1K1NA

Bovine trypsin-inhibitor complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Factorising ligand affinity: a combined thermodynamic and crystallographic study of trypsin and thrombin inhibition.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords TRYPSIN
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2001-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1k1nA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1k1nA02
3BTTE 2ZGXH 4LOYH 3NWUA 1GGDB 2GZ9A 4IN1A 3ZZ4A 7KMEH 6ESTA 2VIWA 3PWBA 1C5ZB 1FY8E 3SO3A 2OBQA 1P02A 2QAAA 2CF8H 5HGGA 1SLXB 4D7GA 1MKWH 1BUIA 3LH3A 1SFIA 1B7XB 1TNHA 1ELFA 2Z9JA 2ODQA 3SJOA 2OLGA 4AN7A 3SGQE 1GJ8B 2EA3A 3KQCA 7ESTE 2NU4E 4LK4A 2PLXA 4INLA 1O3LA 4K60A 4A5TS 1O31A 3SU6A 1SLUB 1AKSA 3ATIA 1C1NA 1DSTA 1GCTC 3U1IB 1ZJKA 3QLPH 2C90B 2A1DB 2ANKH 1E38B 2J9NA 3PTBA 3V3MA 4K69A 1FY3A 1Z8IB 4WJG2 2ZFSA 3QDZB 3ATWA 1MQ6A 1GHBF 1Y5BT 1AN1E 1UTOA 1O5CB 1K9OE 1FZZA 2HVXA 2SGFE 3NCLA 3VXFH 2FX6A 1LHCH 3QK1A 3LDXH 2BDAA 1GBJA 1DWCH 1O2YA 1KLTA 1O3FA 4UDWH 4Y8ZA 5T6GA 1GI1A 4UFFH 3ZZ5A 2H2ZA 2VJ1A 4AGKA 3UUZA 2WPKS 1JMOH 1C1QA 1XX9A 3GCHB 2P16A 3U69H 2JETC 1V2UT 4K1SA 1DLEA 1ANCA 1C1VH 1DWDH 1GMDF 1LHDH 1GJAB 5FCKA 2QA9E 3UNQA 4MTBA 2EEKA 4DIHH 1PFXC 5LH8A 1OP0A 2PKAA 2UUKB 3R0FA 3U1JB 1TAWA 1LMWB 3TGKE 1Y5AT 3A82A 5DK1A 1C2IA 4WXIA 2G5VA 1J9CH 3OYPA 4INKA 1Z1JA 1YPHC 2CXVA 3MMGA 3RXRA 1UVOA 1D3PB 5I46H 2PSYA 1DOJA 2XXLA 4NGAH 1DY8A 4RN6A 4YO9A 4YT6H 1OSSA 5EU8A 3VB5A 1YPJH 2HPQH 3A7TA 1QFKH 1BTPA 3HKJB 3BTFE 1W12U 2GGVB 4ZHMU 3BG8A 5HM2A 1NFUA 3MU4A 1O38A 1O5EH 5FHTA 3TIUA 2R2WU 1NT1A 1SGDE 1AB9C 2ALPA 4AORA 3A7YA 1EUFA 2QYIA 3SHCH 3GYLB 2ZI2H 2TGDA 2RCEA 3K6YA 3LC5A 1UTNA 2A4RA 1TMTH 2WYJA 1SLWB 2Z94A 1QRWA 2F9NA 2SNVA 1L1GA 1AVXA 1FPCH 1P2KA 1BTZA 2HOBA 1TBRH 3RXVA 1C1UH 4WXVA 1TPOA 1N6XA 4O3TA 2PSXA 5PTPA 3C1KA 1RD3B 4CHAC 1QL8A 1VITH 2H6MA 1LPGB 2H5DA 4RSPA 1BZXE 2ANYA 2H9TH 2QCYA 3V12A 2ZHDA 2PKAB 4YM9A 4GHQA 1C2MA 2SGDE 1FONA 3RXMA 4ABFA 1HRTH 4B2AA 5LPFA 4AGJA 2J38A 3RXTA 1SGPE 5GJ4B 3OX7U 1PQ7A 5EPYA 3DD2H 1QHRB 2VVUA 3T2NA 3V13A 4O97A 4ISLA 1QB1A 2VGCC 4WH8A 1F0UA 2B7DH 3B8JA 4CH2B 2IN2A 1SL3A 1UVTH 2XBYA 2PV9B 1QBVH 1XUHA 3MH4A 4X2VA 1WUNH 1QA0A 1Q31A 1IHSH 2GV7A 1TA2A 4INHA 3VXEH 2J92A 3RXAA 3P8OA 1FPHH 3OTJE 2QXGA 1TBZH 1YKTA 4ABHA 2B0FA 1CBWB 1C1OA 4B74A 2F9PA 4ISIH 4B2CA 1QR3E 3E3TA 3VB6A 2G55A 2G52A 3STJA 2FPZA 1P3CA 3M3TA 1YPLH 1Z71A 3ZVEA 5GWZA 1DM4B 1J16A 5K7RA 3M36A 2C8XB 1S85A 1K22H 2C8YB 5FBEA 5FX6A 3SV7A 4FVDA 4JZFH 1P2MA 1C5MD 1GDNA 2OC1A 3GCNA 2PGQB 4X2WA 2BQ6B 2ASUB 4K8BA 3RLWH 1TQ7B 1HFDA 4X1NU 5DP8A 1P9SA 3SHAH 2JKHA 5GCHF 3EAJA 1G2MA 1V2OT 1EQ9A 1P3EA 3RXHA 3UTUH 2V6NA 3BIUH 1Z8JB 4HTCH 1UTJA 5JB9S 2RDLA 1K1OA 4AOQA 2C8ZB 3EA9A 1XUJA 1KLJH 5HMAA 4MPUA 3LGVA 1O2ZA 1ZSJA 1CO7E 1OYQA 3PLKA 1FMGA 3UWIA 4ABDA 2XBVA 1TGNA 3AASA 1Y3UA 4ASHA 1JXPA 1B0EA 3RXOA 2OQUA 3RXFA 3P8GA 3U8OH 2PTCE 1WTGH 2NWNA 4AYVB 3RXIA 1ELAA 4ZUHA 1ABJH 1AY6H 2FESH 4YTAA 1O2VA 2AEIH 2PUQH 3FZDA 4WY3A 1TYNA 1OXGA 3U8TH 4CRFA 4DVAU 1L1NA 3P70B 4XBBA 1TX7A 4KKDA 2TGPZ 1BTYA 2BLQA 3A8CA 5F8ZA 3TJNA 3V7TA 2XRCA 1AZZA 1SGTA 8KME2 1Y59T 1EJNA 3ZZ9A 1XUGA 5AFYH 1HPGA 3BTME 2FS9A 2FP7B 2C8WB 1H9HE 1F5RA 1YPMH 4Z6AH 1GMHF 3ZVFA 3GCTF 1K1JA 4NA9H 1GJCB 5DG6A 1O2HA 2YNBA 2ZQ2A 1LHFH 1A5GH 3TJOA 1PJPA 3PYHA 4MG3A 1G32B 3DA9B 1KY9A 3VFEA 3SUGA 1KIGH 3H7TA 1Y5UT 4BTUB 4XBDA 4CHAB 1PPFE 2V3HH 2ZHQH 3CS7A 2FDAA 1XUIA 3DFLA 2AYWA 3DT0H 3MWIU 1ABIH 3P8NA 4FUIA 4YLUA 3ZZ8A 2ZPQA 5DP5A 1HAHH 3SU0A 3U98H 4KELA 1SGFA 3PO1C 4GCHG 4JCNA 3TPIZ 2VGCB 1C5RA 2FTMA 4WF8A 1K28D 2ZIQH 3P17H 1X7AC 3U8RH 1UMAH 2O8UA 4CRDA 3R3GB 1V2LT 2CJIA 4IC6A 5A0AE 1IQEA 1CVWH 2G4UA 4I8GA 3E1XB 4PROA 3ZVDA 3D65E 1SBWA 2BD4A 2W5EA 1HAVB 5EQSA 1EX3A 2HNTE 2BDGA 5C5NA 4E7RG 4DGJA 1TOMH 4JZDH 1ANEA 3W95A 1QQUA 1C2EA 4UEHH 1EZXC 1NTPA 1D6RA 2BMGB 1NM6A 1P9UA 3GY2A 2BHGA 1DPOA 2BVXH 5DP3A 1RTLA 2ZO3H 3FZZA 1DE7H 1MZDA 1GWAA 5DKMA 4JMYA 4GPGA 1MCVA 2YOLA 1SLVB 2RG3A 1ZOMA 1O30A 1TNGA 4D8NA 2SGEE 1QRXA 2JH6D 1CQQA 1ZGIA 4CRAA 2FZZA 5E2PA 4I7YH 1SGYE 3TH2H 3SU2A 2QY0B 1RGQA 3AW1A 1S6HA 3BN9A 1SSXA 4K5ZA 1GCTB 5CMXH 2BY5X 3T26A 5T6DA 1TPAE 1E34B 3KIDU 1BDAA 1SHHB 2RA0A 2STBE 1F0TA 5A8ZA 1DY9A 1EZQA 4ISOA 1KDQB 2GV6A 2EI7A 1SHYA 1G3BA 2XC4A 4UFGH 1SGFG 4O9VA 2XC5A 3Q3KA 2F83A 4MNVA 1O3BA 1UTMA 1Q2WA 1NRQH 2A7JA 5C1UA 4YZUA 2EI8A 4GUXA 4AB8A 3GY8A 5K0HA 3O8RA 3M5OA 1S6FA 1KTSB 1DITH 1H9LB 1XMNB 1IOEA 3ZVBA 1WQSA 2CN0H 2ZFPH 4GVUA 3SNCA 3GY5A 1MTNC 4Q2KA 4NWLA 3IITA 3HGNA 1GHZA 4JYUH 2F9UA 3ATMA 1TX6A 1ESBA 1G9IE 3SUEA 4TWYA 3SBKA 4MPXA 3SN8A 1CHOF 4X2XA 5EXLA 3GCHC 3ZZ6A 1L2EA 2AIQA 1O32A 4K1EA 1F7ZA 1OWKA 1D3TB 2AERH 1HNEE 4U01A 1K1LA 2P8OC 2J4IA 1BHXF 3KF2A 4KGAA 3SI4H 3K2UA 1YPKH 3D62A 1WOFA 5EW1H 1O2OA 1BRBE 5JYIA 1QJ1B 1O3HA 2LNCA 4YOGA 3UR9A 4FUGA 1C2FA 3O8DA 8LPRA 4FUDA 1MD8A 1VCPA 2NU2E 2VIOA 4CR5A 3AAVA 1Z1IA 1B0FA 1LDTT 3A84A 4OGYA 3TU7H 5A09A 1MU6B 3OY5U 4Z0KA 2BY6X 3NZIA 1K2I1 1FI8A 3TH4H 1MKXK 1VCQA 2ZDMA 5FPTA 1O2PA 1C1RA 1P2NA 5GXPA 3O8BA 1LPZB 3AW0A 4FU7A 3KHVA 2TBSA 1BT7A 1BJVA 5EQQA 3MU5A 2IJOB 1GI2A 4WMDA 4FU9A 5DP7A 3DFJA 1U6QA 1GJBB 1LCYA 1RIWB 3E90B 3T28A 1S0QA 1SI5H 2ZKSA 3F68H 3MNCA 2ZGHA 1MAXA 3Q3XA 3N7OA 3UOUA 4BOHA 1GMCG 4AFSA 5DJ7A 1L4DA 1T8LA 1EPTC 1XVMA 1VCWA 1EP6A 1TBQH 2CGAA 3AAUA 1AWFH 1K1IA 1UTLM 3BTDE 1H8DH 1DANH 3QWCH 1WQVH 4FXGH 2ZHFH 3P8FA 1OWDA 2BXUH 2Y7ZA 5DP4A 1SGNE 2Z9KA 4X6OA 5JBBS 2HNTF 1KLIH 2VIVA 3M5NA 4I8JA 1O2WA 1W3CA 4UFEH 5F6MA 3K65B 5EGMA 1HAOH 2FI3E 4YT7H 1S5SA 1SVPA 4E06H 3MU1A 2I6SA 4DY7B 3ZZDA 1BBRH 1OWJA 2VNTA 1DFPA 3P6ZB 2OUAA 1AUJA 3PWCA 1GHWH 3ZYDA 3ZV8A 2VVVA 5A2MH 1HDTH 2A5KA 2QV1A 2OXSA 4Y0YE 3ZZBA 5EW2H 2A7HA 3NK8A 4TYDA 1O2LA 2DE9A 1W11U 5EOKA 3SUFA 2BM2A 4OGXA 1C2HA 1GHXH 2Z3CA 3BG4B 3MTYA 3UWJH 1F2SE 2WPHS 1WV7H 1LKBA 3ITIA 1IQNA 1VZQH 1PPEE 1LVBA 1OWIA 1P2OA 2D8WA 1F0RA 1HAYB 3GY4A 2P94A 1QL7A 1TABE 3LPRA 3EYDA 3NUMA 2WPIS 6CHAC 1MTSA 1TGBA 1C5OH 4Q80A 4TPIZ 1TMBH 4B1TA 1CSOE 5AF9H 1Y3YA 1V2TT 3VGCC 5CE1A 3MU0A 2J95A 1QJ7B 1XUFA 3L33A 2JH0D 1GDUA 1MBMA 2FOGA 4ZROA 2D2DA 2QF3A 3K6ZA 1HJAB 2ZDAH 1HB0B 1PYTC 1TPPA 2VWMA 2G00A 3F1SB 1UVUH 1Z8GA 5JBAS 3RDZA 1NU9A 3M5MA 1O3EA 3QZRA 1EPTB 2AH4X 4KP0A 1FQ3A 1CA8B 2GZ7A 1TNKA 5C1XA 2GDDA 3URCA 1IQFA 1G37A 1P03A 3RXJA 5EXNA 3QX5H 2GMTB 3SQEE 2DUCA 2M5TA 1ELGA 1KSNA 1ELBA 1CT4E 1FN6A 1EAXA 1A46H 5E0JA 3CP7A 1GBEA 4BAMB 1S81A 1OKXA 4UONA 3GY3A 2ZU5A 2GCHG 2A32A 2OC0A 1GI4A 4XE4A 1P04A 1T32A 2HALA 4ESTE 2ZDVH 2WPLS 1BBRK 1LVYA 1MD7A 1T8OA 4CBOA 2PKSB 1AVWA 1OYTH 1HJ9A 4MVNA 2VWLA 2GD4B 1HAZB 1V2NT 2FMJA 4MLFB 1GVKB 1GI7B 1P2IA 5F03A 1A7SA 3SJ9A 1TWXB 5HM9A 3BG4C 4BNRA 2H9EH 1BMLA 2D26C 1O35A 3F9EA 4HFPB 4K8YA 2AS9A 3K9XB 3VB4A 1O2IA 2UWPA 4AG1A 1YCPM 2XCFA 1GMHG 1D4PB 1MKXH 1EATA 4BXSA 1TLDA 1SOTA 2TGTA 1NRPH 4E7NA 4CBNA 3EE0B 3TNTA 1B5GH 4TY6A 1J8AA 1TFXA 3NPSA 3UNRA 3GDSA 3A83A 5C3NA 1JOUB 2R3YA 1E35B 3MNXA 3ZVAA 3D23A 1ID5H 2C93B 2UUFB 3SV9A 3TGJE 1NRNH 2H5CA 4D9QA 2Y81A 4A6LA 1BQYA 2FM2A 3CENA 4JK6A 1HXFH 4K3JA 3BV9B 1HJAC 5FXLA 4Y11E 4DG4A 4AG2A 1T7CA 3KL6A 1MTNB 2FS8A 3A7XA 2Y82A 3EDXB 7GCHG 1LHEH 2BDIA 2XBXA 1UVSH 1LHGH 3RXEA 1EB2A 2FYQA 9ESTA 2FOAA 2EI6A 3TK5A 4X2YA 2P95A 1DS2E 4J1YA 4JYTA 2XWBI 2GX4A 2GKVE 2BX3A 2BY8X 5T3HA 2P3TB 1C1TA 1GJ9B 1OOKB 4SGAE 2ZNKH 1GMCF 1FIZA 5E0GA 3RC5A 1NN6A 3A8AA 1WBGB 1VITG 1BIOA 4NZQA 3KNXA 3RXLA 1O36A 1GBBA 1GI3A 2VINA 1THRH 3RU4E 4ISNA 1BTWA 1UTKA 5A8YA 2HNTC 3A85A 1SGCA 1DX5M 1UK4A 1N8OB 1G36A 3DHKH 1AIXH 8GCHG 1BBRE 3NXPA 1O2SA 1SFQB 1PYTD 1YCPK 2PHBA 2BY7X 2FO9A 3LH1A 1BTUA 2XNIA 1QURH 2VIQA 1CGHA 4Y71A 1W2KH 2GCTC 1TE0A 1ORFA 2ZU3A 1E37B 2ANMH 4GHTA 1O5DH 2PW8H 1DDJA 1NFXA 2ZPRA 4GAWA 1NU7B 3SGBE 2A4GA 3WY8A 1TX8A 1IQGA 1HCGA 1MAYA 1MTWA 1O37A 1W14U 1LKAA 2C4FH 2Q6FA 2Z7FE 3RXGA 3SU1A 4DJZB 5HXFA 2PR3A 3QTOH 2VH0A 2BD5A 2UUYA 4X6NA 3QTVH 2ZU2A 1A61H 1A2CH 2SGQE 1CA0B 1EB1H 5BRRE 1QJ6B 2OINA 1C5VA 5IYTA 1W7XH 4AFUA 1INCA 1O3GA 2QXIA 5EQRA 1YCPH 1XXFA 4X8TH 1OX1A 1ZHRA 3HK6B 1E36B 1J14A 1VR1H 1F5LA 3LGTA 3E0PB 4ABAA 4YLQH 2F9OA 3RUOA 3KN2A 2AGEX 1BRAA 5IDKA 2BQ7B 3TITA 1QNJA 1YPHE 4DT7B 4FUEA 2ANWA 2BLVA 1P2JA 2BQWB 4WMEA 1MU8B 2OC7A 4NCYA 3ZZCA 1KXFA 4ZXXH 4B71A 1ELVA 3BTKE 4I8HA 3LT3A 3MNBA 4R8TB 4BTTB 1ETTH 4ABGA 1JIMA 3UR6A 1QL9A 3NKKA 2FEQH 2G8TA 2CMYA 1O5FH 1D9IA 1O2JA 1C1WH 1E0FD 1IQMA 2P8OB 2Z9LA 3CS0A 3SORA 2Y6TA 4AFZA 4H42U 3MHWU 3MH5A 4DURA 2VU8E 2CHAC 3LGYA 1GJ4H 3F6UH 1TNJA 1BMNH 1GBMA 1O3NA 3LONA 2WYGA 4TY7A 1QB9A 5F8TA 3BEIB 1TRMA 2PUXB 5DPAA 1RTKA 7GCHF 5ETXA 4BANB 3D49H 3TVJB 3RU4T 4YOIA 1C5XB 5T6FA 3SJIA 4X8VH 2OC8A 3UOPA 5GPIB 1G3CA 1GI9B 1XKBC 3GDUA 1ELTA 1MCTA 2OTVA 1EAUA 2B8OH 3ZYEA 4DOQA 3UY9A 4WWYA 3E91A 2BDYA 2XBWA 1O3IA 1TGTA 3BEUA 3ESTA 4A1TA 4ABBA 4I33A 1DXPA 3TNSA 2ULLA 2ZC9H 1KTTB 4Q7XA 3PO1B 3SU3A 4X1QU 1L1JA 1HAGE 3TGIE 4HI3A 2I6QA 3TJUA 4CH8B 1EP5A 1O3MA 2UUJB 2H1UA 1H4WA 4CR9A 4UD9H 1AQ7A 1CA0C 1AU8A 1F0SA 3O8CA 1AO5A 1UTPA 4B75A 1AE5A 4TPYA 1PPZA 1AVGH 4I31A 3PM3A 3RC6A 1O34A 1MTVA 1GHVH 3SNEA 1XXDA 1FUJA 1EPTA 4I32A 2ILNA 3MI4A 4BTIB 3GISB 1ETSH 1HYLA 2ZGCA 1Z7KA 4DCDA 3S7HB 4X1PU 1O3JA 3A80A 4IC5A 1W0ZU 1A5IA 1GBFA 2ZDKA 1GBCA 2Y7XA 1O2RA 4D9RA 4Y6DA 1BMMH 1MMJN 1QY6A 1DVAH 1EOLA 4A92A 1V2JT 4K2YA 1RIWC 1D6WA 5C1YA 1SQTA 1ZHPA 3ZVCA 3BSQA 1ZTKA 2A2XH 3ODDA 1TA6A 1GI8B 2HLCA 5LGOA 3SUDA 5J4QA 5DO4H 1T31A 3Q77A 3HK3B 3QGJA 3W94A 1IQJA 3VEQB 1EXFA 5E0HA 2Y5HA 3SV2H 2G5NA 1Z6EA 1C5PA 4I8LA 1LQEA 6CHAB 1FJSA 3M3VA 1WCZA 1AZ8A 1FN8A 3E16B 2UWOA 4B2BA 1AD8H 5J4SA 4Q7YA 1SQAA 1YBWA 4ISHH 2D1JA 3JZ1B 1TIOA 1YF4A 4IGDA 3RXUA 3LGWA 1RFNA 2P3UB 4ZKNU 2A5AA 3RXSA 1LQDB 1PPGE 2FOFA 2VIPA 1AMHA 4XFQA 2ZP0H 3G01A 1Z6JH 3H7OA 2BDBA 1VITF 2ZHEH 4ABJA 2XCNA 5JPMH 5FBIA 1BRCE 1VGCC 1HAPH 1EJAA 1O33A 2B5TB 1ELDE 1EJMA 1FY5A 1C1MA 1H1BA 1S82A 3S7KB 5DP9A 4ZHAA 3B23B 1ZTJA 3MH7A 3UFAA 2Y80A 3L6PA 5A0CA 1PPHE 5FPYA 1C5TA 3RP2A 1YGCH 2V0BA 1LO6A 1DUAA 1HIAA 2V3OH 1ANDA 1N1LA 3QGNB 1KDQA 1BHXB 1LVOA 1NC6A 1H9IE 1V2VT 3KCGH 1V2ST 4FU8A 5E2OA 1OWHA 1TNLA 1YC0A 5AVDA 1Z8RA 4OS4A 1SMFE 4NSYA 1C2GA 2G51A 1P57B 1PPCE 1YPEH 1HV7A 3EA7A 3QZQA 7LPRA 1S83A 3A7WA 5LPEA 2PKSC 3QUMP 2O8LA 4NA7A 3HGPA 2STAE 1C4V2 1H8IH 1A1RA 1UCYE 4NWKA 4O3UA 1OP2A 1GBDA 2VWOA 3FP8E 1UHBB 1ESTA 1EZUC 2OBOA 1P11E 1FIWA 3FANA 3VB7A 1AWHB 1KXBA 1SR5C 4QT8C 3LGIA 1NPMA 2ZPSA 1G3EA 4H4FA 4KTCA 2GDEH 3SU5A 4A7IB 1P10A 1ARBA 1SG8B 5L2YH 1TGCA 1CT2E 1OPHB 2BYAX 3GOVB 3T29A 2THFB 3E8LA 4B73A 4BXWA 1O3PB 3IG6B 4NFEA 3SU4A 2ZWLH 2JH5D 1EOJA 1QBNA 1L4ZA 4YESB 1MTUA 3Q00A 2Y5GA 1GG6B 1IQKA 3A87A 2Z3EA 5FCRA 1MBQA 5G4BA 5HYOA 3PMBB 1PQ5A 3EQ0H 1ELCA 2ZDLA 5JDUB 1V2QT 2BLWA 1RS0A 1AUTC 1UTQA 1S84A 4FUCA 1GI6A 3MNSA 4FVBA 4BAOB 1P8VC 1O3OA 3UREA 5B6OA 2Z6BD 3SNDA 1AFQC 2BTCE 4IBLH 2GCHF 5CHAB 3LJOA 2LPRA 3T25A 3F9FA 1NZQH 2P59A 1D3DB 1V2MT 2TIOA 3MO6A 2O8TA 3KQBA 3M61U 3MU8A 2NU3E 1BB0B 1ANBA 4AFQA 1BTXA 3MO9A 2KAIB 3GY6A 2IPHA 2ODYB 2WUBA 5FAHA 1GI5A 4A1XA 4AZ2B 3GYMA 4LXBH 4JZ1A 1CU1A 3OU0A 5EXMA 1O5AB 1HXEH 3PLBA 3ZVGA 1CHOG 3ATLA 2F9VA 1M9UA 1FAKH 3M5LA 3M3SA 1C5NH 3M7QA 2G81E 4Y0ZE 2OQ5A 1GGDC 1HBTH 2A5IA 1GHAF 1AFEH 4O03A 3PB1E 1QCPA 2BX4A 1C9PA 4LZ1H 2OP9A 1HGTH 2GTBA 1O2NA 4X0WU 2W26A 3A88A 5CHAC 2AMDA 3TLOA 1HAXB 1CGIE 2QXHA 1QQ4A 1WAYB 2FTLE 1IHTH 2BVRH 4U32A 2Z9GA 1AB9B 4H6TA 3STIA 2ZFQH 1VGCB 5I25A 1XVOA 1C2LA 2XC0A 2O9QA 1A3EH 1C4Y2 3KEEA 2BD8A 1V2WT 1JWTA 4ZKSU 4HZHA 2XW9A 1C1SA 3TK9A 1AGJA 1ZSLA 3VGCB 2GZ8A 3RXKA 1NY22 2VWNA 1HIAB 3GCOA 1O2XA 2GT8A 4K1TA 3SJKA 4FUFA 2OCVB 2G4TA 3H5CB 1GL0E 2A4OA 1AE8H 5ESTE 1N6YA 4Y76A 1GPZA 1P2QA 2FX4A 4Y79A 1ZZZA 4KTUA 5BPEA 4H6SB 1SOZA 2WPMS 4A1VA 3U9AH 2GT7A 3DUXH 1TOCB 3S9AA 3RMLH 1ZRBA 3BTHE 3SV8A 5EODA 4UE7H 3RXBA 3FAOA 1O5BB 2F9BH 3SV6A 2ZCLP 1AHTH 4OS6A 1O2GH 4CREA 1GL1A 2FLBH 3URDA 5L2ZH 2ODPA 1MH0A 2PWXA 2ZFFH 2VB0A 2W3IA 2ZCHP 5GCHG 1GHYH 3C27B 2BDHA 1SB1H 1J15A 2A2QH 3I77A 1TPSA 4MPVA 2AMPA 2HWLB 2ZU4A 1GBLA 9LPRA 1S0RA 1NRSH 2EC9H 1FLEE 3M7UA 1O2MA 1IQLA 1C5QA 1DUEA 3PMAB 3T5FH 1KYNA 3UQVA 1TRYA 1QTFA 1BJUA 3PV4A 5JBTA 2GCTB 2ZFTA 3UPEA 1V2PT 2PTNA 2ZECA 3BF6H 2TRMA 4NIXA 5DGJA 2ZCKP 1C5LH 1C5YB 1O3KA 1WSSH 3MO3A 1ZMLA 1W7GH 3LIWA 4GLYA 1TMUH 1Y8TA 3BTGE 1O5GH 2HPPH 1J17T 1KXCA 4X6PA 1DWEH 5C2ZA 2W3KA 3V0XA 2ZTXA 3VPKA 1NO9H 2PGBB 5TCAA 3TJVA 1GDQA 3M35A 4I8KA 2F3CE 4ZKRU 3ZZ3A 2A4QA 1C1PA 1G30B 3I78A 1GVZA 2OD3B 1SGQE 2Z3DA 3TK6A 1O3DA 1WTHD 3SNBA 3T62A 3P95A 4WH6A 2ZHWH 2Q6GA 4YOJA 4JZEH 2J94A 1XKAC 3RM2H 4JZIA 4Q7ZA 4BAKB 3BEFB 2BDCA 1GI0A 1QB6A 4RKJB 2DE8A 2O8WA 1LTOA 1C4U2 1SGIB 1A0LA 2YNAA 4WVPE 3F9GA 2A45B 1TNIA 5GDSH 1Q3XA 1ZTLA 2CHAB 1T8NA 4RKOB 3A8BA 4Y7BA 1ZMNA 4X1SU 4AB9A 1YYY1 2FOMB 1XUKA 1W0YH 2ZG0H 3F9HA 3BTQE 1K1PA 1YP9A 2KAIA 3OY6U 4FUJA 1ESAA 4B76A 1A4WH 1YLCA 1P0SH 1HAIH 3KQEA 3AVZA 5C5OA 1GHAG 1JBUH 1ZHMA 1T8MA 2WV5A 1GG6C 2NU1E 1C9TA 4GSOA 4MNWA 1OWEA 1DSUA 4NIWA 4NZLA 4JK5A 4IW4E 3GY7A 5L30H 5F8XA 3SOSA 3UQOA 1ACBE 2ZA5A 4TWWA 3MOCA 4IN2A 2BD7A 1K1NA 4ZAEA 2A7CA 2FODA 4AYYB 1QA7A 4MDSA 1SPJA 3PMHB 2K1QA 5A0BA 1HJ8A 5TCCA 2BZ6H 3ATKA 1EZSC 1FV9A 2ZDNA 3RC4A 3M7TA 3IWMA 1GVLA 1IQHA 2ZF0H 4MNXA 2FOCA 1QRZA 2R0LA 5ABWA 1CHGA 1ZMJA 1UK2A 3VB3A 1O3AA 1QIXB 2PFEA 2Y5FA 2F91A 1GCDA 1VJAU 4MNYA 1UO6A 4X8UH 3SI3H 1O3CA 4X6MA 3LOXA 1YLDA 3S0NA 3RXCA 2ZTYA 2VH6A 3PLPA 1A3BH 5EG4A 1FAXA 3BTWE 3LU9B 4AX9H 1CT0E 4U30A 1AKSB 1PQ8A 1FY1A 2BOKA 3RLYH 1CE5A 1G2LA 1KXEA 1V2KT 2ZFRH 1GHBG 1HLTH 2ESTE 1QBOA 3QO6A 1DT2A 4NA8A 2ZQ1A 3GCTG 4Y7AA 3RU4D 1JRTA 1RTFB 3KGPA 1BCUH 1CBWC 3HKIB 4ABEA 2ZZUH 4CRGA 2BVSH 4NFFA 1ZPBA 1OS8A 3BTEE 4HGCA 1V3XA 2R2MB 3S69A 4X1RU 4Y8YA 1C5WB 2BD2A 2ZU1A 3S9CA 4ZH8A 2FYRA 3HATH 4ZKOU 2BY9X 2BOHB 5TJXA 4IMQA 2GP9B 2FI4E 1A0HB 4VGCC 1OP8A 3HPTB 4NIYA 5LPRA 2AGGX 3Q76A 4XSKU 1KXAA 2BZAA 1XM1A 2FWWA 1P09A 1BTHH 1Y3VA 5A8XA 2CF9H 1DXWA 1TGSZ 1BA8B 3LC3A 1L0ZA 4OS5A 1MUEB 1O2TA 6GCHF 4U2WA 3A8DA 4VGCB 3GDVA 1IQIA 5EPNA 3ZZ7A 1C2JA 2V35A 3QN7A 1TONA 2RA3A 2SNWA 4JYVH 2IOTA 3ENSB 2A0QB 2TPIZ 3ZV9A 2BLOA 2Z9IA 1JRSA 1DWBH 1AFQB 2J2UA 3SNAA 2JETB 2VIDA 2FOHA 1NRRH 5C67A 1HUTH 1THSH 1T4VH 2GMTC 5H4IB 2B9LA 4OS7A 1O2QA 1HAVA 2XWAA 2QN5T 1O39A 3Q3YA 4ZMAH 4FUBA 1WU1A 2W7SA 2BB4A 1IAUA 1P05A 1EAIA 1GJ7B 1Y3XA 2J34A 2ALVA 3A7VA 3RMNH 1P12E 4F4OC 4CRBA 1C5SA 3UNSA 2HRVA 1SC8U 1RXPA 1SQOA 4OS1A 2A31A 1A5HA 1MKWK 3RXQA 5GIBA 4MQAA 1YPGH 1ELEE 1BITA 2R3UA 1ZRKA 3FVFB 1UK3A 1ZJDA 3GICB 6GCHG 4NSVA 1NFWA 2FIRH 1QGFA 2FXRA 3SQHE 3JZ2B 4NG9H 1SGEE 1ZPZA 5AFZH 1T4UH 4NIVA 3RMMH 4F49A 4XDEA 1G3DA 1N8OC 3FP6E 3MH6A 4R0IA 2Q6DA 5FX5A 3LKWA 1V6DA 1A0JA 3L3TA 2UWLA 5JB8S 3P92A 2H9HA 3FFGA 1ZPCA 4SGBE 2ZGJA 4DIIH 2R9PA 1RJXB 2AGIX 4OS2A 2AFQB 4FUHA 1GJ6A 3OSYA 1THPB 4M7GA 2CV3A 5DP6A 2ZTZA 2WINI 1NROH 4Y10E 1FDPA 2TGAA 2QIQA 1LPKB 1EKBB 1C2DA 2XTTB 1NESE 3A7ZA 3EA8A 3UIRA 1FNIA 1LVMA 2P3FH 2O8MA 5ESBA 1JIRA 2C3SA 3SGAE 1ZR0A 2GVFA 4D76A 2W7UA 1ZSKA 5JBCS 1O2UA 4IS5A 4XBCA 5FPSA 3PROA 2FOEA 3M37A 1DICA 1FY4A 5L6NH 1P01A 1RRKA 2SGPE 2HGTH 1WYKA 1BRUP 3SZNA 3RMOH 1NS3A 5C20A 3MYWA 3E0NB 3PMJA 3BIVH 1D3QB 2FLRH 1GBTA 3TH3H 1PQAA 1AI8H 3LJJA 1GBAA 4BAHB 3T27A 4LZ4B 4Y8XA 1NFYA 3A86A 2Q1JA 2QF0A 1TB6H 4ZHLU 1YM0A 4BAQB 1EASA 2SGAA 4IMZA 1GBIA 1TQ0B 2QGRA 4ABIA 1K1MA 3EGKH 1GMDG 4UFDH 3I29A 4XOJA 2BD3A 5AHGH 1UCYH 3ZZAA 3S9BA 1ZGVA 3PTNA 1BMAA 2AIPA 1MZAA 4X8SH 4WMFA 5E8EH 2QC2A 1KXDA 1PPBH 2WPJS 2NU0E 1ZYOA 1UJ1A 3ODFA 5SGAE 1ZLRA 3LGUA 2VVCA 3ELAH 1W10U 3MFJA 1EAWA 2ZEBA 8ESTE 2BXTH 3E6PH 1O0DH 2SFAA 1F5KU 8GCHF 1TALA 2XYAA 2BD9A 4D7FA 3RM0H 1UHBA 3RXDA 1W8BH 1GBKA 1GJ5H 4MPWA 1Y3WA 1GJDB 3A81A 1UVPA 1C2KA 4ZXYH 4CRCA 1C5UA 1BOQA 1GBHA 1V2RT 1UCYK 1K21H 1W13U 6LPRA 4DW2U 3KQDA 4E05H 1ARCA 1DLKB 1MQ5A 1F92A 3A89A 3FP7E 4KTSA 2WUCA 4GCHF 3SJ8A 1P06A 2R0KA 2QXJA 1O2KA 2ZGBH 3SW2B 2P93A 4J2YB 1FXYA 1ETRH 4THNH 2AMQA 2FOBA 1TRNA 2WV4A 1VJ9U 3RXPA 1CGJE 2FI5E 3B9FH 1SGRE
chains in the Genus database with same CATH superfamily
3BTTE 1FX0B 2ZGXH 4LOYH 3NWUA 1GGDB 2GZ9A 4IN1A 3ZZ4A 7KMEH 6ESTA 2VIWA 3PWBA 1C5ZB 1FY8E 3SO3A 2OBQA 1P02A 2QAAA 2CF8H 5HGGA 1SLXB 4D7GA 1MKWH 1BUIA 3LH3A 1SFIA 1B7XB 1TNHA 1ELFA 2Z9JA 2ODQA 3SJOA 2OLGA 4AN7A 3SGQE 1GJ8B 2EA3A 3KQCA 3OFND 5KGOA 7ESTE 2NU4E 4LK4A 2PLXA 4INLA 1O3LA 4K60A 4A5TS 1O31A 3SU6A 1SLUB 1AKSA 2J97A 3ATIA 1C1NA 1DSTA 1GCTC 3SZEA 3U1IB 1ZJKA 3QLPH 3KQ5A 2C90B 2A1DB 2ANKH 1E38B 2J9NA 3PTBA 3V3MA 4K69A 1FY3A 1Z8IB 4WJG2 2ZFSA 3QDZB 3ATWA 1MQ6A 1GHBF 3MQKC 1Y5BT 1AN1E 1UTOA 1O5CB 2KR7A 1K9OE 1FZZA 2SGFE 2HVXA 3NCLA 3VXFH 2FX6A 1LHCH 3QK1A 3LDXH 2BDAA 1GBJA 1DWCH 1O2YA 1KLTA 1O3FA 4UDWH 4Y8ZA 5T6GA 1GI1A 4UFFH 3ZZ5A 2H2ZA 2VJ1A 4AGKA 3UUZA 2WPKS 1JMOH 1C1QA 1XX9A 3GCHB 2P16A 3U69H 2JETC 1V2UT 4K1SA 1DLEA 1ANCA 1C1VH 1DWDH 1GMDF 1LHDH 1GJAB 2WV9A 5FCKA 2WPDD 3KYGA 2QA9E 3UNQA 4MTBA 2EEKA 4DIHH 1PFXC 5LH8A 1OP0A 2PKAA 2UUKB 3R0FA 3U1JB 1TAWA 4RT1A 4TT3D 1LMWB 3TGKE 1Y5AT 3A82A 5DK1A 1C2IA 4WXIA 5HIZA 2G5VA 1J9CH 3OYPA 4INKA 1Z1JA 1YPHC 2CXVA 3DCLA 3MMGA 3RXRA 1UVOA 1D3PB 5I46H 2PSYA 1DOJA 2XXLA 4NGAH 1DY8A 4RN6A 4YO9A 4YT6H 1OSSA 2KCPA 5EU8A 3VB5A 1YPJH 2HPQH 3A7TA 3VG8A 1QFKH 1BTPA 3HKJB 3BTFE 1W12U 2GGVB 4ZHMU 3BG8A 5HM2A 1NFUA 3MU4A 1O38A 1O5EH 5FHTA 3TIUA 2R2WU 1NT1A 1SGDE 1AB9C 2ALPA 4AORA 3A7YA 1EUFA 2QYIA 3SHCH 3GYLB 2ZI2H 2TGDA 2RCEA 3K6YA 3LC5A 1UTNA 4Q4LA 2A4RA 3PV2A 1TMTH 2WYJA 1SLWB 2Z94A 1QRWA 2F9NA 2SNVA 1L1GA 1AVXA 1FPCH 1P2KA 1BTZA 2HOBA 1TBRH 3RXVA 1C1UH 4WXVA 1TPOA 1N6XA 4O3TA 2PSXA 5PTPA 3C1KA 1RD3B 4CHAC 1QL8A 1VITH 2H6MA 1LPGB 2H5DA 4RSPA 1BZXE 2ANYA 2H9TH 2QCYA 3V12A 2ZHDA 2PKAB 4YM9A 4GHQA 1C2MA 2SGDE 1FONA 3RXMA 4ABFA 1HRTH 4B2AA 5LPFA 4AGJA 2J38A 3RXTA 1SGPE 5GJ4B 3OX7U 3ZIAD 1PQ7A 5EPYA 3DD2H 1QHRB 2VVUA 3T2NA 3V13A 4O97A 4ISLA 1QB1A 2VGCC 1SQRA 4WH8A 1F0UA 2B7DH 3B8JA 4CH2B 2IN2A 1SL3A 1UVTH 2XBYA 2PV9B 2J98A 1QBVH 1XUHA 3MH4A 1WUNH 1QA0A 1Q31A 1IHSH 2GV7A 1TA2A 4INHA 4X2VA 3VXEH 2J92A 3RXAA 3P8OA 1FPHH 3OTJE 2QXGA 1TBZH 1YKTA 2YMSD 4ABHA 2B0FA 1CBWB 1C1OA 4B74A 2F9PA 4ISIH 4B2CA 1QR3E 3E3TA 3VB6A 2G55A 2G52A 3STJA 2FPZA 1P3CA 3M3TA 5C0UA 1YPLH 1Z71A 3ZVEA 5GWZA 1DM4B 2GJGA 1J16A 5K7RA 2KZ4A 3M36A 2C8XB 1S85A 1K22H 2C8YB 5FBEA 5FX6A 3SV7A 4FVDA 4JZFH 1P2MA 1C5MD 1GDNA 2OC1A 3GCNA 2PGQB 4X2WA 2BQ6B 2ASUB 4K8BA 3RLWH 1TQ7B 1HFDA 4X1NU 5DP8A 1P9SA 2L6OA 3SHAH 2JKHA 5GCHF 3EAJA 1G2MA 1V2OT 1EQ9A 1P3EA 3RXHA 3UTUH 2V6NA 3BIUH 1Z8JB 4HTCH 1UTJA 5JB9S 2RDLA 1K1OA 4AOQA 2C8ZB 3EA9A 1XUJA 1KLJH 5HMAA 4MPUA 3LGVA 5EIYA 1O2ZA 1ZSJA 1CO7E 1OYQA 1W0JD 3PLKA 1FMGA 3UWIA 4ABDA 2XBVA 1TGNA 3AASA 1Y3UA 4ASHA 1JXPA 1B0EA 3RXOA 2OQUA 3RXFA 3P8GA 3U8OH 3KYFA 2PTCE 1WTGH 2NWNA 4AYVB 3RXIA 1ELAA 4ZUHA 1ABJH 1AY6H 2FESH 4YTAA 1O2VA 2AEIH 2PUQH 3FZDA 4WY3A 1TYNA 1OXGA 2JJ1D 3U8TH 4CRFA 4DVAU 1L1NA 3P70B 4XBBA 1TX7A 4KKDA 2TGPZ 1BTYA 2BLQA 3A8CA 5F8ZA 3TJNA 3V7TA 2XRCA 1AZZA 1SGTA 8KME2 1Y59T 1EJNA 3ZZ9A 1XUGA 5AFYH 1HPGA 3BTME 3F2HA 2FS9A 2FP7B 2C8WB 1H9HE 1F5RA 1YPMH 4Z6AH 1GMHF 3ZVFA 3GCTF 1K1JA 4NA9H 1GJCB 5DG6A 1O2HA 2YNBA 2ZQ2A 1LHFH 1A5GH 3TJOA 1PJPA 3PYHA 4MG3A 1G32B 3DA9B 1KY9A 3VFEA 3SUGA 4P02A 1KIGH 4ASUD 3H7TA 1Y5UT 4BTUB 4XBDA 1WXRA 5DN6D 4CHAB 1PPFE 2V3HH 2ZHQH 3CS7A 2FDAA 1XUIA 3DFLA 2AYWA 3DT0H 3MWIU 1ABIH 3P8NA 4FUIA 4YLUA 3ZZ8A 2ZPQA 5DP5A 1HAHH 3SU0A 3U98H 4KELA 1SGFA 3PO1C 4GCHG 4JCNA 3TPIZ 2VGCB 1C5RA 2FTMA 4WF8A 3U28C 1K28D 2ZIQH 3P17H 1X7AC 3U8RH 1UMAH 2O8UA 4CRDA 3R3GB 1V2LT 2CJIA 4IC6A 5A0AE 1IQEA 1CVWH 2G4UA 4I8GA 3E1XB 4PROA 3ZVDA 3D65E 1SBWA 2BD4A 2JDID 2W5EA 1HAVB 5EQSA 3WWBA 1EX3A 2HNTE 2BDGA 5C5NA 4E7RG 4DGJA 1TOMH 4JZDH 1ANEA 3W95A 1QQUA 1C2EA 4UEHH 1EZXC 1NTPA 1D6RA 2BMGB 1NM6A 1P9UA 3GY2A 2BHGA 1DPOA 2BVXH 5DP3A 1RTLA 2ZO3H 3FZZA 1DE7H 1MZDA 1GWAA 5DKMA 4JMYA 4GPGA 2CK3D 1MCVA 2YOLA 1SLVB 2RG3A 1ZOMA 1O30A 1TNGA 4D8NA 2SGEE 1QRXA 2JH6D 1CQQA 1ZGIA 2W6ID 2FZZA 5E2PA 4CRAA 4I7YH 1SGYE 3TH2H 3SU2A 2QY0B 4F55A 1RGQA 3AW1A 1S6HA 3BN9A 1SSXA 4K5ZA 1GCTB 5CMXH 2BY5X 3T26A 5T6DA 1TPAE 1E34B 3KIDU 1BDAA 1SHHB 2RA0A 2STBE 1F0TA 5A8ZA 1DY9A 1EZQA 4ISOA 1KDQB 2GV6A 2EI7A 1SHYA 1G3BA 2XC4A 4UFGH 1SGFG 4O9VA 2XC5A 3Q3KA 2F83A 4MNVA 1O3BA 1UTMA 1Q2WA 1NRQH 2A7JA 5C1UA 4YZUA 2EI8A 4GUXA 4AB8A 3GY8A 5K0HA 5DSFA 3O8RA 2LELA 3M5OA 1S6FA 1KTSB 1DITH 3W1EA 1H9LB 1XMNB 1IOEA 3ZVBA 1WQSA 2CN0H 2ZFPH 4GVUA 3SNCA 3GY5A 1MTNC 4Q2KA 4NWLA 3IITA 3HGNA 1GHZA 4JYUH 2F9UA 3ATMA 1TX6A 1ESBA 1G9IE 3SUEA 4TWYA 3SBKA 4MPXA 3SN8A 1CHOF 4X2XA 5EXLA 3GCHC 1H8ED 3ZZ6A 1L2EA 2AIQA 1O32A 4K1EA 1F7ZA 1OWKA 1D3TB 2AERH 1HNEE 4U01A 1K1LA 2P8OC 2J4IA 1BHXF 3KF2A 4KGAA 3SI4H 3CNRA 3K2UA 1YPKH 3D62A 1WOFA 5EW1H 1O2OA 1BRBE 5JYIA 1QJ1B 1O3HA 2LNCA 4YOGA 3UR9A 4FUGA 1C2FA 3O8DA 8LPRA 4FUDA 4TSFD 1MD8A 1VCPA 2NU2E 2VIOA 4CR5A 3DSPA 3AAVA 1Z1IA 1B0FA 1LDTT 3A84A 4OGYA 3TU7H 5A09A 1MU6B 3OY5U 4Z0KA 2BY6X 3NZIA 1K2I1 1FI8A 3TH4H 1MKXK 1VCQA 2ZDMA 5FPTA 1O2PA 1C1RA 1P2NA 5GXPA 3O8BA 4RT0A 1LPZB 3AW0A 4FU7A 3KHVA 2TBSA 1BT7A 2WSSD 1BJVA 5EQQA 3MU5A 1YY3A 2IJOB 1GI2A 4WMDA 3WWFA 4FU9A 5DP7A 3DFJA 1U6QA 1GJBB 1LCYA 1RIWB 3E90B 3T28A 1S0QA 1SI5H 2ZKSA 3F68H 3MNCA 2ZGHA 1MAXA 3Q3XA 3N7OA 3UOUA 4BOHA 1GMCG 4AFSA 5DJ7A 1L4DA 1T8LA 1EPTC 1XVMA 1VCWA 1EP6A 1TBQH 2CGAA 3AAUA 1AWFH 1K1IA 1UTLM 3BTDE 1H8DH 1DANH 1KMHB 3QWCH 1WQVH 4FXGH 2ZHFH 5EJLA 3P8FA 1OWDA 2BXUH 2Y7ZA 5DP4A 1SGNE 2Z9KA 4X6OA 5JBBS 2HNTF 1YWUA 1KLIH 2VIVA 3M5NA 4I8JA 3FN8A 1O2WA 1W3CA 4UFEH 5F6MA 3K65B 2IPQX 5EGMA 1HAOH 2FI3E 4YT7H 1S5SA 3DSGA 2EY4C 1SVPA 4E06H 3MU1A 2I6SA 4DY7B 3ZZDA 1BBRH 1OWJA 2VNTA 1DFPA 3P6ZB 2OUAA 1AUJA 3PWCA 1GHWH 3ZYDA 1OHHD 4XRNA 3ZV8A 2VVVA 5A2MH 1HDTH 2A5KA 2QV1A 2OXSA 4Y0YE 3ZZBA 5EW2H 2A7HA 4FETA 3NK8A 4TYDA 1O2LA 2DE9A 1W11U 5EOKA 3SUFA 3PRDA 2BM2A 4OGXA 1C2HA 1GHXH 2Z3CA 3BG4B 3MTYA 3UWJH 1F2SE 2WPHS 1WV7H 1LKBA 3ITIA 1IQNA 1VZQH 1PPEE 1LVBA 1OWIA 1P2OA 2D8WA 1F0RA 1HAYB 3GY4A 2P94A 1QL7A 1TABE 3LPRA 3EYDA 3NUMA 2WPIS 6CHAC 1MTSA 1TGBA 1C5OH 4Q80A 4TPIZ 1TMBH 4B1TA 1CSOE 5AF9H 1Y3YA 1V2TT 3VGCC 2WZQA 3MU0A 5CE1A 2J95A 1QJ7B 1XUFA 3L33A 2JH0D 1GDUA 1MBMA 2FOGA 4ZROA 2D2DA 2QF3A 3K6ZA 1HJAB 2ZDAH 1HB0B 1PYTC 1TPPA 2VWMA 2G00A 3F1SB 1UVUH 1Z8GA 5JBAS 3RDZA 1NU9A 3M5MA 1O3EA 3QZRA 1EPTB 2AH4X 4KP0A 1FQ3A 1CA8B 2GZ7A 1TNKA 5C1XA 2GDDA 3URCA 1IQFA 1G37A 1P03A 3RXJA 5EXNA 3QX5H 2GMTB 4AC9A 3SQEE 4Q63A 2DUCA 2M5TA 1ELGA 1KSNA 1ELBA 1CT4E 1FN6A 1EAXA 2J98B 1A46H 5E0JA 3CP7A 1GBEA 4BAMB 1S81A 1OKXA 4UONA 3GY3A 2ZU5A 2GCHG 2A32A 2OC0A 1GI4A 5C17A 4XE4A 1P04A 1T32A 2HALA 4ESTE 2ZDVH 2WPLS 1BBRK 1LVYA 1MD7A 1T8OA 4CBOA 2PKSB 1AVWA 1OYTH 1HJ9A 4MVNA 2VWLA 2GD4B 4ACBA 1HAZB 1V2NT 2FMJA 4MLFB 1GVKB 1GI7B 1P2IA 5F03A 1A7SA 3SJ9A 1TWXB 5HM9A 3BG4C 4BNRA 2H9EH 1BMLA 2D26C 1O35A 3F9EA 4HFPB 4K8YA 2AS9A 3K9XB 3VB4A 1O2IA 2UWPA 4AG1A 1YCPM 2XCFA 1GMHG 1D4PB 1MKXH 1EATA 4BXSA 1TLDA 1SOTA 2TGTA 1NRPH 4E7NA 2J5UA 4CBNA 3EE0B 3TNTA 1B5GH 4TY6A 1J8AA 1TFXA 3NPSA 3UNRA 2KCAA 3GDSA 3A83A 5C3NA 1JOUB 2R3YA 1E35B 3MNXA 3ZVAA 3D23A 1ID5H 2C93B 2UUFB 3SV9A 3TGJE 1NRNH 2H5CA 4D9QA 2Y81A 4A6LA 1BQYA 2FM2A 3CENA 4JK6A 1HXFH 4K3JA 3BV9B 1HJAC 5FXLA 4Y11E 4DG4A 4AG2A 1T7CA 3KL6A 1MTNB 2FS8A 2XNDD 3A7XA 2Y82A 5KECA 3EDXB 7GCHG 1LHEH 2BDIA 2M2AA 1UVSH 2XBXA 1LHGH 3RXEA 1EB2A 2FYQA 9ESTA 2FOAA 2EI6A 3TK5A 4X2YA 2P95A 1DS2E 4J1YA 4JYTA 2XWBI 2GX4A 2GKVE 2BX3A 2BY8X 5T3HA 2P3TB 1C1TA 1GJ9B 1OOKB 4SGAE 2ZNKH 1GMCF 1FIZA 5E0GA 3RC5A 1NN6A 3A8AA 1WBGB 1VITG 1BIOA 4NZQA 3KNXA 3RXLA 1O36A 1GBBA 1GI3A 4Z1MD 2VINA 1THRH 3RU4E 4ISNA 1BTWA 1UTKA 5A8YA 2HNTC 3A85A 1SGCA 1DX5M 1UK4A 1N8OB 1G36A 3DHKH 1AIXH 8GCHG 1BBRE 3NXPA 1O2SA 1SFQB 1PYTD 1YCPK 2PHBA 2BY7X 2FO9A 3LH1A 1BTUA 2XNIA 1QURH 2VIQA 1CGHA 4Y71A 1W2KH 2GCTC 1TE0A 1ORFA 2ZU3A 1E37B 2ANMH 4GHTA 1O5DH 2PW8H 1DDJA 1NFXA 2ZPRA 4GAWA 1NU7B 3SGBE 2A4GA 3WY8A 1TX8A 1IQGA 1HCGA 1MAYA 1MTWA 1O37A 1W14U 1LKAA 2C4FH 2Q6FA 2Z7FE 3RXGA 3SU1A 4DJZB 5HXFA 2PR3A 3QTOH 2VH0A 2BD5A 2UUYA 4X6NA 3QTVH 2ZU2A 1A61H 1A2CH 2SGQE 1CA0B 1EB1H 3H09A 5BRRE 1QJ6B 2OINA 1C5VA 5IYTA 1W7XH 4AFUA 1INCA 1O3GA 2QXIA 5EQRA 1YCPH 1XXFA 4X8TH 1OX1A 1ZHRA 3HK6B 1E36B 2HLDD 1J14A 1VR1H 1F5LA 3LGTA 3E0PB 4ABAA 4YLQH 2F9OA 3RUOA 3KN2A 2AGEX 1BRAA 5IDKA 2BQ7B 3TITA 1QNJA 1YPHE 4DT7B 4FUEA 2ANWA 2BLVA 1E1RD 1P2JA 2BQWB 4WMEA 2WHXA 1MU8B 2OC7A 4NCYA 3ZZCA 1KXFA 4ZXXH 4B71A 1ELVA 3BTKE 4I8HA 3LT3A 3MNBA 1K0HA 4R8TB 4BTTB 1ETTH 4ABGA 1JIMA 3UR6A 1QL9A 3NKKA 2FEQH 2G8TA 2CMYA 3UB0A 1O5FH 1D9IA 1O2JA 1C1WH 3OEED 1E0FD 1IQMA 2P8OB 2Z9LA 3CS0A 3SORA 2Y6TA 4AFZA 4H42U 3MHWU 3MH5A 5B6LA 4DURA 2VU8E 2CHAC 3LGYA 1GJ4H 3F6UH 1TNJA 1BMNH 1GBMA 1O3NA 3LONA 2WYGA 4TY7A 1QB9A 5F8TA 3BEIB 1TRMA 2PUXB 5DPAA 1RTKA 7GCHF 5ETXA 4BANB 3D49H 3TVJB 3RU4T 4YOIA 1C5XB 5T6FA 3SJIA 4X8VH 2OC8A 3UOPA 5GPIB 1G3CA 1GI9B 1XKBC 3GDUA 1ELTA 1MCTA 2OTVA 1EAUA 2B8OH 3ZYEA 4DOQA 3UY9A 4WWYA 3E91A 2BDYA 2XBWA 1O3IA 1TGTA 3BEUA 3ESTA 4A1TA 4ABBA 4I33A 1DXPA 3TNSA 2ULLA 2ZC9H 1KTTB 4Q7XA 3PO1B 3SU3A 4X1QU 1L1JA 1HAGE 3TGIE 4HI3A 2I6QA 3TJUA 4CH8B 4FOUC 1EP5A 1O3MA 2UUJB 2H1UA 1H4WA 4CR9A 4UD9H 1AQ7A 1CA0C 1AU8A 1F0SA 3O8CA 1AO5A 1UTPA 4B75A 1AE5A 4TPYA 3F3BA 1PPZA 1AVGH 4I31A 3PM3A 3RC6A 1O34A 1MTVA 1GHVH 3SNEA 2KX4A 1XXDA 1FUJA 1EPTA 4I32A 2ILNA 3MI4A 4BTIB 3GISB 1ETSH 1HYLA 2ZGCA 1Z7KA 4DCDA 3S7HB 4X1PU 1O3JA 3A80A 4IC5A 1W0ZU 1A5IA 1GBFA 2ZDKA 1GBCA 2Y7XA 1O2RA 4D9RA 4Y6DA 1BMMH 1MMJN 1QY6A 1E79D 1DVAH 1EOLA 4A92A 1V2JT 4K2YA 1RIWC 1D6WA 5C1YA 1SQTA 1ZHPA 3ZVCA 3BSQA 1ZTKA 5F53A 2A2XH 2V7QD 3ODDA 1TA6A 1GI8B 2HLCA 5LGOA 3SUDA 5J4QA 5DO4H 1T31A 3Q77A 3HK3B 3QGJA 3W94A 1IQJA 3VEQB 1EXFA 5E0HA 2Y5HA 5CHBA 3SV2H 2G5NA 1Z6EA 1C5PA 4I8LA 1LQEA 6CHAB 1FJSA 3M3VA 1WCZA 1AZ8A 1FN8A 3E16B 2UWOA 4B2BA 1AD8H 5J4SA 4Q7YA 1SQAA 1YBWA 4ISHH 2D1JA 3JZ1B 1TIOA 1YF4A 4IGDA 3RXUA 4ACAA 3LGWA 1RFNA 2P3UB 4ZKNU 2JJ2D 2A5AA 3RXSA 3DSOA 1LQDB 1PPGE 2FOFA 2VIPA 1AMHA 4XFQA 2ZP0H 3G01A 1Z6JH 3H7OA 2BDBA 1VITF 2ZHEH 4ABJA 2XCNA 5JPMH 5FBIA 1BRCE 1VGCC 1HAPH 1EJAA 1O33A 2B5TB 1ELDE 1EJMA 1FY5A 1C1MA 1H1BA 1S82A 3S7KB 5DP9A 4ZHAA 4B6FA 3B23B 1ZTJA 3MH7A 3UFAA 2HVYB 2V3MA 2Y80A 3L6PA 5HIYA 5A0CA 1PPHE 5FPYA 1C5TA 3RP2A 1YGCH 2V0BA 1LO6A 1DUAA 1HIAA 2V3OH 1ANDA 1N1LA 3QGNB 1KDQA 1BHXB 1LVOA 1NC6A 1H9IE 1V2VT 3KCGH 1V2ST 4FU8A 5E2OA 1OWHA 1TNLA 1YC0A 5AVDA 1Z8RA 2OK5A 4OS4A 1SMFE 4NSYA 1C2GA 2G51A 1P57B 1PPCE 1YPEH 2KCYA 1HV7A 3EA7A 3QZQA 7LPRA 1S83A 3A7WA 5LPEA 3PV5A 2PKSC 3QUMP 2O8LA 4NA7A 3HGPA 2STAE 1C4V2 1H8IH 1A1RA 1UCYE 4NWKA 4O3UA 1OP2A 1GBDA 2VWOA 3FP8E 1UHBB 1ESTA 1EZUC 2OBOA 1P11E 1FIWA 3FANA 3VB7A 1AWHB 1KXBA 1SR5C 2IJD1 4QT8C 1NBMD 3LGIA 1NPMA 2ZPSA 1G3EA 4H4FA 4KTCA 2GDEH 3SU5A 4A7IB 1P10A 1ARBA 1SG8B 5L2YH 2KFWA 1TGCA 1CT2E 5CDFE 1OPHB 2BYAX 3GOVB 3T29A 1EFRD 2THFB 3E8LA 4B73A 4BXWA 1O3PB 3IG6B 4HG6A 4NFEA 3SU4A 2ZWLH 2JH5D 1EOJA 1QBNA 1L4ZA 4YESB 1MTUA 3Q00A 2Y5GA 1GG6B 1IQKA 3A87A 2Z3EA 5FCRA 1MBQA 5G4BA 5HYOA 3PMBB 1PQ5A 3EQ0H 1ELCA 2ZDLA 5JDUB 1V2QT 4M9FA 3NRLA 2BLWA 1RS0A 1AUTC 1UTQA 1S84A 4FUCA 1GI6A 3MNSA 4FVBA 4BAOB 1P8VC 1O3OA 3UREA 5B6OA 2Z6BD 3SNDA 1AFQC 2BTCE 4IBLH 2GCHF 5CHAB 3LJOA 2LPRA 3T25A 3F9FA 1NZQH 2P59A 1D3DB 1V2MT 2TIOA 3MO6A 2O8TA 3KQBA 3M61U 3MU8A 2NU3E 1BB0B 1ANBA 2QE7D 1MABB 4AFQA 1BTXA 3MO9A 2KAIB 3GY6A 2IPHA 2ODYB 2WUBA 5FAHA 1GI5A 4A1XA 4AZ2B 3GYMA 4LXBH 4JZ1A 1CU1A 3OU0A 5EXMA 1O5AB 1HXEH 3PLBA 3ZVGA 1CHOG 3ATLA 2F9VA 1M9UA 1FAKH 3M5LA 3M3SA 3N99A 1C5NH 3M7QA 2G81E 4Y0ZE 2OQ5A 1GGDC 1HBTH 2A5IA 1GHAF 1AFEH 4O03A 3PB1E 1QCPA 2BX4A 1C9PA 4LZ1H 2OP9A 1HGTH 2GTBA 1O2NA 4X0WU 2W26A 3A88A 5CHAC 2AMDA 3TLOA 1HAXB 5HKKD 3OAAD 5T1VA 1CGIE 2QXHA 1QQ4A 1WAYB 2FTLE 1IHTH 2BVRH 4U32A 2Z9GA 1AB9B 4H6TA 3STIA 2ZFQH 1VGCB 5I25A 1XVOA 2F4LA 1C2LA 2XC0A 2O9QA 1A3EH 1C4Y2 3KEEA 2BD8A 1YLNA 1V2WT 1JWTA 4ZKSU 1WDIA 4HZHA 2XW9A 1C1SA 3TK9A 1AGJA 1ZSLA 3F0PA 3VGCB 5EJ1A 2GZ8A 3RXKA 1NY22 2VWNA 1HIAB 3GCOA 1O2XA 2GT8A 4K1TA 3SJKA 4FUFA 3F2GA 2OCVB 3UAIC 2G4TA 4RI0A 3H5CB 1GL0E 3OTPA 2A4OA 1AE8H 5ESTE 1N6YA 4Y76A 1GPZA 1P2QA 2FX4A 4Y79A 1ZZZA 4KTUA 5BPEA 4H6SB 1SOZA 2WPMS 4A1VA 3U9AH 2GT7A 3DUXH 1TOCB 3S9AA 3RMLH 1ZRBA 3BTHE 3SV8A 5EODA 4UE7H 3RXBA 3FAOA 1O5BB 2F9BH 3SV6A 2ZCLP 1AHTH 4OS6A 1O2GH 4CREA 1GL1A 2FLBH 3URDA 5L2ZH 2ODPA 1MH0A 2PWXA 2ZFFH 2VB0A 2W3IA 2ZCHP 5GCHG 1GHYH 2W6JD 2BDHA 3C27B 1SB1H 3GS9A 1J15A 2A2QH 3I77A 1TPSA 1SKYE 4MPVA 2AMPA 2HWLB 2ZU4A 1GBLA 9LPRA 1S0RA 1NRSH 2EC9H 1FLEE 5C0TA 3M7UA 1O2MA 1IQLA 1C5QA 3PRBA 1DUEA 3PMAB 3T5FH 1KYNA 3UQVA 1TRYA 1QTFA 1BJUA 3PV4A 5JBTA 2GCTB 2ZFTA 3UPEA 1V2PT 2PTNA 2YMSC 2ZECA 3BF6H 2TRMA 1W0KD 4NIXA 5DGJA 2ZCKP 1C5LH 1C5YB 1O3KA 1WSSH 3MO3A 1ZMLA 1W7GH 3LIWA 4GLYA 1TMUH 1Y8TA 3BTGE 1O5GH 2HPPH 2AHME 1J17T 1KXCA 4X6PA 5EJZA 1S6LA 1DWEH 5C2ZA 2W3KA 3V0XA 2EQNA 2ZTXA 3VPKA 1NO9H 2PGBB 5TCAA 3TJVA 1GDQA 3M35A 4I8KA 2F3CE 5GNDA 4ZKRU 3ZZ3A 2A4QA 1C1PA 1G30B 3I78A 1GVZA 2OD3B 1SGQE 2Z3DA 3TK6A 1O3DA 1WTHD 3SNBA 3T62A 3P95A 4WH6A 4ZCNA 2ZHWH 2Q6GA 4YOJA 2L74A 4JZEH 2J94A 1XKAC 3RM2H 4JZIA 4Q7ZA 4BAKB 3BEFB 2BDCA 1GI0A 1QB6A 4RKJB 2DE8A 2O8WA 1LTOA 1C4U2 1SGIB 4XD7D 1A0LA 2YNAA 4WVPE 3F9GA 2A45B 1TNIA 5GDSH 1Q3XA 1ZTLA 2CHAB 1T8NA 4RKOB 3A8BA 2F43B 4Y7BA 1ZMNA 4X1SU 4AB9A 1YYY1 2FOMB 1XUKA 1W0YH 2ZG0H 3F9HA 3BTQE 1K1PA 1YP9A 2KAIA 3OY6U 4FUJA 1ESAA 4B76A 1A4WH 1YLCA 1P0SH 1HAIH 3KQEA 3AVZA 5C5OA 1GHAG 1JBUH 1ZHMA 1T8MA 2WV5A 1GG6C 2NU1E 1C9TA 4GSOA 4MNWA 1QZ8A 1OWEA 1DSUA 4NIWA 4NZLA 4JK5A 4IW4E 3GY7A 4YXWD 5L30H 5F8XA 3SOSA 3UQOA 1ACBE 2ZA5A 4TWWA 3MOCA 4IN2A 2BD7A 3N7DA 1K1NA 4ZAEA 2A7CA 2FODA 4AYYB 1QA7A 3FKSD 4MDSA 1SPJA 3PMHB 2K1QA 5A0BA 1HJ8A 3FOAA 5TCCA 2BZ6H 3ATKA 1EZSC 1FV9A 1VKYA 2ZDNA 3RC4A 3M7TA 3FO8D 3IWMA 1GVLA 1IQHA 2ZF0H 4MNXA 2FOCA 1QRZA 2R0LA 5ABWA 1CHGA 1ZMJA 1UK2A 3VB3A 1O3AA 1H8HD 1QIXB 2PFEA 2Y5FA 2F91A 1GCDA 1VJAU 4MNYA 1UO6A 4X8UH 3SI3H 1O3CA 4X6MA 3LOXA 1YLDA 3S0NA 3RXCA 2ZTYA 2VH6A 3PLPA 1A3BH 5EG4A 4F48B 1FAXA 3BTWE 3LU9B 4AX9H 1CT0E 4U30A 1AKSB 1PQ8A 1FY1A 2BOKA 3RLYH 1CE5A 1G2LA 1KXEA 1V2KT 2ZFRH 3AK5A 1GHBG 1HLTH 2ESTE 2K0QA 1QBOA 3QO6A 1DT2A 4NA8A 2ZQ1A 3GCTG 2QF4A 4Y7AA 3RU4D 1JRTA 1RTFB 3KGPA 1BCUH 3OE7D 1CBWC 3HKIB 4ABEA 2ZZUH 4CRGA 2BVSH 4NFFA 1ZPBA 1OS8A 3BTEE 4HGCA 1V3XA 2R2MB 3S69A 4X1RU 4OM9A 1E1QD 4Y8YA 1C5WB 2BD2A 2ZU1A 3S9CA 4ZH8A 2FYRA 3HATH 3EE7A 4ZKOU 2BY9X 2BOHB 1BMFD 2KCOA 5TJXA 4IMQA 2GP9B 2FI4E 1A0HB 4VGCC 1OP8A 3HPTB 4NIYA 5LPRA 2AGGX 4P00A 3Q76A 4XSKU 1KXAA 2BZAA 1XM1A 2FWWA 1P09A 1BTHH 1Y3VA 1COWD 5A8XA 2CF9H 3F0OA 1DXWA 1TGSZ 1BA8B 3LC3A 1L0ZA 4OS5A 1MUEB 1O2TA 6GCHF 2VBCA 3A8DA 4U2WA 4VGCB 3GDVA 1IQIA 5EPNA 3ZZ7A 1C2JA 2V35A 3QN7A 1TONA 2RA3A 2SNWA 2LP6A 4JYVH 2IOTA 3ENSB 2A0QB 2TPIZ 3ZV9A 2BLOA 2Z9IA 3F2FA 1JRSA 1DWBH 1AFQB 2J2UA 3SNAA 1UW7A 2JETB 2VIDA 2FOHA 1NRRH 5C67A 1HUTH 1THSH 1T4VH 2GMTC 5H4IB 2B9LA 4OS7A 1O2QA 1HAVA 2XWAA 2QN5T 1O39A 3Q3YA 4ZMAH 4FUBA 1WU1A 2W7SA 2BB4A 1IAUA 1P05A 1EAIA 1GJ7B 1Y3XA 3OEHD 2J34A 2ALVA 3A7VA 3RMNH 1P12E 4F4OC 4CRBA 1C5SA 3UNSA 2HRVA 1SC8U 1RXPA 2RDEA 1SQOA 4OS1A 2A31A 1A5HA 4I86A 5IK2D 1MKWK 3RXQA 5GIBA 4MQAA 1YPGH 1ELEE 1BITA 2R3UA 1ZRKA 3FVFB 1UK3A 1ZJDA 2JIZD 3GICB 6GCHG 4NSVA 1NFWA 2FIRH 1QGFA 2FXRA 3SQHE 3JZ2B 4NG9H 2KM0A 1SGEE 1ZPZA 1T4UH 5AFZH 4NIVA 3RMMH 4F49A 4XDEA 1G3DA 1N8OC 3FP6E 2RFKC 3MH6A 5C94A 4R0IA 2Q6DA 5FX5A 2K8IA 3LKWA 1V6DA 1A0JA 3L3TA 2UWLA 5JB8S 3P92A 2H9HA 3FFGA 1ZPCA 4SGBE 2ZGJA 4DIIH 2R9PA 1RJXB 2AGIX 4OS2A 2AFQB 4FUHA 1GJ6A 3OSYA 1THPB 4M7GA 2CV3A 5DP6A 3WW7A 2ZTZA 2WINI 1NROH 4Y10E 1FDPA 2TGAA 2QIQA 1LPKB 1EKBB 1C2DA 1NESE 2XTTB 3A7ZA 3EA8A 3UIRA 1FNIA 1LVMA 2P3FH 2O8MA 5ESBA 1JIRA 2C3SA 3SGAE 1ZR0A 2GVFA 4D76A 2W7UA 1ZSKA 5JBCS 1O2UA 4IS5A 4XBCA 5FPSA 3PROA 2FOEA 3M37A 1DICA 1FY4A 5L6NH 1P01A 1RRKA 2SGPE 2HGTH 3SYJA 4B6EA 1NBME 1WYKA 2XOKD 1BRUP 3SZNA 3RMOH 1NS3A 5C20A 3MYWA 3E0NB 3PMJA 3BIVH 1D3QB 5KEDA 2FLRH 1GBTA 3TH3H 1PQAA 1AI8H 3LJJA 1GBAA 4BAHB 3T27A 4LZ4B 4Y8XA 1NFYA 3A86A 2Q1JA 2QF0A 1TB6H 4ZHLU 1YM0A 4BAQB 1EASA 2QF5A 2SGAA 4IMZA 1GBIA 1TQ0B 2QGRA 4ABIA 1K1MA 3EGKH 1GMDG 4UFDH 3I29A 4XOJA 2BD3A 5AHGH 1UCYH 3ZZAA 3S9BA 1ZGVA 3PTNA 1BMAA 2AIPA 1MZAA 4X8SH 4WMFA 3N7EA 5E8EH 2QC2A 1KXDA 1PPBH 2WPJS 2NU0E 1ZYOA 1UJ1A 3ODFA 5SGAE 1ZLRA 2PP6A 3LGUA 2VVCA 3ELAH 1W10U 5FL7D 3MFJA 1EAWA 2ZEBA 8ESTE 2BXTH 3E6PH 1O0DH 2SFAA 1F5KU 8GCHF 1TALA 2XYAA 2BD9A 4D7FA 3RM0H 1UHBA 3RXDA 1W8BH 1GBKA 1GJ5H 4MPWA 1Y3WA 1GJDB 3A81A 1UVPA 1C2KA 4ZXYH 4CRCA 1C5UA 1BOQA 1GBHA 1V2RT 1UCYK 1K21H 1W13U 6LPRA 4DW2U 3KQDA 4E05H 2YMSB 1ARCA 1DLKB 1MQ5A 1F92A 3A89A 3FP7E 4KTSA 2WUCA 4GCHF 3SJ8A 1P06A 2R0KA 2QXJA 1O2KA 2ZGBH 3SW2B 2P93A 4J2YB 1FXYA 1ETRH 4THNH 2AMQA 2FOBA 1TRNA 2WV4A 4DT4A 1VJ9U 3RXPA 1CGJE 2FI5E 3B9FH 1SGRE
chains in the Genus database with same CATH topology
3BTTE 2ZGXH 4LOYH 3NWUA 1GGDB 2GZ9A 4IN1A 3ZZ4A 7KMEH 6ESTA 2VIWA 3PWBA 1C5ZB 1FY8E 3SO3A 2OBQA 1P02A 2QAAA 2CF8H 5HGGA 1SLXB 4D7GA 1MKWH 1BUIA 3LH3A 1SFIA 1B7XB 1TNHA 1ELFA 2Z9JA 2ODQA 3SJOA 2OLGA 4AN7A 3SGQE 1GJ8B 2EA3A 3KQCA 7ESTE 2NU4E 4LK4A 2PLXA 4INLA 1O3LA 4K60A 4A5TS 1O31A 3SU6A 1SLUB 1AKSA 3ATIA 1C1NA 1DSTA 1GCTC 3U1IB 1ZJKA 3QLPH 2C90B 2A1DB 2ANKH 1E38B 2J9NA 3PTBA 3V3MA 4K69A 1FY3A 1Z8IB 4WJG2 2ZFSA 3QDZB 3ATWA 1MQ6A 1GHBF 1Y5BT 1AN1E 1UTOA 1O5CB 1K9OE 1FZZA 2HVXA 2SGFE 3NCLA 3VXFH 2FX6A 1LHCH 3QK1A 3LDXH 2BDAA 1GBJA 1DWCH 1O2YA 1KLTA 1O3FA 4UDWH 4Y8ZA 5T6GA 1GI1A 4UFFH 3ZZ5A 2H2ZA 2VJ1A 4AGKA 3UUZA 2WPKS 1JMOH 1C1QA 1XX9A 3GCHB 2P16A 3U69H 2JETC 1V2UT 4K1SA 1DLEA 1ANCA 1C1VH 1DWDH 1GMDF 1LHDH 1GJAB 5FCKA 2QA9E 3UNQA 4MTBA 2EEKA 4DIHH 1PFXC 5LH8A 1OP0A 2PKAA 2UUKB 3R0FA 3U1JB 1TAWA 1LMWB 3TGKE 1Y5AT 3A82A 5DK1A 1C2IA 4WXIA 2G5VA 1J9CH 3OYPA 4INKA 1Z1JA 1YPHC 2CXVA 3MMGA 3RXRA 1UVOA 1D3PB 5I46H 2PSYA 1DOJA 2XXLA 4NGAH 1DY8A 4RN6A 4YO9A 4YT6H 1OSSA 5EU8A 3VB5A 1YPJH 2HPQH 3A7TA 1QFKH 1BTPA 3HKJB 3BTFE 1W12U 2GGVB 4ZHMU 3BG8A 5HM2A 1NFUA 3MU4A 1O38A 1O5EH 5FHTA 3TIUA 2R2WU 1NT1A 1SGDE 1AB9C 2ALPA 4AORA 3A7YA 1EUFA 2QYIA 3SHCH 3GYLB 2ZI2H 2TGDA 2RCEA 3K6YA 3LC5A 1UTNA 2A4RA 1TMTH 2WYJA 1SLWB 2Z94A 1QRWA 2F9NA 2SNVA 1L1GA 1AVXA 1FPCH 1P2KA 1BTZA 2HOBA 1TBRH 3RXVA 1C1UH 4WXVA 1TPOA 1N6XA 4O3TA 2PSXA 5PTPA 3C1KA 1RD3B 4CHAC 1QL8A 1VITH 2H6MA 1LPGB 2H5DA 4RSPA 1BZXE 2ANYA 2H9TH 2QCYA 3V12A 2ZHDA 2PKAB 4YM9A 4GHQA 1C2MA 2SGDE 1FONA 3RXMA 4ABFA 1HRTH 4B2AA 5LPFA 4AGJA 2J38A 3RXTA 1SGPE 5GJ4B 3OX7U 1PQ7A 5EPYA 3DD2H 1QHRB 2VVUA 3T2NA 3V13A 4O97A 4ISLA 1QB1A 2VGCC 4WH8A 1F0UA 2B7DH 3B8JA 4CH2B 2IN2A 1SL3A 1UVTH 2XBYA 2PV9B 1QBVH 1XUHA 3MH4A 4X2VA 1WUNH 1QA0A 1Q31A 1IHSH 2GV7A 1TA2A 4INHA 3VXEH 2J92A 3RXAA 3P8OA 1FPHH 3OTJE 2QXGA 1TBZH 1YKTA 4ABHA 2B0FA 1CBWB 1C1OA 4B74A 2F9PA 4ISIH 4B2CA 1QR3E 3E3TA 3VB6A 2G55A 2G52A 3STJA 2FPZA 1P3CA 3M3TA 1YPLH 1Z71A 3ZVEA 5GWZA 1DM4B 1J16A 5K7RA 3M36A 2C8XB 1S85A 1K22H 2C8YB 5FBEA 5FX6A 3SV7A 4FVDA 4JZFH 1P2MA 1C5MD 1GDNA 2OC1A 3GCNA 2PGQB 4X2WA 2BQ6B 2ASUB 4K8BA 3RLWH 1TQ7B 1HFDA 4X1NU 5DP8A 1P9SA 3SHAH 2JKHA 5GCHF 3EAJA 1G2MA 1V2OT 1EQ9A 1P3EA 3RXHA 3UTUH 2V6NA 3BIUH 1Z8JB 4HTCH 1UTJA 5JB9S 2RDLA 1K1OA 4AOQA 2C8ZB 3EA9A 1XUJA 1KLJH 5HMAA 4MPUA 3LGVA 1O2ZA 1ZSJA 1CO7E 1OYQA 3PLKA 1FMGA 3UWIA 4ABDA 2XBVA 1TGNA 3AASA 1Y3UA 4ASHA 1JXPA 1B0EA 3RXOA 2OQUA 3RXFA 3P8GA 3U8OH 2PTCE 1WTGH 2NWNA 4AYVB 3RXIA 1ELAA 4ZUHA 1ABJH 1AY6H 2FESH 4YTAA 1O2VA 2AEIH 2PUQH 3FZDA 4WY3A 1TYNA 1OXGA 3U8TH 4CRFA 4DVAU 1L1NA 3P70B 4XBBA 1TX7A 4KKDA 2TGPZ 1BTYA 2BLQA 3A8CA 5F8ZA 3TJNA 3V7TA 2XRCA 1AZZA 1SGTA 8KME2 1Y59T 1EJNA 3ZZ9A 1XUGA 5AFYH 1HPGA 3BTME 2FS9A 2FP7B 2C8WB 1H9HE 1F5RA 1YPMH 4Z6AH 1GMHF 3ZVFA 3GCTF 1K1JA 4NA9H 1GJCB 5DG6A 1O2HA 2YNBA 2ZQ2A 1LHFH 1A5GH 3TJOA 1PJPA 3PYHA 4MG3A 1G32B 3DA9B 1KY9A 3VFEA 3SUGA 1KIGH 3H7TA 1Y5UT 4BTUB 4XBDA 4CHAB 1PPFE 2V3HH 2ZHQH 3CS7A 2FDAA 1XUIA 3DFLA 2AYWA 3DT0H 3MWIU 1ABIH 3P8NA 4FUIA 4YLUA 3ZZ8A 2ZPQA 5DP5A 1HAHH 3SU0A 3U98H 4KELA 1SGFA 3PO1C 4GCHG 4JCNA 3TPIZ 2VGCB 1C5RA 2FTMA 4WF8A 1K28D 2ZIQH 3P17H 1X7AC 3U8RH 1UMAH 2O8UA 4CRDA 3R3GB 1V2LT 2CJIA 4IC6A 5A0AE 1IQEA 1CVWH 2G4UA 4I8GA 3E1XB 4PROA 3ZVDA 3D65E 1SBWA 2BD4A 2W5EA 1HAVB 5EQSA 1EX3A 2HNTE 2BDGA 5C5NA 4E7RG 4DGJA 1TOMH 4JZDH 1ANEA 3W95A 1QQUA 1C2EA 4UEHH 1EZXC 1NTPA 1D6RA 2BMGB 1NM6A 1P9UA 3GY2A 2BHGA 1DPOA 2BVXH 5DP3A 1RTLA 2ZO3H 3FZZA 1DE7H 1MZDA 1GWAA 5DKMA 4JMYA 4GPGA 1MCVA 2YOLA 1SLVB 2RG3A 1ZOMA 1O30A 1TNGA 4D8NA 2SGEE 1QRXA 2JH6D 1CQQA 1ZGIA 4CRAA 2FZZA 5E2PA 4I7YH 1SGYE 3TH2H 3SU2A 2QY0B 1RGQA 3AW1A 1S6HA 3BN9A 1SSXA 4K5ZA 1GCTB 5CMXH 2BY5X 3T26A 5T6DA 1TPAE 1E34B 3KIDU 1BDAA 1SHHB 2RA0A 2STBE 1F0TA 5A8ZA 1DY9A 1EZQA 4ISOA 1KDQB 2GV6A 2EI7A 1SHYA 1G3BA 2XC4A 4UFGH 1SGFG 4O9VA 2XC5A 3Q3KA 2F83A 4MNVA 1O3BA 1UTMA 1Q2WA 1NRQH 2A7JA 5C1UA 4YZUA 2EI8A 4GUXA 4AB8A 3GY8A 5K0HA 3O8RA 3M5OA 1S6FA 1KTSB 1DITH 1H9LB 1XMNB 1IOEA 3ZVBA 1WQSA 2CN0H 2ZFPH 4GVUA 3SNCA 3GY5A 1MTNC 4Q2KA 4NWLA 3IITA 3HGNA 1GHZA 4JYUH 2F9UA 3ATMA 1TX6A 1ESBA 1G9IE 3SUEA 4TWYA 3SBKA 4MPXA 3SN8A 1CHOF 4X2XA 5EXLA 3GCHC 3ZZ6A 1L2EA 2AIQA 1O32A 4K1EA 1F7ZA 1OWKA 1D3TB 2AERH 1HNEE 4U01A 1K1LA 2P8OC 2J4IA 1BHXF 3KF2A 4KGAA 3SI4H 3K2UA 1YPKH 3D62A 1WOFA 5EW1H 1O2OA 1BRBE 5JYIA 1QJ1B 1O3HA 2LNCA 4YOGA 3UR9A 4FUGA 1C2FA 3O8DA 8LPRA 4FUDA 1MD8A 1VCPA 2NU2E 2VIOA 4CR5A 3AAVA 1Z1IA 1B0FA 1LDTT 3A84A 4OGYA 3TU7H 5A09A 1MU6B 3OY5U 4Z0KA 2BY6X 3NZIA 1K2I1 1FI8A 3TH4H 1MKXK 1VCQA 2ZDMA 5FPTA 1O2PA 1C1RA 1P2NA 5GXPA 3O8BA 1LPZB 3AW0A 4FU7A 3KHVA 2TBSA 1BT7A 1BJVA 5EQQA 3MU5A 2IJOB 1GI2A 4WMDA 4FU9A 5DP7A 3DFJA 1U6QA 1GJBB 1LCYA 1RIWB 3E90B 3T28A 1S0QA 1SI5H 2ZKSA 3F68H 3MNCA 2ZGHA 1MAXA 3Q3XA 3N7OA 3UOUA 4BOHA 1GMCG 4AFSA 5DJ7A 1L4DA 1T8LA 1EPTC 1XVMA 1VCWA 1EP6A 1TBQH 2CGAA 3AAUA 1AWFH 1K1IA 1UTLM 3BTDE 1H8DH 1DANH 3QWCH 1WQVH 4FXGH 2ZHFH 3P8FA 1OWDA 2BXUH 2Y7ZA 5DP4A 1SGNE 2Z9KA 4X6OA 5JBBS 2HNTF 1KLIH 2VIVA 3M5NA 4I8JA 1O2WA 1W3CA 4UFEH 5F6MA 3K65B 5EGMA 1HAOH 2FI3E 4YT7H 1S5SA 1SVPA 4E06H 3MU1A 2I6SA 4DY7B 3ZZDA 1BBRH 1OWJA 2VNTA 1DFPA 3P6ZB 2OUAA 1AUJA 3PWCA 1GHWH 3ZYDA 3ZV8A 2VVVA 5A2MH 1HDTH 2A5KA 2QV1A 2OXSA 4Y0YE 3ZZBA 5EW2H 2A7HA 3NK8A 4TYDA 1O2LA 2DE9A 1W11U 5EOKA 3SUFA 2BM2A 4OGXA 1C2HA 1GHXH 2Z3CA 3BG4B 3MTYA 3UWJH 1F2SE 2WPHS 1WV7H 1LKBA 3ITIA 1IQNA 1VZQH 1PPEE 1LVBA 1OWIA 1P2OA 2D8WA 1F0RA 1HAYB 3GY4A 2P94A 1QL7A 1TABE 3LPRA 3EYDA 3NUMA 2WPIS 6CHAC 1MTSA 1TGBA 1C5OH 4Q80A 4TPIZ 1TMBH 4B1TA 1CSOE 5AF9H 1Y3YA 1V2TT 3VGCC 5CE1A 3MU0A 2J95A 1QJ7B 1XUFA 3L33A 2JH0D 1GDUA 1MBMA 2FOGA 4ZROA 2D2DA 2QF3A 3K6ZA 1HJAB 2ZDAH 1HB0B 1PYTC 1TPPA 2VWMA 2G00A 3F1SB 1UVUH 1Z8GA 5JBAS 3RDZA 1NU9A 3M5MA 1O3EA 3QZRA 1EPTB 2AH4X 4KP0A 1FQ3A 1CA8B 2GZ7A 1TNKA 5C1XA 2GDDA 3URCA 1IQFA 1G37A 1P03A 3RXJA 5EXNA 3QX5H 2GMTB 3SQEE 2DUCA 2M5TA 1ELGA 1KSNA 1ELBA 1CT4E 1FN6A 1EAXA 1A46H 5E0JA 3CP7A 1GBEA 4BAMB 1S81A 1OKXA 4UONA 3GY3A 2ZU5A 2GCHG 2A32A 2OC0A 1GI4A 4XE4A 1P04A 1T32A 2HALA 4ESTE 2ZDVH 2WPLS 1BBRK 1LVYA 1MD7A 1T8OA 4CBOA 2PKSB 1AVWA 1OYTH 1HJ9A 4MVNA 2VWLA 2GD4B 1HAZB 1V2NT 2FMJA 4MLFB 1GVKB 1GI7B 1P2IA 5F03A 1A7SA 3SJ9A 1TWXB 5HM9A 3BG4C 4BNRA 2H9EH 1BMLA 2D26C 1O35A 3F9EA 4HFPB 4K8YA 2AS9A 3K9XB 3VB4A 1O2IA 2UWPA 4AG1A 1YCPM 2XCFA 1GMHG 1D4PB 1MKXH 1EATA 4BXSA 1TLDA 1SOTA 2TGTA 1NRPH 4E7NA 4CBNA 3EE0B 3TNTA 1B5GH 4TY6A 1J8AA 1TFXA 3NPSA 3UNRA 3GDSA 3A83A 5C3NA 1JOUB 2R3YA 1E35B 3MNXA 3ZVAA 3D23A 1ID5H 2C93B 2UUFB 3SV9A 3TGJE 1NRNH 2H5CA 4D9QA 2Y81A 4A6LA 1BQYA 2FM2A 3CENA 4JK6A 1HXFH 4K3JA 3BV9B 1HJAC 5FXLA 4Y11E 4DG4A 4AG2A 1T7CA 3KL6A 1MTNB 2FS8A 3A7XA 2Y82A 3EDXB 7GCHG 1LHEH 2BDIA 2XBXA 1UVSH 1LHGH 3RXEA 1EB2A 2FYQA 9ESTA 2FOAA 2EI6A 3TK5A 4X2YA 2P95A 1DS2E 4J1YA 4JYTA 2XWBI 2GX4A 2GKVE 2BX3A 2BY8X 5T3HA 2P3TB 1C1TA 1GJ9B 1OOKB 4SGAE 2ZNKH 1GMCF 1FIZA 5E0GA 3RC5A 1NN6A 3A8AA 1WBGB 1VITG 1BIOA 4NZQA 3KNXA 3RXLA 1O36A 1GBBA 1GI3A 2VINA 1THRH 3RU4E 4ISNA 1BTWA 1UTKA 5A8YA 2HNTC 3A85A 1SGCA 1DX5M 1UK4A 1N8OB 1G36A 3DHKH 1AIXH 8GCHG 1BBRE 3NXPA 1O2SA 1SFQB 1PYTD 1YCPK 2PHBA 2BY7X 2FO9A 3LH1A 1BTUA 2XNIA 1QURH 2VIQA 1CGHA 4Y71A 1W2KH 2GCTC 1TE0A 1ORFA 2ZU3A 1E37B 2ANMH 4GHTA 1O5DH 2PW8H 1DDJA 1NFXA 2ZPRA 4GAWA 1NU7B 3SGBE 2A4GA 3WY8A 1TX8A 1IQGA 1HCGA 1MAYA 1MTWA 1O37A 1W14U 1LKAA 2C4FH 2Q6FA 2Z7FE 3RXGA 3SU1A 4DJZB 5HXFA 2PR3A 3QTOH 2VH0A 2BD5A 2UUYA 4X6NA 3QTVH 2ZU2A 1A61H 1A2CH 2SGQE 1CA0B 1EB1H 5BRRE 1QJ6B 2OINA 1C5VA 5IYTA 1W7XH 4AFUA 1INCA 1O3GA 2QXIA 5EQRA 1YCPH 1XXFA 4X8TH 1OX1A 1ZHRA 3HK6B 1E36B 1J14A 1VR1H 1F5LA 3LGTA 3E0PB 4ABAA 4YLQH 2F9OA 3RUOA 3KN2A 2AGEX 1BRAA 5IDKA 2BQ7B 3TITA 1QNJA 1YPHE 4DT7B 4FUEA 2ANWA 2BLVA 1P2JA 2BQWB 4WMEA 1MU8B 2OC7A 4NCYA 3ZZCA 1KXFA 4ZXXH 4B71A 1ELVA 3BTKE 4I8HA 3LT3A 3MNBA 4R8TB 4BTTB 1ETTH 4ABGA 1JIMA 3UR6A 1QL9A 3NKKA 2FEQH 2G8TA 2CMYA 1O5FH 1D9IA 1O2JA 1C1W