3S0NA 1O2QA 2J34A 3PROA 2AFQB 3PB1E 2CGAA
chains in the Genus database with same CATH topology
1PPEE 1VR1H 3SU1A 1SGYE 2C8XB 2BDYA 3V3MA 5C3NA 2GMTC 2THFB 2QXIA 1GBMA 3RU4T 1GJ7B 3GY3A 3GY5A 1O5CB 2A2XH 3SU0A 1GJ8B 2FTMA 2PWXA 1FJSA 3RXVA 4ASHA 1XXDA 2FX6A 2QXGA 1EPTC 3RLYH 3FAOA 1TA2A 1C2FA 4ZUHA 3QLPH 4I33A 1IQHA 2Z3DA 1C2JA 1P2JA 3SUEA 1GI4A 3RXQA 3RXDA 1RIWB 3IITA 3SV8A 1G30B 4IGDA 2J4IA 2R3UA 1BMNH 3BG8A 3HGNA 2PSYA 1INCA 3UNQA 4VGCC 1VITG 1WSSH 2RA3A 3T26A 1C1QA 1BRCE 3NWUA 3OYPA 2EI7A 3GISB 1KDQA 4ZHMU 1QL7A 1W11U 1H8IH 3Q3YA 4BAOB 6ESTA 2ZGHA 2LNCA 3BTDE 3U69H 2ZDMA 2G5VA 1QCPA 1ZSLA 1C4U2 2TGTA 1K2I1 5E8EH 3BG4B 1ARCA 2A31A 3I29A 2AGGX 3SORA 1ZR0A 4Y79A 4MNWA 4CH2B 2H9TH 1HXEH 1MTVA 1NFYA 1N6YA 3UWIA 1T31A 1JOUB 3BIVH 2TIOA 1XUKA 2BXUH 2ALPA 3U8TH 3LJJA 3OTJE 1KXDA 2RA0A 3BTHE 4WH6A 2FLRH 1MU6B 5I46H 3AAVA 2Y81A 1OWEA 4FU9A 4MNYA 6GCHF 1P2NA 2Z7FE 5TCCA 3U1IB 1PFXC 1O5AB 5LH8A 2ZEBA 1O3NA 1TA6A 1Z8GA 3UQOA 2FS9A 3MH6A 3TK5A 1THPB 5LPFA 3SUDA 4FU7A 3A80A 1QY6A 1JXPA 2J94A 3OU0A 4NZLA 3SJ8A 4GCHG 4CH8B 5GCHG 1NFXA 1KLIH 4A1XA 2O8LA 2GDEH 4MTBA 1H1BA 1D6RA 3B23B 3RXMA 1ZGIA 3EAJA 1MQ6A 4Y0ZE 2HPPH 5HM2A 5A2MH 5A09A 1GCDA 2BQWB 2STAE 1DLEA 1UK4A 2P93A 3SO3A 5EOKA 3ATWA 4I31A 7ESTE 1NFWA 1O2KA 1SSXA 1L4DA 2BY9X 2EA3A 4BNRA 2JH0D 2ZKSA 3S7KB 1K9OE 1ZTLA 1IQGA 3SU3A 1LDTT 2AIQA 3MU1A 2ZDKA 3DA9B 4JZDH 5SGAE 2XW9A 1T8LA 2QGRA 5DP3A 4ZAEA 3SGAE 3A7VA 1O3MA 1T8MA 1F92A 4D7FA 1Q3XA 3RXFA 3RXHA 4ZKNU 1AFQC 3TLOA 5BRRE 1UMAH 2V3OH 1HAHH 4NIWA 1O3IA 5CE1A 1HXFH 2G4UA 2G81E 3P6ZB 1GBLA 2GCTC 1UVSH 1HJAB 1BRAA 1YCPH 2RDLA 3A89A 1ELEE 1T8OA 1D3QB 2RG3A 2YNAA 1DWDH 1MD8A 2ZC9H 5C5OA 4B1TA 3FP6E 1DWBH 2FOGA 1PPBH 1A3EH 1C5NH 2AMQA 3TJOA 1TRNA 2FOAA 3VB4A 4BAHB 3BEFB 2Y5GA 3T25A 1J15A 3MFJA 3FZDA 4TY6A 1FY8E 5ESTE 3ESTA 1ZMJA 3KQCA 5FX6A 4U30A 5K0HA 2FTLE 4X1SU 3C1KA 3O8BA 2PKSB 3SGBE 2AERH 2VGCB 1LHEH 1TGTA 1THSH 1O3HA 5DKMA 3MOCA 2ZWLH 1F5KU 1O36A 1YM0A 4FUHA 4LZ1H 1P12E 1SOTA 2P3UB 2ZQ2A 2OD3B 4IS5A 4GHQA 1ABIH 1AU8A 4UFGH 1J14A 1W8BH 1RTFB 1SLWB 4K3JA 1ESAA 4YTAA 1JMOH 4UFEH 3RMOH 1UJ1A 1SGTA 3SNAA 3ZVBA 3RXPA 1ELGA 4IMZA 3ZVCA 4IMQA 3MTYA 3SQHE 3UFAA 1GI6A 8KME2 1HJ8A 2GV6A 3NUMA 2UUFB 1KXFA 2BD3A 1BJUA 4INLA 4FUFA 3U8RH 1HAXB 2BLQA 2FOCA 3GCNA 1Z6EA 4AYVB 1K1LA 4ABBA 1UK2A 2AEIH 4BTIB 1L0ZA 1GDUA 5C1UA 3SJIA 3D49H 1MTUA 1S81A 4NIYA 2IPHA 2CMYA 9ESTA 1YPJH 1FN6A 2P8OC 1LMWB 3RXBA 3ZZCA 1QRZA 3F9HA 1KSNA 4IC6A 4JMYA 4YOGA 1TFXA 3S69A 7LPRA 3MNCA 2BZ6H 1VITH 2R0KA 1C2MA 3GDSA 1Z6JH 2QCYA 3SHAH 1B0FA 4FUCA 3C27B 2VIPA 1YBWA 2BX3A 1MQ5A 2R9PA 3HATH 3SN8A 4OGYA 3RU4E 1C5PA 2FLBH 2FYRA 4X8VH 1BA8B 3ATIA 1CHOF 2F9BH 1ACBE 2ZFQH 4TWWA 4IN2A 2F9PA 1IQNA 1GVKB 1F5LA 5HM9A 1W10U 1O2YA 1BHXB 1ANDA 1CA0B 1TRYA 1L1NA 4WMDA 3EDXB 1OYTH 1QBVH 3P70B 5AFYH 3GCTG 5GDSH 5DO4H 1S0QA 3RUOA 2GT8A 4I32A 4RN6A 3E90B 1O5FH 1ELBA 1W7GH 5EXNA 5AVDA 3TGKE 4WVPE 1TGCA 1WQSA 4WMFA 4K69A 3QTVH 1PPFE 3VB6A 2BB4A 3V12A 4AORA 2ZZUH 3LGTA 1ZPBA 3M5LA 1DS2E 1GHBG 2D26C 1FV9A 2Y7XA 3VGCB 1G32B 1W0YH 1BMMH 5LGOA 1XUFA 3DFJA 4M7GA 2OC1A 1A0JA 1MH0A 2ANMH 3UY9A 2FS8A 1GGDC 1Z8RA 4A1VA 2Z9KA 5EG4A 2J2UA 2PSXA 2R2MB 4A7IB 3BV9B 1KTSB 1ZZZA 1PPHE 2C8ZB 1Y3XA 1FLEE 1C1WH 1EZUC 1GMCG 2SFAA 1MTWA 2NU3E 4O9VA 1LHCH 1K1PA 1Y5BT 1GG6B 3ODDA 1CT4E 5CHAB 1AN1E 1SGQE 2A5IA 1P2MA 4O03A 5A0BA 5FPTA 5EW2H 3MHWU 1TYNA 1SGEE 2IOTA 1EASA 4DIIH 4CHAB 2B9LA 5AFZH 2A7JA 3DHKH 3RMLH 2ZA5A 3BEUA 3M61U 4NA9H 4K1SA 2OQ5A 2OXSA 4X6NA 3O8CA 4JYTA 1HDTH 4MPVA 2O8UA 2OC7A 1W14U 2OBOA 1YF4A 3SNBA 1BTYA 3GCOA 1GBKA 1LVBA 4LOYH 2OBQA 1DVAH 3STJA 2BD9A 1BOQA 1O5EH 3UUZA 1O2MA 1AZ8A 1GDNA 3NZIA 2BQ7B 3GY2A 4CRCA 1P2IA 2VB0A 1SFIA 1XUJA 4NSYA 2FWWA 1QB1A 2Z9JA 4F49A 1HNEE 3ZZ9A 2ODQA 1UHBA 2ZDNA 2NU2E 1SGIB 2A7CA 1MMJN 1TQ7B 3SOSA 5FBEA 4YOIA 2ULLA 2BLOA 1S85A 1NRQH 2W7SA 4ABFA 1QBOA 3TITA 1T8NA 3RC4A 4DGJA 1FY3A 2H5DA 4FUIA 3P8NA 2XBXA 3SJKA 2V3HH 1PJPA 1P10A 2F3CE 1WCZA 2BDIA 4R0IA 5T6FA 4INKA 4K8YA 1H9LB 1Y8TA 8ESTE 1NFUA 3TJVA 1BIOA 1GPZA 4THNH 1HUTH 1PQ7A 4BTTB 1QQ4A 1SGDE 1H9IE 1SMFE 2XC5A 1XM1A 1HPGA 1GI7B 1P01A 2PKAB 4JYVH 1P9SA 4ISIH 1B7XB 1ORFA 4YZUA 3SJOA 8GCHF 1EZSC 3UWJH 1TGSZ 4DCDA 4D8NA 1YKTA 1FQ3A 2H5CA 1FUJA 2C3SA 2ZPRA 1GHVH 1ZMNA 2GCHF 1ZYOA 4Y10E 4B2CA 1S5SA 1IQMA 1HV7A 2ZO3H 2VWMA 3PO1B 1A4WH 1TBRH 1DWEH 1EB2A 2A4GA 1DLKB 4KTSA 1XUHA 4XBCA 1EX3A 2ZQ1A 1FPHH 1RJXB 1J17T 2G5NA 4FU8A 2GTBA 3WY8A 5FHTA 1C5VA 3RP2A 2QF0A 1AIXH 3BG4C 4YT6H 5A8ZA 4NWLA 1FPCH 3DFLA 1CBWB 4YOJA 1BZXE 3QUMP 2DE8A 3PLKA 5E0HA 1SLVB 1GJBB 3TNSA 1J8AA 1RD3B 2D8WA 1JIRA 5BPEA 1Z8IB 1SI5H 1VCPA 3GICB 1ARBA 1TGBA 1C5LH 2BDAA 3HKJB 1TPOA 1C5YB 3KL6A 1XMNB 1IQFA 1HAVB 1SBWA 2FDAA 1TNLA 2Q6DA 4HFPB 5EPYA 4I8JA 1QL9A 1EOJA 1ETSH 1ZHMA 2HNTE 3GDUA 6GCHG 1P06A 4ISLA 1Y59T 2VH6A 1TX7A 1O2ZA 4MDSA 1WUNH 1ZHPA 1DX5M 5C2ZA 5IYTA 5E0GA 2XCNA 1P04A 3T62A 1J9CH 2B0FA 4ESTE 3M37A 1AB9B 2F9VA 1ZGVA 7KMEH 2WV5A 1IQJA 1YPKH 1C4Y2 2ZU1A 6CHAC 1BTPA 4KP0A 2ZDLA 5F6MA 1LTOA 4U32A 1O3EA 4DJZB 4JZIA 3AW1A 2VIQA 4J1YA 3G01A 4ZHAA 1GJ4H 1K1MA 1SQAA 3M7QA 2FOHA 4UFFH 4ABIA 2F9NA 2FESH 2UWPA 2BD7A 2GT7A 1GJDB 1DY9A 1QRWA 3CP7A 1YPHC 3TPIZ 3SU4A 3MH5A 1BHXF 3FFGA 3RU4D 4D7GA 3Q77A 4UFDH 1O0DH 1K1IA 1MKXK 5DP4A 3ZZAA 3PMJA 1TBZH 2QN5T 3I77A 2JH5D 2B7DH 2AMPA 2ESTE 4AOQA 1O3BA 4Q7ZA 1G2LA 2O8MA 3SV6A 2VU8E 1MBQA 3VPKA 3EYDA 1S0RA 4AN7A 3RXCA 3LGWA 1HAYB 2XRCA 3A86A 1Y5UT 4FUJA 2WV4A 3SU6A 1VGCB 3ZZ7A 1GBDA 3SV7A 1G3CA 4CR5A 1P03A 4RKOB 1OWJA 1DWCH 5L6NH 1C5RA 1LKBA 3SI4H 2AMDA 3K6ZA 1O2RA 1ZOMA 3EA7A 4X6OA 1HBTH 4HGCA 5JBAS 3A7YA 2V35A 2WPIS 3BTFE 2XCFA 1ZLRA 3T28A 3VEQB 4ABGA 2GP9B 5DJ7A 1NPMA 1XVMA 2BXTH 1O2SA 2OP9A 1AHTH 3MU5A 4BOHA 2ZHEH 2UWLA 3T2NA 4WJG2 3LIWA 1PQAA 4Q80A 1GMDF 4NFEA 2BD4A 4XE4A 1YPGH 4ZKSU 1OWDA 1EJNA 1KIGH 2PGBB 4FXGH 3V7TA 3TU7H 1GCTB 3UOPA 1C4V2 1WBGB 1OWIA 2FIRH 4XFQA 4ZHLU 2H6MA 1W0ZU 2ILNA 3GCHC 1T4VH 3ATMA 3A84A 3JZ2B 2W7UA 1TNHA 1PPCE 3K2UA 4MG3A 1EAUA 1V2QT 1GL1A 3E6PH 2F91A 1CGHA 3TIUA 4Y8YA 1LPGB 4E7NA 1V2PT 2BD8A 2TPIZ 2B8OH 4E7RG 4Q2KA 5JBTA 2ZFFH 1UVPA 3ODFA 1C2LA 1MKWK 4A92A 3HPTB 1CVWH 2C93B 1MTNC 3FP7E 3ZV9A 1RXPA 1D9IA 2ZCHP 3RXTA 1BB0B 1RTKA 4JCNA 5EQQA 3GY7A 1X7AC 1V2JT 1C1MA 1DE7H 3MO3A 2BQ6B 3RXAA 1P8VC 2YNBA 4Y6DA 5GJ4B 4I8HA 1GI5A 3EGKH 5K7RA 2PFEA 4AFQA 1V2WT 3TJUA 1O3LA 2OC0A 3M7UA 2ZFTA 2WUBA 4NGAH 1O2IA 1AI8H 3RXLA 4AZ2B 4IC5A 2GMTB 1MZDA 2GVFA 1TQ0B 1P11E 2NU0E 2V6NA 4XOJA 1AD8H 2OCVB 3K65B 4UEHH 1PPZA 2CXVA 2W5EA 4ZXXH 3TGIE 3BTWE 5E0JA 3QO6A 3K6YA 1XKBC 5DP8A 2VIDA 1EXFA 2SGAA 2FOMB 4X2WA 1ESBA 5GIBA 1F0SA 1RRKA 4J2YB 1EPTB 1YLCA 3GY6A 1GBJA 2A32A 4CREA 4ZKOU 1KLTA 1E36B 2WINI 2P59A 5DPAA 1C1TA 4NIXA 4K60A 1O32A 1C5SA 1C9TA 2C4FH 2QY0B 4I8KA 1CHOG 2QF3A 2SGFE 4X8SH 1CA0C 3BTGE 1NRNH 1BCUH 1WU1A 4QT8C 4VGCB 2A0QB 1HAGE 3W95A 1SR5C 1OYQA 2ZGBH 1GJ6A 1NRPH 1ETRH 1A46H 3L6PA 1RTLA 2ZU5A 3KQBA 3GYLB 1YCPM 4H6TA 2BY6X 3MU4A 1NZQH 4Y7BA 1BT7A 1FIZA 4K1EA 3BTME 3ZZ6A 1W13U 4CRDA 1MTSA 1O2XA 1D3DB 5F8TA 1NM6A 1XVOA 3A82A 1TRMA 1P0SH 3S9AA 3O8RA 3T29A 1TONA 5AHGH 1CGJE 2SGQE 2JKHA 2DUCA 4H42U 1GHWH 1P2OA 1DUEA 4DT7B 1GBIA 1WOFA 1O3FA 3A7WA 1WTHD 1UVTH 1F5RA 2EI8A 4X1QU 1AVWA 2W3IA 2OLGA 2G52A 4NG9H 2WYGA 3TGJE 3DD2H 1CT2E 4I8LA 1KXCA 2HNTF 3ELAH 2VIOA 1SGFG 4NCYA 3GY8A 4IW4E 5L30H 3CS0A 3M3VA 4MPUA 1IQIA 5DP7A 1O3DA 3SBKA 1OWHA 3SZNA 5ABWA 3ZZ8A 2WUCA 3LH3A 3RXJA 1A7SA 2GX4A 4K2YA 1HRTH 4E06H 3F1SB 2JETB 4XDEA 4JZEH 3NPSA 3LJOA 2PGQB 5F8XA 1TNJA 1C1RA 1DDJA 3LKWA 1LPKB 3SV9A 3F9EA 4HTCH 1N8OC 2IJOB 2ANKH 1VCQA 3TVJB 1MAYA 1GJ9B 2LPRA 2OINA 3M7TA 3MI4A 1T32A 4JK5A 1QURH 3VFEA 1ANCA 1EAXA 1HAZB 5EODA 1C2HA 2EC9H 1Y3VA 1T4UH 1EZQA 1UTLM 1O2VA 2KAIB 1OX1A 1EATA 3B8JA 4ZROA 2Y80A 3RLWH 1VCWA 2VIWA 2C8YB 4MQAA 1MZAA 1ID5H 1LHDH 2ZDAH 1UK3A 1A2CH 3URCA 1K1NA 1LKAA 1K1OA 2ZGXH 1V2OT 3PLBA 3BTTE 1GWAA 1AVGH 4X2XA 3ZVGA 3ZZ4A 1CHGA 3ZV8A 4WF8A 1SOZA 3SNDA 4ABHA 1OWKA 1PQ8A 2O9QA 1EJAA 1B0EA 1QRXA 4X2VA 1QFKH 2O8TA 3UREA 5C20A 3U1JB 3TNTA 1G9IE 3Q00A 2BD5A 1