1K1NA

Bovine trypsin-inhibitor complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Factorising ligand affinity: a combined thermodynamic and crystallographic study of trypsin and thrombin inhibition.
pubmed doi rcsb
molecule tags Hydrolase
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2001-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1k1nA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1k1nA02
5FAHA 1EPTA 1IQNA 1LVYA 5FX6A 5LPFA 1G3EA 3RM0H 4INKA 1B0FA 3C1KA 2R0LA 2HNTF 4GLYA 1BITA 1MD7A 1P02A 3E1XB 2ZCHP 4X1QU 5EQQA 4KTUA 1E0FD 3ZZ9A 1KTTB 2CMYA 1GWAA 3VGCB 5FHTA 1TPAE 1WCZA 4FUIA 4AFZA 1AB9C 4I7YH 1SFQB 2Y5HA 3MU4A 2UWPA 1GJ6A 2KAIA 3ELAH 3HATH 1S84A 2Y81A 3L33A 4X2WA 3KEEA 2O9QA 5EODA 1G2MA 4AOQA 1U6QA 3PMJA 2Z3CA 1DUAA 1INCA 1KIGH 1P2OA 1PQ7A 1S81A 1XVMA 3SJIA 1K1MA 2A5IA 1YP9A 1LVMA 1LHGH 4B71A 5J4SA 1A5GH 4CRGA 1GMCF 3UTUH 4UDWH 3U1JB 2HWLB 1O2JA 1AB9B 1C1NA 1YLCA 1T4VH 1TX7A 3STJA 2CF8H 6GCHG 1CBWC 1P3EA 1ID5H 1YF4A 3F1SB 3SV8A 1T32A 2WPMS 1ZYOA 4MPWA 4I8LA 1KLJH 1LMWB 5JB9S 2XBWA 5TCCA 1SQAA 1HDTH 4X1SU 1DUEA 1K9OE 1KXFA 3SQEE 1GDNA 3ZVFA 1XKBC 1ZMLA 3SJKA 1ETTH 1C1TA 1QBOA 1SGTA 3RXPA 1TX8A 2OC1A 1X7AC 3TNSA 2OC8A 4U01A 1OSSA 1CBWB 1UCYH 1HAPH 1O3BA 1CGIE 4ZROA 4WXVA 4ZXXH 3A8BA 3ZZ3A 3RXIA 1IQEA 1FDPA 1T8LA 1FZZA 2CF9H 1SGYE 1O3DA 2QC2A 4INLA 4JYTA 2AIPA 1H4WA 1NZQH 3K6ZA 4VGCC 1M9UA 2GZ9A 5A0CA 4FUBA 1OWEA 1SC8U 3KF2A 1L0ZA 4K8BA 4D9RA 4BTIB 2GKVE 2SGDE 3LH3A 1GBEA 1TBRH 1G32B 4THNH 7ESTE 1CT2E 2PKAB 1TLDA 2VIWA 5DP7A 1HJAC 4IN1A 4NA9H 1LKAA 2K1QA 1OP0A 1LPKB 4VGCB 1O2HA 5F8ZA 3HPTB 2OBOA 1HLTH 3PMHB 1IQMA 1LQEA 5EQRA 4B2BA 2QXIA 1SHHB 2Q6FA 3VB4A 1P9SA 2YOLA 3BIUH 2NWNA 3PM3A 1W14U 4CRCA 3M5MA 2XBYA 5FBIA 1HJAB 1DFPA 3TNTA 3MI4A 2CHAC 1FLEE 3GDSA 5C5NA 2PTNA 1KY9A 1PYTD 4TWWA 1SI5H 1MBMA 2XNIA 3P8FA 4H4FA 3ZV8A 6LPRA 1H8IH 2WUCA 3RU4D 5JDUB 4A5TS 1HNEE 1GBDA 2WPKS 2D26C 3BTQE 3ITIA 2FX4A 1C4Y2 1UCYK 2FLBH 4I8HA 3P95A 5AFYH 2CHAB 4AYVB 3E8LA 3SGAE 3F68H 4TPYA 8LPRA 4FUEA 2PV9B 1TRYA 1BQYA 2ZNKH 3KGPA 2BVRH 4MLFB 2FEQH 5DG6A 1BMMH 1C2JA 1TWXB 2FP7B 3GICB 4FUDA 3KN2A 4Y71A 3GYLB 3RUOA 1GI0A 2QXJA 1O3NA 2BY9X 1QB1A 3SUEA 4JK5A 4MPXA 3TPIZ 1MU6B 2FIRH 4Y76A 3T62A 1XUGA 2Y7ZA 1AZ8A 1YPJH 1GHVH 2P94A 1IHTH 4F49A 4BTTB 1UTOA 1ELTA 1QHRB 4Y8XA 1T8OA 2XXLA 1HXFH 1W0ZU 1QGFA 2ALPA 3SGQE 1ZPZA 1GJBB 2XBVA 3F6UH 3MYWA 3OY6U 2BLVA 4GCHG 4YOIA 4NZLA 1BMNH 1GL1A 1A5HA 1FY4A 1O2TA 5BRRE 2BDIA 1MU8B 4B73A 1DSUA 1FQ3A 3OY5U 2RA0A 1P2KA 5C2ZA 3ZVGA 1TA2A 3Q77A 2Y80A 1SHYA 4ISIH 1C5TA 4CRBA 1GGDC 3TVJB 9LPRA 4AN7A 1WYKA 1HYLA 1ZGVA 1O3EA 1EAXA 4TY7A 3ZVEA 1EP5A 5A8YA 1KXCA 1Z71A 1J8AA 5A2MH 1WOFA 3K9XB 1SQOA 1AFEH 1S82A 2SGPE 3P8GA 3NZIA 1XUHA 4FUCA 1AE8H 1Y5AT 2FM2A 2WPJS 4X0WU 2A4GA 2WUBA 3ATIA 2HPPH 3TJVA 2FOAA 3SHCH 1L4ZA 1GGDB 1NN6A 3SU6A 4CBOA 2IN2A 1TGBA 2YNBA 4NIWA 4X6MA 1TMTH 4GAWA 1O2QA 4JYVH 4YOGA 2BD4A 4IMQA 3VB3A 2FOEA 7GCHF 2H1UA 1K2I1 2LPRA 1L1JA 1DICA 2Z94A 1YCPM 3L6PA 2H5DA 3VPKA 1O2MA 3BTKE 1MBQA 1SSXA 1OWJA 1PPEE 3H7OA 2BDHA 2ZP0H 3SV6A 3RXFA 1DLKB 1EZQA 1NESE 3K6YA 3QTVH 5C1UA 4OS7A 2J38A 1KDQA 4DY7B 4Y8ZA 2VWNA 3GOVB 1SGPE 3UNSA 1GJ4H 1F0RA 2G4UA 2ZGBH 2C8XB 2A31A 5ETXA 4ZKSU 1A2CH 5E2OA 3HGNA 5E8EH 3PO1C 2AS9A 1WTGH 1B0EA 4NA8A 1O2KA 4D8NA 1P2NA 1HIAA 3TU7H 1ZJDA 1BTUA 2ZHQH 4NSYA 2O8UA 3SZNA 1P9UA 3VXFH 5F6MA 2AFQB 1PPHE 2NU4E 1MZDA 2ZZUH 2FLRH 1RTLA 4ESTE 1P2IA 4WH8A 4AGJA 1F0SA 3M5NA 1SGDE 2G81E 4CR5A 1CE5A 2BD5A 3A7YA 4X8UH 4CRDA 1ZGIA 2GCHF 1MAXA 3F9GA 3PO1B 1GI8B 2ZF0H 5HM9A 3NK8A 3A7VA 4GHTA 3BG4C 1NU7B 3QO6A 2CN0H 3MTYA 3RMLH 3RXTA 2HPQH 4BANB 1G9IE 3RM2H 1KXDA 1IQLA 3GCTG 1HPGA 2BZ6H 2UUYA 2FOBA 1DANH 2O8LA 4FVDA 1CT0E 3B9FH 2BX4A 4YT6H 1YGCH 1KXEA 3KL6A 3W94A 2ZGJA 3TK6A 4ABBA 4DVAU 1O0DH 1GDQA 1LVOA 2BVSH 3HK3B 4TY6A 2GX4A 3MNXA 3RXBA 1BRBE 4WMFA 1EP6A 2Y5FA 2A4OA 2XWBI 1BA8B 3BG4B 1C5RA 1O2SA 2Q1JA 4IGDA 1C2LA 1WSSH 1HAGE 2BXUH 1WQSA 3Q3YA 1BTWA 2HALA 2XYAA 1BHXB 2TGTA 3EE0B 1GMCG 3RP2A 1Q31A 4I8JA 3MU8A 2ZFRH 1D9IA 1V2LT 2Q6GA 3RMOH 3EA7A 2VVUA 2FWWA 3DT0H 3SI3H 5FCRA 3S9AA 1GI4A 3PB1E 2J94A 3BTHE 3LH1A 4K1TA 1FIZA 2ZCLP 1GI3A 2GT8A 2Y82A 4O97A 1ZMNA 1EB1H 2BB4A 4MNWA 4AX9H 3S7HB 2JH5D 4LZ1H 4Y7AA 3RXKA 1NY22 4ZUHA 3BEUA 3SQHE 1QTFA 1YC0A 1C5LH 2VWLA 4I31A 5H4IB 4FUJA 1P8VC 1FN8A 3ZVCA 2OUAA 1P2QA 3AW1A 1V2PT 1E35B 1AQ7A 3M3TA 1MTUA 1L4DA 3LC5A 1AGJA 3RXQA 1J16A 1A4WH 4JK6A 1ANEA 2GZ8A 2Q6DA 4H6TA 1UTNA 1V2ST 4NG9H 2GZ7A 4BOHA 1C5UA 5LH8A 1O3AA 2PGQB 2W3KA 3LONA 1XVOA 4ZHAA 1BTXA 3RMNH 1GPZA 2WV5A 1MH0A 4OS2A 1J9CH 2GDEH 1N8OC 3VB5A 4Y11E 3BN9A 3M36A 3AASA 4CH8B 2V0BA 2A2QH 1E36B 3RXEA 1CO7E 2I6QA 2VJ1A 2ZI2H 1T4UH 4LZ4B 1BBRK 2HRVA 1GHAG 3A87A 3GY7A 3LGUA 1OWDA 2VGCC 1C1OA 4MDSA 1H8DH 3GDUA 3SNCA 1THPB 4B2CA 2SGAA 2ZDKA 1AD8H 2W26A 3SU3A 4ZHMU 1MCVA 2G00A 3ZV9A 2PUXB 4IMZA 2IPHA 2PUQH 1SGQE 1GMHF 3BTME 1DE7H 2D2DA 4BTUB 1HUTH 1G30B 3TIUA 1XUJA 3RXMA 5L6NH 3O8BA 2STAE 1FY8E 1W10U 1ETRH 1V2QT 2PHBA 4JCNA 3U8RH 2BDYA 3UPEA 1BTZA 4U2WA 3PLPA 2XC4A 2XCNA 3QZQA 4ZMAH 1C2EA 2VIOA 3V12A 1D6RA 2FMJA 3NUMA 2BQ7B 1C5QA 1TBQH 1H1BA 5JBAS 3BEIB 3BTWE 2H9EH 3K65B 1EJNA 4YTAA 1W11U 1O5EH 4ZKNU 1FAKH 5DK1A 5TJXA 2J4IA 1NRNH 5HM2A 4Y6DA 4XBDA 2W5EA 2QV1A 3TGJE 2BQWB 3SV9A 4FXGH 1VCWA 4UONA 5LPEA 4WVPE 4J2YB 1FXYA 2A2XH 1C5SA 5DGJA 2QN5T 1O2PA 4Q2KA 2VWMA 3ZZ6A 1C5ZB 1GHWH 3MU1A 1AFQB 3SNAA 1VJ9U 3M7TA 3Q00A 1MTVA 2OCVB 4XSKU 3OX7U 1PPGE 2FPZA 3CS0A 1ZHRA 2VB0A 1ZMJA 1PQ8A 3QGJA 3FP7E 1NS3A 3RU4T 4AG2A 4KP0A 1K1LA 3D65E 3UY9A 1UK2A 1YPLH 2XW9A 1QFKH 4ZHLU 3CENA 1UVTH 3P8NA 1O39A 4X6PA 1V2UT 1TRNA 7KMEH 4CR9A 1GHXH 1AUJA 2GP9B 2GCTC 1PPCE 3N7OA 3A81A 3SOSA 1A0HB 1ABJH 2BYAX 3V3MA 1RFNA 3E0PB 1ARCA 1SL3A 4DT7B 4KTCA 3MHWU 3MO3A 4Q80A 1Q2WA 5L2ZH 3SUDA 1GVLA 2FXRA 4NCYA 4X8SH 3I29A 4OGYA 4BAKB 3GY8A 1C1PA 4B75A 1VITG 3PTBA 3PMBB 4A6LA 1C2MA 1JRSA 4K2YA 1FPHH 1TGTA 2ASUB 5HXFA 2GCTB 1F5KU 4ABHA 1DSTA 1DY8A 4UFDH 1ANDA 7GCHG 1AI8H 3QTOH 2BY7X 1DWEH 1GBAA 3RU4E 2FYQA 1HV7A 1PFXC 1GMDG 1L2EA 1OPHB 3KCGH 4NIYA 3D23A 3MU0A 5JYIA 1Z8RA 4KGAA 3ZVBA 2A7JA 1D3QB 1ELEE 2ZG0H 1PPZA 4XBCA 1GJ9B 2H6MA 1GVKB 3SV7A 5FX5A 5FBEA 1C9PA 1XX9A 4MPVA 3RLWH 1NU9A 5F8TA 1TYNA 1GI5A 1VITH 1BIOA 1Y3YA 1GJDB 1Z1JA 1DXWA 2QAAA 2ZC9H 4ZXYH 2F9NA 1TA6A 1ELVA 2B7DH 5EGMA 3BEFB 3T29A 2A5AA 2VIQA 3M7UA 2GCHG 3M5LA 3OSYA 1EUFA 2FDAA 1FONA 1Y3UA 2STBE 3BTFE 1HAHH 4X1NU 4BAHB 1OOKB 3PTNA 5AFZH 2NU2E 1FIWA 1O2RA 4SGBE 3SJ8A 3A86A 1XUKA 2OBQA 5EOKA 3U8OH 1GBFA 3EA8A 3QDZB 1Z8GA 3LGWA 1ELDE 2GV6A 2ZKSA 3H5CB 2V6NA 1C5PA 1T7CA 1C9TA 1DWDH 1LQDB 1UMAH 3SU5A 1GBKA 2EI7A 1ELGA 3LJJA 3SU1A 1EOLA 1V2VT 1UTPA 3DFJA 4A1VA 2HOBA 1DWBH 4FVBA 4IC6A 3BV9B 4UD9H 4RSPA 4FUHA 2XRCA 2ZU4A 5G4BA 5EW2H 4NA7A 1BUIA 2AMQA 1V2OT 1RS0A 1ABIH 4OS5A 1OP2A 5GCHF 1C2GA 2BOKA 2DE9A 1BMLA 4WWYA 1K28D 1MZAA 1AKSA 3O8RA 2TIOA 3DUXH 4OS4A 1O2UA 3KQDA 2FOHA 2FTLE 4ZH8A 4RKOB 2C8ZB 4BAOB 2HLCA 1SGIB 1C1SA 3M5OA 2A0QB 3F9FA 3SBKA 1FUJA 1QA0A 2ZIQH 2ZHDA 1AHTH 2ZDAH 2ZQ1A 1RIWC 1WQVH 2WPLS 3P92A 2NU3E 1C1VH 3LGIA 1W0YH 3ZZBA 2G4TA 1LCYA 1AE5A 2FYRA 1AWFH 3TH3H 2FI5E 2ZPRA 2IJOB 1O2WA 1OKXA 1Y59T 1TNHA 1V2JT 4IN2A 4HGCA 3TJUA 2A7HA 4HFPB 2H2ZA 1S5SA 2R2WU 3UQOA 4GPGA 3RXHA 2O8MA 1FAXA 3QWCH 2CV3A 1RIWB 2J92A 2H5CA 3HGPA 1QB9A 1V2KT 1TIOA 1ZSLA 2ZPSA 3LDXH 1VJAU 2JH6D 5DP6A 4D9QA 4ABFA 1K1IA 1IQGA 3Q3KA 3A7TA 1GBBA 3MH4A 3RDZA 3AAVA 1QJ7B 2SNVA 2PFEA 2WPIS 2BHGA 2JKHA 1LVBA 1J15A 1QY6A 3URCA 2FI3E 1HAXB 4AGKA 4NIXA 1AVXA 1ZSKA 5EG4A 1W12U 3SUFA 1EJMA 1MD8A 4A1TA 2ZHFH 2UUJB 1KSNA 2ZGHA 2FOFA 3RC4A 3S0NA 5E2PA 4Y8YA 1EAWA 2BY6X 2D8WA 3AVZA 3SNBA 3V7TA 1Y3XA 2A5KA 2AGEX 4J1YA 1DITH 3DHKH 5EW1H 3V13A 1EPTC 2Z3DA 4RKJB 4YLQH 2CXVA 5EXMA 1O5AB 3SORA 1A5IA 1PYTC 2HNTC 1VZQH 3SI4H 1GJAB 3EA9A 1ZHMA 4K3JA 1CGHA 1V6DA 3GY6A 4O03A 1AUTC 6GCHF 1UHBB 4MNXA 4Y0ZE 3QLPH 4LK4A 3RXRA 1O31A 3SJOA 1P3CA 1EQ9A 2CJIA 1BRCE 1O3HA 8ESTE 3ZYEA 1IOEA 2A4QA 1UCYE 3A8DA 2THFB 2D1JA 1EPTB 4DIHH 1AO5A 1D3PB 4K1EA 2C3SA 1LHFH 2AMPA 4ISNA 5DJ7A 1ZLRA 2Z7FE 1OX1A 8GCHG 4K1SA 2B8OH 1HAYB 1ESBA 1QB6A 4H42U 1JMOH 1WU1A 3EQ0H 1MKXK 2CGAA 3LGTA 1GBIA 1QRXA 2EC9H 2G5VA 2BVXH 1FY5A 1BOQA 1J14A 1C5XB 2BOHB 2OD3B 2VH6A 4NFEA 2BDAA 1G37A 2KAIB 2F3CE 1CU1A 1TPPA 1TABE 3FFGA 2ZDNA 1TGNA 2ODYB 2QCYA 1H9HE 4TPIZ 3MNCA 3UQVA 1O3LA 2G8TA 2C8YB 1JWTA 2PKSC 4XDEA 2SGEE 3SNEA 3M37A 3SNDA 1UTQA 1GBCA 3NPSA 1T31A 1LDTT 2BXTH 1OWHA 1YBWA 4DURA 2XC0A 4FUGA 1TE0A 1ZSJA 5JBTA 1HJ8A 1IQKA 1ORFA 1SPJA 1O3JA 3BSQA 1ZR0A 4I8GA 1SGEE 2F83A 1BBRH 1SGCA 1QBVH 1VCQA 1EATA 1P2JA 2RA3A 1OS8A 1ZTLA 3EYDA 1D4PB 1H9IE 2PKSB 5CHAC 1A0LA 1O5FH 2H9HA 1E37B 5J4QA 4UFGH 3RXOA 3RXGA 1G3DA 3E3TA 3URDA 2WYGA 2PKAA 3KQCA 3U8TH 2VIDA 1C1MA 1C5WB 1TQ7B 1S85A 3QX5H 5C20A 1KTSB 2ZHEH 1XM1A 5K0HA 3ZZAA 1AY6H 3ATWA 1BDAA 2ZDVH 3PWCA 4D7GA 1V2RT 2OC7A 2G5NA 4BAMB 1S6FA 5EXNA 2RCEA 1C2IA 1SLXB 3F9EA 3KQBA 4BAQB 1SVPA 2P16A 5CHAB 1GDUA 2C4FH 2FOMB 2ODQA 2Y5GA 3RXAA 4NGAH 1FJSA 1MQ5A 2ZTXA 2G51A 4JZFH 2BY8X 1C5VA 2ANYA 4AYYB 3RLYH 2WPHS 1NFYA 1TALA 1ZHPA 1YYY1 3D49H 5C1XA 1AZZA 1P01A 3FANA 1K1OA 1HAOH 2ANKH 3ZZ8A 2AYWA 5IYTA 3LPRA 3P8OA 2ZGXH 3VEQB 1SGRE 1EZSC 2F91A 1QL7A 2XC5A 1DM4B 1NO9H 1UVPA 3ZZ7A 1PPFE 5F03A 2Z9JA 1ELBA 4RN6A 1O3MA 2UUKB 2A7CA 3ZZDA 3T5FH 4BNRA 3BTGE 3F9HA 4D7FA 5SGAE 4FUFA 5GIBA 3LT3A 4GSOA 1GJCB 1RJXB 3RC5A 3LU9B 1YPMH 5JPMH 1AWHB 1O33A 4KTSA 2DE8A 3RC6A 3R0FA 4GCHF 1C5MD 1C1QA 1G36A 2GVFA 3LGVA 4MG3A 3UOPA 1O2YA 1Y3VA 4Q7YA 3OTJE 2F9OA 1S0QA 1XMNB 3E16B 3BTTE 3RXUA 4B76A 4DGJA 2WV4A 1DX5M 1IQHA 2BD8A 5B6OA 2SGFE 4AG1A 1N8OB 1ZPBA 3ZZ5A 5ESTE 3QK1A 4ABEA 1V2MT 2P93A 2HGTH 5AHGH 1Z7KA 1O2ZA 2GD4B 1Z6JH 3ODDA 3BTEE 3A88A 1W7XH 1O2XA 2BLWA 2VGCB 1CVWH 5HMAA 1G3CA 3ZZ4A 1MMJN 3O8DA 1W2KH 3T25A 2Z6BD 1KLTA 3IWMA 1TNJA 3RXVA 1TRMA 1SLWB 3GY4A 4XBBA 1ZJKA 2ZTZA 3EAJA 4JZIA 1BTPA 4IS5A 2W7SA 1HAVB 4TYDA 3M35A 2O8TA 4ISHH 1PJPA 2ZU3A 1DY9A 1C1UH 1SOZA 3GYMA 2UWLA 1F7ZA 3STIA 4Y10E 5K7RA 1A7SA 1LO6A 2AEIH 2GMTC 2GDDA 5A0BA 3JZ1B 3GDVA 3NXPA 4LXBH 4UE7H 1BTYA 2BY5X 1A46H 4NWLA 1JIRA 1THSH 1TOMH 2EA3A 1GVZA 2R9PA 3DA9B 3RXCA 4LOYH 1WAYB 5GXPA 5FXLA 1AIXH 2ZEBA 2BDCA 1ELAA 1EAUA 1LHEH 1SOTA 3I78A 1HAZB 1P10A 4D76A 3MOCA 4AFUA 3O8CA 2GMTB 1GL0E 1FY1A 1FV9A 2GV7A 4CRFA 3KHVA 4X6OA 4X6NA 5E0JA 1UK3A 1UHBA 3TK9A 1TNGA 3SUGA 4IW4E 1SBWA 2BDBA 2LNCA 2ZDLA 1Y5BT 5FPYA 1RTFB 1IQIA 1C5YB 2FS9A 2WYJA 3T27A 5E0HA 1EZXC 1GCDA 1VR1H 5E0GA 1TONA 3KIDU 1P03A 3UIRA 1D6WA 3PLBA 4F4OC 5EPYA 3GCTF 1XXDA 1K1JA 3ATKA 2B9LA 1BBRE 2V3HH 2R3YA 1DWCH 1T8MA 3MFJA 3IITA 1ZTKA 2ANMH 3A7XA 1UK4A 1TNIA 1P05A 1EXFA 4O9VA 2OQ5A 2BM2A 1HJ9A 1JBUH 4UFEH 2FI4E 1EJAA 4ABGA 4CRAA 1KDQB 1BB0B 2QF0A 1UTKA 1GI9B 1GBLA 1V3XA 1GG6C 1NT1A 1WTHD 1H9LB 4DG4A 5C1YA 3DD2H 3KQEA 1RGQA 2FOCA 2J95A 3ZVDA 2HNTE 3NKKA 1GHYH 3M61U 1E34B 1DXPA 2ZDMA 1N6YA 1HIAB 3PROA 4MPUA 4BXSA 1G3BA 1SR5C 1FMGA 1NC6A 1ANBA 2IOTA 2BLOA 2G55A 2ZGCA 5C3NA 4AB8A 2J9NA 4X2XA 5I25A 2Z3EA 1GHZA 1TGCA 1OYQA 5JB8S 2PTCE 4CHAC 1CHOF 2ULLA 1GG6B 4A7IB 4Z0KA 1W3CA 1ESTA 2ZU1A 3BIVH 3T28A 3SU0A 3VB6A 3GY5A 3HK6B 4YLUA 1SB1H 1FN6A 3QZRA 1QQUA 1UVOA 2PLXA 4OGXA 3TJOA 1TPOA 1TNLA 4CBNA 1S0RA 3MMGA 1EZUC 1B7XB 1YPHC 4FU7A 1A3EH 3PLKA 4AFQA 4NIVA 1Y8TA 1BHXF 2B0FA 2P95A 3GCHC 2BLQA 5JBBS 4CHAB 1MAYA 1MTSA 1A61H 4X1PU 1ZOMA 2OP9A 1EB2A 3RXJA 2V35A 2ZCKP 1AVGH 7LPRA 2QXGA 3TJNA 1THRH 5A8ZA 4WJG2 5BPEA 1L1GA 4WMDA 4PROA 1NFUA 1N1LA 1AVWA 1GI1A 2FZZA 4CREA 1HCGA 2GGVB 1P06A 1YPEH 1SGFA 1NFWA 2BX3A 4E06H 2PWXA 3CP7A 3T26A 1AMHA 3GCHB 3DFLA 1RTKA 2M5TA 2EI6A 1KYNA 1GHBF 4XFQA 1ZTJA 1O3OA 1ZRKA 4MNVA 5A8XA 3ATLA 1QBNA 3BTDE 1P09A 4AB9A 2VH0A 4I33A 4WXIA 3ZVAA 1DS2E 1O34A 1BRAA 1LPGB 2XTTB 3S9CA 1GHAF 4WH6A 2ZECA 3B8JA 3M3VA 4HZHA 1CA0C 2VVVA 1V2WT 4ABAA 3AAUA 1BZXE 4X2VA 5DP4A 1YCPH 1Y5UT 2PR3A 1V2NT 2ZFPH 3FVFB 1K21H 4HTCH 1UO6A 1YPGH 1DPOA 3HKJB 6ESTA 2PSXA 1GI6A 3S9BA 3LGYA 1G2LA 1C4V2 2JH0D 4JZDH 2NU1E 3LKWA 1Z8JB 1TBZH 4X2YA 1ZPCA 2AERH 2P8OC 2QA9E 4XOJA 4AZ2B 1NRRH 1CA0B 1ETSH 1DT2A 1FI8A 1Z1IA 4FU9A 5C5OA 3P17H 1O3KA 2ZFQH 2QXHA 2WINI 4DOQA 1BJUA 1JRTA 4AFSA 5DP3A 1GCTC 1W13U 2B5TB 4HI3A 5I46H 2FS8A 2C93B 4Q7XA 1A3BH 2FTMA 1QURH 4JMYA 5CMXH 4I32A 3W95A 5DP9A 3UNRA 3RXDA 2BQ6B 1YKTA 2F9UA 3BF6H 1LHCH 1TQ0B 2P8OB 3SO3A 2QIQA 5F8XA 1D3DB 4YESB 3U9AH 1HAIH 1KXAA 3FZZA 3GY2A 4B2AA 3A84A 1GCTB 2BZAA 5EXLA 5FPSA 4E05H 1WBGB 4O3UA 4E7NA 1SFIA 3ESTA 3VFEA 1HAVA 5AVDA 1MKXH 4ZKRU 4UFFH 1TNKA 1O38A 3H7TA 4U30A 2JETC 1ELCA 3FZDA 1P12E 2XCFA 1P11E 4MTBA 3UR6A 1DOJA 4BXWA 1S83A 1OP8A 3EDXB 5T6FA 1QA7A 3FP8E 4GHQA 3ODFA 1PQ5A 1OYTH 2C90B 4YT7H 1P0SH 1O5DH 2ZPQA 1C5OH 1O3PB 1O32A 1C1RA 4SGAE 1UTJA 3E90B 3SGBE 4R8TB 1Q3XA 1YCPK 4YOJA 2TGPZ 4ASHA 3BG8A 2ZFSA 1EOJA 1F2SE 1C2DA 4TWYA 5HGGA 3TLOA 1W7GH 2SFAA 2JETB 3U1IB 2BD2A 5PTPA 2VIVA 1S6HA 2F9VA 2F9PA 4NZQA 6CHAC 1F92A 1GMHG 1TB6H 1XUFA 1UVUH 3R3GB 2PGBB 4ISOA 5T6GA 3LJOA 5EPNA 3M3SA 4K69A 3V0XA 1LTOA 3MH7A 1O3FA 4WF8A 1NRSH 2VVCA 4DW2U 1BT7A 3PMAB 3KNXA 1O2LA 1O2IA 3SHAH 2ZU2A 4A1XA 3AW0A 1IAUA 2C8WB 1QL9A 2TGDA 1MTNC 1VITF 2VIPA 1O5GH 3P70B 1TAWA 1TGSZ 2QF3A 6CHAB 1XUIA 1XXFA 3OYPA 3P6ZB 1O2GH 2R2MB 1GBHA 2J2UA 4I8KA 1CQQA 1VGCC 4AORA 4KELA 2OINA 2NU0E 1TX6A 3A7ZA 3IG6B 4YM9A 2PW8H 2A32A 4JZEH 3PWBA 2BTCE 1GMDF 1SQTA 5ABWA 3JZ2B 1RD3B 3TH2H 2F9BH 2RDLA 4M7GA 3U98H 5DO4H 1ZZZA 1C2KA 3QUMP 1MTNB 1NROH 1MQ6A 2DUCA 4Q7ZA 5DPAA 2ZFTA 1QIXB 1BCUH 1DVAH 1ZRBA 1NRPH 2A45B 4MNYA 1FPCH 1HFDA 2UUFB 3RXSA 1Y3WA 5T6DA 5AF9H 1VGCB 4ISLA 2BD7A 5LPRA 2P3TB 4A92A 4JZ1A 3E6PH 1TMUH 2BD3A 1IQJA 4X8VH 3MH5A 3CS7A 3UUZA 2XWAA 1V2TT 1NPMA 1YLDA 2ANWA 3B23B 1P2MA 9ESTA 3TGKE 2OTVA 3ATMA 3UOUA 1K22H 1KXBA 1PPBH 1QRWA 1QCPA 3MH6A 2Y6TA 3PYHA 1O36A 3FP6E 3NCLA 5FPTA 4NFFA 2UWOA 3GY3A 1SLVB 3E0NB 2Y7XA 3SW2B 1EKBB 1O30A 3GCNA 1EAIA 2P3FH 1F5RA 1RXPA 5ESBA 3NWUA 5A0AE 2GT7A 2TPIZ 2V3OH 1AN1E 2FO9A 5CE1A 3RXLA 1HBTH 1O2OA 5EU8A 2ZU5A 1L1NA 2XBXA 3UREA 1O5CB 1QRZA 4OS1A 1WUNH 3Q76A 1C1WH 4DCDA 3ZYDA 1GBTA 1QR3E 4YO9A 5LGOA 1GBMA 4NWKA 3U69H 1CGJE 4GVUA 2ODPA 1ELFA 1WV7H 3G01A 3L3TA 1OWKA 1GJ5H 2OC0A 3HKIB 3QGNB 2EEKA 3WY8A 2SNWA 2ZTYA 3SU2A 5C67A 5GDSH 2AGIX 4ZAEA 1PQAA 1O3CA 2AMDA 1C2FA 4ZKOU 1YM0A 2BDGA 2Z9LA 2P3UB 5DKMA 1SG8B 1CHOG 2A1DB 2R0KA 3A82A 3UNQA 4YZUA 3A7WA 1F0TA 3K2UA 1QJ1B 1NTPA 3I77A 1GI2A 5JBCS 1Z8IB 2RG3A 4Y7BA 3TH4H 1SMFE 4QT8C 1GI7B 1YPHE 2PSYA 2Z9KA 1JXPA 1E38B 2YNAA 3PV4A 1BTHH 1N6XA 1SLUB 3A8AA 3UR9A 4CH2B 1HGTH 5GPIB 2P59A 3Q3XA 4WY3A 1MKWH 1W8BH 1P57B 1O37A 5HYOA 1GBJA 4KKDA 1HRTH 1XKAC 1HB0B 3MU5A 4XE4A 5GJ4B 3QN7A 3A83A 2SGQE 3LC3A 2ZQ2A 1CA8B 1QJ6B 5FCKA 1FY3A 5TCAA 3TGIE 2FESH 2TRMA 2Z9GA 1YPKH 3E91A 4GUXA 3LIWA 3UFAA 1LPZB 2H9TH 1BJVA 1T8NA 2OQUA 2I6SA 2Z9IA 4IBLH 4DJZB 1O3IA 4H6SB 1C4U2 1GJ8B 1CT4E 2FODA 4X1RU 3FAOA 1O2VA 1DDJA 5EQSA 1B5GH 4Y79A 3VB7A 1O2NA 2AGGX 1O35A 3A89A 1SGFG 1ACBE 2VU8E 1TFXA 3S69A 2VWOA 5L2YH 4K60A 1GHBG 2ZWLH 1AKSB 2ZA5A 1QNJA 2QY0B 2ZHWH 2TGAA 2BMGB 2A4RA 1CSOE 2ZO3H 3MWIU 1O5BB 2GTBA 3EGKH 1LHDH 1MUEB 1KLIH 1RRKA 2ILNA 4U32A 3D62A 5T3HA 8KME2 2ALVA 3MO6A 1SGNE 1UTMA 4ABJA 2BD9A 2TBSA 1P04A 2R3UA 3C27B 5GCHG 1J17T 4Z6AH 3ZZCA 1LKBA 2HVXA 3S7KB 1QL8A 3OU0A 2QGRA 3VXEH 1BRUP 2EI8A 4K8YA 3TITA 4E7RG 3TK5A 2J34A 3MO9A 2ZFFH 3SN8A 2OLGA 3MNSA 1K1NA 1D3TB 1A0JA 1UJ1A 1NFXA 3UWJH 3M7QA 1C2HA 4O3TA 3LOXA 1A1RA 1BMAA 2O8WA 2FX6A 4K5ZA 2ESTE 1OXGA 1CHGA 4B74A 4R0IA 3MNBA 5DP5A 1EX3A 1HXEH 2FOGA 2W3IA 1IQFA 1MTWA 4Y0YE 3SU4A 3T2NA 2G52A 1IHSH 1OWIA 3A8CA 3SJ9A 1MKWK 1DLEA 4UEHH 2QYIA 1K1PA 4MQAA 1F0UA 3A80A 4ABIA 5IDKA 1TPSA 1FNIA 5A09A 1TOCB 2W7UA 1UVSH 1ARBA 3RMMH 1GJ7B 1JIMA 2AIQA 3ENSB 1AFQC 1UTLM 3A85A 4NSVA 4INHA 4MVNA 4B1TA 1NRQH 1ANCA 4IC5A 2VINA 1QQ4A 1C5NH 1Z6EA 1VCPA 4JYUH 3GCOA 1TMBH 3GISB 4X8TH 4ABDA 4OS6A 8GCHF 5GWZA 1JOUB 1F5LA 5DP8A 1EASA 2OXSA 4DIIH 2AH4X 4FU8A 3SV2H 1O3GA 3VGCC 5L30H 4WMEA 3UWIA 1ESAA 2VNTA 1AU8A 1NM6A 1MCTA
chains in the Genus database with same CATH superfamily
5FAHA 1EPTA 1IQNA 1LVYA 5FX6A 5LPFA 1G3EA 3RM0H 4INKA 1B0FA 3C1KA 2R0LA 2HNTF 4GLYA 1BITA 1MD7A 1P02A 3E1XB 2ZCHP 4X1QU 5EQQA 2RFKC 4KTUA 1E0FD 3ZZ9A 1KTTB 2CMYA 1GWAA 4HG6A 3VGCB 5FHTA 1TPAE 1WCZA 4FUIA 4AFZA 1AB9C 4I7YH 1SFQB 2Y5HA 3MU4A 3MQKC 2UWPA 1GJ6A 2KAIA 3ELAH 3HATH 1S84A 2Y81A 3L33A 4X2WA 3KEEA 2O9QA 5EODA 1G2MA 4AOQA 1U6QA 3F2FA 3PMJA 2Z3CA 1DUAA 1INCA 1KIGH 1P2OA 1PQ7A 1S81A 1XVMA 3SJIA 1K1MA 2A5IA 1YP9A 1LVMA 1LHGH 4B71A 5J4SA 2KCPA 2HVYB 1A5GH 4CRGA 1GMCF 3UTUH 4UDWH 3U1JB 2HWLB 1O2JA 1AB9B 1C1NA 1YLCA 1T4VH 1TX7A 3STJA 2CF8H 6GCHG 1CBWC 1P3EA 1ID5H 1YF4A 3F1SB 3SV8A 1T32A 2WPMS 3W1EA 1ZYOA 4MPWA 4I8LA 1KLJH 1LMWB 5JB9S 2XBWA 5TCCA 1SQAA 1HDTH 4X1SU 1DUEA 1K9OE 1KXFA 3SQEE 3UB0A 1GDNA 3ZVFA 1XKBC 1ZMLA 3SJKA 1ETTH 1C1TA 1QBOA 1SGTA 2KFWA 3RXPA 1TX8A 2OC1A 1X7AC 3TNSA 2OC8A 4U01A 1OSSA 1CBWB 5C0TA 1UCYH 1HAPH 1O3BA 1CGIE 4ZROA 4WXVA 4ZXXH 3A8BA 3ZZ3A 3RXIA 1IQEA 1FDPA 1T8LA 1FZZA 2CF9H 1SGYE 1O3DA 2QC2A 4INLA 4JYTA 2AIPA 1H4WA 2VBCA 1NZQH 3K6ZA 4VGCC 1M9UA 2GZ9A 5A0CA 4FUBA 1OWEA 1SC8U 3KF2A 1L0ZA 4K8BA 4D9RA 4BTIB 2GKVE 2SGDE 3LH3A 1GBEA 1TBRH 1G32B 4THNH 7ESTE 1CT2E 2PKAB 1TLDA 2VIWA 5DP7A 1HJAC 4IN1A 4NA9H 2V3MA 1LKAA 2K1QA 1OP0A 1LPKB 4VGCB 1O2HA 5F8ZA 3HPTB 2OBOA 1HLTH 3PMHB 1IQMA 1LQEA 5EQRA 4B2BA 2QXIA 1SHHB 2Q6FA 3VB4A 1P9SA 2YOLA 3BIUH 2NWNA 3PM3A 1W14U 5F53A 3M5MA 4CRCA 2XBYA 5FBIA 1HJAB 1DFPA 3TNTA 3MI4A 2CHAC 1FLEE 3GDSA 5C5NA 2PTNA 1KY9A 1PYTD 4TWWA 1SI5H 1MBMA 2XNIA 3P8FA 4H4FA 3ZV8A 6LPRA 1H8IH 2WUCA 3RU4D 5JDUB 4A5TS 3VG8A 1HNEE 1GBDA 2WPKS 2D26C 3BTQE 3ITIA 2FX4A 1C4Y2 1UCYK 2FLBH 4I8HA 3P95A 5AFYH 2CHAB 4AYVB 5T1VA 3E8LA 3SGAE 3F68H 4DT4A 4TPYA 8LPRA 4FUEA 2PV9B 1TRYA 1BQYA 2ZNKH 3KGPA 2BVRH 4MLFB 2FEQH 5DG6A 1BMMH 1C2JA 1TWXB 2FP7B 3GICB 4FUDA 3KN2A 4Y71A 2QE7D 3GYLB 3RUOA 1GI0A 2QXJA 1O3NA 2BY9X 1QB1A 3SUEA 4JK5A 4MPXA 3TPIZ 1MU6B 2FIRH 4Y76A 3T62A 1XUGA 2Y7ZA 1AZ8A 1YPJH 1GHVH 2P94A 1IHTH 4F49A 4BTTB 1UTOA 2J98B 1ELTA 1QHRB 4Y8XA 1T8OA 2XXLA 1HXFH 1W0ZU 1QGFA 2ALPA 3SGQE 1ZPZA 4XD7D 1GJBB 3OTPA 2XBVA 3F6UH 3MYWA 3OY6U 2BLVA 4GCHG 4YOIA 1E1QD 4NZLA 1BMNH 1GL1A 1A5HA 1FY4A 1O2TA 5BRRE 2BDIA 1MU8B 4B73A 1DSUA 1FQ3A 3OY5U 2RA0A 1P2KA 5C2ZA 3ZVGA 1TA2A 3Q77A 2Y80A 1SHYA 4ISIH 1C5TA 4CRBA 1GGDC 3TVJB 9LPRA 4AN7A 1WYKA 1HYLA 1ZGVA 1O3EA 1EAXA 4TY7A 3ZVEA 1EP5A 5A8YA 1KXCA 1Z71A 1J8AA 5A2MH 1WOFA 3K9XB 1SQOA 1AFEH 3EE7A 1S82A 2SGPE 3P8GA 3NZIA 1XUHA 2LELA 4FUCA 1AE8H 1Y5AT 2FM2A 2WPJS 4X0WU 2A4GA 2WUBA 3ATIA 2HPPH 3TJVA 2WZQA 2FOAA 3SHCH 1L4ZA 1GGDB 1NN6A 3SU6A 4CBOA 2IN2A 1TGBA 2YNBA 4NIWA 4X6MA 1TMTH 4GAWA 1O2QA 4JYVH 4YOGA 2BD4A 4IMQA 3VB3A 2FOEA 7GCHF 2H1UA 1K2I1 2LPRA 1L1JA 1DICA 2Z94A 1YCPM 3L6PA 2H5DA 3VPKA 1O2MA 3BTKE 2KCYA 1MBQA 1SSXA 5KEDA 1OWJA 1PPEE 3H7OA 2BDHA 2ZP0H 3SV6A 3RXFA 1DLKB 1EZQA 1NESE 3K6YA 3QTVH 5C1UA 4OS7A 2J38A 1KDQA 4DY7B 4Y8ZA 2VWNA 3GOVB 1SGPE 3UNSA 4ASUD 1GJ4H 1F0RA 2G4UA 2ZGBH 2C8XB 2A31A 5ETXA 4ZKSU 1A2CH 5E2OA 3HGNA 5E8EH 3PO1C 2AS9A 1WTGH 1B0EA 4NA8A 1O2KA 4D8NA 1P2NA 1HIAA 3TU7H 2F4LA 1ZJDA 1BTUA 2ZHQH 4NSYA 2O8UA 3SZNA 1P9UA 3VXFH 5F6MA 2AFQB 1PPHE 2NU4E 1MZDA 2ZZUH 2FLRH 1RTLA 4ESTE 1P2IA 4WH8A 4AGJA 1F0SA 3M5NA 1SGDE 2PP6A 2G81E 4CR5A 1CE5A 2BD5A 3A7YA 4X8UH 4CRDA 1ZGIA 2GCHF 1MAXA 3F9GA 3PO1B 1GI8B 2LP6A 2ZF0H 5HM9A 3NK8A 3A7VA 4GHTA 3BG4C 1NU7B 3QO6A 2CN0H 3MTYA 3RMLH 3RXTA 2HPQH 4BANB 1G9IE 3RM2H 1KXDA 1IQLA 3GCTG 1HPGA 2BZ6H 2UUYA 2FOBA 1DANH 2O8LA 4FVDA 1CT0E 3B9FH 2BX4A 4YT6H 1YGCH 1KXEA 3KL6A 3W94A 2ZGJA 3TK6A 4ABBA 4DVAU 1O0DH 1GDQA 1LVOA 2BVSH 3HK3B 4TY6A 1KMHB 2GX4A 3MNXA 3RXBA 1BRBE 4WMFA 1EP6A 2Y5FA 2A4OA 2XWBI 1BA8B 3BG4B 1C5RA 1O2SA 2Q1JA 4YXWD 4IGDA 1C2LA 1WSSH 1HAGE 2BXUH 1WQSA 3Q3YA 1BTWA 2HALA 2XYAA 1BHXB 2TGTA 3EE0B 1GMCG 3RP2A 1Q31A 2JIZD 3WW7A 4I8JA 3MU8A 2ZFRH 1D9IA 1V2LT 2Q6GA 3RMOH 3EA7A 2VVUA 2FWWA 3DT0H 3SI3H 5FCRA 3S9AA 1GI4A 3PB1E 2J94A 3BTHE 3LH1A 4K1TA 1FIZA 2ZCLP 1GI3A 2GT8A 2Y82A 1H8ED 4O97A 1ZMNA 1EB1H 2BB4A 3OFND 4MNWA 4AX9H 3S7HB 2JH5D 4LZ1H 4Y7AA 3RXKA 1NY22 4ZUHA 3BEUA 3SQHE 1QTFA 1YC0A 1C5LH 2VWLA 4I31A 5H4IB 3WWFA 4FUJA 1P8VC 1FN8A 3ZVCA 2OUAA 1P2QA 3AW1A 1V2PT 1E35B 1AQ7A 3M3TA 1MTUA 1L4DA 3LC5A 1AGJA 3RXQA 1J16A 1A4WH 4JK6A 1ANEA 2GZ8A 2Q6DA 4H6TA 1UTNA 1V2ST 4NG9H 2GZ7A 4BOHA 1C5UA 5LH8A 1O3AA 3DSOA 2PGQB 2W3KA 3LONA 1XVOA 3WWBA 4ZHAA 1BTXA 3RMNH 1GPZA 2WV5A 3OEHD 1MH0A 2W6JD 4Q4LA 4OS2A 1J9CH 2GDEH 1N8OC 3VB5A 4Y11E 3BN9A 3M36A 3AASA 4CH8B 2V0BA 2A2QH 1E36B 3RXEA 1CO7E 1W0JD 2GJGA 2I6QA 2VJ1A 2ZI2H 1T4UH 4LZ4B 1BBRK 2HRVA 1GHAG 3A87A 3GY7A 3LGUA 1OWDA 2VGCC 1C1OA 4MDSA 1H8DH 3GDUA 3SNCA 1THPB 5C17A 4B2CA 2SGAA 2ZDKA 5FL7D 1AD8H 2W26A 3SU3A 4ZHMU 1MCVA 2G00A 3ZV9A 2PUXB 4IMZA 2IPHA 2PUQH 1SGQE 2KR7A 1GMHF 3BTME 1DE7H 2D2DA 4ACBA 4BTUB 1HUTH 1G30B 3TIUA 4RI0A 1XUJA 3RXMA 5L6NH 3O8BA 2STAE 1FY8E 1W10U 1ETRH 1V2QT 2JJ1D 2PHBA 4JCNA 3U8RH 2BDYA 3UPEA 1BTZA 4U2WA 3PLPA 2XC4A 2XCNA 3QZQA 4ZMAH 1C2EA 4AC9A 2VIOA 3V12A 1D6RA 2FMJA 3NUMA 2BQ7B 1C5QA 1TBQH 1H1BA 5JBAS 3BEIB 3BTWE 2H9EH 3K65B 1EJNA 4YTAA 1W11U 1O5EH 4ZKNU 1FAKH 5DK1A 5TJXA 2J4IA 1NRNH 5HM2A 3U28C 4Y6DA 4XBDA 2W5EA 2QV1A 3TGJE 2BQWB 3SV9A 4FXGH 1VCWA 4UONA 5LPEA 4TSFD 4J2YB 4WVPE 5B6LA 1FXYA 4OM9A 2A2XH 1C5SA 5DGJA 2QN5T 1FX0B 1O2PA 4Q2KA 2VWMA 3ZZ6A 1C5ZB 1GHWH 3MU1A 3H09A 1AFQB 3SNAA 1VJ9U 3M7TA 3Q00A 1MTVA 2OCVB 4XSKU 3OX7U 1PPGE 2FPZA 3CS0A 1ZHRA 5CDFE 2VB0A 1ZMJA 1PQ8A 3QGJA 3FP7E 1NS3A 3RU4T 4AG2A 4KP0A 1K1LA 3D65E 3UY9A 1UK2A 1YPLH 2XW9A 1QFKH 4ZHLU 3CENA 3GS9A 1UVTH 3P8NA 1O39A 4X6PA 1V2UT 1TRNA 7KMEH 4CR9A 1GHXH 1AUJA 2GP9B 2GCTC 1PPCE 3N7OA 3A81A 3SOSA 1A0HB 1ABJH 2BYAX 3OE7D 3V3MA 1RFNA 3E0PB 1ARCA 1SL3A 4DT7B 4KTCA 3MHWU 3MO3A 4Q80A 1Q2WA 5L2ZH 3SUDA 1GVLA 2FXRA 4NCYA 4X8SH 3I29A 4OGYA 4BAKB 3GY8A 1C1PA 4B75A 1VITG 3PTBA 3PMBB 4A6LA 1C2MA 1JRSA 4K2YA 1FPHH 1TGTA 2ASUB 5HXFA 2GCTB 1F5KU 4ABHA 1DSTA 1DY8A 4UFDH 1ANDA 7GCHG 1AI8H 3QTOH 2BY7X 1DWEH 1GBAA 3RU4E 1NBME 2FYQA 1HV7A 1PFXC 1GMDG 1L2EA 1OPHB 3KCGH 4NIYA 3D23A 3MU0A 5JYIA 1Z8RA 4KGAA 3ZVBA 2J97A 2A7JA 1D3QB 1ELEE 2ZG0H 1PPZA 4XBCA 1GJ9B 2H6MA 1GVKB 4B6FA 3SV7A 3N99A 5FX5A 5FBEA 1C9PA 1XX9A 4MPVA 3RLWH 1NU9A 5F8TA 1TYNA 1GI5A 1VITH 1BIOA 1S6LA 1Y3YA 2QF4A 1GJDB 1Z1JA 4ZCNA 1DXWA 2QAAA 2ZC9H 4ZXYH 2F9NA 1TA6A 3UAIC 1ELVA 2B7DH 5EGMA 3BEFB 3T29A 2A5AA 2VIQA 3M7UA 2GCHG 3M5LA 3OSYA 1EUFA 2FDAA 1FONA 1Y3UA 2W6ID 2STBE 3BTFE 1HAHH 4X1NU 4BAHB 1OOKB 3PTNA 5AFZH 2NU2E 1FIWA 1O2RA 4SGBE 3SJ8A 3A86A 1XUKA 2OBQA 5EOKA 3U8OH 1GBFA 3EA8A 3QDZB 1Z8GA 3LGWA 1ELDE 2GV6A 2ZKSA 3H5CB 2V6NA 1C5PA 1T7CA 1C9TA 1DWDH 1LQDB 1UMAH 3SU5A 1GBKA 2EI7A 1ELGA 3DSGA 3LJJA 3SU1A 1EOLA 1V2VT 1UTPA 3F2GA 3DFJA 4A1VA 2HOBA 1DWBH 4FVBA 3KQ5A 4IC6A 3BV9B 4I86A 4UD9H 4RSPA 4FUHA 2XRCA 2ZU4A 5G4BA 5EW2H 4NA7A 1BUIA 2AHME 1V2OT 2AMQA 3FN8A 1RS0A 1ABIH 4OS5A 1OP2A 5GCHF 1C2GA 2BOKA 2DE9A 1BMLA 4WWYA 1K28D 1MZAA 2KM0A 1AKSA 3O8RA 2TIOA 3DUXH 4OS4A 1O2UA 3KQDA 2FOHA 2FTLE 4ZH8A 4RKOB 5CHBA 2C8ZB 4BAOB 2HLCA 1SGIB 1C1SA 3N7EA 3M5OA 2A0QB 3PRDA 3F9FA 3SBKA 1FUJA 1QA0A 2ZIQH 2ZHDA 1AHTH 2YMSD 2ZDAH 2ZQ1A 1RIWC 1WQVH 2WPLS 3P92A 1YY3A 2NU3E 1C1VH 3LGIA 1W0YH 3ZZBA 2XNDD 2G4TA 1LCYA 1AE5A 2FYRA 1AWFH 3TH3H 3AK5A 2FI5E 2ZPRA 3FO8D 2IJOB 1O2WA 1OKXA 1Y59T 1TNHA 1V2JT 4IN2A 4HGCA 3TJUA 2A7HA 1K0HA 4HFPB 2H2ZA 1S5SA 2R2WU 3UQOA 4GPGA 3RXHA 2HLDD 2O8MA 1FAXA 3QWCH 2CV3A 1RIWB 2J92A 2H5CA 3ZIAD 3HGPA 1QB9A 1V2KT 1TIOA 1ZSLA 2ZPSA 3LDXH 1VJAU 2JH6D 5DP6A 4D9QA 4ABFA 1K1IA 1IQGA 3Q3KA 3A7TA 1GBBA 3MH4A 5EJ1A 3RDZA 3AAVA 1QJ7B 2SNVA 2PFEA 2WPIS 2BHGA 2JKHA 1LVBA 1J15A 1QY6A 3URCA 2FI3E 1HAXB 4AGKA 4NIXA 1AVXA 1ZSKA 5EG4A 1W12U 3SUFA 1EJMA 1MD8A 4A1TA 2ZHFH 2UUJB 1KSNA 2ZGHA 2FOFA 3RC4A 3S0NA 5E2PA 4Y8YA 1EAWA 2BY6X 2D8WA 3AVZA 5GNDA 3SNBA 3V7TA 1Y3XA 2A5KA 2AGEX 4J1YA 1DITH 3DHKH 5EW1H 3V13A 1EPTC 2Z3DA 4RKJB 4YLQH 2CXVA 4Q63A 5EXMA 5DSFA 1O5AB 3SORA 1A5IA 1PYTC 2HNTC 1VZQH 3SI4H 1GJAB 3F2HA 3EA9A 4M9FA 2JJ2D 1ZHMA 4K3JA 1CGHA 1V6DA 3GY6A 4O03A 1AUTC 6GCHF 1UHBB 4MNXA 4Y0ZE 3QLPH 4LK4A 3RXRA 1O31A 3SJOA 1P3CA 1EQ9A 2CJIA 1BRCE 1O3HA 8ESTE 3ZYEA 1IOEA 2A4QA 1UCYE 3A8DA 2THFB 2D1JA 1EPTB 4DIHH 1AO5A 1D3PB 4K1EA 2C3SA 1LHFH 2AMPA 4ISNA 5DJ7A 1ZLRA 2Z7FE 1OX1A 8GCHG 4K1SA 2B8OH 1HAYB 1ESBA 1QB6A 4H42U 1JMOH 2L6OA 1WU1A 3EQ0H 1YLNA 1MKXK 2CGAA 3LGTA 1GBIA 1QRXA 2EC9H 2G5VA 2BVXH 1FY5A 1BOQA 1J14A 2YMSC 1C5XB 2BOHB 2OD3B 2VH6A 4NFEA 2BDAA 1G37A 2KAIB 4RT1A 2RDEA 2F3CE 1CU1A 1TPPA 1TABE 3FFGA 2ZDNA 1TGNA 2ODYB 2QCYA 1H9HE 4TPIZ 3MNCA 3UQVA 1O3LA 2G8TA 2C8YB 1JWTA 2PKSC 4XDEA 2SGEE 3SNEA 3M37A 3SNDA 1UTQA 2WPDD 1GBCA 3NPSA 1T31A 1LDTT 2BXTH 2IPQX 2YMSB 1OWHA 1YBWA 4DURA 2XC0A 4FUGA 1TE0A 1ZSJA 5JBTA 1HJ8A 1IQKA 1ORFA 1SPJA 1MABB 3SYJA 1O3JA 3BSQA 1ZR0A 4I8GA 1SGEE 2F83A 1BBRH 1SGCA 1QBVH 1VCQA 2EQNA 1EATA 1P2JA 2RA3A 1OS8A 1ZTLA 3EYDA 1D4PB 1H9IE 2PKSB 4FETA 5CHAC 1A0LA 1O5FH 2H9HA 1E37B 5J4QA 5EIYA 2V7QD 4UFGH 3RXOA 3RXGA 1G3DA 3E3TA 3URDA 2WYGA 2PKAA 3KQCA 3U8TH 2VIDA 1C1MA 1C5WB 1TQ7B 1S85A 3QX5H 5C20A 1KTSB 3DCLA 2ZHEH 1XM1A 5K0HA 3ZZAA 1AY6H 3ATWA 1BDAA 2ZDVH 3PWCA 4D7GA 1V2RT 2OC7A 2G5NA 4BAMB 1S6FA 5EXNA 2RCEA 1C2IA 1SLXB 3F9EA 3KQBA 4BAQB 1SVPA 2P16A 5CHAB 1GDUA 2C4FH 2FOMB 2ODQA 2Y5GA 3RXAA 4NGAH 1FJSA 1MQ5A 2ZTXA 2G51A 4JZFH 2BY8X 1C5VA 2ANYA 4AYYB 3RLYH 2WPHS 1NFYA 1TALA 1ZHPA 1YYY1 3D49H 5C1XA 1AZZA 1P01A 3FANA 1K1OA 1HAOH 2ANKH 3ZZ8A 2AYWA 4RT0A 5IYTA 2KCAA 3LPRA 3P8OA 2ZGXH 3VEQB 1SGRE 1EZSC 2F91A 1QL7A 2XC5A 1DM4B 1NO9H 1UVPA 3ZZ7A 1PPFE 5F03A 2Z9JA 1ELBA 4RN6A 1O3MA 2UUKB 2A7CA 3ZZDA 3T5FH 4BNRA 1E1RD 5EJLA 2IJD1 3BTGE 3F9HA 4D7FA 5SGAE 4FUFA 5GIBA 3LT3A 4GSOA 1GJCB 1RJXB 3RC5A 3LU9B 1YPMH 5JPMH 1AWHB 1O33A 4KTSA 2DE8A 3RC6A 3R0FA 2EY4C 4GCHF 1C5MD 1C1QA 1G36A 2GVFA 3LGVA 4MG3A 3UOPA 4FOUC 1O2YA 1Y3VA 5KECA 4Q7YA 3OTJE 2F9OA 3FKSD 1S0QA 1XMNB 3E16B 3BTTE 3RXUA 4B76A 4DGJA 2WV4A 1QZ8A 3KYGA 1DX5M 1IQHA 5C0UA 2BD8A 5B6OA 2SGFE 4AG1A 1N8OB 1ZPBA 3ZZ5A 5ESTE 3QK1A 2J98A 4ABEA 1V2MT 2P93A 2HGTH 5AHGH 1Z7KA 1O2ZA 2GD4B 1Z6JH 3ODDA 3BTEE 3A88A 1W7XH 1O2XA 2BLWA 2VGCB 1CVWH 5HMAA 1G3CA 3ZZ4A 1MMJN 3O8DA 1W2KH 3T25A 2Z6BD 1KLTA 3IWMA 1TNJA 3RXVA 1TRMA 1SLWB 3GY4A 4XBBA 1ZJKA 2ZTZA 3EAJA 1COWD 4JZIA 1BTPA 4IS5A 2W7SA 1HAVB 4TYDA 3M35A 2O8TA 4ISHH 1PJPA 2ZU3A 1DY9A 1C1UH 1SOZA 3GYMA 2UWLA 1F7ZA 3STIA 3SZEA 4Y10E 5K7RA 1A7SA 1LO6A 2AEIH 2GMTC 2GDDA 5A0BA 5KGOA 3JZ1B 3GDVA 3NXPA 4LXBH 4UE7H 1BTYA 2BY5X 1A46H 4Z1MD 4NWLA 1JIRA 1THSH 1TOMH 2EA3A 1GVZA 2R9PA 3DA9B 3RXCA 4LOYH 1WAYB 5GXPA 5FXLA 1AIXH 2ZEBA 2BDCA 1ELAA 1EAUA 1LHEH 1SOTA 3I78A 1HAZB 1P10A 4D76A 3MOCA 4AFUA 3O8CA 2GMTB 1GL0E 1FY1A 1FV9A 2GV7A 4CRFA 3FOAA 3KHVA 4X6OA 4X6NA 5E0JA 1UK3A 1UHBA 3TK9A 1TNGA 3SUGA 4IW4E 5HIYA 1SBWA 2BDBA 2LNCA 3F0PA 2ZDLA 1Y5BT 5FPYA 1RTFB 1IQIA 1C5YB 2FS9A 2WYJA 3T27A 5E0HA 1EZXC 1GCDA 1VR1H 5E0GA 1TONA 3KIDU 1P03A 3UIRA 1D6WA 3PLBA 4F4OC 5EPYA 3GCTF 1XXDA 1K1JA 3ATKA 2B9LA 1BBRE 2V3HH 2R3YA 1DWCH 1T8MA 3MFJA 3IITA 1ZTKA 2ANMH 3A7XA 1UK4A 1TNIA 1P05A 1EXFA 4O9VA 2OQ5A 2BM2A 1HJ9A 1JBUH 4UFEH 2FI4E 1EJAA 4ABGA 4CRAA 1KDQB 1BB0B 2QF0A 1UTKA 1GI9B 3DSPA 1GBLA 1V3XA 1YWUA 1GG6C 1NT1A 1WTHD 1H9LB 4DG4A 5C1YA 3DD2H 3KQEA 1RGQA 2FOCA 2J95A 2F43B 3ZVDA 2HNTE 3NKKA 1GHYH 3M61U 1E34B 1DXPA 2ZDMA 1N6YA 1HIAB 3PROA 4MPUA 4BXSA 1G3BA 1SR5C 1FMGA 1NC6A 1ANBA 2IOTA 2BLOA 2G55A 2ZGCA 5C3NA 4AB8A 1VKYA 2J9NA 4X2XA 5I25A 2Z3EA 1GHZA 1TGCA 1OYQA 5JB8S 2PTCE 4CHAC 1CHOF 2ULLA 1GG6B 4A7IB 4Z0KA 1W3CA 1ESTA 2ZU1A 3BIVH 3T28A 3SU0A 3VB6A 3GY5A 3HK6B 4YLUA 1SB1H 1FN6A 3QZRA 1QQUA 1UVOA 2PLXA 4OGXA 3TJOA 1TPOA 1E79D 1TNLA 4CBNA 1S0RA 3MMGA 3PV2A 1EZUC 1B7XB 1YPHC 4FU7A 1A3EH 3PLKA 4AFQA 4NIVA 1Y8TA 1BHXF 2B0FA 2P95A 3GCHC 2BLQA 5JBBS 4CHAB 1MAYA 1MTSA 1A61H 4X1PU 1ZOMA 2OP9A 1EB2A 3RXJA 2V35A 2ZCKP 1AVGH 2OK5A 7LPRA 2QXGA 3TJNA 1THRH 5A8ZA 4WJG2 5BPEA 1L1GA 4WMDA 4PROA 1NFUA 1N1LA 4P02A 1AVWA 1GI1A 2FZZA 4CREA 1HCGA 2GGVB 1P06A 1YPEH 1SGFA 1NFWA 2BX3A 4E06H 2PWXA 1BMFD 3CP7A 3T26A 5HIZA 1AMHA 3GCHB 3DFLA 1RTKA 2M5TA 2EI6A 1KYNA 1GHBF 4XFQA 1ZTJA 1O3OA 1ZRKA 4MNVA 5A8XA 3ATLA 1QBNA 3BTDE 1P09A 4AB9A 2VH0A 4I33A 4WXIA 3ZVAA 1DS2E 1O34A 1BRAA 1LPGB 2XTTB 2QF5A 3S9CA 1GHAF 4WH6A 2ZECA 3B8JA 3M3VA 4HZHA 1CA0C 2VVVA 1V2WT 4ABAA 3AAUA 1BZXE 3NRLA 4X2VA 5DP4A 1YCPH 1Y5UT 2PR3A 3PV5A 1V2NT 2ZFPH 3FVFB 1UW7A 1K21H 2J5UA 4HTCH 1UO6A 1YPGH 1DPOA 3HKJB 6ESTA 2PSXA 1GI6A 3S9BA 5IK2D 3LGYA 1G2LA 1C4V2 2JH0D 4JZDH 2NU1E 3LKWA 1Z8JB 1TBZH 4X2YA 1ZPCA 2AERH 2P8OC 2QA9E 4XOJA 4AZ2B 1NRRH 1CA0B 1ETSH 1DT2A 2K8IA 1FI8A 1Z1IA 4FU9A 5C5OA 1NBMD 3P17H 1O3KA 2ZFQH 2KCOA 2QXHA 2WINI 4DOQA 1BJUA 1JRTA 4AFSA 5DP3A 1GCTC 1W13U 2B5TB 4HI3A 5I46H 2FS8A 2C93B 4Q7XA 1A3BH 2FTMA 1QURH 4JMYA 2KX4A 5CMXH 4I32A 3W95A 5DP9A 3UNRA 3RXDA 2BQ6B 1YKTA 2F9UA 3BF6H 1LHCH 4F48B 3N7DA 1TQ0B 2P8OB 3SO3A 2QIQA 5F8XA 1D3DB 4YESB 3U9AH 1HAIH 1KXAA 3FZZA 3GY2A 4B2AA 1WDIA 3A84A 1GCTB 2BZAA 5EXLA 5FPSA 2L74A 4E05H 1WBGB 4O3UA 4E7NA 1SFIA 3ESTA 3VFEA 1HAVA 4P00A 5AVDA 1MKXH 4ZKRU 4UFFH 1TNKA 1O38A 3H7TA 4U30A 2JETC 1ELCA 3F3BA 3FZDA 1P12E 2XCFA 1P11E 1OHHD 4MTBA 3UR6A 1DOJA 4BXWA 1S83A 1OP8A 3EDXB 5T6FA 1QA7A 3FP8E 4GHQA 3ODFA 1PQ5A 1OYTH 2C90B 4YT7H 1P0SH 1O5DH 2ZPQA 1C5OH 1O3PB 1O32A 1C1RA 4SGAE 4XRNA 1UTJA 3E90B 3SGBE 4R8TB 1Q3XA 1YCPK 4YOJA 2TGPZ 4ASHA 3BG8A 2ZFSA 1EOJA 1F2SE 1C2DA 4TWYA 5HGGA 3TLOA 1W7GH 2SFAA 2JETB 3U1IB 2BD2A 5PTPA 2VIVA 1S6HA 2F9VA 2F9PA 4NZQA 6CHAC 2WV9A 1F92A 1GMHG 1TB6H 1XUFA 1UVUH 3R3GB 2PGBB 4ISOA 5T6GA 3LJOA 5EPNA 3M3SA 4K69A 3V0XA 1LTOA 3MH7A 2CK3D 1O3FA 2KZ4A 4WF8A 1NRSH 2VVCA 4DW2U 1BT7A 3PMAB 3KNXA 1O2LA 1O2IA 3SHAH 2ZU2A 4A1XA 3AW0A 1IAUA 2C8WB 1QL9A 2WSSD 2TGDA 1MTNC 1VITF 2VIPA 1O5GH 3P70B 1TAWA 1TGSZ 2QF3A 6CHAB 1XUIA 1XXFA 3OYPA 3P6ZB 1O2GH 2R2MB 3OAAD 1WXRA 1GBHA 3F0OA 2J2UA 3OEED 4I8KA 1CQQA 1VGCC 4AORA 4KELA 2OINA 2NU0E 1TX6A 3A7ZA 3IG6B 4YM9A 2PW8H 2A32A 4JZEH 3PWBA 2BTCE 1GMDF 1SQTA 5ABWA 3JZ2B 1RD3B 3TH2H 2F9BH 2RDLA 4M7GA 3U98H 5DO4H 1ZZZA 3KYFA 1C2KA 3QUMP 1MTNB 1NROH 1MQ6A 2DUCA 4Q7ZA 5DPAA 2ZFTA 1QIXB 1BCUH 1DVAH 1ZRBA 1NRPH 2A45B 4MNYA 1FPCH 1HFDA 2UUFB 3RXSA 1Y3WA 5T6DA 5AF9H 1VGCB 4ISLA 4ACAA 2BD7A 5LPRA 2P3TB 4A92A 4JZ1A 2XOKD 3E6PH 1TMUH 2BD3A 1IQJA 4X8VH 3MH5A 3CS7A 3UUZA 2XWAA 1V2TT 1NPMA 1YLDA 2ANWA 3B23B 1P2MA 9ESTA 3TGKE 2OTVA 3ATMA 3UOUA 1K22H 1KXBA 1PPBH 1QRWA 1QCPA 3MH6A 2Y6TA 3PYHA 1O36A 3FP6E 3NCLA 5FPTA 4NFFA 2UWOA 3GY3A 1SLVB 3E0NB 2Y7XA 3SW2B 1H8HD 5DN6D 1SQRA 1EKBB 1O30A 3GCNA 1EAIA 2P3FH 1F5RA 1RXPA 5ESBA 3NWUA 5A0AE 2GT7A 2TPIZ 2V3OH 3PRBA 1AN1E 2FO9A 5CE1A 3RXLA 1HBTH 4B6EA 1O2OA 5EU8A 2ZU5A 1L1NA 2XBXA 3UREA 1O5CB 1QRZA 4OS1A 1WUNH 3Q76A 1C1WH 4DCDA 3ZYDA 1GBTA 1QR3E 4YO9A 5LGOA 1GBMA 4NWKA 3U69H 1CGJE 4GVUA 2ODPA 1ELFA 1WV7H 3G01A 3L3TA 2JDID 1OWKA 5HKKD 1GJ5H 2OC0A 3HKIB 3QGNB 2EEKA 3WY8A 2SNWA 2ZTYA 3SU2A 5C67A 5GDSH 2AGIX 4ZAEA 1PQAA 1O3CA 2AMDA 1C2FA 4ZKOU 1YM0A 1EFRD 2BDGA 2Z9LA 2P3UB 5DKMA 1SG8B 1CHOG 2A1DB 2R0KA 3A82A 3UNQA 4YZUA 3A7WA 1F0TA 3K2UA 1QJ1B 1NTPA 3I77A 1GI2A 5JBCS 1Z8IB 2RG3A 4Y7BA 1SKYE 3TH4H 1SMFE 4QT8C 1GI7B 1YPHE 2PSYA 2Z9KA 1JXPA 1E38B 2YNAA 3PV4A 1BTHH 1N6XA 1SLUB 3A8AA 3UR9A 4CH2B 1HGTH 5GPIB 2P59A 3Q3XA 4WY3A 1MKWH 1W8BH 2WHXA 1P57B 1O37A 5HYOA 1GBJA 4KKDA 1HRTH 1XKAC 1HB0B 3MU5A 4XE4A 5GJ4B 3QN7A 3A83A 2SGQE 3LC3A 2ZQ2A 1CA8B 1QJ6B 5FCKA 1FY3A 5TCAA 3TGIE 2FESH 2TRMA 2Z9GA 1YPKH 3E91A 4GUXA 2M2AA 3LIWA 3UFAA 1LPZB 2H9TH 1BJVA 1T8NA 2OQUA 2I6SA 2Z9IA 4IBLH 5EJZA 4DJZB 1O3IA 4H6SB 1C4U2 1GJ8B 1CT4E 2FODA 4X1RU 3FAOA 1O2VA 1DDJA 5EQSA 1B5GH 4Y79A 3VB7A 1O2NA 2AGGX 1O35A 3A89A 1SGFG 1ACBE 2VU8E 1TFXA 3S69A 2VWOA 5L2YH 4K60A 1GHBG 2ZWLH 1AKSB 2ZA5A 1QNJA 2QY0B 2ZHWH 2TGAA 2BMGB 2A4RA 1CSOE 2ZO3H 3MWIU 1O5BB 2GTBA 3EGKH 1LHDH 1MUEB 1KLIH 1RRKA 2ILNA 4U32A 3D62A 5T3HA 8KME2 2ALVA 3MO6A 1SGNE 1UTMA 4ABJA 2BD9A 2TBSA 1P04A 2R3UA 3C27B 5GCHG 1J17T 4Z6AH 3ZZCA 1LKBA 2HVXA 3S7KB 1QL8A 3OU0A 2QGRA 3VXEH 1BRUP 2EI8A 4K8YA 3TITA 1W0KD 4E7RG 3TK5A 2J34A 3MO9A 2ZFFH 3SN8A 2OLGA 3MNSA 1K1NA 1D3TB 1A0JA 1UJ1A 1NFXA 2K0QA 3UWJH 3M7QA 5C94A 1C2HA 4O3TA 3LOXA 1A1RA 1BMAA 2O8WA 2FX6A 4K5ZA 2ESTE 1OXGA 4F55A 1CHGA 4B74A 4R0IA 3MNBA 5DP5A 1EX3A 1HXEH 2FOGA 2W3IA 1IQFA 1MTWA 4Y0YE 3SU4A 3T2NA 2G52A 1IHSH 1OWIA 3A8CA 3SJ9A 1MKWK 1DLEA 4UEHH 2QYIA 1K1PA 4MQAA 1F0UA 3A80A 3CNRA 4ABIA 5IDKA 1TPSA 1FNIA 5A09A 1TOCB 2W7UA 1UVSH 1ARBA 4TT3D 3RMMH 1GJ7B 1JIMA 2AIQA 3ENSB 1AFQC 1UTLM 3A85A 4NSVA 4INHA 4MVNA 4B1TA 1NRQH 1ANCA 4IC5A 2VINA 1QQ4A 1C5NH 1Z6EA 1VCPA 4JYUH 3GCOA 1TMBH 3GISB 4X8TH 4ABDA 4OS6A 8GCHF 5GWZA 1JOUB 1F5LA 5DP8A 1EASA 2OXSA 4DIIH 2AH4X 4FU8A 3SV2H 1O3GA 3VGCC 5L30H 4WMEA 3UWIA 1ESAA 2VNTA 1AU8A 1NM6A 1MCTA
chains in the Genus database with same CATH topology
5FAHA 1EPTA 1IQNA 1LVYA 5FX6A 5LPFA 1G3EA 3RM0H 4INKA 1B0FA 3C1KA 2R0LA 2HNTF 4GLYA 1BITA 1MD7A 1P02A 3E1XB 2ZCHP 4X1QU 5EQQA 4KTUA 1E0FD 3ZZ9A 1KTTB 2CMYA 1GWAA 3VGCB 5FHTA 1TPAE 1WCZA 4FUIA 4AFZA 1AB9C 4I7YH 1SFQB 2Y5HA 3MU4A 2UWPA 1GJ6A 2KAIA 3ELAH 3HATH 1S84A 2Y81A 3L33A 4X2WA 3KEEA 2O9QA 5EODA 1G2MA 4AOQA 1U6QA 3PMJA 2Z3CA 1DUAA 1INCA 1KIGH 1P2OA 1PQ7A 1S81A 1XVMA 3SJIA 1K1MA 2A5IA 1YP9A 1LVMA 1LHGH 4B71A 5J4SA 1A5GH 4CRGA 1GMCF 3UTUH 4UDWH 3U1JB 2HWLB 1O2JA 1AB9B 1C1NA 1YLCA 1T4VH 1TX7A 3STJA 2CF8H 6GCHG 1CBWC 1P3EA 1ID5H 1YF4A 3F1SB 3SV8A 1T32A 2WPMS 1ZYOA 4MPWA 4I8LA 1KLJH 1LMWB 5JB9S 2XBWA 5TCCA 1SQAA 1HDTH 4X1SU 1DUEA 1K9OE 1KXFA 3SQEE 1GDNA 3ZVFA 1XKBC 1ZMLA 3SJKA 1ETTH 1C1TA 1QBOA 1SGTA 3RXPA 1TX8A 2OC1A 1X7AC 3TNSA 2OC8A 4U01A 1OSSA 1CBWB 1UCYH 1HAPH 1O3BA 1CGIE 4ZROA 4WXVA 4ZXXH 3A8BA 3ZZ3A 3RXIA 1IQEA 1FDPA 1T8LA 1FZZA 2CF9H 1SGYE 1O3DA 2QC2A 4INLA 4JYTA 2AIPA 1H4WA 1NZQH 3K6ZA 4VGCC 1M9UA 2GZ9A 5A0CA 4FUBA 1OWEA 1SC8U 3KF2A 1L0ZA 4K8BA 4D9RA 4BTIB 2GKVE 2SGDE 3LH3A 1GBEA 1TBRH 1G32B 4THNH 7ESTE 1CT2E 2PKAB 1TLDA 2VIWA 5DP7A 1HJAC 4IN1A 4NA9H 1LKAA 2K1QA 1OP0A 1LPKB 4VGCB 1O2HA 5F8ZA 3HPTB 2OBOA 1HLTH 3PMHB 1IQMA 1LQEA 5EQRA 4B2BA 2QXIA 1SHHB 2Q6FA 3VB4A 1P9SA 2YOLA 3BIUH 2NWNA 3PM3A 1W14U 4CRCA 3M5MA 2XBYA 5FBIA 1HJAB 1DFPA 3TNTA 3MI4A 2CHAC 1FLEE 3GDSA 5C5NA 2PTNA 1KY9A 1PYTD 4TWWA 1SI5H 1MBMA 2XNIA 3P8FA 4H4FA 3ZV8A 6LPRA 1H8IH 2WUCA 3RU4D 5JDUB 4A5TS 1HNEE 1GBDA 2WPKS 2D26C 3BTQE 3ITIA 2FX4A 1C4Y2 1UCYK 2FLBH 4I8HA 3P95A 5AFYH 2CHAB 4AYVB 3E8LA 3SGAE 3F68H 4TPYA 8LPRA 4FUEA 2PV9B 1TRYA 1BQYA 2ZNKH 3KGPA 2BVRH 4MLFB 2FEQH 5DG6A 1BMMH 1C2JA 1TWXB 2FP7B 3GICB 4FUDA 3KN2A 4Y71A 3GYLB 3RUOA 1GI0A 2QXJA 1O3NA 2BY9X 1QB1A 3SUEA 4JK5A 4MPXA 3TPIZ 1MU6B 2FIRH 4Y76A 3T62A 1XUGA 2Y7ZA 1AZ8A 1YPJH 1GHVH 2P94A 1IHTH 4F49A 4BTTB 1UTOA 1ELTA 1QHRB 4Y8XA 1T8OA 2XXLA 1HXFH 1W0ZU 1QGFA 2ALPA 3SGQE 1ZPZA 1GJBB 2XBVA 3F6UH 3MYWA 3OY6U 2BLVA 4GCHG 4YOIA 4NZLA 1BMNH 1GL1A 1A5HA 1FY4A 1O2TA 5BRRE 2BDIA 1MU8B 4B73A 1DSUA 1FQ3A 3OY5U 2RA0A 1P2KA 5C2ZA 3ZVGA 1TA2A 3Q77A 2Y80A 1SHYA 4ISIH 1C5TA 4CRBA 1GGDC 3TVJB 9LPRA 4AN7A 1WYKA 1HYLA 1ZGVA 1O3EA 1EAXA 4TY7A 3ZVEA 1EP5A 5A8YA 1KXCA 1Z71A 1J8AA 5A2MH 1WOFA 3K9XB 1SQOA 1AFEH 1S82A 2SGPE 3P8GA 3NZIA 1XUHA 4FUCA 1AE8H 1Y5AT 2FM2A 2WPJS 4X0WU 2A4GA 2WUBA 3ATIA 2HPPH 3TJVA 2FOAA 3SHCH 1L4ZA 1GGDB 1NN6A 3SU6A 4CBOA 2IN2A 1TGBA 2YNBA 4NIWA 4X6MA 1TMTH 4GAWA 1O2QA 4JYVH 4YOGA 2BD4A 4IMQA 3VB3A 2FOEA 7GCHF 2H1UA 1K2I1 2LPRA 1L1JA 1DICA 2Z94A 1YCPM 3L6PA 2H5DA 3VPKA 1O2MA 3BTKE 1MBQA 1SSXA 1OWJA 1PPEE 3H7OA 2BDHA 2ZP0H 3SV6A 3RXFA 1DLKB 1EZQA 1NESE 3K6YA 3QTVH 5C1UA 4OS7A 2J38A 1KDQA 4DY7B 4Y8ZA 2VWNA 3GOVB 1SGPE 3UNSA 1GJ4H 1F0RA 2G4UA 2ZGBH 2C8XB 2A31A 5ETXA 4ZKSU 1A2CH 5E2OA 3HGNA 5E8EH 3PO1C 2AS9A 1WTGH 1B0EA 4NA8A 1O2KA 4D8NA 1P2NA 1HIAA 3TU7H 1ZJDA 1BTUA 2ZHQH 4NSYA 2O8UA 3SZNA 1P9UA 3VXFH 5F6MA 2AFQB 1PPHE 2NU4E 1MZDA 2ZZUH 2FLRH 1RTLA 4ESTE 1P2IA 4WH8A 4AGJA 1F0SA 3M5NA 1SGDE 2G81E 4CR5A 1CE5A 2BD5A 3A7YA 4X8UH 4CRDA 1ZGIA 2GCHF 1MAXA 3F9GA 3PO1B 1GI8B 2ZF0H 5HM9A 3NK8A 3A7VA 4GHTA 3BG4C 1NU7B 3QO6A 2CN0H 3MTYA 3RMLH 3RXTA 2HPQH 4BANB 1G9IE 3RM2H 1KXDA 1IQLA 3GCTG 1HPGA 2BZ6H 2UUYA 2FOBA 1DANH 2O8LA 4FVDA 1CT0E 3B9FH 2BX4A 4YT6H 1YGCH 1KXEA 3KL6A 3W94A 2ZGJA 3TK6A 4ABBA 4DVAU 1O0DH 1GDQA 1LVOA 2BVSH 3HK3B 4TY6A 2GX4A 3MNXA 3RXBA 1BRBE 4WMFA 1EP6A 2Y5FA 2A4OA 2XWBI 1BA8B 3BG4B 1C5RA 1O2SA 2Q1JA 4IGDA 1C2LA 1WSSH 1HAGE 2BXUH 1WQSA 3Q3YA 1BTWA 2HALA 2XYAA 1BHXB 2TGTA 3EE0B 1GMCG 3RP2A 1Q31A 4I8JA 3MU8A 2ZFRH 1D9IA 1V2LT 2Q6GA 3RMOH 3EA7A 2VVUA 2FWWA 3DT0H 3SI3H 5FCRA 3S9AA 1GI4A 3PB1E 2J94A 3BTHE 3LH1A 4K1TA 1FIZA 2ZCLP 1GI3A 2GT8A 2Y82A 4O97A 1ZMNA 1EB1H 2BB4A 4MNWA 4AX9H 3S7HB 2JH5D 4LZ1H 4Y7AA 3RXKA 1NY22 4ZUHA 3BEUA 3SQHE 1QTFA 1YC0A 1C5LH 2VWLA 4I31A 5H4IB 4FUJA 1P8VC 1FN8A 3ZVCA 2OUAA 1P2QA 3AW1A 1V2PT 1E35B 1AQ7A 3M3TA 1MTUA 1L4DA 3LC5A 1AGJA 3RXQA 1J16A 1A4WH 4JK6A 1ANEA 2GZ8A 2Q6DA 4H6TA 1UTNA 1V2ST 4NG9H 2GZ7A 4BOHA 1C5UA 5LH8A 1O3AA 2PGQB 2W3KA 3LONA 1XVOA 4ZHAA 1BTXA 3RMNH 1GPZA 2WV5A 1MH0A 4OS2A 1J9CH 2GDEH 1N8OC 3VB5A 4Y11E 3BN9A 3M36A 3AASA 4CH8B 2V0BA 2A2QH 1E36B 3RXEA 1CO7E 2I6QA 2VJ1A 2ZI2H 1T4UH 4LZ4B 1BBRK 2HRVA 1GHAG 3A87A 3GY7A 3LGUA 1OWDA 2VGCC 1C1OA 4MDSA 1H8DH 3GDUA 3SNCA 1THPB 4B2CA 2SGAA 2ZDKA 1AD8H 2W26A 3SU3A 4ZHMU 1MCVA 2G00A 3ZV9A 2PUXB 4IMZA 2IPHA 2PUQH 1SGQE 1GMHF 3BTME 1DE7H 2D2DA 4BTUB 1HUTH 1G30B 3TIUA 1XUJA 3RXMA 5L6NH 3O8BA 2STAE 1FY8E 1W10U 1ETRH 1V2QT 2PHBA 4JCNA 3U8RH 2BDYA 3UPEA 1BTZA 4U2WA 3PLPA 2XC4A 2XCNA 3QZQA 4ZMAH 1C2EA 2VIOA 3V12A 1D6RA 2FMJA 3NUMA 2BQ7B 1C5QA 1TBQH 1H1BA 5JBAS 3BEIB 3BTWE 2H9EH 3K65B 1EJNA 4YTAA 1W11U 1O5EH 4ZKNU 1FAKH 5DK1A 5TJXA 2J4IA 1NRNH 5HM2A 4Y6DA 4XBDA 2W5EA 2QV1A 3TGJE 2BQWB 3SV9A 4FXGH 1VCWA 4UONA 5LPEA 4WVPE 4J2YB 1FXYA 2A2XH 1C5SA 5DGJA 2QN5T 1O2PA 4Q2KA 2VWMA 3ZZ6A 1C5ZB 1GHWH 3MU1A 1AFQB 3SNAA 1VJ9U 3M7TA 3Q00A 1MTVA 2OCVB 4XSKU 3OX7U 1PPGE 2FPZA 3CS0A 1ZHRA 2VB0A 1ZMJA 1PQ8A 3QGJA 3FP7E 1NS3A 3RU4T 4AG2A 4KP0A 1K1LA 3D65E 3UY9A 1UK2A 1YPLH 2XW9A 1QFKH 4ZHLU 3CENA 1UVTH 3P8NA 1O39A 4X6PA 1V2UT 1TRNA 7KMEH 4CR9A 1GHXH 1AUJA 2GP9B 2GCTC 1PPCE 3N7OA 3A81A 3SOSA 1A0HB 1ABJH 2BYAX 3V3MA 1RFNA 3E0PB 1ARCA 1SL3A 4DT7B 4KTCA 3MHWU 3MO3A 4Q80A 1Q2WA 5L2ZH 3SUDA 1GVLA 2FXRA 4NCYA 4X8SH 3I29A 4OGYA 4BAKB 3GY8A 1C1PA 4B75A 1VITG 3PTBA 3PMBB 4A6LA 1C2MA 1JRSA 4K2YA 1FPHH 1TGTA 2ASUB 5HXFA 2GCTB 1F5KU 4ABHA 1DSTA 1DY8A 4UFDH 1ANDA 7GCHG 1AI8H 3QTOH 2BY7X 1DWEH 1GBAA 3RU4E 2FYQA 1HV7A 1PFXC 1GMDG 1L2EA 1OPHB 3KCGH 4NIYA 3D23A 3MU0A 5JYIA 1Z8RA 4KGAA 3ZVBA 2A7JA 1D3QB 1ELEE 2ZG0H 1PPZA 4XBCA 1GJ9B 2H6MA 1GVKB 3SV7A 5FX5A 5FBEA 1C9PA 1XX9A 4MPVA 3RLWH 1NU9A 5F8TA 1TYNA 1GI5A 1VITH 1BIOA 1Y3YA 1GJDB 1Z1JA 1DXWA 2QAAA 2ZC9H 4ZXYH 2F9NA 1TA6A 1ELVA 2B7DH 5EGMA 3BEFB 3T29A 2A5AA 2VIQA 3M7UA 2GCHG 3M5LA 3OSYA 1EUFA 2FDAA 1FONA 1Y3UA 2STBE 3BTFE 1HAHH 4X1NU 4BAHB 1OOKB 3PTNA 5AFZH 2NU2E 1FIWA 1O2RA 4SGBE 3SJ8A 3A86A 1XUKA 2OBQA 5EOKA 3U8OH 1GBFA 3EA8A 3QDZB 1Z8GA 3LGWA 1ELDE 2GV6A 2ZKSA 3H5CB 2V6NA 1C5PA 1T7CA 1C9TA 1DWDH 1LQDB 1UMAH 3SU5A 1GBKA 2EI7A 1ELGA 3LJJA 3SU1A 1EOLA 1V2VT 1UTPA 3DFJA 4A1VA 2HOBA 1DWBH 4FVBA 4IC6A 3BV9B 4UD9H 4RSPA 4FUHA 2XRCA 2ZU4A 5G4BA 5EW2H 4NA7A 1BUIA 2AMQA 1V2OT 1RS0A 1ABIH 4OS5A 1OP2A 5GCHF 1C2GA 2BOKA 2DE9A 1BMLA 4WWYA 1K28D 1MZAA 1AKSA 3O8RA 2TIOA 3DUXH 4OS4A 1O2UA 3KQDA 2FOHA 2FTLE 4ZH8A 4RKOB 2C8ZB 4BAOB 2HLCA 1SGIB 1C1SA 3M5OA 2A0QB 3F9FA 3SBKA 1FUJA 1QA0A 2ZIQH 2ZHDA 1AHTH 2ZDAH 2ZQ1A 1RIWC 1WQVH 2WPLS 3P92A 2NU3E 1C1VH 3LGIA 1W0YH 3ZZBA 2G4TA 1LCYA 1AE5A 2FYRA 1AWFH 3TH3H 2FI5E 2ZPRA 2IJOB 1O2WA 1OKXA 1Y59T 1TNHA 1V2JT 4IN2A 4HGCA 3TJUA 2A7HA 4HFPB 2H2ZA 1S5SA 2R2WU 3UQOA 4GPGA 3RXHA 2O8MA 1FAXA 3QWCH 2CV3A 1RIWB 2J92A 2H5CA 3HGPA 1QB9A 1V2KT 1TIOA 1ZSLA 2ZPSA 3LDXH 1VJAU 2JH6D 5DP6A 4D9QA 4ABFA 1K1IA 1IQGA 3Q3KA 3A7TA 1GBBA 3MH4A 3RDZA 3AAVA 1QJ7B 2SNVA 2PFEA 2WPIS 2BHGA 2JKHA 1LVBA 1J15A 1QY6A 3URCA 2FI3E 1HAXB 4AGKA 4NIXA 1AVXA 1ZSKA 5EG4A 1W12U 3SUFA 1EJMA 1MD8A 4A1TA 2ZHFH 2UUJB 1KSNA 2ZGHA 2FOFA 3RC4A 3S0NA 5E2PA 4Y8YA 1EAWA 2BY6X 2D8WA 3AVZA 3SNBA 3V7TA 1Y3XA 2A5KA 2AGEX 4J1YA 1DITH 3DHKH 5EW1H 3V13A 1EPTC 2Z3DA 4RKJB 4YLQH 2CXVA 5EXMA 1O5AB 3SORA 1A5IA 1PYTC 2HNTC 1VZQH 3SI4H 1GJAB 3EA9A 1ZHMA 4K3JA 1CGHA 1V6DA 3GY6A 4O03A 1AUTC 6GCHF 1UHBB 4MNXA 4Y0ZE 3QLPH 4LK4A 3RXRA 1O31A 3SJOA 1P3CA 1EQ9A 2CJIA 1BRCE 1O3HA 8ESTE 3ZYEA 1IOEA 2A4QA 1UCYE 3A8DA 2THFB 2D1JA 1EPTB 4DIHH 1AO5A 1D3PB 4K1EA 2C3SA 1LHFH 2AMPA 4ISNA 5DJ7A 1ZLRA 2Z7FE 1OX1A 8GCHG 4K1SA 2B8OH 1HAYB 1ESBA 1QB6A 4H42U 1JMOH 1WU1A 3EQ0H 1MKXK 2CGAA 3LGTA 1GBIA 1QRXA 2EC9H 2G5VA 2BVXH 1FY5A 1BOQA 1J14A 1C5XB 2BOHB 2OD3B 2VH6A 4NFEA 2BDAA 1G37A 2KAIB 2F3CE 1CU1A 1TPPA 1TABE 3FFGA 2ZDNA 1TGNA 2ODYB 2QCYA 1H9HE 4TPIZ 3MNCA 3UQVA 1O3LA 2G8TA 2C8YB 1JWTA 2PKSC 4XDEA 2SGEE