4AGKA

Crystal structure of capsid protein (110-267) from aura virus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
152
structure length
152
Chain Sequence
DRTFAVKNEDGKIMGYAVAMEGKVIKPLHVKGTIDHPALAKLKFTKSSSYDMEFAKLPTEMKSDAFGYTTEHPEGFYNWHHGAVQFSGGRFTIPTGAGGPGDSGRPILDNSGKVVAIVLGGANEGARTALSVVTWNKKGAAIKTTHEDTVEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAPSID PROTEIN
publication title Crystal Structure of Aura Virus Capsid Protease and its Complex with Dioxane: New Insights Into Capsid-Glycoprotein Molecular Contacts
pubmed doi rcsb
source organism Aura virus
molecule tags Hydrolase
total genus 35
structure length 152
sequence length 152
ec nomenclature ec 3.4.21.90: Togavirin.
pdb deposition date 2012-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4agkA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4agkA01
3K2UA 3MNSA 1V2UT 5DP5A 2GVFA 1BRAA 1O2TA 3MTYA 3SU4A 1DY9A 4K2YA 3U1JB 3HKIB 1O3CA 1TGBA 1Q2WA 1BQYA 1IOEA 2H9HA 3M7QA 4A5TS 7KMEH 3UR6A 1SQAA 1WOFA 1O30A 2ZP0H 1EPTB 3A8DA 1O5GH 2FOGA 3T25A 4B73A 3AW1A 4E06H 2BM2A 1XM1A 1TQ0B 3F6UH 1C2EA 2SGPE 3TVJB 2W5EA 4I7YH 3A7TA 1Z6JH 1DXPA 2BLVA 4A1XA 4JZEH 1O2UA 4ISOA 1GHWH 2RCEA 4FUFA 1LPZB 3ATLA 3K9XB 5HYOA 3F9FA 1MU6B 2GT7A 2R2WU 3RLYH 7GCHF 2SGAA 1FAXA 3ZVBA 3QGJA 3DFLA 1DWCH 2AIQA 3FZDA 4K1EA 3S9AA 3WY8A 4ABEA 3A7ZA 1UK2A 4U01A 1P3EA 4X1NU 6ESTA 5E2PA 5EG4A 3PV4A 2BY9X 2QGRA 1EASA 2OLGA 2SGFE 2J34A 3RXBA 2FOCA 1UVOA 1BZXE 5FCRA 1ZGVA 3EGKH 2LNCA 5DP6A 1S85A 3UNQA 3VEQB 1GHXH 1ZHMA 3E1XB 4MPXA 4BAQB 1B5GH 1BIOA 5AHGH 3V3MA 1TX6A 2A45B 4O9VA 1PPZA 2HPPH 3TK6A 1O2GH 3SV9A 4UFEH 1NC6A 5J4SA 3HATH 4I8LA 1O39A 1XUFA 1C1MA 1UTQA 1ANCA 5K0HA 3GY6A 1P03A 1SQOA 3V7TA 3F1SB 1B0EA 1K28D 2OC8A 6GCHG 1THPB 4ISNA 1LTOA 3A80A 2PHBA 2FMJA 3FAOA 1W3CA 2GDEH 2QF0A 1GJ5H 1AFQB 2XBWA 2BQ7B 4I33A 3IWMA 1ZTLA 1C1RA 1W8BH 1NFYA 1O34A 1MKXK 1FY1A 2R9PA 1O2LA 4X1SU 1V3XA 4NZLA 1FIWA 1MBMA 3BV9B 1ZMJA 1WUNH 3TJOA 4BAOB 3UOPA 4AORA 4X8TH 1SGEE 1EUFA 1DWBH 2PGBB 1EPTC 2ZU3A 2OP9A 1C4Y2 3TITA 3A7VA 2GX4A 1O2JA 1EB2A 4RN6A 1W11U 4ABAA 4YOJA 1C5YB 2RA3A 1UCYH 2GV6A 2FX4A 5FPTA 2ZGJA 1C2IA 3TK5A 4DW2U 1EKBB 5EQRA 3S0NA 1E37B 1UK3A 4YT6H 1K1MA 1Y5BT 1QBOA 2BY5X 3MWIU 3GCTG 1NRRH 1BMLA 3SJKA 4D7FA 2V3OH 1GI7B 4ABGA 3OY6U 3TJNA 1OOKB 1LVOA 1ETSH 4X8UH 4U30A 3SJ8A 1LPKB 5E0GA 2HLCA 2HPQH 3RM0H 4XDEA 3S9CA 1ANBA 2ZHDA 3SGQE 3AASA 4Y0YE 1HJAB 2VVCA 3ESTA 1GBBA 2ZCHP 2ZTYA 3UPEA 1QL9A 1CBWB 1HAOH 4DOQA 3SJOA 2G4UA 4Z6AH 2G8TA 3RU4E 3SNCA 1SGPE 3R0FA 5C5NA 4CHAB 4AX9H 4ISLA 3KIDU 1XVOA 5DP7A 1SBWA 4UDWH 2ZTXA 3PTBA 1GVLA 1QA0A 1CGIE 3L33A 4INKA 1EZXC 3BTQE 3RC4A 4AG1A 4IS5A 2VU8E 4FUDA 3NWUA 1AB9C 3LKWA 4TY7A 1C1VH 2ZFQH 4ABJA 4NG9H 2C93B 1CA8B 5E2OA 2BD4A 2GCTB 1GHZA 2GV7A 2FESH 1GJ6A 2Z9GA 4DGJA 3RXSA 2SGEE 1J16A 1SGDE 2R0KA 2GKVE 1GHVH 1EZUC 3BSQA 1QL7A 1MTWA 4O3UA 1A0LA 4NIXA 3RXTA 4I32A 2G81E 1PQ8A 4WJG2 3GY3A 5HM9A 2QN5T 3TGKE 2H9TH 4FU9A 2ODPA 1TGNA 1F5RA 5AF9H 1MCTA 2SGDE 1O3PB 2W26A 3MH5A 4XOJA 1GBEA 3SU0A 2XCNA 3HK3B 1MAYA 4H42U 1C2FA 4TY6A 3MI4A 1GJAB 1BTZA 1GI9B 1TNKA 3U98H 1YGCH 3F68H 2F9PA 4JZDH 4NSVA 3B23B 2Y81A 2GCHF 1V2TT 1TNLA 3SNEA 3U9AH 2XBXA 1GJDB 2BY6X 1G3EA 1JBUH 3VFEA 3NCLA 1QR3E 2P94A 1Z7KA 2XW9A 1BBRE 1O2VA 2EI6A 1AVXA 4BNRA 1ELVA 3T26A 3TH3H 1RD3B 4Q2KA 4YOIA 3U1IB 2FWWA 1A4WH 1H9HE 1LHCH 1UCYK 1AIXH 1VCWA 4ZH8A 1OWDA 1DFPA 1NRSH 1HRTH 4ZXYH 5TCAA 3STIA 1KDQA 1QHRB 2NU0E 2ZO3H 4U2WA 1HAVA 2FLBH 1HJAC 3LT3A 1TAWA 3JZ1B 4ZAEA 4NA9H 2A7JA 1OXGA 1FJSA 1BTXA 5EQSA 3KQBA 1CBWC 1TMTH 1QBNA 3BTTE 1C5SA 3TPIZ 1NRQH 1NS3A 4GCHF 4TWYA 1E36B 2ZF0H 8GCHF 4UONA 3RUOA 4CHAC 2F9VA 1QRWA 4ZKRU 1HLTH 4CBOA 3LH3A 3MNCA 2VIWA 2QXGA 5AVDA 1ZHPA 3VXEH 1C1NA 2I6QA 1OWEA 1M9UA 1OX1A 3PB1E 4INHA 5L2YH 1GI0A 4YLUA 1SFQB 3Q3XA 4X8SH 1AY6H 1NROH 4FUCA 2V35A 1CA0B 3RXPA 1O31A 2FS8A 3S7HB 2GCTC 4GVUA 1Y5UT 1AQ7A 4B76A 5BRRE 1V2VT 2NU3E 2HWLB 3ATIA 3NK8A 4BAKB 4OS7A 5SGAE 1O5AB 2CHAB 1VJ9U 5C20A 5JPMH 1C2JA 2A31A 4JYUH 3RXVA 2FYRA 3KL6A 1GG6B 1GCTC 8ESTE 1DWDH 1LHFH 3MH4A 3SHAH 3UUZA 1GI6A 1VITH 2QYIA 9LPRA 2BOKA 4UE7H 1YLDA 1TPOA 1HCGA 3MU1A 4DURA 2RG3A 1OWHA 1KDQB 2QIQA 1ZMLA 1Z8JB 1HAVB 4YOGA 1K2I1 5EOKA 1CHOF 3SOSA 1H1BA 4O03A 5T6FA 3QZRA 1NU9A 1ZMNA 1N1LA 3T62A 4X6NA 1TRMA 2BLOA 2ESTE 3LGWA 1L2EA 2BVXH 3BTFE 5DG6A 2AERH 2P95A 2B7DH 1V2KT 2OD3B 1OWJA 1P2IA 3GY5A 1JRTA 3VB3A 1EJMA 1T8MA 1WU1A 4DIIH 2PR3A 3RXLA 1GJ9B 3RXCA 1HUTH 3MHWU 3O8BA 3AW0A 2A4QA 2CJIA 1QCPA 3GCHB 4Q7ZA 2GD4B 4X2VA 3LGYA 5T3HA 3SI3H 3RMOH 1EAWA 4MPWA 4E7NA 5A8XA 3SV7A 2BB4A 2FODA 3PMHB 1SLWB 3O8DA 2PKAA 2B5TB 4H6TA 3TJVA 1IHSH 3W95A 2EEKA 1K1JA 3EQ0H 1LHDH 1HXEH 2VH0A 3IG6B 3K6YA 2ZU1A 3QTVH 1O3BA 2HNTF 1DWEH 5DP4A 5ETXA 5B6OA 1V2ST 5FX6A 1XKBC 1SFIA 1BHXB 7GCHG 3MH7A 3SU2A 2ZQ1A 1ELAA 1RJXB 4I8KA 1GBTA 1MKWH 2PFEA 4DIHH 1XUKA 4MNVA 2A32A 3ZZ8A 1TYNA 2FO9A 3S7KB 3N7OA 4ZROA 1GBDA 4UFFH 1TGSZ 2WUBA 4AB9A 4YLQH 1C5QA 2ANKH 4X6PA 2P59A 1CA0C 1H8IH 1H9LB 1AVGH 1TQ7B 1OWIA 3A83A 5EPYA 3MH6A 3M3VA 1SOZA 1O3JA 2B9LA 2W3KA 1Z1IA 2AYWA 1ESBA 2GP9B 4FU8A 3ZVDA 2VWNA 1TA6A 4ZHAA 4AGJA 1YCPM 4A6LA 4K8YA 1GHYH 2ZG0H 1ELEE 3UQOA 1C9TA 1C1SA 2HNTC 3E0NB 4DG4A 1GG6C 1ZJDA 2ANYA 1K9OE 1PJPA 4X2XA 5C1XA 1FUJA 4LZ4B 1Q3XA 1AZZA 2AMDA 1EOJA 1C4V2 1C1TA 1JIMA 1KLTA 4AFQA 1CU1A 3LPRA 3RLWH 3LC5A 4NCYA 2F9BH 2O9QA 1GBJA 2P16A 1EX3A 3V13A 1YC0A 3Q3KA 1HGTH 1Y8TA 3URCA 2PKAB 1EPTA 5FAHA 3C27B 4RSPA 4GAWA 3F9HA 4WH6A 5AFYH 1BHXF 1P8VC 4XBBA 1O2SA 4IC6A 3SN8A 3PYHA 2Y5HA 3GISB 4CBNA 2ZDLA 3SGBE 2XNIA 2H2ZA 2HOBA 3M61U 2STBE 1O2RA 2YNBA 2BD8A 2OUAA 2FM2A 1U6QA 2P3FH 1W7GH 1V2LT 1QY6A 1RFNA 4Y8YA 1TNJA 2BD7A 3L3TA 1J9CH 1AUTC 3GCHC 1W12U 2WV5A 1UJ1A 2F91A 3LIWA 1FQ3A 1W14U 1YYY1 1AUJA 1GHBG 2C90B 1V2WT 4LZ1H 3PWBA 3DUXH 3SUDA 1KY9A 3SHCH 3L6PA 4K69A 3OX7U 1GGDB 3BG8A 1YPKH 2ZZUH 5L30H 4Q7XA 1SG8B 1O3EA 1XUIA 2Z3DA 1AO5A 2F9OA 4WY3A 2PGQB 2D2DA 1ELDE 1SB1H 2AGEX 3OY5U 2WYJA 1IQLA 2BDYA 4LK4A 3D49H 3E0PB 3V0XA 1WTGH 4JZ1A 3ZV8A 1LQDB 3RU4T 1P09A 1CT0E 1A0HB 3QX5H 1TBRH 5J4QA 1YPLH 1TX8A 1FAKH 1GDQA 5EXLA 1S6FA 4AFSA 1NFXA 2O8WA 4M7GA 1DSUA 1AI8H 1XUHA 3KQEA 4O97A 2QAAA 2XC0A 1K1LA 3TLOA 1SLXB 1MKWK 5LGOA 1Y3UA 1FNIA 1MTVA 1V2JT 5DPAA 4AZ2B 1VZQH 3MO3A 2C8YB 2JETB 1O2QA 3LONA 2ZGXH 5A8YA 1KXFA 1OWKA 1GMDF 2W3IA 4KTUA 2AMPA 1UTKA 2V6NA 1C5MD 3UQVA 2ZGCA 2Y6TA 3GYLB 3M36A 3ZVAA 1O5CB 3K6ZA 3R3GB 1KYNA 2ZPRA 3RXAA 1J8AA 2GMTC 1SGTA 1ZSJA 1P04A 4KTCA 1GCDA 5EPNA 4TPIZ 2VH6A 2AFQB 4NIWA 1AHTH 2DUCA 4B74A 1BRCE 1C1UH 1GHAF 3NKKA 3P8GA 1F0RA 4DCDA 1SC8U 1PYTC 1AFEH 1EP6A 2BDAA 1FY8E 2V0BA 3ZVFA 2FOEA 2GZ7A 1D3DB 2BX3A 1GDNA 2ULLA 1ZOMA 4ZKSU 2G4TA 4FUEA 1EZQA 1V2QT 1O2WA 3A89A 4Y71A 5EXMA 5A0AE 1G32B 5L6NH 5E8EH 3E8LA 1FN8A 1T32A 3T2NA 1EB1H 1YPHC 2Y5GA 3OTJE 1GBMA 2ANWA 4OS6A 4GPGA 4KKDA 1NTPA 2C8ZB 1XUGA 4WXIA 2KAIA 4JCNA 5E0JA 2HGTH 3HKJB 3DHKH 1AB9B 2GDDA 4WH8A 1GBCA 4K8BA 1KSNA 2ZHEH 1QB9A 1Z8GA 3RXQA 1F0SA 3O8RA 4JK6A 3RXRA 1IQMA 2B0FA 2GCHG 1GGDC 1DM4B 1RTKA 1SL3A 3SU1A 1T8OA 1L0ZA 1O3LA 1FN6A 3H5CB 4MLFB 2CXVA 5LH8A 5K7RA 1SGRE 2BDCA 2G5VA 2AMQA 5G4BA 1D6RA 2G00A 5DP3A 2VWOA 3Q3YA 1LPGB 2FOAA 4FU7A 1C5RA 1C5LH 1HAPH 1FI8A 3PLBA 5I46H 4WXVA 1HAYB 1BMAA 2C3SA 3AVZA 3TH2H 3TGJE 1TFXA 4IW4E 3FVFB 3A8BA 1UO6A 2J38A 3OU0A 4TYDA 1MTNB 1V2PT 1W7XH 3U8OH 1JXPA 2TGTA 3EE0B 1NY22 1W10U 1QJ7B 5EU8A 4GHTA 4GCHG 1HAIH 3BG4B 8GCHG 1F7ZA 2QA9E 5JBCS 2FZZA 2BZAA 3EAJA 1LMWB 4ISIH 2JETC 1TWXB 1JWTA 4X2YA 5DJ7A 1DDJA 4BXSA 2J2UA 3H7TA 2R2MB 3A7YA 1IQKA 1AGJA 1L1JA 1PPCE 3F9EA 2C8WB 1QBVH 1MUEB 1ZJKA 3GCOA 4A1TA 3E91A 1WBGB 2F9NA 1QJ1B 2KAIB 4INLA 3ELAH 3TNTA 2ZHQH 5DGJA 1DSTA 1TOMH 1A5HA 1PPHE 2SFAA 1S0QA 4MTBA 1GMCG 2H5CA 2ZU4A 3MNXA 1MD7A 1TB6H 3DFJA 3LJJA 3OSYA 1P3CA 3ZZ4A 4DT7B 2ZDNA 2W7UA 3MU8A 4B2AA 3MU5A 3B8JA 1HFDA 2NU4E 2ZA5A 2XRCA 2A7CA 3I78A 4ISHH 4U32A 1A61H 1SR5C 1ABJH 1IQEA 1HAHH 2EA3A 4MPUA 1PQ5A 2THFB 4JZFH 2A5IA 3JZ2B 3LH1A 4ABHA 1O2XA 1CGJE 4OS4A 2H5DA 4K5ZA 5A8ZA 1AE8H 3EA7A 1CHOG 1VCQA 2D1JA 3B9FH 2BY7X 1OYTH 3SJ9A 3LGTA 3VB4A 1T4UH 1KIGH 2Y82A 1O38A 1TNGA 2ZFFH 3CS7A 3UY9A 2GZ9A 2OC0A 5A09A 4FXGH 2WYGA 3FANA 1K21H 3AAUA 3FP8E 1GCTB 1BBRH 4YT7H 1P01A 1NFWA 1BB0B 3GY4A 2Z3CA 4FVDA 3T28A 1MTSA 1NU7B 1IQHA 1SOTA 1YPEH 2H9EH 4AFUA 1S84A 3PLPA 3T5FH 4ABIA 2FI4E 1A5IA 1O3AA 2BXUH 1AD8H 1PPBH 3BTHE 1DLEA 5JB9S 2CF8H 1LCYA 4XE4A 1MTNC 1O5FH 3QO6A 1SGNE 1TA2A 3MO6A 2FOBA 1F0TA 1SI5H 3BG4C 1FDPA 2J9NA 2PLXA 2VINA 1IQNA 3A88A 5GJ4B 1K22H 5C67A 4CRBA 3P6ZB 5DP8A 3M7TA 1TPPA 1QGFA 1TX7A 5F8XA 4ESTE 2OBQA 1MCVA 4DVAU 2FI5E 1P06A 5LPFA 2P8OC 5F03A 4XBDA 1SGQE 4XBCA 3P8OA 1ZR0A 1N6XA 3E3TA 4MQAA 5FBIA 3UNRA 2H6MA 1S82A 1TONA 1CE5A 1O37A 4UEHH 4YTAA 1LHEH 1YPHE 4B75A 3DD2H 4SGBE 3A82A 1HV7A 3ZZ6A 5JDUB 4HZHA 2ZFTA 1CQQA 1PFXC 4I31A 1O0DH 2WINI 4ABFA 2A1DB 1XXFA 1ELTA 5C5OA 2WPMS 3SW2B 1GVZA 3TH4H 1Y3XA 2A2QH 5DO4H 3ZZAA 4CRGA 3TIUA 3QWCH 3RXGA 4CR5A 1D3TB 6LPRA 4WVPE 4YO9A 1PPFE 1TLDA 1RTFB 2OC1A 3RU4D 1UTNA 2WPJS 3PMAB 1W2KH 3UTUH 1RXPA 1G3CA 2BYAX 5F8ZA 5I25A 3RXUA 3CENA 3MFJA 4NIYA 2P3TB 1A2CH 4VGCC 3P95A 3GCTF 4AG2A 3G01A 1TOCB 1T8NA 1P9UA 3QDZB 3DA9B 3UWIA 1G37A 4D76A 1J15A 1G2MA 1EP5A 4IMQA 1TNHA 1G9IE 1C5NH 2ZEBA 1TRNA 4DJZB 5C1UA 4FUHA 1QRXA 3BEUA 3MU4A 5JBBS 1BITA 1C1OA 1TMBH 1MU8B 2DE8A 1SLUB 1JIRA 2QXJA 2Z9KA 3KHVA 1G30B 2JH6D 4MG3A 1O3NA 2WV4A 1GJBB 3VB5A 1BBRK 3KGPA 3SV2H 2O8LA 3RMLH 1O3DA 3PMBB 1SGFA 2CF9H 3SZNA 1KXEA 1OYQA 1UMAH 1P2OA 1BTYA 1PQAA 5A0CA 2OQUA 2BDIA 2UUFB 8LPRA 2J95A 2QY0B 3SORA 2OXSA 4NWLA 1AKSA 1P02A 1T7CA 2Z7FE 4MVNA 3M5NA 4YM9A 2NU2E 3A86A 1J17T 1Z1JA 2GZ8A 5GCHF 2FX6A 3P8FA 2F83A 5GXPA 3OYPA 4NIVA 1ETRH 3M3TA 3RXFA 5FCKA 2A2XH 1ZSKA 1EATA 1WYKA 3DT0H 1O3HA 2ALVA 2Z3EA 3QGNB 1DY8A 2VGCC 1VJAU 2IN2A 3GY7A 1SSXA 2UUKB 3ZYEA 4A92A 1ESTA 2PUQH 3QZQA 1E35B 3LJOA 2BVSH 2HRVA 1DUAA 1ZPCA 1YM0A 3LOXA 2C4FH 3E6PH 4IBLH 2FI3E 4IMZA 1LQEA 3UR9A 5FPSA 1Y3YA 3EDXB 3P17H 1AE5A 2CV3A 1P2JA 3ODDA 1DPOA 4I8HA 2J94A 2AS9A 1C2GA 1GI2A 5E0HA 4UFDH 1O3GA 2G52A 2AEIH 2VIVA 4YESB 1UTMA 1OKXA 2FOHA 1G3BA 3QK1A 3P8NA 3QTOH 1GBFA 1GHAG 1LDTT 2VIQA 1KXCA 2F9UA 1RTLA 1CT2E 4CRFA 1O3KA 3RP2A 3AAVA 2XCFA 4I8JA 2Q6FA 2W7SA 1QTFA 3P70B 4F49A 4CRAA 2XBVA 1B7XB 1WTHD 2F3CE 2OINA 2WPHS 3NPSA 1OS8A 1AN1E 1GVKB 1JOUB 1AKSB 1GL0E 4ZHMU 1P05A 1V2NT 1P12E 3RXKA 3V12A 1OP2A 2NU1E 1HPGA 3VB7A 1GWAA 2G5NA 1C9PA 2ZDMA 2XXLA 2QXHA 1FIZA 1L4ZA 3EA9A 1LKAA 3HPTB 4MNYA 2PV9B 5ABWA 2ZFSA 3S9BA 1TMUH 2GMTB 1O5EH 5LPEA 4XSKU 5DKMA 1MH0A 1P2MA 3T27A 4WMFA 2FPZA 4X1PU 6CHAC 2ZHWH 1O2NA 2WPIS 4BXWA 2TGAA 1HB0B 2RDLA 4ABDA 3PWCA 1ID5H 1A3EH 1L1GA 2BQWB 3ZZ9A 9ESTA 2Y5FA 1TNIA 2CMYA 2BVRH 3KF2A 2QCYA 3D23A 3MU0A 4MNWA 1BTWA 1F5LA 4SGAE 5F8TA 3D65E 3RMMH 2DE9A 3RXHA 3TK9A 4Y10E 1BOQA 1LO6A 1SQTA 4R0IA 3LDXH 3M5MA 1MTUA 2XWAA 1ABIH 1Z6EA 4AGKA 3ZZCA 1OPHB 3PLKA 1FZZA 1MZAA 1O33A 2BY8X 2ZI2H 2FTLE 1KXBA 4AYVB 5HM2A 1GI5A 3ZVEA 4AB8A 4D7GA 1TRYA 1V2RT 2YNAA 3HGNA 1YPGH 1G36A 3ATWA 3SI4H 5TJXA 3ZYDA 3A85A 3Q77A 1MAXA 1SVPA 4AN7A 1QIXB 3VPKA 2Z9LA 3MYWA 4CRDA 2BD5A 1WAYB 4NFEA 2Y7ZA 1K1OA 1HAXB 2HALA 1ZLRA 2VVUA 4Y11E 3TU7H 1C5OH 1VCPA 1DX5M 1LVYA 4FUGA 1BTUA 2XYAA 2TIOA 2Z94A 3A8CA 1E0FD 5FHTA 1O2MA 3URDA 4MNXA 1C2KA 1C1QA 1GBKA 2A4OA 3M3SA 1SHYA 3M7UA 2ZKSA 2XBYA 4NWKA 1O2KA 1BRUP 3BF6H 1C5WB 1YPJH 4X1QU 1WQSA 3SUEA 1YF4A 1UVTH 2XWBI 2PTNA 2RA0A 1TBQH 3SQHE 5PTPA 3U8TH 1X7AC 2PWXA 5IDKA 1P57B 2VWMA 2J4IA 1BDAA 1BT7A 2SNVA 5LPRA 1P10A 3ENSB 3SU5A 4A7IB 1Y59T 2I6SA 1ELGA 3E90B 1HIAA 1FXYA 2OQ5A 1ANEA 1CHGA 4GSOA 1C5TA 1N8OC 4CREA 4ZKOU 1A1RA 3RXEA 3BTWE 1O36A 5T6GA 1GMHF 1PQ7A 1UVPA 3GOVB 3ZZBA 2AGIX 4FUIA 2VNTA 1RIWB 1FPHH 1KTSB 2XC5A 4X1RU 4Z0KA 2Q6DA 1O2IA 1P2KA 4NFFA 2Y80A 2QF3A 5L2ZH 2IPHA 2CN0H 5CMXH 1V2MT 2BDGA 1KXAA 3BIVH 1INCA 4I8GA 1AVWA 4QT8C 1FY5A 1H8DH 3RC6A 5H4IB 5JYIA 4J1YA 4K1SA 1GJ7B 2JKHA 2ZECA 3BEIB 1FLEE 3E16B 1GI3A 1SHHB 3K65B 3A87A 1ELFA 7ESTE 1D3QB 5EXNA 1O3MA 1H4WA 1ZTJA 4OGXA 1E34B 1DITH 2ZNKH 1YBWA 1D9IA 3RXJA 3U69H 3QN7A 2TGDA 1BMMH 1GJ4H 4F4OC 3SV6A 2ANMH 2SNWA 1TPAE 5GDSH 3LGVA 1HAZB 3FP6E 2P3UB 3A81A 1ZYOA 3UOUA 5GIBA 1C5ZB 3M5OA 2WUCA 4E7RG 4B2BA 5A0BA 1EAXA 1EXFA 1V6DA 1UK4A 2ZQ2A 1BJUA 2GTBA 1FV9A 2IJOB 2A5AA 2BD2A 4AOQA 1HIAB 1L1NA 2HNTE 2BD9A 1IAUA 2FOMB 3ZZ3A 4D9RA 2ZCLP 2H1UA 3M37A 1H9IE 1BA8B 4O3TA 1ZRKA 3SQEE 1GJ8B 2ZGBH 1YKTA 4MDSA 1DS2E 1HBTH 2M5TA 1T4VH 4YZUA 2EC9H 1HNEE 1NESE 1LVBA 8KME2 1C1PA 1NO9H 3A84A 2A4RA 5AFZH 4B2CA 3GCNA 2G51A 2BOHB 1ZTKA 1HYLA 5ESBA 1NN6A 1O32A 3MNBA 4CH2B 2PKSB 1IHTH 5IYTA 2WPLS 3T29A 4Y76A 1ARBA 2FEQH 3SUFA 4OS2A 2P8OB 7LPRA 2ODYB 1GHBF 3ZV9A 1BTPA 3RXIA 1G3DA 1QNJA 1QQUA 1ZSLA 1QFKH 3NZIA 3ATKA 1VITF 3A7XA 1BJVA 1C1WH 1P2NA 4BTUB 3BEFB 3I29A 2O8MA 3ZZ7A 1VR1H 1SLVB 1GBIA 2BXTH 3QUMP 5FX5A 1LVMA 5A2MH 2TGPZ 1GBLA 4KGAA 4BAMB 1RIWC 1QL8A 1EAUA 1ELBA 2ZWLH 5CHAB 3I77A 4OS5A 4IN2A 1YP9A 5TCCA 3KN2A 1GI1A 4K60A 2Z9JA 1GPZA 2B8OH 3ODFA 1HJ8A 1AZ8A 3VB6A 3RXMA 1VGCB 3LGUA 2BDHA 3SU6A 2ZPQA 2LPRA 1O5DH 1S81A 1MD8A 2ODQA 5BPEA 3ZVCA 2BQ6B 1KLJH 2BHGA 2FLRH 2Z9IA 1GI4A 1DVAH 2UWLA 4WMDA 1UCYE 1THSH 3GYMA 1F0UA 1NFUA 1O35A 1T8LA 1ZPBA 2BLQA 1DLKB 4WWYA 2V3HH 2A7HA 2XTTB 4VGCB 2PUXB 4NA7A 2GT8A 2BD3A 1YLCA 2FOFA 4IC5A 1Q31A 1TGTA 1ZPZA 1SGYE 3LU9B 4ZKNU 3SNAA 2D26C 1XKAC 5GCHG 5DK1A 1TE0A 1D6WA 1EJAA 1L4DA 1XMNB 2PW8H 1ESAA 1O2PA 3GDUA 1LHGH 4NSYA 2K1QA 5EGMA 1AWFH 2Q1JA 4TWWA 2J92A 3ITIA 1Y5AT 5ESTE 1CGHA 4RKJB 2QXIA 2G55A 1F92A 3PTNA 3GDSA 1Z71A 2ZU5A 4Y8XA 1C2DA 1TGCA 1AFQC 2GGVB 3RDZA 3ZVGA 1P11E 3PROA 3KNXA 1SMFE 1AU8A 3SNDA 1CT4E 4A1VA 2FTMA 2ZC9H 2ZFPH 4X2WA 2FIRH 5C3NA 5HXFA 1HXFH 1UVSH 3UNSA 4DY7B 1YCPH 2PKSC 1S0RA 1MZDA 1KLIH 1ELCA 1O5BB 4ZMAH 1GI8B 4KP0A 3UIRA 2FS9A 4X8VH 2FXRA 1C5UA 4GHQA 3SBKA 3HK6B 1Z8IB 1NRNH 3VGCB 3SO3A 4KTSA 1HDTH 1O3OA 2A4GA 2D8WA 3RM2H 5F6MA 2ZDKA 2VGCB 1CO7E 3KCGH 1A46H 4JMYA 1K1PA 1W0ZU 3BTEE 6GCHF 2ASUB 1WSSH 4HFPB 1IQJA 1EAIA 4ASHA 4UFGH 5CHAC 3UWJH 1UTPA 1A5GH 3SJIA 1HJ9A 3O8CA 3GY2A 1OP0A 2STAE 3NXPA 2A0QB 1VGCC 5C1YA 4IN1A 2BDBA 1Y3WA 1N6YA 4Y6DA 1DOJA 1UTJA 1O3FA 2ZFRH 1GJCB 3Q00A 4R8TB 1NM6A 5FBEA 3LGIA 3MO9A 2PTCE 3PM3A 4Y7AA 5HMAA 2PSYA 1ANDA 1JMOH 1PPGE 2Q6GA 2IOTA 2SGQE 2OC7A 1XX9A 1BTHH 4ZUHA 2R0LA 2JH0D 3D62A 4J2YB 5CE1A 1GBAA 3STJA 1DANH 2O8TA 4BANB 4WF8A 2VIDA 1EOLA 1BCUH 1QURH 2Z6BD 2BTCE 5EW2H 1O2HA 1K1IA 4LXBH 3M35A 2UWPA 1NT1A 1ARCA 3ZZ5A 1THRH 1ZRBA 2EI7A 1C2LA 1V2OT 3GICB 2BLWA 2NWNA 1GMCF 1KTTB 4HGCA 1SGFG 1RRKA 4IGDA 1Z8RA 4NZQA 3S69A 1O3IA 2ZHFH 2ZPSA 4K1TA 2VWLA 6CHAB 1QB1A 3W94A 3BTME 2R3UA 2ZGHA 4Y79A 3SUGA 3BN9A 4NGAH 4D9QA 5T6DA 1F5KU 4Y0ZE 1QB6A 4ABBA 5GWZA 4PROA 1IQFA 2ZIQH 4H4FA 1F2SE 1K1NA 3PMJA 1FY3A 1W13U 1W0YH 2R3YA 4CRCA 3CS0A 5EODA 1XXDA 3IITA 1MMJN 1GL1A 2ZDVH 3H7OA 3NUMA 4KELA 4X6MA 2TPIZ 1SGCA 1TBZH 1DXWA 1SGIB 1ZZZA 4TPYA 4AFZA 3TGIE 1DT2A 4AYYB 1CVWH 4JYTA 2VVVA 3A8AA 3SGAE 3VGCC 2EI8A 1WQVH 3CP7A 1NPMA 2P93A 3LC3A 5EQQA 1A0JA 4X6OA 1PYTD 2ZDAH 1YCPK 1NRPH 4BAHB 1TIOA 3HGPA 1C5XB 1TPSA 4D8NA 1GMDG 1YPMH 1NZQH 4GUXA 3SV8A 2ZU2A 4UD9H 1C2MA 1T31A 1TALA 1C5PA 4Q7YA 1QRZA 2TRMA 1S6HA 5EW1H 1OP8A 1S83A 1FONA 3U8RH 2QV1A 2FP7B 1D4PB 1QQ4A 4JK5A 1JRSA 1RGQA 4HTCH 1BUIA 1GMHG 1TABE 4X0WU 1UTOA 2ILNA 2BZ6H 3PO1B 1RS0A 4FUJA 3RXOA 4H6SB 2A5KA 4HI3A 3EYDA 5JBTA 1D3PB 2BMGB 5C2ZA 4CR9A 1C5VA 2OTVA 3A7WA 2O8UA 1WCZA 2Y7XA 1ZGIA 4RKOB 4BTIB 4OS1A 1P2QA 2UWOA 1UTLM 1P9SA 1UVUH 3KEEA 4WMEA 2ZCKP 1XVMA 1FY4A 4JZIA 4FUBA 4B71A 1Y3VA 2UUJB 2CGAA 2BX4A 4THNH 2ALPA 4NA8A 3FP7E 4BTTB 1DE7H 4ZXXH 2CHAC 1IQIA 2FYQA 5GPIB 1EQ9A 1N8OB 4OGYA 3ATMA 1EJNA 3BTDE 2VB0A 3UREA 1AWHB 3SNBA 3VXFH 1UHBA 2AGGX 4Q80A 2WPKS 3Q76A 3BTKE 2FDAA 4LOYH 2OBOA 2PSXA 3BIUH 4ZHLU 2JH5D 1P0SH 3TNSA 1ZHRA 2HVXA 1AMHA 3FZZA 1MQ5A 3KQCA 1OSSA 3C1KA 3QLPH 4BOHA 2TBSA 4Y8ZA 3KQDA 1ACBE 1C2HA 3RXDA 5JB8S 1B0FA 1ORFA 2UUYA 3MOCA 1A7SA 1J14A 1SPJA 4Y7BA 5JBAS 1GDUA 4CH8B 3MMGA 1GBHA 5FXLA 1G2LA 3UFAA 3P92A 3TJUA 1IQGA 1A3BH 1MBQA 1XUJA 2QC2A 1HAGE 5HGGA 1QA7A 4GLYA 3ZZDA 1O2ZA 5FPYA 1C4U2 1ETTH 3GDVA 1PPEE 1EZSC 1QJ6B 1WV7H 2AIPA 1BRBE 2VJ1A 4B1TA 1O2OA 5DP9A 4K3JA 1MKXH 2OCVB 3RMNH 4MPVA 1FMGA 1E38B 2VIPA 3SU3A 1VITG 2XC4A 3M5LA 1DICA 3RC5A 1DUEA 2VIOA 3F9GA 3EA8A 4E05H 1FPCH 3GY8A 2C8XB 4FVBA 1KXDA 1S5SA 2ZTZA 1UHBB 3BTGE 3PO1C 1BMNH 1LKBA 1MQ6A 3FFGA 4JYVH 1O2YA 2AH4X 1CSOE 2YOLA 4XFQA
chains in the Genus database with same CATH superfamily
3K2UA 2W6ID 3MNSA 1V2UT 5DP5A 2GVFA 1BRAA 1O2TA 3PV5A 3MTYA 3SU4A 1DY9A 4K2YA 3U1JB 3HKIB 1O3CA 1TGBA 1Q2WA 3OTPA 1BQYA 1IOEA 2H9HA 3M7QA 4A5TS 7KMEH 3UR6A 1SQAA 1WOFA 1O30A 2ZP0H 1EPTB 3A8DA 1O5GH 2FOGA 3T25A 4B73A 3AW1A 4E06H 2BM2A 1XM1A 2QF4A 1TQ0B 3F6UH 1C2EA 2SGPE 3TVJB 2W5EA 4I7YH 3A7TA 1Z6JH 1DXPA 2BLVA 2RDEA 4A1XA 4JZEH 1O2UA 4ISOA 1GHWH 2RCEA 4FUFA 1LPZB 3ATLA 3K9XB 5HYOA 3F9FA 1EFRD 1MU6B 2GT7A 2R2WU 3RLYH 7GCHF 2SGAA 2L6OA 1FAXA 3ZVBA 3QGJA 3DFLA 1DWCH 2AIQA 3FZDA 4K1EA 3S9AA 3WY8A 4ABEA 3A7ZA 1UK2A 4U01A 1P3EA 4X1NU 6ESTA 5E2PA 5EG4A 3PV4A 2BY9X 2QGRA 1EASA 2OLGA 2SGFE 2J34A 3RXBA 2FOCA 1UVOA 1BZXE 5FCRA 3FO8D 5C94A 1ZGVA 3EGKH 2WHXA 2LNCA 2LP6A 1S85A 5DP6A 3UNQA 3VEQB 1GHXH 1ZHMA 3E1XB 4MPXA 4BAQB 1B5GH 1BIOA 5AHGH 3V3MA 1TX6A 2A45B 4O9VA 1PPZA 2HPPH 3TK6A 1O2GH 2KZ4A 4UFEH 3SV9A 1NC6A 5J4SA 3HATH 2KCPA 4I8LA 1O39A 1XUFA 2W6JD 1C1MA 1UTQA 1ANCA 5K0HA 3GY6A 1P03A 1SQOA 3V7TA 3F1SB 1B0EA 2KCYA 1K28D 3OE7D 2OC8A 2XOKD 6GCHG 1THPB 4ISNA 1LTOA 4FETA 3A80A 4I86A 2PHBA 4Z1MD 2FMJA 3FAOA 1W3CA 2GDEH 2LELA 2QF0A 1GJ5H 1E1RD 1AFQB 2XBWA 2BQ7B 4I33A 3IWMA 1ZTLA 1C1RA 1W8BH 4TSFD 1NFYA 1O34A 1MKXK 1FY1A 2R9PA 1O2LA 4X1SU 1V3XA 4NZLA 1FIWA 1MBMA 3BV9B 1ZMJA 1WUNH 3TJOA 4TT3D 4BAOB 3UOPA 4AORA 4X8TH 1SGEE 1EUFA 3ZIAD 1DWBH 2PGBB 1EPTC 2ZU3A 2OP9A 1C4Y2 3TITA 3A7VA 2GX4A 1O2JA 1EB2A 4RN6A 1W11U 4ABAA 4YOJA 1C5YB 2RA3A 1UCYH 2GV6A 2FX4A 5FPTA 2ZGJA 1C2IA 3TK5A 4DW2U 1EKBB 5EQRA 3S0NA 1E37B 1UK3A 4YT6H 1K1MA 1Y5BT 2F43B 1MABB 1QBOA 2BY5X 3MWIU 3GCTG 1NRRH 1BMLA 3SJKA 4D7FA 2V3OH 1GI7B 4ABGA 3OY6U 3TJNA 3DCLA 1OOKB 1LVOA 3UAIC 1ETSH 4X8UH 4U30A 3SJ8A 1LPKB 5E0GA 2HLCA 2HPQH 2WPDD 3RM0H 4XDEA 3S9CA 1ANBA 2ZHDA 2KCOA 3AASA 3SGQE 4Y0YE 1HJAB 2VVCA 3ESTA 1GBBA 2ZCHP 3OFND 2ZTYA 3UPEA 1QL9A 1CBWB 1HAOH 4DOQA 3SJOA 2G4UA 4Z6AH 2G8TA 3RU4E 3SNCA 1SGPE 3PRDA 3R0FA 5C5NA 4CHAB 4AX9H 4ISLA 3KIDU 1XVOA 5DP7A 1SBWA 4UDWH 2ZTXA 3PTBA 1GVLA 2QF5A 1QA0A 1CGIE 3L33A 4INKA 1EZXC 3BTQE 3RC4A 4AG1A 1QZ8A 4IS5A 4F55A 2VU8E 4FUDA 3NWUA 1AB9C 3LKWA 4TY7A 1C1VH 2ZFQH 4ABJA 4NG9H 2C93B 1CA8B 5E2OA 2BD4A 2GCTB 1GHZA 2GV7A 2FESH 1GJ6A 2Z9GA 4DGJA 3RXSA 2SGEE 1J16A 3CNRA 1SGDE 2R0KA 5IK2D 2GKVE 1GHVH 1EZUC 3BSQA 2JDID 1QL7A 1MTWA 2K0QA 4O3UA 1A0LA 4NIXA 3RXTA 4I32A 2G81E 1PQ8A 4WJG2 3GY3A 5HM9A 2QN5T 3TGKE 2H9TH 4FU9A 2ODPA 1TGNA 1F5RA 5AF9H 1MCTA 2SGDE 1O3PB 2W26A 3MH5A 4XOJA 1GBEA 3SU0A 2XCNA 3HK3B 1MAYA 4H42U 1C2FA 4TY6A 3MI4A 1GJAB 1BTZA 1GI9B 1TNKA 3U98H 1YGCH 3WWFA 3F68H 5CDFE 2F9PA 4JZDH 4NSVA 3B23B 2Y81A 2GCHF 1V2TT 1TNLA 3SNEA 3U9AH 2XBXA 1GJDB 2BY6X 1G3EA 1JBUH 3VFEA 3NCLA 1QR3E 2P94A 1Z7KA 2XW9A 1BBRE 1O2VA 2EI6A 1AVXA 4BNRA 1ELVA 3T26A 3TH3H 1RD3B 4Q2KA 4YOIA 3U1IB 2FWWA 1A4WH 1H9HE 1LHCH 1UCYK 1AIXH 1VCWA 4ZH8A 1OWDA 1DFPA 1NRSH 1HRTH 4ZXYH 5TCAA 3STIA 1KDQA 1QHRB 2NU0E 2ZO3H 4U2WA 1HAVA 2FLBH 1HJAC 3LT3A 1TAWA 3JZ1B 4ZAEA 4NA9H 2A7JA 1OXGA 1FJSA 1BTXA 5EQSA 3KQBA 1CBWC 1TMTH 1QBNA 3BTTE 1C5SA 3TPIZ 1NRQH 1NS3A 4GCHF 4TWYA 1E36B 2ZF0H 8GCHF 4UONA 3RUOA 4CHAC 2F9VA 1QRWA 4ZKRU 1HLTH 4CBOA 3LH3A 3MNCA 2VIWA 2QXGA 5AVDA 1ZHPA 3VXEH 1C1NA 2I6QA 1OWEA 1M9UA 1OX1A 3PB1E 4INHA 5L2YH 1GI0A 2HVYB 4YLUA 1SFQB 3Q3XA 4X8SH 1AY6H 1NROH 4FUCA 2V35A 1CA0B 3RXPA 1O31A 2FS8A 3S7HB 2GCTC 4GVUA 1Y5UT 1AQ7A 4B76A 5BRRE 1V2VT 2NU3E 2HWLB 3ATIA 3NK8A 4BAKB 4OS7A 5SGAE 1O5AB 2CHAB 1VJ9U 5C20A 5JPMH 1C2JA 2A31A 4JYUH 3RXVA 2FYRA 3KL6A 1GG6B 1GCTC 8ESTE 1DWDH 1LHFH 3MH4A 3SHAH 3UUZA 1GI6A 1VITH 2QYIA 9LPRA 2BOKA 4UE7H 1YLDA 3FN8A 1TPOA 1HCGA 3MU1A 4DURA 2RG3A 1OWHA 1KDQB 2QIQA 1ZMLA 1Z8JB 5DN6D 1HAVB 4YOGA 1K2I1 5EOKA 1CHOF 2YMSD 3SOSA 1H1BA 4O03A 5EJ1A 5T6FA 3QZRA 1NU9A 1ZMNA 1N1LA 3T62A 4X6NA 1TRMA 2BLOA 2ESTE 3LGWA 1L2EA 2BVXH 3BTFE 2KM0A 5DG6A 2AERH 2P95A 2B7DH 1V2KT 2OD3B 1OWJA 1P2IA 3GY5A 1JRTA 3VB3A 1EJMA 1T8MA 1WU1A 4DIIH 2PR3A 3RXLA 1GJ9B 4XRNA 3RXCA 3MHWU 3O8BA 1HUTH 3AW0A 2A4QA 2CJIA 1QCPA 3GCHB 4Q7ZA 2GD4B 4X2VA 3LGYA 5T3HA 3SI3H 3RMOH 1EAWA 4MPWA 4E7NA 5A8XA 3SV7A 2BB4A 2FODA 3PMHB 3OEED 1SLWB 2WZQA 3O8DA 2PKAA 2B5TB 4H6TA 3TJVA 1IHSH 3W95A 2EEKA 1K1JA 3EQ0H 1LHDH 1HXEH 2VH0A 3IG6B 3K6YA 2ZU1A 3QTVH 1O3BA 2HNTF 1DWEH 2EY4C 5DP4A 5ETXA 5B6OA 1V2ST 5FX6A 1XKBC 1SFIA 1BHXB 7GCHG 3MH7A 3SU2A 2ZQ1A 1ELAA 1RJXB 4I8KA 1GBTA 1MKWH 2PFEA 4DIHH 1XUKA 4MNVA 2A32A 3ZZ8A 1TYNA 2FO9A 3S7KB 3N7OA 4ZROA 1GBDA 3DSOA 4UFFH 1TGSZ 2WUBA 4AB9A 4YLQH 1C5QA 2ANKH 4OM9A 4X6PA 2P59A 1CA0C 1H8IH 1E1QD 1H9LB 1AVGH 1TQ7B 1NBME 1OWIA 3A83A 5EPYA 3MH6A 3M3VA 1SOZA 1O3JA 2B9LA 2W3KA 3KYGA 1Z1IA 2AYWA 1ESBA 2GP9B 4FU8A 3ZVDA 2VWNA 1TA6A 4ZHAA 4AGJA 1YCPM 4A6LA 4K8YA 1GHYH 2ZG0H 1ELEE 3UQOA 1C9TA 1C1SA 2HNTC 3E0NB 4DG4A 3EE7A 1GG6C 1ZJDA 2ANYA 1K9OE 1PJPA 4X2XA 5C1XA 1FUJA 4LZ4B 1Q3XA 1AZZA 2AMDA 1EOJA 1C4V2 1C1TA 1JIMA 1KLTA 4AFQA 1CU1A 3LPRA 3RLWH 3LC5A 4NCYA 2F9BH 1KMHB 2O9QA 1GBJA 2P16A 1EX3A 3V13A 1YC0A 3Q3KA 1HGTH 1Y8TA 3URCA 2PKAB 3WWBA 1EPTA 5FAHA 3C27B 4RSPA 4GAWA 3F9HA 4WH6A 5AFYH 1BHXF 1P8VC 4XBBA 1O2SA 4IC6A 3SN8A 3PYHA 2Y5HA 3GISB 4CBNA 5EJZA 2ZDLA 3SGBE 2XNIA 2H2ZA 2HOBA 3M61U 2STBE 1O2RA 2YNBA 2BD8A 2OUAA 2FM2A 1U6QA 2P3FH 1W7GH 1V2LT 1QY6A 1RFNA 4Y8YA 1TNJA 2BD7A 3L3TA 1J9CH 1AUTC 3GCHC 1W12U 2WV5A 1UJ1A 2F91A 3LIWA 1FQ3A 1W14U 1YYY1 1AUJA 1GHBG 2C90B 1V2WT 4LZ1H 3PWBA 3DUXH 4P02A 3SUDA 1KY9A 3SHCH 2GJGA 3L6PA 4K69A 3OX7U 1GGDB 2IJD1 3BG8A 1YPKH 2ZZUH 5L30H 4Q7XA 1SG8B 4AC9A 1O3EA 1XUIA 2Z3DA 1AO5A 3N7DA 2F9OA 4WY3A 2PGQB 2D2DA 1ELDE 1SB1H 2AGEX 3OY5U 2WYJA 1IQLA 2BDYA 4LK4A 3D49H 3E0PB 3V0XA 1WTGH 4JZ1A 3ZV8A 1LQDB 3RU4T 1P09A 1CT0E 1A0HB 3QX5H 1TBRH 5J4QA 1YPLH 1TX8A 1FAKH 1GDQA 5EXLA 1S6FA 1FX0B 1NFXA 4AFSA 2RFKC 2O8WA 4M7GA 1DSUA 1AI8H 1XUHA 3KQEA 4O97A 2QAAA 2XC0A 1K1LA 3TLOA 1SLXB 1MKWK 5LGOA 1Y3UA 1FNIA 1MTVA 1V2JT 5DPAA 4AZ2B 1VZQH 3MO3A 2C8YB 2JETB 1O2QA 3LONA 2ZGXH 5A8YA 1KXFA 1OWKA 1GMDF 2W3IA 4KTUA 2AMPA 1UTKA 2V6NA 1C5MD 3UQVA 2ZGCA 2Y6TA 3GYLB 3M36A 3ZVAA 1O5CB 2YMSC 3K6ZA 3R3GB 1KYNA 2ZPRA 3RXAA 1J8AA 2GMTC 1SGTA 1ZSJA 1P04A 4KTCA 1GCDA 5EPNA 4TPIZ 2VH6A 2AFQB 4NIWA 1AHTH 2DUCA 4B74A 1BRCE 1C1UH 1GHAF 3NKKA 3P8GA 1F0RA 4DCDA 1SC8U 1PYTC 1AFEH 1EP6A 2BDAA 1FY8E 2V0BA 3ZVFA 2FOEA 4Q63A 2GZ7A 1D3DB 2BX3A 1GDNA 2ULLA 1ZOMA 4ZKSU 2G4TA 4FUEA 1EZQA 1V2QT 1O2WA 3A89A 4Y71A 5EXMA 4B6EA 5A0AE 1G32B 5L6NH 5E8EH 3E8LA 1FN8A 1T32A 3T2NA 1EB1H 1YPHC 2Y5GA 3OTJE 1GBMA 2ANWA 4OS6A 4GPGA 4KKDA 1NTPA 2C8ZB 1XUGA 4WXIA 2KAIA 4JCNA 5E0JA 2HGTH 3HKJB 4ZCNA 3DHKH 1AB9B 2GDDA 4WH8A 1GBCA 4K8BA 1KSNA 2ZHEH 1QB9A 1Z8GA 3RXQA 1F0SA 3O8RA 4JK6A 3RXRA 1IQMA 2B0FA 2GCHG 1GGDC 1DM4B 1RTKA 1SL3A 3SU1A 1T8OA 1L0ZA 1O3LA 4FOUC 1FN6A 3H5CB 4MLFB 2CXVA 5LH8A 2HLDD 5K7RA 3FKSD 1SGRE 2BDCA 2G5VA 3KYFA 2AMQA 5G4BA 1D6RA 2G00A 5DP3A 4RT0A 2VWOA 3Q3YA 1LPGB 2FOAA 4FU7A 3F3BA 1C5RA 1C5LH 1HAPH 1FI8A 3PLBA 5I46H 4WXVA 1HAYB 1BMAA 2C3SA 3AVZA 3TH2H 3TGJE 1TFXA 4IW4E 3FVFB 3A8BA 1UO6A 2J38A 3OU0A 4TYDA 1MTNB 1V2PT 1W7XH 3U8OH 1JXPA 3NRLA 2TGTA 3EE0B 1NY22 1W10U 1QJ7B 5EU8A 4GHTA 4GCHG 1HAIH 3BG4B 8GCHG 1F7ZA 2QA9E 5JBCS 2FZZA 2BZAA 3EAJA 1LMWB 4ISIH 2JETC 1TWXB 1JWTA 4X2YA 5DJ7A 1DDJA 4BXSA 2J2UA 3H7TA 2R2MB 3A7YA 1IQKA 2KX4A 1AGJA 1L1JA 1PPCE 3F9EA 2C8WB 1QBVH 1MUEB 1ZJKA 3GCOA 4A1TA 3E91A 1WBGB 2F9NA 1QJ1B 2KAIB 4INLA 3ELAH 3TNTA 2ZHQH 5DGJA 1DSTA 1TOMH 1A5HA 1PPHE 2SFAA 4Q4LA 1WXRA 1S0QA 4MTBA 1GMCG 2H5CA 2ZU4A 3MNXA 1MD7A 1TB6H 3DFJA 3LJJA 3OSYA 1P3CA 3ZZ4A 5HIYA 4DT7B 2ZDNA 2W7UA 3MU8A 4B2AA 3MU5A 3B8JA 1HFDA 2NU4E 2ZA5A 2XRCA 2A7CA 3I78A 4ISHH 4U32A 1A61H 1SR5C 1ABJH 1IQEA 1HAHH 2EA3A 4MPUA 1PQ5A 2THFB 4JZFH 2A5IA 3JZ2B 3LH1A 4ABHA 1O2XA 1CGJE 4OS4A 2H5DA 4K5ZA 5A8ZA 1AE8H 3EA7A 1CHOG 1VCQA 2D1JA 3B9FH 2BY7X 1OYTH 3SJ9A 3LGTA 3VB4A 1T4UH 1KIGH 2Y82A 1O38A 1TNGA 2ZFFH 3CS7A 3UY9A 2GZ9A 5KECA 2OC0A 5A09A 4FXGH 2WYGA 3FANA 1K21H 3AAUA 1K0HA 3FP8E 1GCTB 1BBRH 4YT7H 1P01A 1NFWA 1BB0B 3GY4A 2Z3CA 4FVDA 3T28A 1MTSA 1NU7B 1IQHA 1SOTA 1YPEH 2H9EH 4AFUA 5KEDA 1S84A 3PLPA 3T5FH 4ABIA 2FI4E 1A5IA 1O3AA 2BXUH 1AD8H 1PPBH 3BTHE 1DLEA 5JB9S 2CF8H 1LCYA 4XE4A 1MTNC 1O5FH 3QO6A 1SGNE 1TA2A 3MO6A 4RI0A 2FOBA 1F0TA 1SI5H 3BG4C 1FDPA 2J9NA 2PLXA 2VINA 1IQNA 3A88A 1UW7A 5GJ4B 1K22H 5C67A 3SZEA 4CRBA 3P6ZB 5DP8A 3M7TA 1TPPA 1QGFA 1TX7A 5F8XA 4ESTE 2OBQA 1MCVA 4DVAU 2FI5E 1P06A 5LPFA 2P8OC 5F03A 4XBDA 1SGQE 4XBCA 2V7QD 3P8OA 1ZR0A 1N6XA 3E3TA 4MQAA 5FBIA 3UNRA 2H6MA 3SYJA 1S82A 1TONA 1CE5A 1O37A 4UEHH 4YTAA 1LHEH 1YPHE 4B75A 3DD2H 4SGBE 3A82A 1HV7A 3ZZ6A 3DSPA 5JDUB 4HZHA 2ZFTA 1CQQA 1PFXC 4I31A 1O0DH 2WINI 4ABFA 2A1DB 1XXFA 1ELTA 5C5OA 2WPMS 3SW2B 1GVZA 3TH4H 1Y3XA 2A2QH 5DO4H 3ZZAA 5KGOA 4CRGA 3TIUA 3QWCH 3RXGA 4CR5A 1D3TB 6LPRA 4WVPE 4YO9A 1PPFE 1TLDA 3F2HA 1RTFB 2OC1A 3RU4D 1UTNA 2WPJS 3PMAB 1W2KH 3UTUH 1RXPA 1G3CA 2BYAX 5F8ZA 5I25A 3RXUA 3CENA 3MFJA 2JJ2D 4NIYA 2P3TB 1A2CH 4VGCC 3P95A 3GCTF 4AG2A 3G01A 1TOCB 1T8NA 1P9UA 3QDZB 3DA9B 4HG6A 1G37A 5DSFA 3UWIA 4D76A 1J15A 1W0KD 4ACAA 2V3MA 1G2MA 1EP5A 4IMQA 1TNHA 1S6LA 1G9IE 1C5NH 2ZEBA 1TRNA 4DJZB 2KR7A 5C1UA 4FUHA 1QRXA 3BEUA 3MU4A 5JBBS 1BITA 1C1OA 1TMBH 2PP6A 1MU8B 2DE8A 1SLUB 1JIRA 2QXJA 2Z9KA 3KHVA 5HKKD 1G30B 2JH6D 4MG3A 1O3NA 3FOAA 2WV4A 1GJBB 3VB5A 1BBRK 3KGPA 3SV2H 2O8LA 3RMLH 4ACBA 1O3DA 3PMBB 1SGFA 2CF9H 3SZNA 1KXEA 1OYQA 1UMAH 1P2OA 1BTYA 1PQAA 5A0CA 2OQUA 2BDIA 2UUFB 8LPRA 2J95A 2QY0B 3SORA 2OXSA 4NWLA 1AKSA 1P02A 1T7CA 3OEHD 2Z7FE 4MVNA 3M5NA 4YM9A 2NU2E 3A86A 1J17T 1Z1JA 2GZ8A 5GCHF 2FX6A 3P8FA 2F83A 3PRBA 3OYPA 5GXPA 4NIVA 1ETRH 3M3TA 3RXFA 5FCKA 2A2XH 1ZSKA 1EATA 1WYKA 3DT0H 1O3HA 2ALVA 2Z3EA 3QGNB 1DY8A 2VGCC 1VJAU 2IN2A 3GY7A 1SSXA 2UUKB 3ZYEA 4A92A 3W1EA 1ESTA 1SQRA 2PUQH 3QZQA 1E35B 3LJOA 2BVSH 2HRVA 1DUAA 1ZPCA 3H09A 1YM0A 3LOXA 3AK5A 2C4FH 3E6PH 4IBLH 2FI3E 4IMZA 1LQEA 3UR9A 5FPSA 1Y3YA 3EDXB 3P17H 1AE5A 2CV3A 1P2JA 3ODDA 1DPOA 4I8HA 5B6LA 2J94A 2AS9A 1C2GA 1GI2A 5E0HA 4UFDH 3N99A 1O3GA 2G52A 2AEIH 2VIVA 4YESB 1UTMA 1OKXA 2FOHA 1G3BA 3QK1A 3P8NA 3QTOH 1GBFA 1GHAG 1LDTT 2VIQA 1KXCA 2F9UA 1RTLA 1CT2E 4CRFA 1O3KA 3RP2A 3AAVA 1YLNA 2XCFA 4I8JA 2Q6FA 2W7SA 1QTFA 3P70B 4F49A 4CRAA 2XBVA 1B7XB 1WTHD 2F3CE 2OINA 2WPHS 3NPSA 1OS8A 2EQNA 1AN1E 1GVKB 1JOUB 1AKSB 1GL0E 4ZHMU 1P05A 1V2NT 1P12E 3RXKA 3V12A 1OP2A 2NU1E 1HPGA 3VB7A 1GWAA 2G5NA 1C9PA 2ZDMA 2XXLA 2QXHA 1FIZA 1L4ZA 3EA9A 1LKAA 2YMSB 3HPTB 4MNYA 2PV9B 5ABWA 2ZFSA 3S9BA 1TMUH 2GMTB 1O5EH 5LPEA 4XSKU 5DKMA 1MH0A 1P2MA 3T27A 4WMFA 2FPZA 4X1PU 6CHAC 2ZHWH 1O2NA 2WPIS 4BXWA 2TGAA 1HB0B 2RDLA 4ABDA 3PWCA 1ID5H 1A3EH 1L1GA 2BQWB 3ZZ9A 9ESTA 2Y5FA 1TNIA 2CMYA 2BVRH 3KF2A 2QCYA 3D23A 3MU0A 4MNWA 1BTWA 1F5LA 4SGAE 5F8TA 3D65E 3RMMH 2DE9A 3RXHA 3TK9A 4Y10E 1BOQA 1LO6A 1SQTA 4R0IA 3LDXH 3M5MA 1MTUA 2XWAA 1ABIH 1Z6EA 4AGKA 3ZZCA 1OPHB 3PLKA 1FZZA 1WDIA 1MZAA 1O33A 2BY8X 2ZI2H 2FTLE 1KXBA 4AYVB 5HM2A 1GI5A 3ZVEA 4AB8A 4D7GA 1TRYA 1V2RT 2YNAA 3HGNA 1YPGH 1G36A 2IPQX 3ATWA 3SI4H 5TJXA 3ZYDA 3A85A 3Q77A 1MAXA 1SVPA 4AN7A 1QIXB 3VPKA 2Z9LA 3MYWA 4CRDA 2BD5A 1WAYB 4NFEA 3DSGA 2WSSD 2Y7ZA 1K1OA 1HAXB 2HALA 1ZLRA 2M2AA 4B6FA 2VVUA 4Y11E 3TU7H 1C5OH 1VCPA 1DX5M 1LVYA 4FUGA 1BTUA 2XYAA 2TIOA 2Z94A 3A8CA 1E0FD 5FHTA 1O2MA 1YY3A 3URDA 4MNXA 1C2KA 1C1QA 1GBKA 2A4OA 3M3SA 1SHYA 3M7UA 2ZKSA 2XBYA 4NWKA 1O2KA 1BRUP 3BF6H 1C5WB 1YPJH 4X1QU 1WQSA 3SUEA 1YF4A 2CK3D 1UVTH 2XWBI 2PTNA 2RA0A 1TBQH 3SQHE 5PTPA 3U8TH 1X7AC 2PWXA 5IDKA 1P57B 2VWMA 2J4IA 1BDAA 1NBMD 1BT7A 2SNVA 5LPRA 1P10A 2JJ1D 3ENSB 3SU5A 1BMFD 4A7IB 1Y59T 2I6SA 4M9FA 1ELGA 3E90B 1HIAA 1FXYA 2OQ5A 1ANEA 1CHGA 4GSOA 1C5TA 1N8OC 4CREA 4ZKOU 1A1RA 3RXEA 3BTWE 1O36A 5T6GA 5C0UA 1GMHF 1PQ7A 1H8ED 1UVPA 3GOVB 3ZZBA 2AGIX 4FUIA 2VNTA 1RIWB 1FPHH 1KTSB 2VBCA 2XC5A 4X1RU 4Z0KA 2Q6DA 1O2IA 1P2KA 4NFFA 2Y80A 2QF3A 5L2ZH 2IPHA 2CN0H 5CMXH 1V2MT 2BDGA 1KXAA 3BIVH 1INCA 4I8GA 1AVWA 4QT8C 1FY5A 1H8DH 3RC6A 5H4IB 5JYIA 4J1YA 4K1SA 1GJ7B 2JKHA 2ZECA 3BEIB 1FLEE 3E16B 1GI3A 1SHHB 3K65B 3A87A 1ELFA 7ESTE 1D3QB 5EXNA 2J97A 1O3MA 1H4WA 1ZTJA 4OGXA 1E34B 1DITH 3KQ5A 2ZNKH 1YBWA 1D9IA 3RXJA 3U69H 3QN7A 2TGDA 1BMMH 1GJ4H 4F4OC 3SV6A 2ANMH 2SNWA 1TPAE 5GDSH 3LGVA 1HAZB 3FP6E 2P3UB 3A81A 1ZYOA 3UOUA 5GIBA 1C5ZB 3M5OA 2WUCA 4E7RG 4B2BA 4XD7D 5A0BA 1EAXA 1EXFA 1V6DA 1UK4A 2ZQ2A 1BJUA 2GTBA 1FV9A 2IJOB 2A5AA 2BD2A 4AOQA 1HIAB 1L1NA 2HNTE 2BD9A 1IAUA 2FOMB 3ZZ3A 4D9RA 2ZCLP 2H1UA 3M37A 1H9IE 1BA8B 4O3TA 1ZRKA 3SQEE 1GJ8B 2ZGBH 1YKTA 4MDSA 1DS2E 1HBTH 2M5TA 1T4VH 2L74A 4YZUA 2EC9H 1HNEE 1NESE 1LVBA 8KME2 1C1PA 1NO9H 3A84A 2A4RA 5AFZH 4B2CA 3GCNA 2G51A 2BOHB 1ZTKA 1HYLA 5ESBA 1NN6A 1O32A 3F2FA 3MNBA 4CH2B 2PKSB 5C17A 3GS9A 1IHTH 5IYTA 2WPLS 3T29A 2WV9A 4Y76A 1ARBA 2FEQH 3SUFA 4OS2A 2P8OB 7LPRA 2ODYB 1GHBF 3ZV9A 1BTPA 3RXIA 1G3DA 1QNJA 1QQUA 1ZSLA 1QFKH 3NZIA 3ATKA 1VITF 3A7XA 1BJVA 1C1WH 1P2NA 4BTUB 3BEFB 3I29A 2J5UA 2O8MA 3ZZ7A 1VR1H 1SLVB 1GBIA 2BXTH 3QUMP 5FX5A 1LVMA 5A2MH 2TGPZ 1GBLA 4KGAA 4BAMB 1RIWC 1QL8A 1EAUA 1ELBA 2ZWLH 4P00A 5CHAB 3I77A 4OS5A 4IN2A 1YP9A 5TCCA 3KN2A 1GI1A 4K60A 2Z9JA 1GPZA 2B8OH 3ODFA 1HJ8A 1AZ8A 3VB6A 3RXMA 1VGCB 3LGUA 2BDHA 3SU6A 2ZPQA 2LPRA 1O5DH 1S81A 1MD8A 2ODQA 5BPEA 3ZVCA 2BQ6B 1KLJH 2BHGA 2FLRH 2Z9IA 1GI4A 1DVAH 2UWLA 4WMDA 1UCYE 2AHME 1THSH 3GYMA 1F0UA 1NFUA 5HIZA 1O35A 1T8LA 1ZPBA 2BLQA 1DLKB 2QE7D 4WWYA 2V3HH 2A7HA 2XTTB 4VGCB 2PUXB 2OK5A 4NA7A 2GT8A 2BD3A 1YLCA 2FOFA 4IC5A 1Q31A 1TGTA 1ZPZA 1SGYE 3LU9B 4ZKNU 3SNAA 2D26C 3WW7A 1OHHD 1XKAC 5GCHG 5DK1A 3OAAD 1TE0A 1D6WA 1EJAA 1L4DA 1XMNB 2PW8H 1ESAA 1O2PA 3GDUA 1LHGH 4NSYA 2K1QA 5EGMA 1AWFH 2Q1JA 4TWWA 2J92A 3ITIA 1Y5AT 5ESTE 3VG8A 1CGHA 4RKJB 2QXIA 2G55A 1F92A 3PTNA 3GDSA 1Z71A 2ZU5A 4Y8XA 1C2DA 1TGCA 1AFQC 3F0OA 2GGVB 3RDZA 3ZVGA 1P11E 3PROA 3KNXA 1SMFE 1AU8A 3SNDA 1CT4E 4A1VA 2FTMA 4RT1A 2ZC9H 2ZFPH 4X2WA 2FIRH 5C3NA 5HXFA 1HXFH 1UVSH 3UNSA 4DY7B 1YCPH 2PKSC 1S0RA 1MZDA 1KLIH 1ELCA 1O5BB 4ZMAH 1GI8B 4KP0A 3UIRA 2FS9A 4X8VH 2FXRA 1C5UA 4GHQA 3SBKA 3HK6B 1Z8IB 1NRNH 3VGCB 3SO3A 4KTSA 1HDTH 1O3OA 1E79D 2A4GA 2D8WA 3RM2H 5F6MA 2ZDKA 2VGCB 1CO7E 3KCGH 1A46H 4JMYA 1K1PA 1H8HD 1W0ZU 3BTEE 6GCHF 2ASUB 1WSSH 4HFPB 1IQJA 1EAIA 4ASHA 4UFGH 5CHAC 3UWJH 1UTPA 3MQKC 1A5GH 3SJIA 1HJ9A 3O8CA 3GY2A 1OP0A 2STAE 3NXPA 2A0QB 1VGCC 5C1YA 4IN1A 2BDBA 1Y3WA 1N6YA 4Y6DA 1DOJA 1UTJA 1O3FA 2ZFRH 3N7EA 1GJCB 2F4LA 3Q00A 4R8TB 1NM6A 2XNDD 5FBEA 3LGIA 3MO9A 2PTCE 3PM3A 4Y7AA 5HMAA 2PSYA 1ANDA 1JMOH 1PPGE 2Q6GA 2IOTA 2SGQE 2OC7A 1XX9A 1BTHH 4ZUHA 2K8IA 1VKYA 2R0LA 2JH0D 3D62A 4J2YB 5CE1A 3F2GA 1GBAA 3STJA 1DANH 2O8TA 4BANB 4WF8A 2VIDA 1EOLA 1BCUH 1QURH 2Z6BD 2BTCE 5EW2H 1O2HA 1K1IA 4LXBH 3M35A 2UWPA 5F53A 1NT1A 1ARCA 3ZZ5A 1THRH 1ZRBA 2EI7A 1C2LA 1V2OT 3GICB 2BLWA 2NWNA 1GMCF 1KTTB 4HGCA 1SGFG 1RRKA 4IGDA 1Z8RA 4NZQA 3S69A 1O3IA 2ZHFH 2ZPSA 4K1TA 2VWLA 6CHAB 4ASUD 1QB1A 5CHBA 3W94A 3BTME 1SKYE 2R3UA 2ZGHA 4Y79A 3SUGA 3BN9A 1YWUA 4NGAH 4D9QA 5T6DA 1F5KU 4Y0ZE 1QB6A 4ABBA 5GWZA 4PROA 1IQFA 2ZIQH 4H4FA 1F2SE 1K1NA 3PMJA 5EJLA 1FY3A 1W13U 1W0YH 2R3YA 4CRCA 3CS0A 5EODA 1XXDA 3IITA 1MMJN 1GL1A 2ZDVH 3H7OA 3NUMA 4KELA 4X6MA 2TPIZ 1SGCA 1TBZH 1DXWA 1SGIB 1ZZZA 4TPYA 4AFZA 3TGIE 1DT2A 4AYYB 1CVWH 4JYTA 2VVVA 3A8AA 3SGAE 3VGCC 2EI8A 1WQVH 3CP7A 1NPMA 2P93A 3LC3A 5EQQA 1A0JA 4X6OA 1PYTD 2ZDAH 1YCPK 1NRPH 4BAHB 1TIOA 3HGPA 1C5XB 1TPSA 4D8NA 3PV2A 1GMDG 1YPMH 1NZQH 4GUXA 3SV8A 2ZU2A 4UD9H 1C2MA 1T31A 1TALA 3U28C 1W0JD 1C5PA 4Q7YA 1QRZA 2TRMA 1S6HA 5EW1H 1OP8A 1S83A 1FONA 3U8RH 2J98A 2QV1A 2FP7B 1D4PB 1QQ4A 2JIZD 4JK5A 1JRSA 1RGQA 4HTCH 1BUIA 1GMHG 1TABE 4X0WU 1UTOA 2ILNA 2BZ6H 3PO1B 1RS0A 4FUJA 3RXOA 4H6SB 2A5KA 4HI3A 4YXWD 2KFWA 3EYDA 5JBTA 1D3PB 2BMGB 5C2ZA 5EIYA 4CR9A 1C5VA 2OTVA 3A7WA 2O8UA 1WCZA 2Y7XA 1ZGIA 4RKOB 4BTIB 4OS1A 1P2QA 4F48B 2UWOA 1UTLM 1P9SA 1UVUH 3KEEA 4WMEA 2ZCKP 1XVMA 1FY4A 4JZIA 4FUBA 4B71A 1Y3VA 2UUJB 2CGAA 2BX4A 4THNH 5T1VA 2ALPA 4NA8A 3FP7E 4BTTB 1DE7H 4ZXXH 2CHAC 1IQIA 2FYQA 5GPIB 1EQ9A 1N8OB 4OGYA 3ATMA 1EJNA 3BTDE 2VB0A 3UREA 1AWHB 3SNBA 3VXFH 1UHBA 2AGGX 4Q80A 4DT4A 2WPKS 3Q76A 3BTKE 2FDAA 4LOYH 2OBOA 2PSXA 3BIUH 4ZHLU 2KCAA 2JH5D 1P0SH 3TNSA 1ZHRA 2HVXA 1AMHA 3FZZA 1MQ5A 3KQCA 1OSSA 3C1KA 3QLPH 4BOHA 2TBSA 4Y8ZA 3KQDA 2J98B 1ACBE 5C0TA 1C2HA 3RXDA 5JB8S 1B0FA 1ORFA 2UUYA 3MOCA 1A7SA 1J14A 1SPJA 4Y7BA 5JBAS 1GDUA 3F0PA 4CH8B 3MMGA 1GBHA 5FXLA 1G2LA 3UFAA 3P92A 3TJUA 1IQGA 1A3BH 1MBQA 1XUJA 2QC2A 1HAGE 5HGGA 5GNDA 1COWD 1QA7A 4GLYA 3ZZDA 1O2ZA 5FL7D 5FPYA 1C4U2 1ETTH 3GDVA 1PPEE 1EZSC 1QJ6B 1WV7H 2AIPA 1BRBE 2VJ1A 4B1TA 1O2OA 3UB0A 5DP9A 4K3JA 1MKXH 2OCVB 3RMNH 4MPVA 1FMGA 1E38B 2VIPA 3SU3A 1VITG 2XC4A 3M5LA 1DICA 3RC5A 1DUEA 2VIOA 3F9GA 3EA8A 4E05H 1FPCH 3GY8A 2C8XB 4FVBA 1KXDA 1S5SA 2ZTZA 1UHBB 3BTGE 3PO1C 1BMNH 1LKBA 1MQ6A 3FFGA 4JYVH 1O2YA 2AH4X 1CSOE 2YOLA 4XFQA
chains in the Genus database with same CATH topology
3K2UA 3MNSA 1V2UT 5DP5A 2GVFA 1BRAA 1O2TA 3MTYA 3SU4A 1DY9A 4K2YA 3U1JB 3HKIB 1O3CA 1TGBA 1Q2WA 1BQYA 1IOEA 2H9HA 3M7QA 4A5TS 7KMEH 3UR6A 1SQAA 1WOFA 1O30A 2ZP0H 1EPTB 3A8DA 1O5GH 2FOGA 3T25A 4B73A 3AW1A 4E06H 2BM2A 1XM1A 1TQ0B 3F6UH 1C2EA 2SGPE 3TVJB 2W5EA 4I7YH 3A7TA 1Z6JH 1DXPA 2BLVA 4A1XA 4JZEH 1O2UA 4ISOA 1GHWH 2RCEA 4FUFA 1LPZB 3ATLA 3K9XB 5HYOA 3F9FA 1MU6B 2GT7A 2R2WU 3RLYH 7GCHF 2SGAA 1FAXA 3ZVBA 3QGJA 3DFLA 1DWCH 2AIQA 3FZDA 4K1EA 3S9AA 3WY8A 4ABEA 3A7ZA 1UK2A 4U01A 1P3EA 4X1NU 6ESTA 5E2PA 5EG4A 3PV4A 2BY9X 2QGRA 1EASA 2OLGA 2SGFE 2J34A 3RXBA 2FOCA 1UVOA 1BZXE 5FCRA 1ZGVA 3EGKH 2LNCA 5DP6A 1S85A 3UNQA 3VEQB 1GHXH 1ZHMA 3E1XB 4MPXA 4BAQB 1B5GH 1BIOA 5AHGH 3V3MA 1TX6A 2A45B 4O9VA 1PPZA 2HPPH 3TK6A 1O2GH 3SV9A 4UFEH 1NC6A 5J4SA 3HATH 4I8LA 1O39A 1XUFA 1C1MA 1UTQA 1ANCA 5K0HA 3GY6A 1P03A 1SQOA 3V7TA 3F1SB 1B0EA 1K28D 2OC8A 6GCHG 1THPB 4ISNA 1LTOA 3A80A 2PHBA 2FMJA 3FAOA 1W3CA 2GDEH 2QF0A 1GJ5H 1AFQB 2XBWA 2BQ7B 4I33A 3IWMA 1ZTLA 1C1RA 1W8BH 1NFYA 1O34A 1MKXK 1FY1A 2R9PA 1O2LA 4X1SU 1V3XA 4NZLA 1FIWA 1MBMA 3BV9B 1ZMJA 1WUNH 3TJOA 4BAOB 3UOPA 4AORA 4X8TH 1SGEE 1EUFA 1DWBH 2PGBB 1EPTC 2ZU3A 2OP9A 1C4Y2 3TITA 3A7VA 2GX4A 1O2JA 1EB2A 4RN6A 1W11U 4ABAA 4YOJA 1C5YB 2RA3A 1UCYH 2GV6A 2FX4A 5FPTA 2ZGJA 1C2IA 3TK5A 4DW2U 1EKBB 5EQRA 3S0NA 1E37B 1UK3A 4YT6H 1K1MA 1Y5BT 1QBOA 2BY5X 3MWIU 3GCTG 1NRRH 1BMLA 3SJKA 4D7FA 2V3OH 1GI7B 4ABGA 3OY6U 3TJNA 1OOKB 1LVOA 1ETSH 4X8UH 4U30A 3SJ8A 1LPKB 5E0GA 2HLCA 2HPQH 3RM0H 4XDEA 3S9CA 1ANBA 2ZHDA 3SGQE 3AASA 4Y0YE 1HJAB 2VVCA 3ESTA 1GBBA 2ZCHP 2ZTYA 3UPEA 1QL9A 1CBWB 1HAOH 4DOQA 3SJOA 2G4UA 4Z6AH 2G8TA 3RU4E 3SNCA 1SGPE 3R0FA 5C5NA 4CHAB 4AX9H 4ISLA 3KIDU 1XVOA 5DP7A 1SBWA 4UDWH 2ZTXA 3PTBA 1GVLA 1QA0A 1CGIE 3L33A 4INKA 1EZXC 3BTQE 3RC4A 4AG1A 4IS5A 2VU8E 4FUDA 3NWUA 1AB9C 3LKWA 4TY7A 1C1VH 2ZFQH 4ABJA 4NG9H 2C93B 1CA8B 5E2OA 2BD4A 2GCTB 1GHZA 2GV7A 2FESH 1GJ6A 2Z9GA 4DGJA 3RXSA 2SGEE 1J16A 1SGDE 2R0KA 2GKVE 1GHVH 1EZUC 3BSQA 1QL7A 1MTWA 4O3UA 1A0LA 4NIXA 3RXTA 4I32A 2G81E 1PQ8A 4WJG2 3GY3A 5HM9A 2QN5T 3TGKE 2H9TH 4FU9A 2ODPA 1TGNA 1F5RA 5AF9H 1MCTA 2SGDE 1O3PB 2W26A 3MH5A 4XOJA 1GBEA 3SU0A 2XCNA 3HK3B 1MAYA 4H42U 1C2FA 4TY6A 3MI4A 1GJAB 1BTZA 1GI9B 1TNKA 3U98H 1YGCH 3F68H 2F9PA 4JZDH 4NSVA 3B23B 2Y81A 2GCHF 1V2TT 1TNLA 3SNEA 3U9AH 2XBXA 1GJDB 2BY6X 1G3EA 1JBUH 3VFEA 3NCLA 1QR3E 2P94A 1Z7KA 2XW9A 1BBRE 1O2VA 2EI6A 1AVXA 4BNRA 1ELVA 3T26A 3TH3H 1RD3B 4Q2KA 4YOIA 3U1IB 2FWWA 1A4WH 1H9HE 1LHCH 1UCYK 1AIXH 1VCWA 4ZH8A 1OWDA 1DFPA 1NRSH 1HRTH 4ZXYH 5TCAA 3STIA 1KDQA 1QHRB 2NU0E 2ZO3H 4U2WA 1HAVA 2FLBH 1HJAC 3LT3A 1TAWA 3JZ1B 4ZAEA 4NA9H 2A7JA 1OXGA 1FJSA 1BTXA 5EQSA 3KQBA 1CBWC 1TMTH 1QBNA 3BTTE 1C5SA 3TPIZ 1NRQH 1NS3A 4GCHF 4TWYA 1E36B 2ZF0H 8GCHF 4UONA 3RUOA 4CHAC 2F9VA 1QRWA 4ZKRU 1HLTH 4CBOA 3LH3A 3MNCA 2VIWA 2QXGA 5AVDA 1ZHPA 3VXEH 1C1NA 2I6QA 1OWEA 1M9UA 1OX1A 3PB1E 4INHA 5L2YH 1GI0A 4YLUA 1SFQB 3Q3XA 4X8SH 1AY6H 1NROH 4FUCA 2V35A 1CA0B 3RXPA 1O31A 2FS8A 3S7HB 2GCTC 4GVUA 1Y5UT 1AQ7A 4B76A 5BRRE 1V2VT 2NU3E 2HWLB 3ATIA 3NK8A 4BAKB 4OS7A 5SGAE 1O5AB 2CHAB 1VJ9U 5C20A 5JPMH 1C2JA 2A31A 4JYUH 3RXVA 2FYRA 3KL6A 1GG6B 1GCTC 8ESTE 1DWDH 1LHFH 3MH4A 3SHAH 3UUZA 1GI6A 1VITH 2QYIA 9LPRA 2BOKA 4UE7H 1YLDA 1TPOA 1HCGA 3MU1A 4DURA 2RG3A 1OWHA 1KDQB 2QIQA 1ZMLA 1Z8JB 1HAVB 4YOGA 1K2I1 5EOKA 1CHOF 3SOSA 1H1BA 4O03A 5T6FA 3QZRA 1NU9A 1ZMNA 1N1LA 3T62A 4X6NA 1TRMA 2BLOA 2ESTE 3LGWA 1L2EA 2BVXH 3BTFE 5DG6A 2AERH 2P95A 2B7DH 1V2KT 2OD3B 1OWJA 1P2IA 3GY5A 1JRTA 3VB3A 1EJMA 1T8MA 1WU1A 4DIIH 2PR3A 3RXLA 1GJ9B 3RXCA 1HUTH 3MHWU 3O8BA 3AW0A 2A4QA 2CJIA 1QCPA 3GCHB 4Q7ZA 2GD4B 4X2VA 3LGYA 5T3HA 3SI3H 3RMOH 1EAWA 4MPWA 4E7NA 5A8XA 3SV7A 2BB4A 2FODA 3PMHB 1SLWB 3O8DA 2PKAA 2B5TB 4H6TA 3TJVA 1IHSH 3W95A 2EEKA 1K1JA 3EQ0H 1LHDH 1HXEH 2VH0A 3IG6B 3K6YA 2ZU1A 3QTVH 1O3BA 2HNTF 1DWEH 5DP4A 5ETXA 5B6OA 1V2ST 5FX6A 1XKBC 1SFIA 1BHXB 7GCHG 3MH7A 3SU2A 2ZQ1A 1ELAA 1RJXB 4I8KA 1GBTA 1MKWH 2PFEA 4DIHH 1XUKA 4MNVA 2A32A 3ZZ8A 1TYNA 2FO9A 3S7KB 3N7OA 4ZROA 1GBDA 4UFFH 1TGSZ 2WUBA 4AB9A 4YLQH 1C5QA 2ANKH 4X6PA 2P59A 1CA0C 1H8IH 1H9LB 1AVGH 1TQ7B 1OWIA 3A83A 5EPYA 3MH6A 3M3VA 1SOZA 1O3JA 2B9LA 2W3KA 1Z1IA 2AYWA 1ESBA 2GP9B 4FU8A 3ZVDA 2VWNA 1TA6A 4ZHAA 4AGJA 1YCPM 4A6LA 4K8YA 1GHYH 2ZG0H 1ELEE 3UQOA 1C9TA 1C1SA 2HNTC 3E0NB 4DG4A 1GG6C 1ZJDA 2ANYA 1K9OE 1PJPA 4X2XA 5C1XA 1FUJA 4LZ4B 1Q3XA 1AZZA 2AMDA 1EOJA 1C4V2 1C1TA 1JIMA 1KLTA 4AFQA 1CU1A 3LPRA 3RLWH 3LC5A 4NCYA 2F9BH 2O9QA 1GBJA 2P16A 1EX3A 3V13A 1YC0A 3Q3KA 1HGTH 1Y8TA 3URCA 2PKAB 1EPTA 5FAHA 3C27B 4RSPA 4GAWA 3F9HA 4WH6A 5AFYH 1BHXF 1P8VC 4XBBA 1O2SA 4IC6A 3SN8A 3PYHA 2Y5HA 3GISB 4CBNA 2ZDLA 3SGBE 2XNIA 2H2ZA 2HOBA 3M61U 2STBE 1O2RA 2YNBA 2BD8A 2OUAA 2FM2A 1U6QA 2P3FH 1W7GH 1V2LT 1QY6A 1RFNA 4Y8YA 1TNJA 2BD7A 3L3TA 1J9CH 1AUTC 3GCHC 1W12U 2WV5A 1UJ1A 2F91A 3LIWA 1FQ3A 1W14U 1YYY1 1AUJA 1GHBG 2C90B 1V2WT 4LZ1H 3PWBA 3DUXH 3SUDA 1KY9A 3SHCH 3L6PA 4K69A 3OX7U 1GGDB 3BG8A 1YPKH 2ZZUH 5L30H 4Q7XA 1SG8B 1O3EA 1XUIA 2Z3DA 1AO5A 2F9OA 4WY3A 2PGQB 2D2DA 1ELDE 1SB1H 2AGEX 3OY5U 2WYJA 1IQLA 2BDYA 4LK4A 3D49H 3E0PB 3V0XA 1WTGH 4JZ1A 3ZV8A 1LQDB 3RU4T 1P09A 1CT0E 1A0HB 3QX5H 1TBRH 5J4QA 1YPLH 1TX8A 1FAKH 1GDQA 5EXLA 1S6FA 4AFSA 1NFXA 2O8WA 4M7GA 1DSUA 1AI8H 1XUHA 3KQEA 4O97A 2QAAA 2XC0A 1K1LA 3TLOA 1SLXB 1MKWK 5LGOA 1Y3UA 1FNIA 1MTVA 1V2JT 5DPAA 4AZ2B 1VZQH 3MO3A 2C8YB 2JETB 1O2QA 3LONA 2ZGXH 5A8YA 1KXFA 1OWKA 1GMDF 2W3IA 4KTUA 2AMPA 1UTKA 2V6NA 1C5MD 3UQVA 2ZGCA 2Y6TA 3GYLB 3M36A 3ZVAA 1O5CB 3K6ZA 3R3GB 1KYNA 2ZPRA 3RXAA 1J8AA 2GMTC 1SGTA 1ZSJA 1P04A 4KTCA 1GCDA 5EPNA 4TPIZ 2VH6A 2AFQB 4NIWA 1AHTH 2DUCA 4B74A 1BRCE 1C1UH 1GHAF 3NKKA 3P8GA 1F0RA 4DCDA 1SC8U 1PYTC 1AFEH 1EP6A 2BDAA 1FY8E 2V0BA 3ZVFA 2FOEA 2GZ7A 1D3DB 2BX3A 1GDNA 2ULLA 1ZOMA 4ZKSU 2G4TA 4FUEA 1EZQA 1V2QT 1O2WA 3A89A 4Y71A 5EXMA 5A0AE 1G32B 5L6NH 5E8EH 3E8LA 1FN8A 1T32A 3T2NA 1EB1H 1YPHC 2Y5GA 3OTJE 1GBMA 2ANWA 4OS6A 4GPGA 4KKDA 1NTPA 2C8ZB 1XUGA 4WXIA 2KAIA 4JCNA 5E0JA 2HGTH 3HKJB 3DHKH 1AB9B 2GDDA 4WH8A 1GBCA 4K8BA 1KSNA 2ZHEH 1QB9A 1Z8GA 3RXQA 1F0SA 3O8RA 4JK6A 3RXRA 1IQMA 2B0FA 2GCHG 1GGDC 1DM4B 1RTKA 1SL3A 3SU1A 1T8OA 1L0ZA 1O3LA 1FN6A 3H5CB 4MLFB 2CXVA 5LH8A 5K7RA 1SGRE 2BDCA 2G5VA 2AMQA 5G4BA 1D6RA 2G00A 5DP3A 2VWOA 3Q3YA 1LPGB 2FOAA 4FU7A 1C5RA 1C5LH 1HAPH 1FI8A 3PLBA 5I46H 4WXVA 1HAYB 1BMAA 2C3SA 3AVZA 3TH2H 3TGJE 1TFXA 4IW4E 3FVFB 3A8BA 1UO6A 2J38A 3OU0A 4TYDA 1MTNB 1V2PT 1W7XH 3U8OH 1JXPA 2TGTA 3EE0B 1NY22 1W10U 1QJ7B 5EU8A 4GHTA 4GCHG 1HAIH 3BG4B 8GCHG 1F7ZA 2QA9E 5JBCS 2FZZA 2BZAA 3EAJA 1LMWB 4ISIH 2JETC 1TWXB 1JWTA 4X2YA 5DJ7A 1DDJA 4BXSA 2J2UA 3H7TA 2R2MB 3A7YA 1IQKA 1AGJA 1L1JA 1PPCE 3F9EA 2C8WB 1QBVH 1MUEB 1ZJKA 3GCOA 4A1TA 3E91A 1WBGB 2F9NA 1QJ1B 2KAIB 4INLA 3ELAH 3TNTA 2ZHQH 5DGJA 1DSTA 1TOMH 1A5HA 1PPHE 2SFAA 1S0QA 4MTBA 1GMCG 2H5CA 2ZU4A 3MNXA 1MD7A 1TB6H 3DFJA 3LJJA 3OSYA 1P3CA 3ZZ4A 4DT7B 2ZDNA 2W7UA 3MU8A 4B2AA 3MU5A 3B8JA 1HFDA 2NU4E 2ZA5A 2XRCA 2A7CA 3I78A 4ISHH 4U32A 1A61H 1SR5C 1ABJH 1IQEA 1HAHH 2EA3A 4MPUA 1PQ5A 2THFB 4JZFH 2A5IA 3JZ2B 3LH1A 4ABHA 1O2XA 1CGJE 4OS4A 2H5DA 4K5ZA 5A8ZA 1AE8H 3EA7A 1CHOG 1VCQA 2D1JA 3B9FH 2BY7X 1OYTH 3SJ9A 3LGTA 3VB4A 1T4UH 1KIGH 2Y82A 1O38A 1TNGA 2ZFFH 3CS7A 3UY9A 2GZ9A 2OC0A 5A09A 4FXGH 2WYGA 3FANA 1K21H 3AAUA 3FP8E 1GCTB 1BBRH 4YT7H 1P01A 1NFWA 1BB0B 3GY4A 2Z3CA 4FVDA 3T28A 1MTSA 1NU7B 1IQHA 1SOTA 1YPEH 2H9EH 4AFUA 1S84A 3PLPA 3T5FH 4ABIA 2FI4E 1A5IA 1O3AA 2BXUH 1AD8H 1PPBH 3BTHE 1DLEA 5JB9S 2CF8H 1LCYA 4XE4A 1MTNC 1O5FH 3QO6A 1SGNE 1TA2A 3MO6A 2FOBA 1F0TA 1SI5H 3BG4C 1FDPA 2J9NA 2PLXA 2VINA 1IQNA 3A88A 5GJ4B 1K22H 5C67A 4CRBA 3P6ZB 5DP8A 3M7TA 1TPPA 1QGFA 1TX7A 5F8XA 4ESTE 2OBQA 1MCVA 4DVAU 2FI5E 1P06A 5LPFA 2P8OC 5F03A 4XBDA 1SGQE 4XBCA 3P8OA 1ZR0A 1N6XA 3E3TA 4MQAA 5FBIA 3UNRA 2H6MA 1S82A 1TONA 1CE5A 1O37A 4UEHH 4YTAA 1LHEH 1YPHE 4B75A 3DD2H 4SGBE 3A82A 1HV7A 3ZZ6A 5JDUB 4HZHA 2ZFTA 1CQQA 1PFXC 4I31A 1O0DH 2WINI 4ABFA