1K1NA

Bovine trypsin-inhibitor complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords TRYPSIN
publication title Factorising ligand affinity: a combined thermodynamic and crystallographic study of trypsin and thrombin inhibition.
pubmed doi rcsb
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2001-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1k1nA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1k1nA02
1K1IA 1HBTH 4A6LA 3AASA 3LGUA 2KAIB 3SORA 2AEIH 1TGNA 4ABGA 1NC6A 1FPCH 3VB7A 3ESTA 5GXPA 5FX6A 2B9LA 2BLWA 1AWFH 4ABIA 1TQ0B 2VGCB 2STBE 2BQ6B 2EI7A 2WPMS 2IPHA 1SBWA 4GHQA 1UTJA 4NWKA 1UVTH 1HIAA 2JH0D 2BOHB 1GHAF 1QA7A 1AUTC 3DUXH 1F5LA 4FU8A 1TNHA 5TCAA 2AYWA 2CHAC 4A92A 3Q3KA 2VWLA 1HJ9A 2ZFRH 1TOCB 3G01A 1A7SA 1T8NA 1CT0E 1HAYB 2CN0H 2J4IA 2WYGA 3A8CA 3E16B 4DY7B 1HAPH 4CREA 1OWKA 1LHCH 1GBMA 3B8JA 4GLYA 2TBSA 5EG4A 3GY5A 1EXFA 1C2FA 3A84A 3A8AA 3PV4A 3U98H 1NFXA 4H6TA 1C1NA 3UPEA 1EAUA 1J14A 5T6FA 1SGDE 4R8TB 3RXJA 1BT7A 4NCYA 2FMJA 2ODYB 3RU4D 1ZZZA 3AAVA 4FUFA 1TLDA 3VB3A 2BD5A 5A0BA 1QJ7B 3GICB 1ARBA 4GCHF 1P3CA 1P05A 1INCA 4ISNA 1KSNA 5TCCA 3ZV8A 2FP7B 5C3NA 1W12U 3VXFH 1TBRH 4VGCC 1C5OH 3LIWA 3ZZDA 4OGXA 2WPLS 1LPKB 1BTPA 1SMFE 2VWNA 4I8LA 2V3HH 3S7KB 3EYDA 3O8CA 3WY8A 1Z1JA 4OS5A 3ZZ5A 4BXSA 1E0FD 1ZSJA 2PTCE 3PMJA 1B7XB 5GCHG 1FDPA 2GP9B 1MQ6A 1SLXB 1NESE 1YPJH 4TWWA 1BHXB 4Y76A 2F9UA 1QQ4A 4AZ2B 1KXDA 3PROA 1BBRE 1CBWC 1QCPA 3RXSA 1Y8TA 3PLKA 3ZVBA 1GI2A 1LVYA 1E36B 4FU9A 1IQLA 2ODQA 1MTUA 2FTMA 5I25A 1GBJA 1H8DH 2ZU3A 1ACBE 3PMBB 2I6SA 3M3VA 4I7YH 2UWPA 1UVOA 2ZDVH 1QL9A 1QB9A 1D9IA 1O30A 3MU5A 1O5AB 4MPWA 3F9EA 4NSVA 1DITH 3URCA 1ELEE 3GY4A 2CV3A 4X6MA 3SHCH 1O2KA 1RRKA 4UEHH 4B2CA 1W7XH 1C1OA 2FIRH 1HAHH 2WPIS 4H42U 4A7IB 1NFWA 1PQ5A 5C1XA 3OU0A 3UR9A 1FXYA 2CMYA 5K7RA 2RDLA 1GI7B 1G3BA 3RXAA 4BOHA 1ZLRA 1GBHA 2G5NA 1OWHA 1SLUB 1YBWA 2XC0A 1K21H 2QN5T 2XBWA 1ELBA 1N1LA 2XCFA 2P16A 3BTHE 1TMTH 3SUDA 5DP6A 1HUTH 1BHXF 1D4PB 4FUDA 1MBMA 2BQ7B 4KELA 1ZHPA 3M37A 2QV1A 3S7HB 2G5VA 3RXBA 1HIAB 2WPJS 1GBCA 1PPFE 4KTUA 3SQHE 1QL8A 1KXFA 1GI9B 5CHAB 1TX6A 1Z8RA 2P94A 4YTAA 2F3CE 1C2GA 1FN8A 1G37A 4XOJA 5J4QA 3VB4A 3VGCB 3RXEA 4FUCA 4HFPB 5GIBA 1AN1E 1WUNH 2ANMH 1O3EA 2P3TB 4X2VA 5CE1A 1P2NA 1NU9A 2HRVA 3ZZ7A 1AZZA 1HJAB 2BY7X 5AHGH 4WY3A 1GJ5H 2FTLE 3SNEA 1VGCC 1UK4A 3LOXA 2F9NA 1O3PB 2R0LA 1QA0A 1FY8E 3U1IB 1GBFA 2BDGA 2OTVA 3GYMA 4KP0A 5ABWA 1H9HE 4X8UH 3QZQA 1BRUP 1L2EA 2ZGCA 1AE5A 1ARCA 1HAGE 2HVXA 4MPXA 4LK4A 2ZFSA 1E37B 3T5FH 1NN6A 1C5QA 1DVAH 2A4GA 2NU4E 3AAUA 4CRGA 3SNDA 1N6YA 1AFQB 1C4Y2 1ZR0A 3A8BA 2PR3A 1OWIA 1A5HA 2P59A 4GVUA 1Y5UT 2QXHA 1O2YA 3MU0A 2QXGA 4YLUA 1CQQA 2SGQE 1SGTA 4NSYA 4DURA 3A80A 1BRAA 1VCQA 1O2ZA 1LHDH 3F1SB 2VIWA 2FOEA 1G3EA 4FUJA 3A7XA 5GCHF 1PPBH 2A2XH 1KLTA 1V2QT 3SU4A 1MMJN 3F9FA 4ZMAH 4D7GA 1TMBH 4FVDA 1C1RA 5JBAS 7ESTE 3PMAB 1C2IA 2XW9A 1ZSLA 5BPEA 4MNXA 2PUXB 2Q6GA 4I31A 3TLOA 2NU2E 4ZXXH 3S9BA 1OYQA 2V35A 3ZZBA 1O3JA 1ELCA 1YPHC 4R0IA 4DVAU 4X2XA 3ZZ4A 2QF3A 4Y71A 4I8KA 1AB9C 4JK6A 4Q80A 2O8MA 4WMDA 1YCPM 3GCHB 1FPHH 3HK3B 1EP6A 1P57B 1TA6A 2XXLA 3NZIA 3A8DA 1NM6A 2BY6X 2WPHS 2ALPA 3JZ1B 1J17T 1FQ3A 1K1LA 5LPEA 1NRNH 1AMHA 2ZECA 1GDUA 2VVVA 1GMDF 2FPZA 3S9CA 2R0KA 1FN6A 3RU4T 3T27A 3A7VA 3EAJA 1C5RA 3ZYDA 2J38A 3DHKH 1GBBA 3MYWA 1PPEE 2C8WB 4INLA 2O8TA 1UTQA 1QQUA 3ZZCA 6CHAC 1GHXH 2BD4A 5JB8S 3TIUA 4D8NA 3FFGA 1ZOMA 4FVBA 1EKBB 2ZDNA 1FLEE 1WU1A 3P8NA 2PWXA 1WTGH 4MPUA 5IDKA 2WUCA 5A8XA 2PW8H 1O2TA 4I33A 3SV8A 5GJ4B 4NIVA 4MG3A 1ETSH 1GHZA 1Z6JH 1SGYE 3ATKA 1P3EA 1AVGH 4UFEH 1O34A 1HJ8A 1NRRH 4AFQA 2Y5HA 2GCHG 1O2VA 1GI4A 1ZGIA 3PMHB 4XBCA 3KHVA 3TVJB 4CHAB 1YKTA 1QL7A 9ESTA 5EQSA 1AE8H 5HYOA 1V2ST 2F9VA 4O3TA 4TY7A 1TA2A 2V3OH 1HLTH 2BB4A 2ZCLP 1JRSA 1RJXB 3ZZ8A 1PYTC 1O33A 1PJPA 3KGPA 3QGJA 4YESB 4A1TA 2ZHFH 1D6WA 3D23A 3PLPA 3PYHA 4DG4A 1GGDC 1UHBA 3RMMH 2B8OH 4O97A 1C1QA 2ZU4A 1F0RA 1K1NA 1S6FA 2ZP0H 3T29A 3TGJE 1GI3A 3UWIA 4KTCA 1DICA 1O3MA 2FEQH 2P3FH 1GG6B 2QCYA 3MMGA 2GD4B 3VB5A 3SQEE 2B5TB 3QK1A 2PSXA 1FI8A 5FPYA 3DFJA 1B5GH 1C2HA 1CSOE 2XRCA 3P92A 1O2WA 1O2JA 2BYAX 4JCNA 1GJBB 3SV9A 1CT4E 1IQJA 4B2AA 5AFYH 1KDQA 1P12E 1O2NA 1QHRB 5EXLA 2EEKA 3BG4C 4Y7AA 3QZRA 2FOHA 5JB9S 1LTOA 5ETXA 3I29A 3ODDA 1YCPH 3NK8A 5IYTA 1AQ7A 5EU8A 3S69A 4X6PA 3ZYEA 1RIWB 2AMQA 2ZDAH 1C2DA 1CHOG 1DX5M 3TITA 1MTNC 2V6NA 5EW2H 1TPAE 2OC0A 2GZ9A 4BTTB 2W7SA 3O8RA 1AVXA 1N8OC 3Q77A 2BHGA 5E0JA 4AX9H 1GMHF 2DE8A 4MNWA 1UTKA 3VPKA 1S84A 5DG6A 4BNRA 2ESTE 2PKSB 4NZQA 7GCHG 1HXFH 1LPZB 2BX4A 3MTYA 1KXCA 4OS2A 1O2GH 3RXGA 2WUBA 1P0SH 2PSYA 5L2YH 4NA8A 2ZZUH 1ELTA 3L33A 2QIQA 2FX4A 2BXTH 1IQMA 6ESTA 2HGTH 4BXWA 1VJAU 3R0FA 1GHYH 1GJ9B 1E34B 1O3BA 2VWOA 1UTOA 3ZZ9A 5BRRE 2ALVA 1DWEH 3DD2H 1AZ8A 2W3KA 3SNAA 1SGIB 2HNTF 2VGCC 5GWZA 2ZWLH 1BJUA 3TPIZ 2AMDA 1EJNA 1ZGVA 4Y0YE 1V2NT 3NKKA 3UOUA 4AB9A 3LJOA 1FIZA 2CJIA 1DUAA 2A5KA 3RC5A 1SVPA 4AFZA 1F92A 4B1TA 1SGCA 2FYRA 1EP5A 2F91A 1DSTA 3M5MA 3UNSA 3MH6A 1S85A 3BTKE 1V2MT 4MVNA 1TQ7B 2FOBA 4K1SA 3K65B 2H5DA 4K5ZA 1C1MA 4B75A 2R2MB 2W3IA 2Y5GA 4K1EA 1JIRA 1OX1A 4CRAA 1RTKA 1S5SA 1ELVA 1BTZA 1TBZH 3MNSA 2GCHF 4INKA 3A86A 4JZEH 1IQEA 4H6SB 3RXDA 1O2PA 1T8LA 2VIVA 3OY5U 1C2EA 3MH7A 3IWMA 4NIYA 4A5TS 3OX7U 1C5ZB 1UK2A 1VITG 3AVZA 2HLCA 5FXLA 1GHBG 4ZROA 1L1GA 1MU8B 2BVXH 1AWHB 1OP2A 1V2UT 3RM0H 5EGMA 5F6MA 3LONA 3RXUA 4HI3A 1KY9A 1ANDA 2FXRA 4KKDA 1OYTH 2DUCA 1ZRKA 2SGDE 3BTTE 4K8YA 2GZ7A 4GHTA 1KDQB 1TPPA 1MKXH 1LKBA 3DA9B 8GCHG 5C20A 1S83A 2AIQA 4AORA 1Y3VA 3TGIE 2BDYA 2FYQA 3GCNA 4K1TA 1ELGA 2GGVB 5H4IB 2JETB 1TWXB 1P9SA 1NFYA 3ZVAA 1O38A 3M7UA 2ZTYA 1UVPA 2GDEH 2JKHA 3T62A 1TMUH 2V0BA 2Y81A 7LPRA 1CA0B 1O5CB 1TX7A 4AFSA 1ETTH 1TGTA 1K2I1 3PM3A 3P95A 1CHOF 4AYYB 1B0EA 4ZXYH 1TNGA 2ZG0H 1S82A 1GI8B 1NTPA 1XUFA 1ELFA 1P03A 3Q3XA 1EZSC 1W0YH 3FVFB 1W7GH 3F9HA 1FY4A 2Z9LA 1NRPH 1MCVA 1C5XB 3GY7A 2BY8X 7GCHF 4GSOA 1E38B 1OPHB 4JYTA 1SB1H 1O2XA 4NG9H 1M9UA 1PPZA 2DE9A 5L6NH 3RXTA 1VITH 2AIPA 3SU1A 2OBQA 1HYLA 3BSQA 1PFXC 3QWCH 1QJ6B 1CE5A 2BD8A 4FUHA 2ZNKH 1P2QA 2VIQA 1O5BB 1GBTA 4NIWA 4NA7A 3SNCA 1YCPK 3NPSA 1NRQH 3GCTG 3A7YA 2GV7A 5CHAC 4RKJB 1UVUH 2NU3E 2XNIA 1MTWA 4WMFA 1SQTA 1Z7KA 1Z8IB 1LHGH 2TGTA 4O3UA 1EB1H 4K60A 4KTSA 5LH8A 5HXFA 3VGCC 1AUJA 4CRBA 2UUJB 4OS6A 4WH6A 3E0PB 3MO6A 1D3PB 2ZHWH 1S0RA 5HM2A 1P2MA 1O5EH 3M5LA 5EXMA 5JYIA 1FY1A 3BTME 5DGJA 1CGHA 1GBIA 1GPZA 1BMLA 1HJAC 1JXPA 3V12A 3P8OA 5E2PA 1CGIE 4CH2B 4CBNA 3BEFB 2A4RA 4MNVA 1Z8GA 2Z9JA 3MNBA 1O32A 1MAXA 1O2MA 1QB1A 2PUQH 2ILNA 2NU1E 3SU0A 2OINA 1L1NA 1YGCH 2BVSH 2R9PA 2FOAA 2G4TA 1VITF 2W5EA 1GHBF 1GDQA 3H5CB 1MH0A 4WF8A 4NZLA 2R3UA 3KQBA 1O37A 5A8ZA 1O3NA 3TNSA 5FPSA 1AFQC 1H4WA 1LHFH 3PWCA 2IN2A 3K6YA 3MO9A 1VJ9U 2ZC9H 1YM0A 2F83A 1DT2A 1YP9A 2ZF0H 2NU0E 2OP9A 1TX8A 1GJAB 1O3AA 2BD3A 1CU1A 3MHWU 1EJMA 1MU6B 1EAWA 1QGFA 2VWMA 2UUYA 3TGKE 1P2OA 3M5NA 8GCHF 1F2SE 2Y7ZA 1BTUA 1A5GH 3C27B 1J8AA 2THFB 1L1JA 1NZQH 3IG6B 4FUEA 2IJOB 4YOGA 1GJCB 1ETRH 1OP0A 4NGAH 2PHBA 2TGPZ 1IQKA 1HAVB 2D26C 3K6ZA 1ID5H 3E6PH 3RXIA 3E8LA 4XBDA 3M61U 1DSUA 2B7DH 4Y6DA 1ZYOA 2PTNA 1O39A 2FESH 5JBCS 3TH2H 3GCHC 2JH5D 2UWLA 3SJOA 3BIUH 5LGOA 1G9IE 2Z9IA 5DP4A 2ZGBH 3QTVH 4X8SH 2F9BH 4UONA 1HB0B 2O8UA 2J2UA 1LCYA 2ZI2H 1UCYH 1MKXK 1V2LT 1OKXA 1ELDE 1HV7A 5E2OA 2ZPRA 1GJ8B 2A7CA 3P8GA 1YPHE 2ZPSA 4AG1A 1GWAA 1O5GH 3E91A 1RS0A 3MO3A 3QGNB 1QNJA 4CR5A 4AGKA 3HKIB 1P10A 4ZHAA 2AERH 1C5TA 4WMEA 3BTDE 4U30A 4BANB 2ASUB 3GCTF 1XMNB 2GVFA 3RXHA 3ENSB 2O8WA 1GJ7B 2HNTE 2PGBB 5DP3A 5E8EH 1ZRBA 1LDTT 1ZSKA 1JBUH 3P8FA 1OS8A 3NCLA 1HPGA 1MQ5A 1TNIA 2BXUH 4ZKOU 1TPSA 2R3YA 1HNEE 4AG2A 1G30B 2ANWA 4ISOA 1SFQB 3SI3H 5FAHA 1W13U 4CHAC 3UY9A 2LNCA 1LMWB 1FONA 1SG8B 2C93B 3EQ0H 3RXOA 3RXVA 1EAXA 3TK6A 4JZIA 1C5PA 1TE0A 4D76A 2VU8E 1W0ZU 2C4FH 3A88A 5A09A 3ZV9A 3A7ZA 3AW1A 2G52A 3PTNA 1KYNA 2Z7FE 3RXQA 2WV4A 3U8RH 2W26A 1A0JA 4Z0KA 1A5IA 3RLWH 4OS4A 3NUMA 1BITA 3LH1A 3BTWE 4J2YB 4NWLA 1IHTH 1TYNA 2SGPE 3RXRA 1AIXH 1JIMA 1GG6C 1Y3XA 1C2LA 2TPIZ 1MBQA 4JZFH 1KTSB 4GUXA 1MTVA 4OGYA 3DT0H 1BJVA 1EASA 2A4OA 2CF8H 5T6DA 4BAQB 1TRNA 1AD8H 4Q2KA 3MWIU 3PB1E 2QA9E 2ZU2A 1TNJA 1T4VH 2EA3A 1KLJH 1QRXA 1C2JA 1KXEA 2YNBA 1CVWH 3GDUA 4FUGA 1DLEA 1Z8JB 4RSPA 1VCWA 1W3CA 3NWUA 2HNTC 1J9CH 2A4QA 1NFUA 1LO6A 5HGGA 1RIWC 3FP8E 1QBNA 1HGTH 3IITA 4CR9A 4ABBA 1HRTH 1LVBA 2ZPQA 3RXLA 1TAWA 4AB8A 4WXVA 4ABAA 4J1YA 3V3MA 3LDXH 2BLVA 1DE7H 3SGQE 1BBRH 3A82A 1SR5C 3RC6A 1C4U2 1WSSH 1DWBH 1ANEA 2XWBI 2HOBA 1IHSH 2Q6FA 4D9RA 1WCZA 1RXPA 2P93A 4AN7A 1ZJDA 1T32A 2PKSC 2C8YB 4BAKB 3OSYA 1C9PA 3ITIA 3TJNA 1O2LA 3M7TA 3GOVB 3SU2A 4JYVH 2BZ6H 1SGPE 2QY0B 1A46H 1SGQE 4TY6A 3LJJA 2ZA5A 2ZU1A 4B76A 5EW1H 2G4UA 8ESTE 4YZUA 1YF4A 2FWWA 2P95A 4YM9A 1ESTA 4I32A 1WYKA 3ZVGA 2OQ5A 4M7GA 1MKWH 5DP5A 3U8TH 2P8OB 5A0AE 3ATIA 1J16A 4X1RU 1N6XA 4E06H 3GDVA 1P2KA 2ZFPH 3Q00A 1EZUC 5EQQA 4D9QA 3UQOA 2ZHQH 2GT7A 1C5NH 4Y8XA 3SHAH 1SSXA 4LZ1H 2ANKH 1QRZA 2ZO3H 1F0SA 1XXFA 3UQVA 5EXNA 8KME2 2ZFFH 1EATA 2FOFA 3ZZAA 4X6NA 3SGAE 3SU3A 3SJ9A 1GBAA 1Y5AT 2Z6BD 3BTQE 2VH6A 1BTYA 2D2DA 4E7RG 1GBEA 2HPPH 4MLFB 2H9TH 2ODPA 1Y5BT 1T8MA 1O3KA 1W8BH 3URDA 1FIWA 2ULLA 1SGNE 5GPIB 4JZ1A 4THNH 1EOLA 3TJOA 4DT7B 1Q2WA 1UTNA 2OBOA 1EPTB 1FAKH 1P02A 1SHYA 1XUGA 3LGVA 5GDSH 3UIRA 3HKJB 1UCYK 1O3DA 2QXJA 3BTFE 1THPB 1AKSA 3TK9A 2FLBH 3GY8A 2ZTZA 4Q7ZA 3U8OH 1BTXA 2SGAA 5CMXH 1LQDB 2Q1JA 1KXAA 5HMAA 5AFZH 3SUFA 4ASHA 2VINA 3GISB 1NS3A 4INHA 1QRWA 1ZHMA 3VXEH 1THSH 1DS2E 2ZCKP 5TJXA 4BAMB 4UFGH 1GCTB 2ZIQH 1ANCA 1HCGA 2HALA 1P06A 2XC4A 3KL6A 5FCRA 3LKWA 5L30H 1TONA 4IC5A 2FI4E 3BEUA 1HAZB 1E35B 2F9PA 4B73A 2BD2A 2SNVA 2WYJA 4DOQA 2PKAB 2VIPA 3UUZA 1QBOA 3BTGE 2JETC 4UE7H 1DM4B 3JZ2B 4X1PU 1RGQA 1AHTH 4ISHH 1GVKB 3N7OA 1O3OA 4MTBA 3MH4A 1CA0C 1KTTB 1O2OA 1EOJA 2C3SA 3EDXB 4HTCH 1EAIA 3KF2A 2ZQ1A 4WXIA 4BAHB 2F9OA 4I8HA 1P01A 5C2ZA 4X2YA 3RP2A 1ESAA 1YPKH 1GHVH 3ODFA 1T4UH 2G51A 4F49A 1BZXE 1T7CA 1ZPCA 2PFEA 5J4SA 1PPHE 2EI6A 1HFDA 4CRDA 3F68H 4SGAE 3FP6E 5DKMA 1UO6A 3M7QA 4FU7A 4B71A 2RA3A 3ATLA 3SZNA 2ZEBA 5FHTA 4H4FA 2G00A 3UREA 1UTPA 4ABDA 1K9OE 2RG3A 3TU7H 1XXDA 2GCTB 1BTWA 2QF0A 3GDSA 2VVUA 1V2RT 1UJ1A 1C1UH 1GDNA 3NXPA 1ZTJA 1GHWH 2FOMB 2ZTXA 4ZKSU 4D7FA 5A8YA 2WV5A 1WOFA 3HPTB 4TYDA 5ESTE 1LHEH 3V0XA 2H9EH 6GCHG 2BD9A 5EODA 1O2QA 1WV7H 2FZZA 4X8VH 1BRCE 2BY5X 3PLBA 5DK1A 3A7WA 2SGEE 4DGJA 5C5NA 3OY6U 1CT2E 5EQRA 3QUMP 1FAXA 2HPQH 2FDAA 2P3UB 2QC2A 4CBOA 2A7HA 2ZDMA 2NWNA 1BBRK 1O3LA 1RTLA 3STJA 3EA8A 1DWCH 1P11E 1WBGB 3OTJE 2G8TA 5DP8A 1FY5A 5DPAA 3D65E 4LXBH 4AGJA 2Z3CA 1PQ7A 1AKSB 1C5VA 3RXKA 2M5TA 5LPRA 1DDJA 3PTBA 3QLPH 1UTMA 3PO1B 3TH3H 1GMCG 2ZDLA 1OSSA 2ZGJA 1K1PA 1G36A 2GKVE 1P9UA 3FZDA 3UWJH 1TIOA 1MKWK 1BMMH 4SGBE 1VCPA 2GMTB 3KQCA 1DFPA 4YT6H 4ZHMU 2AS9A 1O36A 3LC5A 1L0ZA 3BF6H 2A45B 1G32B 3SV2H 1TALA 1UCYE 1J15A 1ZJKA 2XBXA 3H7OA 2VNTA 4AFUA 4ABHA 2BDIA 1H8IH 3LC3A 1HAVA 3MFJA 1C2KA 3O8BA 1GCDA 1LKAA 3MU1A 4ESTE 3ZZ6A 3B23B 3EE0B 4Y8ZA 3VB6A 3U9AH 3KNXA 4Y0ZE 1XVMA 3MU4A 3SUGA 2QGRA 2UWOA 1NRSH 2BDBA 3HK6B 3QTOH 4X1NU 1OWJA 1XKAC 4WH8A 9LPRA 3QO6A 1C5SA 5G4BA 5C1UA 1AGJA 1Y59T 4DIHH 1K1OA 4MNYA 4CRCA 3P17H 1GJ6A 1EUFA 2ZU5A 3M35A 3UTUH 5K0HA 1EX3A 1ESBA 1O35A 4TPYA 1FY3A 3SBKA 1GJDB 3K9XB 4Y10E 5B6OA 2XBVA 1BQYA 2BM2A 3SJIA 5T3HA 4YO9A 2PV9B 3RXFA 1IOEA 3RUOA 4DJZB 1P09A 1QJ1B 1OXGA 2XTTB 4ZKNU 5LPFA 2ZDKA 1AFEH 5DO4H 1TGSZ 1D3DB 1GL1A 4YOJA 1C9TA 1XKBC 4B74A 1A3EH 2GX4A 4ISIH 3A85A 3RMNH 1QB6A 3A89A 2CGAA 2H6MA 5DP7A 1C5LH 1F7ZA 1MCTA 1YPEH 3AW0A 3M3TA 1F0TA 1O3HA 1LVMA 1SOTA 4ABEA 1AO5A 3S0NA 4ZHLU 1P2JA 4O03A 1B0FA 1IAUA 4F4OC 3MNCA 2D1JA 2A2QH 2TRMA 3E0NB 3GY6A 1NO9H 2OQUA 1G3CA 1EQ9A 1K1JA 1ZMNA 6GCHF 3FP7E 5C5OA 4NFEA 3KCGH 2VB0A 1HXEH 1TGBA 4CRFA 2FI5E 3ATWA 1KIGH 4MQAA 3STIA 3EA7A 1AU8A 2IOTA 1C5YB 3LU9B 3T26A 1DWDH 1QIXB 3MNXA 2OC8A 2UUFB 4ABFA 3ZVCA 5ESBA 3LGTA 1SOZA 2VIOA 1PYTD 4XE4A 2OCVB 1V2JT 1OWEA 1CA8B 3LT3A 4GAWA 2YNAA 1O5FH 1QBVH 3ZZ3A 1Y3UA 3GYLB 1A61H 2TIOA 1H9LB 1XUHA 2H1UA 1LPGB 5FBIA 4ISLA 1GMCF 3PWBA 1QFKH 2UUKB 5EPNA 1A2CH 1C5UA 5FPTA 3A81A 3A83A 2FX6A 5A2MH 3CS7A 2O9QA 2ZKSA 2Q6DA 5JDUB 3BTEE 3ZVEA 1GVLA 4I8GA 1K28D 2CF9H 4IMZA 4A1XA 1S0QA 1DUEA 1BUIA 3SO3A 1C1SA 1JMOH 4K2YA 2ZGXH 3UNQA 2WINI 1GMDG 1C1TA 2J92A 3SV6A 1UTLM 2CHAB 1IQHA 1Z6EA 1TRYA 2FM2A 1LVOA 1GBLA 3SGBE 1A0LA 4JK5A 3TH4H 1MD7A 1MUEB 1C5WB 4AOQA 4K69A 1A3BH 2I6QA 3FANA 2A1DB 1FV9A 3SUEA 2XWAA 1C2MA 4IW4E 4Q7XA 1V2VT 4Y11E 1Z1IA 2BZAA 4WJG2 1O2HA 1C5MD 5C1YA 2BQWB 8LPRA 3M3SA 3RMOH 2R2WU 4FUBA 4K3JA 4YOIA 4ABJA 5PTPA 3GCOA 2FO9A 1ZMLA 2EI8A 3SOSA 2GT8A 1AVWA 1O3GA 1GI1A 1D6RA 1UMAH 2FLRH 1JOUB 1BCUH 4VGCB 3SN8A 2OLGA 1UVSH 3BG8A 5AF9H 4IC6A 4NA9H 4IN2A 3TJVA 2WPKS 1TABE 3LH3A 1H1BA 1O0DH 1EB2A 4X6OA 3RDZA 4UFDH 2P8OC 4X8TH 1GBDA 1AY6H 1O31A 3I77A 1O3CA 1A4WH 2Y5FA 1WQVH 3H7TA 4K8BA 5FX5A 3RU4E 1CBWB 1ZMJA 3RLYH 2Z9GA 1OWDA 2BDHA 1EPTA 2G55A 2EC9H 3CENA 2C8ZB 4LOYH 2Z94A 5I46H 2SFAA 3LGYA 2OC1A 1NROH 1K22H 1LQEA 1BDAA 2BDCA 2C90B 1SC8U 6LPRA 1XX9A 4E05H 1GI5A 3BN9A 1DXWA 1W11U 1O2SA 1SI5H 3Q76A 2OD3B 2TGAA 4NIXA 1SPJA 1PQ8A 1SQAA 2QXIA 2OC7A 1EPTC 1TGCA 2ANYA 4Q7YA 3C1KA 2GV6A 3RXCA 4XDEA 1V2TT 3MI4A 1EZXC 2ZQ2A 5JBBS 4I8JA 1XUIA 1YPLH 2K1QA 4QT8C 1DY8A 1FUJA 4YLQH 3TNTA 3LGWA 1SLVB 2Y7XA 1GMHG 2PKAA 2RCEA 3E3TA 1THRH 2J95A 5JBTA 2J9NA 1C1WH 2C8XB 3FZZA 3GY2A 3M5OA 1GBKA 5FCKA 5A0CA 1L4DA 4ZAEA 4MPVA 1SL3A 1G3DA 1GCTC 1TFXA 1ORFA 4IS5A 1O2UA 1KXBA 4ZKRU 4IBLH 5EOKA 1FMGA 2A32A 3D49H 1GJ4H 4XBBA 1TNLA 4Y7BA 3O8DA 1SLWB 1C1PA 2JH6D 3ELAH 4IN1A 4AYVB 3V13A 4X2WA 1JRTA 1XUKA 2QAAA 5C67A 2FOCA 4Y79A 5T6GA 2XC5A 1CHGA 1V2WT 2Z3DA 4U01A 4Z6AH 1EJAA 1MAYA 3BEIB 5SGAE 3T28A 1O2RA 1V3XA 2RA0A 3Q3YA 1CO7E 1C1VH 4U2WA 2SGFE 1V2KT 1YLCA 5F8ZA 1PQAA 1Q3XA 3MU8A 3RC4A 3TJUA 3T25A 1ANBA 5E0HA 1SGEE 2XBYA 3DFLA 4X1SU 1VGCB 4TPIZ 2HWLB 2AGIX 1Y3WA 3KEEA 3W94A 2BY9X 3QN7A 1ZPBA 1ZTKA 1BMNH 4JZDH 3RM2H 2AMPA 4RKOB 1TPOA 1ABJH 1TNKA 2A5AA 4OS1A 3HATH 2ZGHA 1QTFA 2A0QB 1XUJA 3SW2B 1VR1H 4RN6A 5AVDA 1YPGH 4GPGA 2BOKA 4OS7A 3P70B 1P04A 1FNIA 3SNBA 1RD3B 1H9IE 2GCTC 1HAOH 2ZHEH 3LGIA 4B2BA 2BX3A 2ZFQH 4HZHA 1G2LA 1BA8B 1S81A 4UFFH 1MZAA 1TRMA 3SU5A 1WTHD 4E7NA 1HAXB 1RFNA 4O9VA 1P2IA 4UD9H 1SGFA 4BTIB 3K2UA 5E0GA 4TWYA 1SHHB 2VVCA 3TK5A 2BLOA 1NU7B 3R3GB 4FUIA 1ZPZA 1K1MA 4X1QU 5F03A 3M36A 3V7TA 3SJKA 2STAE 5L2ZH 1AB9B 1ABIH 2AGGX 4Y8YA 1V2OT 2BTCE 4JYUH 3S9AA 3HGPA 1GI6A 3UR6A 3RMLH 3VFEA 5F8TA 2O8LA 1HDTH 1QY6A 3KIDU 2Y82A 3P6ZB 1F5RA 1V2PT 1P8VC 2AH4X 2BMGB 1DY9A 3FAOA 3PO1C 1QR3E 1TB6H 3A87A 1C4V2 4CH8B 1DOJA 1Z71A 1GI0A 3EGKH 3QDZB 1SFIA 4FXGH 2ZCHP 4YT7H 1SGFG 3MH5A 1NT1A 1Q31A 2GMTC 4ZUHA 2KAIA 4DIIH 3B9FH 2FS9A 1BB0B 1FZZA 4XFQA 2W7UA 6CHAB 3U69H 1BRBE 1HAIH 3RXPA 1YYY1 3HGNA 1DANH 2PLXA 3UFAA 1GVZA 2FS8A 1KLIH 1BIOA 1OOKB 3E90B 1GL0E 2J34A 5F8XA 1IQFA 1GHAG 2A7JA 2SNWA 4XSKU 3EA9A 3MOCA 1MTSA 2CXVA 2VH0A 1TBQH 1XM1A 2TGDA 3SJ8A 3E1XB 2OUAA 3RXMA 3LPRA 1BMAA 4DCDA 2BVRH 2AGEX 2VIDA 1O3IA 1XVOA 3GY3A 2H5CA 2BD7A 2YOLA 1BOQA 1DLKB 1L4ZA 1NY22 2GZ8A 1AI8H 1IQNA 3UOPA 1A1RA 3UNRA 3QX5H 2ZHDA 1PPCE 2H9HA 4LZ4B 2OXSA 5DJ7A 4HGCA 1SGRE 1O5DH 1CGJE 1DXPA 1EZQA 2J94A 2FOGA 1D3TB 1TOMH 4DW2U 3KQDA 4IGDA 2H2ZA 5DP9A 1OP8A 4BTUB 2PGQB 5FBEA 3BIVH 4GCHG 1W2KH 2LPRA 1GGDB 2B0FA 1O2IA 4BAOB 2GTBA 3W95A 1JWTA 1RTFB 3KQEA 4PROA 5HM9A 1G2MA 1S6HA 2XYAA 2BDAA 4ZH8A 3A7TA 2D8WA 1WQSA 7KMEH 4WVPE 1W14U 1UK3A 3CP7A 1O3FA 3SU6A 4U32A 2BLQA 1F5KU 1VZQH 1NPMA 1U6QA 2AFQB 3U1JB 1IQGA 1W10U 2QYIA 3D62A 4MDSA 1UHBB 3BG4B 1ELAA 1DPOA 2A31A 1FJSA 1SQOA 1A0HB 2FI3E 4UDWH 5JPMH 3T2NA 1T8OA 1D3QB 3ATMA 1X7AC 4X0WU 3CS0A 1MZDA 1T31A 3L6PA 3VEQB 1V6DA 4NFFA 1ZTLA 1MTNB 3L3TA 4A1VA 3SV7A 1MD8A 1QURH 4WWYA 1N8OB 1ZHRA 2VJ1A 2Z3EA 5EPYA 2ZFTA 3KN2A 4IMQA 2Z9KA 1WAYB 1YLDA 3SI4H 2A5IA 2G81E 2Y80A 1Y3YA 1PPGE 2GDDA 1BTHH 1YPMH 2Y6TA 3F9GA 3I78A 4JMYA 3ZVFA 1YC0A 3ZVDA 1F0UA 4KGAA 1IQIA 2XCNA 3F6UH 3BV9B 3OYPA 2FODA
chains in the Genus database with same CATH superfamily
1K1IA 1HBTH 4A6LA 3AASA 2YMSC 3LGUA 2KAIB 3SORA 2AEIH 1TGNA 4ABGA 1NC6A 1FPCH 2WPDD 3VB7A 3ESTA 5GXPA 5FX6A 2B9LA 2BLWA 1AWFH 4ABIA 1TQ0B 2VGCB 2STBE 2BQ6B 2EI7A 2WPMS 2IPHA 1SBWA 4GHQA 1UTJA 4NWKA 1UVTH 1NBMD 1HIAA 2JH0D 2BOHB 1GHAF 1QA7A 1AUTC 3DUXH 1F5LA 4FU8A 1TNHA 5TCAA 2AYWA 2CHAC 4A92A 3Q3KA 2VWLA 1HJ9A 2ZFRH 1TOCB 3G01A 1A7SA 1T8NA 1CT0E 1HAYB 2CN0H 2J4IA 2WYGA 3A8CA 3E16B 4DY7B 1HAPH 4CREA 1OWKA 1LHCH 1GBMA 3B8JA 4GLYA 2TBSA 3AK5A 5EG4A 3GY5A 1EXFA 1C2FA 3A84A 3A8AA 3PV4A 3U98H 1NFXA 4H6TA 1C1NA 3UPEA 1EAUA 1J14A 5T6FA 1SGDE 4R8TB 3RXJA 1BT7A 4NCYA 2FMJA 2ODYB 3RU4D 1ZZZA 3AAVA 4FUFA 1TLDA 2JJ2D 3VB3A 2BD5A 5A0BA 1QJ7B 3GICB 1ARBA 4GCHF 1P3CA 1P05A 1INCA 4ISNA 1KSNA 2VBCA 5TCCA 3ZV8A 2FP7B 5C3NA 1W12U 3VXFH 1TBRH 5EJ1A 4VGCC 1C5OH 3LIWA 3ZZDA 4OGXA 2WPLS 1LPKB 1BTPA 1SMFE 3PRBA 2VWNA 3KYGA 2V3HH 4I8LA 3S7KB 3EYDA 3O8CA 3FN8A 3WY8A 1Z1JA 4OS5A 3ZZ5A 4BXSA 1E0FD 1ZSJA 2PTCE 3PMJA 1B7XB 5GCHG 5FL7D 1FDPA 2GP9B 1MQ6A 1SLXB 1NESE 1YPJH 4TWWA 1BHXB 4Y76A 2F9UA 1QQ4A 4AZ2B 1KXDA 3PROA 2W6ID 1BBRE 1CBWC 1QCPA 3RXSA 1Y8TA 3PLKA 2KCYA 3ZVBA 1GI2A 1LVYA 1E36B 4FU9A 1IQLA 2ODQA 1MTUA 2FTMA 5I25A 1GBJA 1H8DH 2ZU3A 1ACBE 3PMBB 2I6SA 3M3VA 4I7YH 2UWPA 3WWBA 1UVOA 2ZDVH 3W1EA 1QL9A 1QB9A 1D9IA 1O30A 3MU5A 1FX0B 1O5AB 4MPWA 3F9EA 4NSVA 1DITH 3URCA 1ELEE 3GY4A 2CV3A 4X6MA 3SHCH 1O2KA 1RRKA 4UEHH 4B2CA 1W7XH 1C1OA 2FIRH 1HAHH 2WPIS 4M9FA 4H42U 5KEDA 4A7IB 1NFWA 1PQ5A 5C1XA 3OU0A 3UR9A 1FXYA 2CMYA 5K7RA 2RDLA 1GI7B 1G3BA 3RXAA 4BOHA 1ZLRA 1GBHA 2G5NA 1OWHA 1SLUB 1YBWA 2XC0A 1K21H 2QN5T 2XBWA 1ELBA 1N1LA 2XCFA 2P16A 3BTHE 1TMTH 3SUDA 5DP6A 1HUTH 1BHXF 1D4PB 4FUDA 1MBMA 2BQ7B 4KELA 1ZHPA 3M37A 2QV1A 4OM9A 3S7HB 2G5VA 5C17A 3RXBA 1HIAB 2WPJS 1GBCA 1PPFE 4KTUA 3SQHE 1QL8A 1KXFA 1GI9B 5CHAB 4XD7D 2KCAA 1TX6A 1Z8RA 2P94A 4YTAA 2F3CE 1C2GA 1FN8A 1G37A 3KQ5A 4XOJA 5J4QA 3PV2A 1YWUA 3VB4A 3VGCB 3RXEA 4FUCA 4HFPB 5GIBA 1AN1E 1WUNH 2ANMH 1O3EA 2P3TB 4X2VA 4P00A 5CE1A 1P2NA 1NU9A 2HRVA 4RT0A 3ZZ7A 1AZZA 1HJAB 2BY7X 5AHGH 4WY3A 1GJ5H 2FTLE 3SNEA 1VGCC 1UK4A 3LOXA 2F9NA 1O3PB 2R0LA 1QA0A 1FY8E 3U1IB 1GBFA 2BDGA 2OTVA 3GYMA 4KP0A 5ABWA 1H9HE 4X8UH 3QZQA 1BRUP 1L2EA 2ZGCA 1AE5A 1ARCA 1HAGE 2HVXA 4MPXA 4LK4A 2ZFSA 1E37B 3T5FH 1NN6A 1C5QA 1DVAH 2A4GA 2NU4E 3AAUA 4CRGA 3SNDA 1N6YA 1AFQB 1C4Y2 4B6FA 1ZR0A 3A8BA 2PR3A 1OWIA 1A5HA 2P59A 4GVUA 1Y5UT 2QXHA 1O2YA 3MU0A 2QXGA 4YLUA 1CQQA 2SGQE 1SGTA 4NSYA 4DURA 5T1VA 3A80A 1BRAA 1VCQA 1O2ZA 4I86A 1LHDH 3F1SB 2VIWA 2FOEA 1G3EA 4FUJA 3A7XA 5GCHF 1PPBH 2A2XH 1KLTA 1V2QT 3SU4A 3OEED 1MMJN 3F9FA 4ZMAH 4D7GA 1TMBH 4FVDA 1C1RA 5CHBA 5JBAS 7ESTE 3PMAB 2KZ4A 1C2IA 2XW9A 1ZSLA 5BPEA 4MNXA 2PUXB 2Q6GA 4I31A 3TLOA 2NU2E 4ZXXH 3S9BA 3OTPA 1OYQA 2F43B 2V35A 3ZZBA 1O3JA 1ELCA 1YPHC 4R0IA 4DVAU 4X2XA 3ZZ4A 2QF3A 4Y71A 4I8KA 1AB9C 4JK6A 4Q80A 2O8MA 3F3BA 4WMDA 1YCPM 3GCHB 1FPHH 3HK3B 1EP6A 1P57B 1TA6A 2XXLA 3NZIA 3A8DA 1NM6A 2BY6X 2KCOA 2WPHS 2ALPA 3JZ1B 1J17T 1FQ3A 1K1LA 5LPEA 1NRNH 1AMHA 2ZECA 1GDUA 1MABB 2VVVA 1GMDF 2FPZA 3S9CA 2R0KA 1FN6A 3RU4T 3T27A 3A7VA 3EAJA 5EJZA 1C5RA 3ZYDA 2J38A 3DHKH 1GBBA 3MYWA 3UAIC 1PPEE 2C8WB 4INLA 2O8TA 5DSFA 3OEHD 1UTQA 1QQUA 3ZZCA 6CHAC 1GHXH 2BD4A 5JB8S 3TIUA 4D8NA 3FFGA 1ZOMA 2LELA 4FVBA 1EKBB 2ZDNA 1FLEE 1WU1A 3OFND 2PWXA 3P8NA 1WTGH 4MPUA 5IDKA 2WUCA 5A8XA 2PW8H 1O2TA 4I33A 3SV8A 5GJ4B 4NIVA 4MG3A 1ETSH 1GHZA 5DN6D 1Z6JH 1SGYE 3ATKA 1P3EA 1AVGH 4UFEH 1O34A 1HJ8A 1NRRH 4AFQA 2Y5HA 2GCHG 1O2VA 1GI4A 1ZGIA 3PMHB 4XBCA 3KHVA 3TVJB 4CHAB 1YKTA 1QL7A 4AC9A 3OE7D 9ESTA 5EQSA 1AE8H 5HYOA 1V2ST 2F9VA 4O3TA 4TY7A 1TA2A 2V3OH 1HLTH 2BB4A 2ZCLP 1JRSA 1RJXB 3ZZ8A 1PYTC 1O33A 1PJPA 3KGPA 3QGJA 4YESB 5C0TA 4A1TA 2ZHFH 3UB0A 1D6WA 3D23A 3PLPA 2EY4C 3PYHA 4DG4A 1GGDC 1UHBA 3RMMH 2B8OH 4O97A 1C1QA 2ZU4A 1F0RA 1K1NA 1S6FA 2ZP0H 3T29A 3TGJE 1GI3A 3UWIA 4KTCA 1DICA 1O3MA 2FEQH 2P3FH 4Q4LA 1GG6B 2QCYA 3MMGA 2GD4B 3VB5A 3SQEE 2B5TB 3QK1A 2PSXA 3N7DA 1FI8A 5FPYA 3DFJA 1B5GH 1C2HA 1CSOE 2XRCA 3P92A 1O2WA 1O2JA 2BYAX 4JCNA 1GJBB 3SV9A 1CT4E 1IQJA 4B2AA 5AFYH 1KDQA 1P12E 1O2NA 1QHRB 5EXLA 2EEKA 3BG4C 4Y7AA 3QZRA 2FOHA 5JB9S 1LTOA 5ETXA 3I29A 3ODDA 1YCPH 3NK8A 5IYTA 1AQ7A 5EU8A 3S69A 3WWFA 3ZIAD 4YXWD 4X6PA 3ZYEA 1RIWB 2AMQA 2ZDAH 1C2DA 1CHOG 1DX5M 3TITA 1MTNC 2V6NA 5EW2H 1TPAE 1SQRA 2OC0A 2GZ9A 4BTTB 2W7SA 3O8RA 1AVXA 1N8OC 3Q77A 2BHGA 5E0JA 4AX9H 1GMHF 1COWD 2DE8A 4MNWA 1UTKA 3VPKA 1S84A 5DG6A 4BNRA 2ESTE 2PKSB 4NZQA 7GCHG 1HXFH 1LPZB 2BX4A 3PV5A 3MTYA 1KXCA 4OS2A 1O2GH 3RXGA 2WUBA 1P0SH 2PSYA 5L2YH 4NA8A 2ZZUH 1ELTA 3L33A 2QIQA 2FX4A 2BXTH 1IQMA 6ESTA 2HGTH 4BXWA 1VJAU 3R0FA 1GHYH 1GJ9B 1E34B 1O3BA 2VWOA 1UTOA 3ZZ9A 5BRRE 2ALVA 1DWEH 3DD2H 1AZ8A 2W3KA 3SNAA 1SGIB 2HNTF 2VGCC 5GWZA 2ZWLH 1BJUA 3TPIZ 2AMDA 1EJNA 1ZGVA 4Y0YE 1V2NT 3NKKA 3UOUA 4AB9A 3LJOA 1FIZA 2CJIA 1DUAA 2WZQA 2A5KA 3RC5A 1SVPA 4AFZA 1F92A 4B1TA 1SGCA 2FYRA 1EP5A 2F91A 1DSTA 4HG6A 3M5MA 3UNSA 3MH6A 1S85A 3BTKE 1V2MT 4MVNA 1TQ7B 2FOBA 4K1SA 3K65B 2H5DA 4K5ZA 1C1MA 4B75A 2R2MB 2W3IA 2Y5GA 4K1EA 1JIRA 1OX1A 4CRAA 1RTKA 1S5SA 1ELVA 1BTZA 1TBZH 3MNSA 2GCHF 4INKA 3A86A 4JZEH 1IQEA 4H6SB 3RXDA 1O2PA 1T8LA 2VIVA 3OY5U 1C2EA 3MH7A 3IWMA 4NIYA 4A5TS 3OX7U 1C5ZB 1UK2A 1VITG 3AVZA 2HLCA 5FXLA 1GHBG 4ZCNA 1S6LA 4ZROA 1L1GA 1MU8B 2BVXH 1AWHB 1OP2A 3FO8D 1V2UT 3RM0H 5EGMA 5F6MA 3LONA 3RXUA 4HI3A 1KY9A 1ANDA 2FXRA 4KKDA 1OYTH 2DUCA 1ZRKA 2SGDE 3BTTE 4K8YA 2GZ7A 4GHTA 1KDQB 1TPPA 1MKXH 1LKBA 3DA9B 3DSPA 8GCHG 5C20A 1S83A 2AIQA 4AORA 1Y3VA 3TGIE 2BDYA 2FYQA 3GCNA 4K1TA 1ELGA 2GGVB 5H4IB 2JETB 2F4LA 1TWXB 1P9SA 1NFYA 3ZVAA 1O38A 3M7UA 2ZTYA 1UVPA 2GDEH 2JKHA 3T62A 1TMUH 2V0BA 2Y81A 7LPRA 1CA0B 1O5CB 1W0JD 1TX7A 4AFSA 1ETTH 1TGTA 1K2I1 3PM3A 3P95A 1CHOF 4AYYB 1B0EA 4ZXYH 1TNGA 2ZG0H 1S82A 1GI8B 1NTPA 1XUFA 1ELFA 1P03A 3Q3XA 1EZSC 1W0YH 3FVFB 1W7GH 3F9HA 1FY4A 2Z9LA 1NRPH 1MCVA 1C5XB 3GY7A 2BY8X 7GCHF 4GSOA 1E38B 1OPHB 4JYTA 1SB1H 1O2XA 4NG9H 1M9UA 1PPZA 2DE9A 5L6NH 3RXTA 1VITH 2AIPA 3SU1A 2OBQA 1HYLA 3BSQA 1PFXC 3QWCH 1QJ6B 1CE5A 2BD8A 4FUHA 2QF4A 2ZNKH 1P2QA 2VIQA 1O5BB 1H8ED 1GBTA 4NIWA 4NA7A 3SNCA 1YCPK 3NPSA 1NRQH 3GCTG 3A7YA 2GV7A 5CHAC 4RKJB 1UVUH 3F0PA 2NU3E 2XNIA 1MTWA 4WMFA 1SQTA 1Z7KA 1Z8IB 1LHGH 2TGTA 4O3UA 1EB1H 4K60A 4KTSA 5LH8A 5HXFA 3VGCC 1AUJA 4CRBA 2UUJB 4OS6A 4WH6A 3E0PB 3MO6A 1D3PB 2ZHWH 1S0RA 5HM2A 1P2MA 1BMFD 1O5EH 3M5LA 5EJLA 5EXMA 5JYIA 1FY1A 3BTME 5DGJA 1CGHA 1GBIA 1GPZA 2WHXA 1BMLA 1HJAC 1JXPA 3V12A 3P8OA 5E2PA 1CGIE 4CH2B 4CBNA 3BEFB 2A4RA 4MNVA 1Z8GA 2Z9JA 3MNBA 1O32A 1MAXA 1O2MA 1QB1A 2PUQH 2ILNA 2NU1E 3SU0A 2OINA 1L1NA 1YGCH 2BVSH 2R9PA 2FOAA 2G4TA 3DSOA 1VITF 2W5EA 1GHBF 1GDQA 1UW7A 3H5CB 1MH0A 4WF8A 4NZLA 3U28C 2R3UA 3KQBA 1O37A 5A8ZA 1O3NA 3TNSA 5FPSA 1AFQC 1H4WA 1LHFH 2XNDD 3PWCA 2IN2A 3K6YA 3MO9A 1VJ9U 2ZC9H 2V7QD 1YM0A 1SKYE 2F83A 1DT2A 1YP9A 2ZF0H 2NU0E 2OP9A 1TX8A 1GJAB 1O3AA 2BD3A 1CU1A 3MHWU 1EJMA 3MQKC 1MU6B 1EAWA 5GNDA 1QGFA 2VWMA 2UUYA 3TGKE 3N7EA 1P2OA 3M5NA 8GCHF 1F2SE 2Y7ZA 1BTUA 1A5GH 3C27B 1J8AA 2THFB 1H8HD 1L1JA 1NZQH 3IG6B 4FUEA 2RFKC 2IJOB 4YOGA 1GJCB 1ETRH 1OP0A 4NGAH 2PHBA 2TGPZ 1IQKA 1HAVB 2D26C 3K6ZA 1ID5H 3F0OA 3E6PH 3RXIA 3E8LA 4XBDA 3M61U 1DSUA 2B7DH 2J98B 1E79D 4Y6DA 1ZYOA 2PTNA 1O39A 2FESH 5JBCS 3TH2H 3GCHC 2JH5D 2UWLA 3SJOA 3BIUH 3EE7A 5LGOA 1G9IE 2Z9IA 5DP4A 2ZGBH 3QTVH 4X8SH 2F9BH 4UONA 1HB0B 2O8UA 2J2UA 1LCYA 2ZI2H 1UCYH 1MKXK 1V2LT 1OKXA 1ELDE 1HV7A 5E2OA 2ZPRA 1GJ8B 2A7CA 3P8GA 1YPHE 2ZPSA 4AG1A 5B6LA 1GWAA 1O5GH 3E91A 1RS0A 3MO3A 3QGNB 1QNJA 1KMHB 4CR5A 4AGKA 3HKIB 1P10A 4ZHAA 2AERH 1C5TA 4WMEA 3BTDE 1NBME 4U30A 4BANB 2ASUB 3GCTF 1XMNB 2GVFA 3RXHA 3ENSB 2O8WA 1GJ7B 2HNTE 2PGBB 5DP3A 5E8EH 1ZRBA 2EQNA 1LDTT 1ZSKA 1JBUH 3P8FA 1OS8A 3NCLA 1HPGA 1MQ5A 1TNIA 2BXUH 4ZKOU 1TPSA 2R3YA 1HNEE 4AG2A 1WXRA 1G30B 2ANWA 4ISOA 1SFQB 3SI3H 5FAHA 1W13U 4CHAC 3UY9A 2LNCA 1LMWB 1FONA 1SG8B 2C93B 3EQ0H 3RXOA 2RDEA 3RXVA 1EAXA 3TK6A 4JZIA 1C5PA 1TE0A 4D76A 5F53A 2VU8E 1W0ZU 2C4FH 3A88A 4XRNA 5A09A 3ZV9A 3A7ZA 3AW1A 2G52A 3PTNA 1KYNA 2Z7FE 3RXQA 2WV4A 3U8RH 2W26A 1A0JA 4Z0KA 1A5IA 3RLWH 4OS4A 3NUMA 1BITA 3LH1A 3BTWE 4J2YB 4NWLA 1IHTH 1TYNA 2SGPE 3RXRA 1AIXH 1JIMA 4RI0A 1GG6C 1Y3XA 1C2LA 2TPIZ 2KX4A 1MBQA 4JZFH 1KTSB 4GUXA 1MTVA 4OGYA 3DT0H 1BJVA 1EASA 2A4OA 2CF8H 5T6DA 4BAQB 1TRNA 1AD8H 4Q2KA 3MWIU 3PB1E 2QA9E 2ZU2A 1TNJA 1T4VH 2EA3A 1KLJH 1QRXA 1C2JA 1KXEA 2YNBA 1CVWH 3GDUA 4FUGA 1DLEA 1Z8JB 4RSPA 1VCWA 1W3CA 3NWUA 2HNTC 1J9CH 2A4QA 1NFUA 1LO6A 5HGGA 1RIWC 3FP8E 1QBNA 1HGTH 3IITA 4CR9A 4ABBA 1HRTH 1LVBA 2ZPQA 3RXLA 1TAWA 4AB8A 4WXVA 4ABAA 4J1YA 3V3MA 3LDXH 2BLVA 1DE7H 3SGQE 1BBRH 3A82A 1SR5C 3RC6A 1C4U2 1WSSH 1DWBH 1ANEA 2XWBI 2HOBA 1IHSH 2Q6FA 4D9RA 1WCZA 1RXPA 2P93A 4AN7A 5C0UA 1ZJDA 1T32A 2PKSC 2C8YB 4BAKB 3OSYA 1C9PA 3ITIA 3TJNA 4RT1A 2YMSD 1O2LA 3M7TA 3GOVB 3SU2A 4JYVH 2BZ6H 1SGPE 2QY0B 1A46H 1SGQE 4TY6A 3LJJA 2ZA5A 2ZU1A 4B76A 5EW1H 2G4UA 8ESTE 4YZUA 1YF4A 2FWWA 2P95A 4YM9A 1ESTA 4I32A 1WYKA 3ZVGA 2OQ5A 4M7GA 4F55A 1MKWH 5DP5A 3U8TH 2P8OB 5A0AE 3ATIA 1J16A 4X1RU 1N6XA 4TSFD 4E06H 3GDVA 1P2KA 2ZFPH 3Q00A 1EZUC 5EQQA 4D9QA 3UQOA 2ZHQH 2GT7A 1C5NH 4Y8XA 1WDIA 3SHAH 1SSXA 4LZ1H 2ANKH 1QRZA 2ZO3H 1F0SA 1XXFA 3UQVA 5EXNA 8KME2 2ZFFH 1EATA 2FOFA 3ZZAA 2JDID 4X6NA 3SGAE 3SU3A 3SJ9A 1GBAA 1Y5AT 2Z6BD 3BTQE 2VH6A 1BTYA 2D2DA 2KM0A 4E7RG 1GBEA 2HPPH 4MLFB 2H9TH 2HLDD 2ODPA 1Y5BT 1T8MA 1O3KA 1W8BH 3URDA 1FIWA 2ULLA 1SGNE 5GPIB 4JZ1A 4THNH 1EOLA 3TJOA 4DT7B 1Q2WA 1UTNA 2OBOA 1EPTB 1FAKH 1P02A 1SHYA 1XUGA 3LGVA 5GDSH 3UIRA 3HKJB 1UCYK 2WV9A 1O3DA 2QXJA 3BTFE 4ACBA 1THPB 1AKSA 3TK9A 2FLBH 3GY8A 2ZTZA 4Q7ZA 3OAAD 3U8OH 1BTXA 3GS9A 2SGAA 5CMXH 1LQDB 2Q1JA 1KXAA 5HMAA 5AFZH 3SUFA 4ASHA 2VINA 5HKKD 3GISB 1NS3A 4INHA 1QRWA 1ZHMA 3VXEH 1THSH 1DS2E 2ZCKP 5TJXA 4BAMB 4UFGH 1GCTB 2ZIQH 1ANCA 1HCGA 2HALA 1P06A 2XC4A 3KL6A 5FCRA 3LKWA 5L30H 1TONA 4IC5A 2FI4E 3BEUA 1HAZB 1E35B 4ACAA 2F9PA 2QE7D 4B73A 2BD2A 2SNVA 2WYJA 4DOQA 2PKAB 2VIPA 2K0QA 3UUZA 1QBOA 3BTGE 2JETC 3WW7A 4UE7H 1DM4B 3JZ2B 3H09A 4FETA 4X1PU 1RGQA 1AHTH 4ISHH 1GVKB 3N7OA 1O3OA 4MTBA 3MH4A 1CA0C 1KTTB 1O2OA 1EOJA 2C3SA 3EDXB 4HTCH 1EAIA 3KF2A 2ZQ1A 4WXIA 2JIZD 2QF5A 2F9OA 4BAHB 4B6EA 4I8HA 1P01A 5C2ZA 4X2YA 3RP2A 1ESAA 1YPKH 1GHVH 3ODFA 1T4UH 2G51A 4F49A 1BZXE 1T7CA 1ZPCA 2PFEA 5J4SA 3SZEA 1PPHE 2EI6A 1HFDA 4CRDA 3F68H 4SGAE 3FP6E 5DKMA 1UO6A 3M7QA 4FU7A 4B71A 2RA3A 3ATLA 3SZNA 2ZEBA 5FHTA 4H4FA 2G00A 3UREA 1UTPA 4ABDA 1K9OE 2RG3A 3TU7H 1XXDA 2GCTB 1BTWA 1K0HA 2QF0A 3GDSA 2VVUA 1V2RT 1UJ1A 1C1UH 1GDNA 3NXPA 1ZTJA 1GHWH 2FOMB 2ZTXA 4ZKSU 4D7FA 5A8YA 2WV5A 1WOFA 3HPTB 4TYDA 5ESTE 1LHEH 3V0XA 2H9EH 6GCHG 2BD9A 5EODA 1O2QA 1WV7H 2FZZA 4X8VH 1BRCE 2BY5X 2WSSD 3PLBA 5DK1A 3A7WA 2SGEE 4DGJA 5C5NA 3OY6U 1CT2E 5EQRA 3QUMP 1FAXA 2HPQH 2FDAA 2P3UB 2QC2A 4CBOA 2A7HA 2ZDMA 2NWNA 1BBRK 3DSGA 1O3LA 1RTLA 2AHME 3STJA 3EA8A 1DWCH 1P11E 1WBGB 3OTJE 2G8TA 5DP8A 1FY5A 5DPAA 3D65E 4LXBH 4AGJA 2Z3CA 3F2GA 1PQ7A 1AKSB 1C5VA 3RXKA 2M5TA 5LPRA 1DDJA 3PTBA 3QLPH 1UTMA 3PO1B 3TH3H 1GMCG 2ZDLA 1OSSA 2ZGJA 1K1PA 1G36A 2GKVE 1P9UA 3FZDA 3UWJH 1TIOA 1MKWK 1BMMH 4SGBE 1VCPA 2GMTB 3KQCA 2M2AA 1DFPA 4YT6H 4ZHMU 2AS9A 1O36A 3LC5A 1L0ZA 3BF6H 2A45B 1G32B 3SV2H 1TALA 2L6OA 1UCYE 1J15A 1ZJKA 2XBXA 3H7OA 2VNTA 4AFUA 4ABHA 2BDIA 1H8IH 3LC3A 1HAVA 3MFJA 1C2KA 3O8BA 1GCDA 1LKAA 3MU1A 4ESTE 3ZZ6A 3B23B 3EE0B 4Y8ZA 3VB6A 3U9AH 3KNXA 4Y0ZE 1XVMA 3MU4A 2J98A 3SUGA 2QGRA 2UWOA 1NRSH 2BDBA 3HK6B 3QTOH 3CNRA 4X1NU 1OWJA 1XKAC 4WH8A 9LPRA 3QO6A 1C5SA 5G4BA 5C1UA 1AGJA 1Y59T 4DIHH 1K1OA 4MNYA 4CRCA 3P17H 1GJ6A 1EUFA 2ZU5A 3M35A 3UTUH 4TT3D 5K0HA 1EX3A 1ESBA 1O35A 4TPYA 1FY3A 3SBKA 1GJDB 3K9XB 3KYFA 4Y10E 5B6OA 2XBVA 1BQYA 2BM2A 3SJIA 5T3HA 4YO9A 2PV9B 3RXFA 1IOEA 3RUOA 4DJZB 1P09A 1QJ1B 1OXGA 2XTTB 4ZKNU 5LPFA 2ZDKA 1AFEH 5DO4H 1TGSZ 1D3DB 1GL1A 4YOJA 1C9TA 1XKBC 4B74A 1A3EH 2GX4A 4ISIH 3A85A 3RMNH 1QB6A 3A89A 2CGAA 2H6MA 5DP7A 1C5LH 1F7ZA 1MCTA 1YPEH 3AW0A 3M3TA 1F0TA 1O3HA 1LVMA 1SOTA 4ABEA 1AO5A 3S0NA 4ZHLU 1P2JA 4O03A 1B0FA 1IAUA 4F4OC 4P02A 3MNCA 2D1JA 2A2QH 2TRMA 3E0NB 3GY6A 1NO9H 2OQUA 1G3CA 1EQ9A 1K1JA 1ZMNA 6GCHF 3FP7E 5C5OA 4NFEA 2PP6A 2VB0A 3KCGH 1HXEH 1TGBA 4CRFA 2FI5E 3ATWA 1KIGH 4MQAA 3STIA 3EA7A 1AU8A 2IOTA 1C5YB 3LU9B 2OK5A 3T26A 1DWDH 1QIXB 3MNXA 2OC8A 2UUFB 4ABFA 3ZVCA 5ESBA 3LGTA 3FOAA 1SOZA 2KCPA 2VIOA 1PYTD 4XE4A 1E1RD 2OCVB 2CK3D 1EFRD 1V2JT 1OWEA 1CA8B 3LT3A 4GAWA 2YNAA 1O5FH 1QBVH 3ZZ3A 1Y3UA 3GYLB 1A61H 2TIOA 1H9LB 1XUHA 2H1UA 2YMSB 1LPGB 5FBIA 4ISLA 1GMCF 3PWBA 1QFKH 2UUKB 5EPNA 1A2CH 1C5UA 5FPTA 3A81A 3A83A 2FX6A 5A2MH 3CS7A 2O9QA 2ZKSA 2Q6DA 5JDUB 3BTEE 3ZVEA 1GVLA 4I8GA 1K28D 2CF9H 1QZ8A 4IMZA 4A1XA 1S0QA 1DUEA 1BUIA 2GJGA 3SO3A 1C1SA 1JMOH 4K2YA 2ZGXH 3DCLA 3UNQA 2IPQX 2WINI 1GMDG 1C1TA 2J92A 3SV6A 1UTLM 2CHAB 1IQHA 1Z6EA 1TRYA 2FM2A 1LVOA 1GBLA 3SGBE 1A0LA 4JK5A 5EIYA 3TH4H 1MD7A 1MUEB 1C5WB 4AOQA 4K69A 1A3BH 2I6QA 3FANA 2A1DB 1FV9A 3SUEA 2XWAA 3F2FA 1C2MA 4IW4E 4Q7XA 1V2VT 4Y11E 1Z1IA 2BZAA 4WJG2 2J97A 1O2HA 1C5MD 5C1YA 2BQWB 8LPRA 3M3SA 3VG8A 3RMOH 2R2WU 4FUBA 4K3JA 4YOIA 4ABJA 5PTPA 3GCOA 3N99A 2FO9A 1ZMLA 2EI8A 3SOSA 2GT8A 1AVWA 3NRLA 3FKSD 3PRDA 1O3GA 1GI1A 1D6RA 1UMAH 2FLRH 1JOUB 1BCUH 4VGCB 3SN8A 2OLGA 1UVSH 3BG8A 5AF9H 4IC6A 4NA9H 1YLNA 4IN2A 3TJVA 3SYJA 2WPKS 1TABE 3LH3A 1H1BA 1O0DH 1EB2A 4X6OA 3RDZA 5CDFE 4UFDH 5HIZA 2P8OC 4X8TH 1GBDA 2KFWA 1AY6H 1O31A 3I77A 1O3CA 1A4WH 2Y5FA 1WQVH 3H7TA 4K8BA 5FX5A 3RU4E 1CBWB 1ZMJA 3RLYH 2Z9GA 1OWDA 2BDHA 1EPTA 2G55A 2EC9H 3CENA 2C8ZB 4LOYH 2Z94A 4FOUC 5I46H 2SFAA 3LGYA 1NROH 2OC1A 1K22H 1LQEA 1BDAA 2BDCA 2C90B 1SC8U 6LPRA 1XX9A 4E05H 1GI5A 3BN9A 1DXWA 1W11U 1O2SA 1SI5H 3Q76A 2OD3B 2TGAA 4NIXA 1SPJA 1PQ8A 1OHHD 1SQAA 2QXIA 5KECA 2OC7A 1EPTC 1TGCA 2ANYA 4Q7YA 3C1KA 2GV6A 3RXCA 4XDEA 1V2TT 3MI4A 1EZXC 2ZQ2A 5JBBS 4I8JA 1XUIA 1YPLH 2K1QA 4QT8C 1DY8A 1FUJA 4YLQH 3TNTA 3LGWA 1SLVB 2Y7XA 1GMHG 2PKAA 2RCEA 3E3TA 1THRH 2J95A 5JBTA 2J9NA 1C1WH 2C8XB 3FZZA 3GY2A 3M5OA 1GBKA 5FCKA 5A0CA 1L4DA 4ZAEA 4MPVA 1SL3A 1G3DA 1GCTC 1TFXA 1ORFA 4IS5A 1O2UA 1KXBA 4ZKRU 4IBLH 5EOKA 1FMGA 2A32A 3D49H 1GJ4H 4XBBA 1TNLA 4Y7BA 3O8DA 1SLWB 1C1PA 2JH6D 3ELAH 4IN1A 4AYVB 3V13A 4X2WA 1JRTA 1XUKA 2QAAA 5C67A 2FOCA 4Y79A 5T6GA 2XC5A 1CHGA 1V2WT 2Z3DA 4U01A 4Z6AH 2J5UA 1EJAA 1MAYA 3BEIB 5SGAE 3T28A 1O2RA 1V3XA 2RA0A 3Q3YA 1CO7E 1C1VH 4U2WA 2SGFE 1V2KT 1YLCA 5F8ZA 1PQAA 1Q3XA 3MU8A 3RC4A 3TJUA 3T25A 1ANBA 2W6JD 5E0HA 1SGEE 2XBYA 3DFLA 4X1SU 1VGCB 4TPIZ 2HWLB 2AGIX 1Y3WA 3KEEA 3W94A 2BY9X 3QN7A 1ZPBA 1ZTKA 2KR7A 1BMNH 4JZDH 3RM2H 2AMPA 4RKOB 1TPOA 1ABJH 1TNKA 2A5AA 4OS1A 3HATH 2ZGHA 1QTFA 2A0QB 1XUJA 3SW2B 1VR1H 4RN6A 5HIYA 2XOKD 5AVDA 1YPGH 4GPGA 2BOKA 4OS7A 3P70B 1P04A 1FNIA 3SNBA 1RD3B 1H9IE 2GCTC 1HAOH 2ZHEH 3LGIA 4B2BA 2BX3A 2ZFQH 4HZHA 1G2LA 1BA8B 1S81A 4UFFH 2V3MA 1MZAA 1TRMA 3SU5A 1WTHD 4E7NA 1HAXB 1RFNA 4O9VA 1P2IA 4UD9H 1SGFA 4BTIB 3K2UA 5E0GA 4TWYA 1SHHB 2VVCA 3TK5A 2BLOA 1NU7B 3R3GB 4FUIA 1ZPZA 1K1MA 4X1QU 5F03A 3M36A 3V7TA 3SJKA 2STAE 5L2ZH 1AB9B 1ABIH 2AGGX 4Y8YA 1V2OT 2BTCE 4JYUH 3S9AA 3HGPA 1GI6A 3UR6A 3RMLH 3VFEA 5F8TA 2O8LA 1HDTH 1QY6A 3KIDU 2Y82A 3P6ZB 1F5RA 1V2PT 1P8VC 2AH4X 2BMGB 1DY9A 3FAOA 3PO1C 1QR3E 1TB6H 3A87A 2LP6A 1C4V2 3F2HA 4CH8B 1DOJA 1Z71A 1GI0A 4Z1MD 3EGKH 3QDZB 1SFIA 4FXGH 2ZCHP 4YT7H 1SGFG 3MH5A 1NT1A 1Q31A 2GMTC 4ZUHA 2KAIA 4DIIH 3B9FH 2FS9A 1BB0B 1FZZA 4XFQA 2W7UA 6CHAB 3U69H 1BRBE 1HAIH 3RXPA 1YYY1 3HGNA 1DANH 2PLXA 3UFAA 1GVZA 2FS8A 1KLIH 1BIOA 2K8IA 1OOKB 3E90B 4F48B 1GL0E 2J34A 5F8XA 1IQFA 1GHAG 2A7JA 2SNWA 4XSKU 3EA9A 3MOCA 1MTSA 2CXVA 2VH0A 1TBQH 1XM1A 2TGDA 3SJ8A 3E1XB 2OUAA 3RXMA 3LPRA 1BMAA 5C94A 4DCDA 2BVRH 2AGEX 2VIDA 1O3IA 1XVOA 3GY3A 2H5CA 2BD7A 2YOLA 1BOQA 1DLKB 1L4ZA 1NY22 2GZ8A 2HVYB 2JJ1D 1AI8H 1IQNA 3UOPA 1YY3A 1A1RA 3UNRA 3QX5H 2ZHDA 1PPCE 2H9HA 4LZ4B 2OXSA 5DJ7A 4HGCA 1SGRE 1O5DH 1CGJE 1DXPA 1EZQA 2J94A 2FOGA 1D3TB 1TOMH 4DW2U 3KQDA 4IGDA 2H2ZA 5DP9A 1OP8A 4BTUB 2PGQB 5FBEA 3BIVH 4GCHG 1W2KH 2LPRA 1GGDB 2B0FA 1O2IA 4BAOB 2GTBA 1VKYA 3W95A 1JWTA 1RTFB 3KQEA 4PROA 5HM9A 1G2MA 1S6HA 2XYAA 2BDAA 4ZH8A 3A7TA 2D8WA 1WQSA 7KMEH 4WVPE 1W14U 1UK3A 3CP7A 1O3FA 3SU6A 4U32A 4ASUD 2BLQA 1F5KU 1VZQH 1NPMA 1U6QA 2AFQB 3U1JB 1IQGA 1W10U 2QYIA 3D62A 4MDSA 1UHBB 1W0KD 3BG4B 1ELAA 1DPOA 2A31A 2L74A 1FJSA 1SQOA 1A0HB 1E1QD 2FI3E 4UDWH 5JPMH 3T2NA 1T8OA 1D3QB 3ATMA 1X7AC 4X0WU 3CS0A 1MZDA 1T31A 3L6PA 3VEQB 1V6DA 4NFFA 1ZTLA 1MTNB 3L3TA 4Q63A 4A1VA 2IJD1 3SV7A 1MD8A 1QURH 4WWYA 1N8OB 1ZHRA 2VJ1A 2Z3EA 5EPYA 5IK2D 2ZFTA 3KN2A 4IMQA 2Z9KA 1WAYB 1YLDA 3SI4H 2A5IA 2G81E 2Y80A 1Y3YA 5KGOA 1PPGE 2GDDA 1BTHH 1YPMH 2Y6TA 3F9GA 3I78A 4JMYA 3ZVFA 4DT4A 1YC0A 3ZVDA 1F0UA 4KGAA 1IQIA 2XCNA 3F6UH 3BV9B 3OYPA 2FODA
chains in the Genus database with same CATH topology
1K1IA 1HBTH 4A6LA 3AASA 3LGUA 2KAIB 3SORA 2AEIH 1TGNA 4ABGA 1NC6A 1FPCH 3VB7A 3ESTA 5GXPA 5FX6A 2B9LA 2BLWA 1AWFH 4ABIA 1TQ0B 2VGCB 2STBE 2BQ6B 2EI7A 2WPMS 2IPHA 1SBWA 4GHQA 1UTJA 4NWKA 1UVTH 1HIAA 2JH0D 2BOHB 1GHAF 1QA7A 1AUTC 3DUXH 1F5LA 4FU8A 1TNHA 5TCAA 2AYWA 2CHAC 4A92A 3Q3KA 2VWLA 1HJ9A 2ZFRH 1TOCB 3G01A 1A7SA 1T8NA 1CT0E 1HAYB 2CN0H 2J4IA 2WYGA 3A8CA 3E16B 4DY7B 1HAPH 4CREA 1OWKA 1LHCH 1GBMA 3B8JA 4GLYA 2TBSA 5EG4A 3GY5A 1EXFA 1C2FA 3A84A 3A8AA 3PV4A 3U98H 1NFXA 4H6TA 1C1NA 3UPEA 1EAUA 1J14A 5T6FA 1SGDE 4R8TB 3RXJA 1BT7A 4NCYA 2FMJA 2ODYB 3RU4D 1ZZZA 3AAVA 4FUFA 1TLDA 3VB3A 2BD5A 5A0BA 1QJ7B 3GICB 1ARBA 4GCHF 1P3CA 1P05A 1INCA 4ISNA 1KSNA 5TCCA 3ZV8A 2FP7B 5C3NA 1W12U 3VXFH 1TBRH 4VGCC 1C5OH 3LIWA 3ZZDA 4OGXA 2WPLS 1LPKB 1BTPA 1SMFE 2VWNA 4I8LA 2V3HH 3S7KB 3EYDA 3O8CA 3WY8A 1Z1JA 4OS5A 3ZZ5A 4BXSA 1E0FD 1ZSJA 2PTCE 3PMJA 1B7XB 5GCHG 1FDPA 2GP9B 1MQ6A 1SLXB 1NESE 1YPJH 4TWWA 1BHXB 4Y76A 2F9UA 1QQ4A 4AZ2B 1KXDA 3PROA 1BBRE 1CBWC 1QCPA 3RXSA 1Y8TA 3PLKA 3ZVBA 1GI2A 1LVYA 1E36B 4FU9A 1IQLA 2ODQA 1MTUA 2FTMA 5I25A 1GBJA 1H8DH 2ZU3A 1ACBE 3PMBB 2I6SA 3M3VA 4I7YH 2UWPA 1UVOA 2ZDVH 1QL9A 1QB9A 1D9IA 1O30A 3MU5A 1O5AB 4MPWA 3F9EA 4NSVA 1DITH 3URCA 1ELEE 3GY4A 2CV3A 4X6MA 3SHCH 1O2KA 1RRKA 4UEHH 4B2CA 1W7XH 1C1OA 2FIRH 1HAHH 2WPIS 4H42U 4A7IB 1NFWA 1PQ5A 5C1XA 3OU0A 3UR9A 1FXYA 2CMYA 5K7RA 2RDLA 1GI7B 1G3BA 3RXAA 4BOHA 1ZLRA 1GBHA 2G5NA 1OWHA 1SLUB 1YBWA 2XC0A 1K21H 2QN5T 2XBWA 1ELBA 1N1LA 2XCFA 2P16A 3BTHE 1TMTH 3SUDA 5DP6A 1HUTH 1BHXF 1D4PB 4FUDA 1MBMA 2BQ7B 4KELA 1ZHPA 3M37A 2QV1A 3S7HB 2G5VA 3RXBA 1HIAB 2WPJS 1GBCA 1PPFE 4KTUA 3SQHE 1QL8A 1KXFA 1GI9B 5CHAB 1TX6A 1Z8RA 2P94A 4YTAA 2F3CE 1C2GA 1FN8A 1G37A 4XOJA 5J4QA 3VB4A 3VGCB 3RXEA 4FUCA 4HFPB 5GIBA 1AN1E 1WUNH 2ANMH 1O3EA 2P3TB 4X2VA 5CE1A 1P2NA 1NU9A 2HRVA 3ZZ7A 1AZZA 1HJAB 2BY7X 5AHGH 4WY3A 1GJ5H 2FTLE 3SNEA 1VGCC 1UK4A 3LOXA 2F9NA 1O3PB 2R0LA 1QA0A 1FY8E 3U1IB 1GBFA 2BDGA 2OTVA 3GYMA 4KP0A 5ABWA 1H9HE 4X8UH 3QZQA 1BRUP 1L2EA 2ZGCA 1AE5A 1ARCA 1HAGE 2HVXA 4MPXA 4LK4A 2ZFSA 1E37B 3T5FH 1NN6A 1C5QA 1DVAH 2A4GA 2NU4E 3AAUA 4CRGA 3SNDA 1N6YA 1AFQB 1C4Y2 1ZR0A 3A8BA 2PR3A 1OWIA 1A5HA 2P59A 4GVUA 1Y5UT 2QXHA 1O2YA 3MU0A 2QXGA 4YLUA 1CQQA 2SGQE 1SGTA 4NSYA 4DURA 3A80A 1BRAA 1VCQA 1O2ZA 1LHDH 3F1SB 2VIWA 2FOEA 1G3EA 4FUJA 3A7XA 5GCHF 1PPBH 2A2XH 1KLTA 1V2QT 3SU4A 1MMJN 3F9FA 4ZMAH 4D7GA 1TMBH 4FVDA 1C1RA 5JBAS 7ESTE 3PMAB 1C2IA 2XW9A 1ZSLA 5BPEA 4MNXA 2PUXB 2Q6GA 4I31A 3TLOA 2NU2E 4ZXXH 3S9BA 1OYQA 2V35A 3ZZBA 1O3JA 1ELCA 1YPHC 4R0IA 4DVAU 4X2XA 3ZZ4A 2QF3A 4Y71A 4I8KA 1AB9C 4JK6A 4Q80A 2O8MA 4WMDA 1YCPM 3GCHB 1FPHH 3HK3B 1EP6A 1P57B 1TA6A 2XXLA 3NZIA 3A8DA 1NM6A 2BY6X 2WPHS 2ALPA 3JZ1B 1J17T 1FQ3A 1K1LA 5LPEA 1NRNH 1AMHA 2ZECA 1GDUA 2VVVA 1GMDF 2FPZA 3S9CA 2R0KA 1FN6A 3RU4T 3T27A 3A7VA 3EAJA 1C5RA 3ZYDA 2J38A 3DHKH 1GBBA 3MYWA 1PPEE 2C8WB 4INLA 2O8TA 1UTQA 1QQUA 3ZZCA 6CHAC 1GHXH 2BD4A 5JB8S 3TIUA 4D8NA 3FFGA 1ZOMA 4FVBA 1EKBB 2ZDNA 1FLEE 1WU1A 3P8NA 2PWXA 1WTGH 4MPUA 5IDKA 2WUCA 5A8XA 2PW8H 1O2TA 4I33A 3SV8A 5GJ4B 4NIVA 4MG3A 1ETSH 1GHZA 1Z6JH 1SGYE 3ATKA 1P3EA 1AVGH 4UFEH 1O34A 1HJ8A 1NRRH 4AFQA 2Y5HA 2GCHG 1O2VA 1GI4A 1ZGIA 3PMHB 4XBCA 3KHVA 3TVJB 4CHAB 1YKTA 1QL7A 9ESTA 5EQSA 1AE8H 5HYOA 1V2ST 2F9VA 4O3TA 4TY7A 1TA2A 2V3OH 1HLTH 2BB4A 2ZCLP 1JRSA 1RJXB 3ZZ8A 1PYTC 1O33A 1PJPA 3KGPA 3QGJA 4YESB 4A1TA 2ZHFH 1D6WA 3D23A 3PLPA 3PYHA 4DG4A 1GGDC 1UHBA 3RMMH 2B8OH 4O97A 1C1QA 2ZU4A 1F0RA 1K1NA 1S6FA 2ZP0H 3T29A 3TGJE 1GI3A 3UWIA 4KTCA 1DICA 1O3MA 2FEQH 2P3FH 1GG6B 2QCYA 3MMGA 2GD4B 3VB5A 3SQEE 2B5TB 3QK1A 2PSXA 1FI8A 5FPYA 3DFJA 1B5GH 1C2HA 1CSOE 2XRCA 3P92A 1O2WA 1O2JA 2BYAX 4JCNA 1GJBB 3SV9A 1CT4E 1IQJA 4B2AA 5AFYH 1KDQA 1P12E 1O2NA 1QHRB 5EXLA 2EEKA 3BG4C 4Y7AA 3QZRA 2FOHA 5JB9S 1LTOA 5ETXA 3I29A 3ODDA 1YCPH 3NK8A 5IYTA 1AQ7A 5EU8A 3S69A 4X6PA 3ZYEA 1RIWB 2AMQA 2ZDAH 1C2DA 1CHOG 1DX5M 3TITA 1MTNC 2V6NA 5EW2H 1TPAE 2OC0A 2GZ9A 4BTTB 2W7SA 3O8RA 1AVXA 1N8OC 3Q77A 2BHGA 5E0JA 4AX9H 1GMHF 2DE8A 4MNWA 1UTKA 3VPKA 1S84A 5DG6A 4BNRA 2ESTE 2PKSB 4NZQA 7GCHG 1HXFH 1LPZB 2BX4A 3MTYA 1KXCA 4OS2A 1O2GH 3RXGA 2WUBA 1P0SH 2PSYA 5L2YH 4NA8A 2ZZUH 1ELTA 3L33A 2QIQA 2FX4A 2BXTH 1IQMA 6ESTA 2HGTH 4BXWA 1VJAU 3R0FA 1GHYH 1GJ9B 1E34B 1O3BA 2VWOA 1UTOA 3ZZ9A 5BRRE 2ALVA 1DWEH 3DD2H 1AZ8A 2W3KA 3SNAA 1SGIB 2HNTF 2VGCC 5GWZA 2ZWLH 1BJUA 3TPIZ 2AMDA 1EJNA 1ZGVA 4Y0YE 1V2NT 3NKKA 3UOUA 4AB9A 3LJOA 1FIZA 2CJIA 1DUAA 2A5KA 3RC5A 1SVPA 4AFZA 1F92A 4B1TA 1SGCA 2FYRA 1EP5A 2F91A 1DSTA 3M5MA 3UNSA 3MH6A 1S85A 3BTKE 1V2MT 4MVNA 1TQ7B 2FOBA 4K1SA 3K65B 2H5DA 4K5ZA 1C1MA 4B75A 2R2MB 2W3IA 2Y5GA 4K1EA 1JIRA 1OX1A 4CRAA 1RTKA 1S5SA 1ELVA 1BTZA 1TBZH 3MNSA 2GCHF 4INKA 3A86A 4JZEH 1IQEA 4H6SB 3RXDA 1O2PA 1T8LA 2VIVA 3OY5U 1C2EA 3MH7A 3IWMA 4NIYA 4A5TS 3OX7U 1C5ZB 1UK2A 1VITG 3AVZA 2HLCA 5FXLA 1GHBG 4ZROA 1L1GA 1MU8B 2BVXH 1AWHB 1OP2A 1V2UT 3RM0H 5EGMA 5F6MA 3LONA 3RXUA 4HI3A 1KY9A 1ANDA 2FXRA 4KKDA 1OYTH 2DUCA 1ZRKA 2SGDE 3BTTE 4K8YA 2GZ7A 4GHTA 1KDQB 1TPPA 1MKXH 1LKBA 3DA9B 8GCHG 5C20A 1S83A 2AIQA 4AORA 1Y3VA 3TGIE 2BDYA 2FYQA 3GCNA 4K1TA 1ELGA 2GGVB 5H4IB 2JETB 1TWXB 1P9SA 1NFYA 3ZVAA 1O38A 3M7UA 2ZTYA 1UVPA 2GDEH 2JKHA 3T62A 1TMUH 2V0BA 2Y81A 7LPRA 1CA0B 1O5CB 1TX7A 4AFSA 1ETTH 1TGTA 1K2I1 3PM3A 3P95A 1CHOF 4AYYB 1B0EA 4ZXYH 1TNGA 2ZG0H 1S82A 1GI8B 1NTPA 1XUFA 1ELFA 1P03A 3Q3XA 1EZSC 1W0YH 3FVFB 1W7GH 3F9HA 1FY4A 2Z9LA 1NRPH 1MCVA 1C5XB 3GY7A 2BY8X 7GCHF 4GSOA 1E38B 1OPHB 4JYTA 1SB1H 1O2XA 4NG9H 1M9UA 1PPZA 2DE9A 5L6NH 3RXTA 1VITH 2AIPA 3SU1A 2OBQA 1HYLA 3BSQA 1PFXC 3QWCH 1QJ6B 1CE5A 2BD8A 4FUHA 2ZNKH 1P2QA 2VIQA 1O5BB 1GBTA 4NIWA 4NA7A 3SNCA 1YCPK 3NPSA 1NRQH 3GCTG 3A7YA 2GV7A 5CHAC 4RKJB 1UVUH 2NU3E 2XNIA 1MTWA 4WMFA 1SQTA 1Z7KA 1Z8IB 1LHGH 2TGTA 4O3UA 1EB1H 4K60A 4KTSA 5LH8A 5HXFA 3VGCC 1AUJA 4CRBA 2UUJB 4OS6A 4WH6A 3E0PB 3MO6A 1D3PB 2ZHWH 1S0RA 5HM2A 1P2MA 1O5EH 3M5LA 5EXMA 5JYIA 1FY1A 3BTME 5DGJA 1CGHA 1GBIA 1GPZA 1BMLA 1HJAC 1JXPA 3V12A 3P8OA 5E2PA 1CGIE 4CH2B 4CBNA 3BEFB 2A4RA 4MNVA 1Z8GA 2Z9JA 3MNBA 1O32A 1MAXA 1O2MA 1QB1A 2PUQH 2ILNA 2NU1E 3SU0A 2OINA 1L1NA 1YGCH 2BVSH 2R9PA 2FOAA 2G4TA 1VITF 2W5EA 1GHBF 1GDQA 3H5CB 1MH0A 4WF8A 4NZLA 2R3UA 3KQBA 1O37A 5A8ZA 1O3NA 3TNSA 5FPSA 1AFQC 1H4WA 1LHFH 3PWCA 2IN2A 3K6YA 3MO9A 1VJ9U 2ZC9H 1YM0A 2F83A 1DT2A 1YP9A 2ZF0H 2NU0E 2OP9A 1TX8A 1GJAB 1O3AA 2BD3A 1CU1A 3MHWU 1EJMA 1MU6B 1EAWA 1QGFA 2VWMA 2UUYA 3TGKE 1P2OA 3M5NA 8GCHF 1F2SE 2Y7ZA 1BTUA 1A5GH 3C27B 1J8AA 2THFB 1L1JA 1NZQH 3IG6B 4FUEA 2IJOB 4YOGA 1GJCB 1ETRH 1OP0A 4NGAH 2PHBA 2TGPZ 1IQKA 1HAVB 2D26C 3K6ZA 1ID5H 3E6PH 3RXIA 3E8LA 4XBDA 3M61U 1DSUA 2B7DH 4Y6DA 1ZYOA 2PTNA 1O39A 2FESH 5JBCS 3TH2H 3GCHC 2JH5D 2UWLA 3SJOA 3BIUH 5LGOA 1G9IE 2Z9IA 5DP4A 2ZGBH 3QTVH 4X8SH 2F9BH 4UONA 1HB0B 2O8UA 2J2UA 1LCYA 2ZI2H 1UCYH 1MKXK 1V2LT 1OKXA 1ELDE 1HV7A 5E2OA 2ZPRA 1GJ8B 2A7CA 3P8GA 1YPHE 2ZPSA 4AG1A 1GWAA 1O5GH 3E91A 1RS0A 3MO3A 3QGNB 1QNJA 4CR5A 4AGKA 3HKIB 1P10A 4ZHAA 2AERH 1C5TA 4WMEA 3BTDE 4U30A 4BANB 2ASUB 3GCTF 1XMNB 2GVFA 3RXHA 3ENSB 2O8WA 1GJ7B 2HNTE 2PGBB 5DP3A 5E8EH 1ZRBA 1LDTT 1ZSKA 1JBUH 3P8FA 1OS8A 3NCLA 1HPGA 1MQ5A 1TNIA 2BXUH 4ZKOU 1TPSA 2R3YA 1HNEE 4AG2A 1G30B 2ANWA 4ISOA 1SFQB 3SI3H 5FAHA 1W13U 4CHAC 3UY9A 2LNCA 1LMWB 1FONA 1SG8B 2C93B 3EQ0H 3RXOA 3RXVA 1EAXA 3TK6A 4JZIA 1C5PA 1TE0A 4D76A 2VU8E 1W0ZU 2C4FH 3A88A 5A09A 3ZV9A 3A7ZA 3AW1A 2G52A 3PTNA 1KYNA 2Z7FE 3RXQA 2WV4A 3U8RH 2W26A 1A0JA 4Z0KA 1A5IA 3RLWH 4OS4A 3NUMA 1BITA 3LH1A 3BTWE 4J2YB 4NWLA 1IHTH 1TYNA 2SGPE 3RXRA 1AIXH 1JIMA 1GG6C 1Y3XA 1C2LA 2TPIZ 1MBQA 4JZFH 1KTSB 4GUXA 1MTVA 4OGYA 3DT0H 1BJVA 1EASA 2A4OA 2CF8H 5T6DA 4BAQB 1TRNA 1AD8H 4Q2KA 3MWIU 3PB1E 2QA9E 2ZU2A 1TNJA 1T4VH 2EA3A 1KLJH 1QRXA 1C2JA 1KXEA 2YNBA 1CVWH 3GDUA 4FUGA 1DLEA 1Z8JB 4RSPA 1VCWA 1W3CA 3NWUA 2HNTC 1J9CH 2A4QA 1NFUA 1LO6A 5HGGA 1RIWC 3FP8E 1QBNA 1HGTH 3IITA 4CR9A 4ABBA 1HRTH 1LVBA 2ZPQA 3RXLA 1TAWA 4AB8A 4WXVA