1N6XA

Rip-phasing on bovine trypsin
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsinogen, cationic
publication title Specific Radiation-Damage Can Be Used To Solve Macromolecular Crystal Structures
pubmed doi rcsb
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2002-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1n6xA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1n6xA02
2TRMA 1C9TA 1A3BH 2CXVA 1S81A 1MKWK 5DP6A 1KY9A 1YM0A 4B75A 4UDWH 2Q1JA 1LPGB 4FU9A 3ENSB 2ZKSA 3FP8E 2GT7A 4JCNA 2B7DH 1BZXE 2Z3EA 4IMZA 1Z6EA 1PPFE 2ASUB 4UEHH 1WTHD 1MZAA 1YCPK 4KTCA 4ZMAH 1ORFA 3D23A 3BIVH 3KNXA 5EW2H 2ZCHP 1T8MA 1GBCA 4FUHA 1Z8JB 5EQRA 5IYTA 1PPZA 4ISHH 1H8IH 2ZDNA 4IS5A 5FX5A 4INKA 3RLWH 2VWOA 1UVTH 1TQ0B 1LVYA 2CHAC 1IOEA 1VCWA 2OD3B 3TIUA 2XNIA 2GMTC 4BTTB 3ITIA 2VH6A 1C1OA 1XUJA 1BIOA 3D49H 3BTQE 1FN6A 2ZECA 1VITF 3ZZBA 1TNLA 1TMBH 3ZZ6A 4K3JA 1NRSH 1C2IA 3KHVA 1V2RT 2PW8H 3RXTA 1GBAA 3E3TA 5CHAB 3QDZB 3S9AA 2H9HA 2C3SA 2ODPA 3BTDE 4X8SH 2LNCA 3MHWU 3PTBA 3UR6A 1W12U 1C4U2 1ZGIA 3AVZA 1NS3A 2Z6BD 1ELTA 2BQWB 4O3UA 3BSQA 1T8NA 2TPIZ 1O5FH 1ZPBA 2ODYB 1A2CH 4YOGA 4FU8A 3F9HA 4RSPA 1BBRE 1K1LA 4ESTE 1LDTT 1KDQA 1HJAB 1EAWA 1ARBA 4R8TB 2PFEA 1XVOA 1O3IA 1TPSA 1VCQA 2Q6DA 1Y3XA 1HXFH 5BRRE 3FFGA 1P10A 3QX5H 4GVUA 2VVCA 3EAJA 3ZZCA 1O2OA 1GCDA 2FI4E 4H42U 1VZQH 3RMLH 3T62A 1BJVA 5F8XA 2GZ7A 3LGIA 1P2OA 2QCYA 4UD9H 3SBKA 1SGQE 1TIOA 3SV2H 4SGBE 3LGYA 1QHRB 2ZHWH 1HAGE 3FP6E 1PQ7A 2FOHA 1LPZB 1LHDH 3M3SA 1NRQH 4INHA 1O2VA 3OU0A 4MTBA 3MYWA 4MQAA 3L3TA 2BQ6B 5C1YA 2G51A 1WYKA 3B23B 2CHAB 3IWMA 1HLTH 4WH8A 1ZZZA 4Y11E 1YPEH 2EI7A 1GBDA 1E35B 2GMTB 7ESTE 1TBQH 2AYWA 2BX3A 4FUEA 5ABWA 5GJ4B 3A89A 1THRH 2B9LA 1MTWA 1B0FA 2ZFTA 2RCEA 5EXMA 2QXGA 1V2QT 5FCRA 3TJUA 1G3EA 2TIOA 2W3KA 4JZ1A 2ANWA 1O3FA 1D6WA 1FI8A 2O8LA 2XW9A 4D8NA 2IOTA 4E05H 1O5BB 1GWAA 2HNTC 4WXIA 1S0RA 1QA7A 2BZAA 3NKKA 1E37B 5A09A 4Y6DA 3SU5A 1D6RA 2XXLA 3A8CA 2H1UA 1C5MD 3HATH 2FOCA 3JZ2B 2SGPE 2OQUA 1EP5A 1ZSJA 2A4GA 2VIQA 4JYVH 4K5ZA 2C8YB 3SGQE 4I32A 1JIRA 5A0BA 1YKTA 3T2NA 3SNBA 3BTFE 3LPRA 1GJ9B 3UWJH 2ZEBA 1C5OH 1SB1H 3TK5A 4YOIA 1UO6A 4AZ2B 3MU0A 1DT2A 1PFXC 3MNCA 1NRNH 3SU6A 4MNVA 1UTPA 1K1MA 4X2VA 2UWLA 3GCOA 2WYGA 1BTPA 3ATMA 2B5TB 1EOLA 2R0KA 5LH8A 1UTQA 4MPUA 4DY7B 1NROH 1QRZA 2WPJS 1ZTLA 1WBGB 1HCGA 1O3AA 1GJDB 1GI9B 1BBRK 3QZQA 4WY3A 8GCHG 1V2VT 1GDNA 1UCYH 4ABAA 5CMXH 1SLVB 2Q6FA 3T25A 1SR5C 2G4TA 3I78A 3TH4H 1EQ9A 1GI3A 5GWZA 3KGPA 5LPFA 1O3GA 1C5SA 3Q3KA 3A84A 3HPTB 2CF9H 4KELA 1XM1A 1G32B 2GCHF 6LPRA 1NPMA 1TGNA 2FTMA 4I8JA 2XCNA 1L0ZA 3F9GA 1MTVA 1EOJA 1P01A 3BN9A 3ZVFA 2HRVA 4XBBA 1C1UH 1UVSH 4I8LA 2R2WU 6GCHF 1AKSA 3RMOH 2Y7ZA 3KN2A 1HV7A 3ZZAA 2QN5T 4RKJB 1KYNA 4CH8B 1F92A 3QGNB 1WCZA 4NIYA 1U6QA 3LKWA 3LJOA 1F0RA 1GVLA 1T4VH 1BB0B 1KXBA 3V0XA 2H9EH 1YGCH 3MO9A 1LHCH 1W0ZU 2J2UA 4HTCH 2ZDLA 4CRBA 1GL0E 1C2LA 1SI5H 2RA0A 3H7OA 1PPHE 1QJ7B 1P0SH 4H4FA 1SOTA 1GHBG 4YO9A 9LPRA 4JMYA 4UFFH 1ZPZA 1ELEE 4TPIZ 3A8AA 1FXYA 5FCKA 5DPAA 3PMHB 2GDDA 5FPYA 3SJKA 3SNAA 4GAWA 2Y6TA 1EUFA 4F49A 2QIQA 2A7JA 5DP7A 5LGOA 1BRCE 1JBUH 6CHAC 4AGKA 3R3GB 3TVJB 1Y5UT 3H5CB 5TCCA 1QRWA 1LQEA 1ZRKA 1CGHA 1ZYOA 2R9PA 1AFQC 1WOFA 2M5TA 2XWBI 3LU9B 4H6TA 1JXPA 1W0YH 2Z3DA 1BCUH 3SV7A 2G00A 2RG3A 3SV8A 1P2NA 1HFDA 1ZSLA 4OS6A 1YF4A 2JH6D 1G9IE 1O2IA 2OCVB 2BDIA 1P3EA 4DVAU 1FUJA 1V2LT 4NFFA 3ZVBA 3F68H 2BOKA 1D9IA 1QBNA 5A8YA 2ZQ2A 1C4V2 2R3UA 3MMGA 1K2I1 3MH5A 4Y8YA 2QV1A 3A7WA 1G2MA 1V2PT 2GX4A 3MH7A 5FHTA 3U69H 2LPRA 3KIDU 1IAUA 3SHCH 1RTLA 2Y5GA 1QFKH 3PM3A 3ZZ7A 1AE5A 1SC8U 2A4QA 2AERH 1GHXH 3PMBB 1T7CA 3MU4A 3P8FA 4Z0KA 2P93A 4PROA 3SNEA 3MOCA 1SL3A 2W26A 3TH2H 2PV9B 3BTWE 2ULLA 1TE0A 3MO6A 3SUEA 1ZMLA 4ZHLU 1YPLH 1Y3VA 5EPYA 1SFIA 1H9LB 1O2TA 1C2HA 1SGFG 4X1SU 1OOKB 3UIRA 1DWEH 2J92A 4K60A 2WUCA 2FYRA 1FY3A 1ANBA 1Z8RA 4X1NU 2Y81A 5L2ZH 3URDA 1G3CA 3PLPA 2BXUH 2PKAB 4D7FA 2BMGB 1G3BA 4WMFA 1EZUC 4NA7A 3T27A 2UWOA 2A4OA 1C9PA 1HYLA 3PB1E 3ZVCA 1C5TA 1O31A 2GZ8A 3A81A 5ESBA 1FJSA 1HUTH 3GCTG 3C1KA 1TALA 3E90B 6CHAB 3SUGA 3SQHE 2PWXA 1CQQA 4NFEA 1LVBA 2ZNKH 3RXVA 1O33A 1O38A 4JYTA 2Y82A 1RIWC 2XYAA 1AFQB 3A83A 1C5LH 2V6NA 4D9QA 1C2KA 1WQVH 2SNWA 4CH2B 1NESE 1C1PA 1GJBB 1YPHE 1P2IA 3LGUA 1P2JA 5JBAS 5A0CA 1EKBB 2BDGA 1DVAH 3O8DA 4X0WU 1OWJA 1FPHH 1AVWA 3HK6B 3U8OH 4Q7YA 2PGQB 3GYLB 4H6SB 3M7UA 3C27B 4DG4A 3LDXH 1Z1JA 1D3TB 2OBOA 3FZDA 4ZKSU 3KL6A 1OXGA 2DE8A 3CS7A 3BTTE 2CN0H 4B1TA 1YLDA 5G4BA 1C2GA 3ESTA 4Y0YE 1MKXK 1EPTC 3STIA 1NRRH 1O2XA 4BAQB 3PV4A 1NTPA 3U9AH 4X2WA 4UFEH 5E2OA 4ZROA 3UFAA 3QK1A 3RXQA 3P8GA 1YCPM 1AN1E 1C1QA 1VITG 2VVVA 5L30H 1O2GH 1H9HE 1C1TA 1KDQB 1MBMA 1YLCA 1XKAC 3O8CA 2UUKB 3M36A 4NIXA 1E34B 5T3HA 1GGDC 4THNH 1IQEA 2ZU2A 1Z1IA 2VWLA 4O9VA 1GG6C 1E0FD 2RDLA 1OWIA 3H7TA 1DX5M 1C5ZB 4ZHAA 4ZAEA 1BITA 1J16A 1K1OA 1PQ8A 2HNTF 1T8OA 5DP3A 1FQ3A 1O3KA 3HGPA 2WV4A 5JBTA 1ZJKA 3Q3YA 1TYNA 3DHKH 4YM9A 1PQAA 5F8ZA 5LPRA 1OKXA 2HVXA 5GXPA 5DG6A 1CBWC 3TK9A 1NO9H 4CRCA 4HGCA 1MBQA 1O2WA 1CT2E 3TITA 4ZKNU 3GYMA 2FOAA 5HM9A 1ESAA 1O2YA 4B2AA 4AFSA 1TNGA 1SBWA 2STBE 1ANCA 1OP0A 1AZ8A 1UTKA 3RC5A 3ZZ8A 1RIWB 1EP6A 1UHBA 5TCAA 3MO3A 1W13U 1ZSKA 1J9CH 2ALPA 3BTHE 2UWPA 1TNKA 4IN2A 3GDSA 1K1PA 1QB1A 2OP9A 1S5SA 1K28D 2BDBA 2BVRH 4LZ1H 3EYDA 2BD5A 1O3OA 1LVOA 5A8ZA 1C1VH 2TGTA 1MD8A 2VB0A 2JH5D 3RXMA 1TLDA 1UVPA 5A2MH 3B9FH 1V6DA 3VXFH 1QBVH 2QYIA 2XBYA 1AFEH 1B0EA 3SNCA 1O0DH 1HAIH 3EA7A 1Y5BT 3I29A 2PKAA 1O5EH 2ZIQH 1ANEA 4WMEA 2KAIB 4BNRA 1AIXH 1AO5A 1W3CA 1P9UA 1BMAA 4OGYA 1EPTB 1EJAA 1SGIB 1GMDF 1LMWB 3PWBA 2FOMB 2NU4E 1G30B 3SO3A 1GHVH 5EXLA 4RKOB 2ZU5A 4GSOA 4A92A 5JYIA 1LHEH 1CU1A 1C2MA 3QO6A 5DP8A 3OY6U 1TBRH 2VU8E 1D4PB 3DT0H 3LH1A 3S7KB 2PLXA 3UPEA 4B76A 1O2ZA 1K1IA 5FPTA 2OXSA 4Y10E 3SW2B 1GBMA 1TAWA 1GGDB 1GHYH 4FUCA 1IQFA 4MDSA 2VNTA 1O2RA 1GG6B 3ZYDA 4MVNA 2ZQ1A 3R0FA 2CJIA 3MH4A 3RXOA 2FMJA 1BTWA 1GJ7B 2A5IA 1UTOA 4ABHA 2GZ9A 1P2MA 8KME2 1SLXB 2BD2A 1YPKH 4WMDA 1NFWA 5JDUB 2R0LA 1CBWB 1TPPA 1ESBA 1GDUA 2A2XH 4BXSA 1W7XH 4BAKB 4AFZA 3GDVA 4B73A 4FXGH 4XDEA 2C8ZB 1DPOA 1SQAA 3GCNA 5ESTE 4Y8XA 2EI6A 4Y7AA 2R2MB 3BF6H 5E2PA 1TRYA 9ESTA 2TBSA 2J38A 1K21H 1ELFA 1PQ5A 1K1JA 2PHBA 4DOQA 1P9SA 3ZZ3A 1DSTA 2BLQA 2WPIS 3RXIA 2DUCA 3BTGE 1UVUH 1OX1A 2SGDE 1J17T 3RMMH 1AKSB 2BVXH 1LTOA 2GCTC 1BRAA 1CSOE 1P02A 2FX4A 1TGTA 1AHTH 1AD8H 4D7GA 5H4IB 4ZHMU 3RXKA 1GJ8B 1SGDE 1QGFA 3F9FA 5DJ7A 4ABDA 3P6ZB 3LJJA 1L4ZA 2WV5A 3VB4A 1DITH 1O5DH 1O2SA 1GBLA 2Z3CA 1WU1A 2AMQA 3UUZA 4CRGA 4K1SA 5I46H 2XCFA 2ZU3A 1GBFA 3RMNH 1DE7H 2GCHG 2C4FH 4YLUA 4BTIB 1AUTC 2BTCE 2AGIX 3GOVB 4JYUH 2PGBB 5DP9A 4ISIH 1A46H 1FMGA 5FPSA 1WUNH 1XUIA 4BANB 4AX9H 2A2QH 5EPNA 4XBCA 5FXLA 1LKBA 1EJMA 4YT6H 2OC7A 5ETXA 6GCHG 2ZTZA 2BYAX 1KIGH 5E0HA 3RXPA 2BQ7B 1C2FA 3BG4C 1OWDA 3ATWA 2BOHB 1GJCB 2BD4A 2ZTYA 4KTUA 3UQVA 2WPLS 3ZZ4A 1UK4A 2EI8A 1JWTA 1MAYA 1GJAB 4R0IA 4IBLH 1PPGE 1DUAA 3UREA 1WQSA 4X8TH 2A4RA 3QLPH 3A80A 1PJPA 5AF9H 1O32A 1BHXF 2A31A 2NU2E 2XTTB 3CENA 3NXPA 4FUJA 1RTKA 1LVMA 1MKWH 1DSUA 2BD9A 5GDSH 1F0SA 1AE8H 3ZVEA 4Y76A 1TMTH 2JETC 4WWYA 2FLRH 1TOCB 3MI4A 3PLKA 3SN8A 3SU4A 1BRBE 2ZDKA 1TWXB 1YCPH 1P3CA 3RLYH 1SGCA 2I6QA 3VEQB 4XSKU 4DT7B 3M35A 4TY7A 1N8OC 3T5FH 3ZV8A 2F9VA 1DY8A 1AU8A 1SGNE 5JB8S 2KAIA 2QA9E 2BLVA 2SGQE 3NPSA 1EPTA 1GBTA 1NC6A 3ZZDA 1ELAA 3LOXA 1NFXA 1T32A 1GBKA 3ATLA 3EA9A 1GBJA 4GUXA 1EAIA 2GVFA 4GCHG 2GCTB 1ABJH 7KMEH 3OYPA 3TH3H 1NZQH 2UUJB 4K1EA 2CMYA 4YOJA 3RC6A 3A88A 3UOPA 4A1XA 3TGIE 2BY5X 1C5QA 3P95A 4AYYB 3SJ9A 2QXIA 1SHHB 1YBWA 5EGMA 2G5NA 1KXFA 3PO1C 1EASA 1DXPA 2BY7X 2NU1E 3AW1A 2A1DB 2F9NA 5EU8A 4RN6A 2XBXA 2BDCA 1GHAF 1H9IE 1HAVB 1N6XA 1EJNA 1P05A 2ZZUH 1HAOH 2A5KA 1GVZA 3TPIZ 1IQGA 4AFUA 4SGAE 3BG4B 2QGRA 2OC8A 1YP9A 1SGYE 1V3XA 1ELDE 2F91A 3O8BA 4HZHA 1RS0A 3GDUA 3EQ0H 3MU8A 3E0PB 1OSSA 4WH6A 4AN7A 4FU7A 1L1NA 1IHTH 2XBWA 4X6PA 1O3BA 2FP7B 3FANA 1DY9A 3ODDA 1EX3A 2HWLB 1C5PA 3EE0B 3DFJA 1C5VA 3F1SB 1ELVA 2FXRA 3GY4A 2JETB 4ZXYH 4K8YA 3SU1A 4KP0A 1GPZA 1QNJA 1AY6H 1O5GH 1QURH 4DIIH 3P17H 3U1IB 4MPXA 2ZHDA 5L6NH 3V7TA 1N8OB 3A8BA 4ASHA 1LPKB 2Y5FA 1C1WH 2A7CA 1AB9C 3TNSA 2ZDAH 4XFQA 3QGJA 4DW2U 5DO4H 1HJ8A 2D26C 4JK6A 4CRDA 1HGTH 4X1PU 1KSNA 3AAUA 2HNTE 1ZRBA 1HDTH 2FM2A 4AG1A 4DJZB 1SG8B 1O34A 2WINI 3CP7A 4K1TA 1O3DA 3A7XA 3NWUA 3TGKE 3U8RH 1Y3WA 7GCHF 1KLTA 4TWWA 4NCYA 1BUIA 1GI5A 2F9UA 2NWNA 1LCYA 2BY8X 3PLBA 2GV7A 4GCHF 2BLOA 5HXFA 3PO1B 1O2QA 3GCHC 1A4WH 1D3DB 3MFJA 4NWKA 1BRUP 3VB5A 1CO7E 1OYTH 2GD4B 2ZF0H 2XRCA 1C2JA 1QTFA 1IQNA 5DP5A 2XBVA 1UVOA 3M7TA 5E0JA 1V2MT 4TPYA 2H9TH 3RXSA 3SUDA 3STJA 1O3CA 4NZLA 3ZYEA 3QZRA 1TRNA 2F83A 1WAYB 2F9PA 5T6FA 2SFAA 1ZMJA 4MNWA 4X6NA 1Z8GA 1TGSZ 2PSYA 3BTKE 1GL1A 4X6MA 5E0GA 1QIXB 1UHBB 3UQOA 1O2NA 2J94A 5J4SA 2J4IA 2V3HH 4A5TS 1MD7A 1CHOG 5JPMH 4ABFA 1C1RA 2STAE 1NFYA 1XXFA 4FUIA 1HBTH 2GGVB 4Q80A 1GI0A 3MNXA 3SU0A 3KEEA 3BV9B 1ID5H 1QQ4A 1O3NA 1AZZA 1BBRH 1O3JA 2K1QA 3SI3H 1F5LA 1YYY1 1AWFH 2FTLE 1GJ6A 3FAOA 1LKAA 1O2UA 1BOQA 1QCPA 4FVBA 3V13A 2BLWA 5L2YH 3M7QA 1AB9B 1HNEE 1HAVA 4AOQA 2QF0A 2W7SA 5DGJA 1M9UA 1C2EA 4B2CA 3SJOA 2DE9A 2D8WA 2ZDVH 4VGCC 1YPGH 1QQUA 3U98H 1PYTD 4XBDA 1RRKA 1L2EA 2AMPA 4ABIA 1VJAU 4J1YA 3VFEA 2VVUA 1ZHMA 2OINA 3SV9A 2BD8A 2BVSH 4CRFA 2O9QA 2BDAA 2XWAA 1ETSH 1ZMNA 3KCGH 3P8OA 3M37A 2YOLA 2ZC9H 3LC5A 4WF8A 4Y8ZA 2TGAA 3GISB 3N7OA 2PKSC 1EAXA 5EXNA 4CR5A 2J95A 1MZDA 1P06A 3GCHB 4YLQH 2F9OA 4D76A 5GCHF 3LONA 2CV3A 1C1NA 1TNJA 5A8XA 1Z7KA 1OP8A 1QJ1B 3LGWA 3RC4A 1TX6A 4CR9A 1BT7A 1P2QA 2BDHA 1GMDG 1UK3A 1QB9A 2SGAA 2W5EA 1Q2WA 2PTCE 3DUXH 3SI4H 2ZFFH 1TFXA 2ZFQH 1INCA 3K6YA 1GI2A 4IN1A 1V2KT 2SGEE 4IMQA 3S69A 4ZXXH 3SZNA 3M5LA 1HPGA 1UK2A 4JK5A 1Q31A 5F8TA 1V2OT 3KQCA 3T29A 4IC6A 1OWEA 1G3DA 2ODQA 1HAZB 2A7HA 4WVPE 3LIWA 3L33A 2P95A 2PUXB 1O3LA 3RU4T 1NU9A 4MPWA 4MLFB 1CGJE 3M5MA 4NIWA 5GIBA 3RXDA 1CHOF 2ZO3H 3ATKA 3GY7A 1XXDA 4WJG2 1C1MA 1IQHA 3WY8A 1XUGA 1GJ5H 1SHYA 4I8GA 1UJ1A 4UFDH 4D9RA 1FV9A 2WUBA 5C1XA 5F6MA 4NA8A 1UTLM 2ZGBH 3GY3A 3MTYA 4B71A 4O97A 2ZTXA 3NK8A 1O3MA 3KF2A 2WPKS 4FVDA 1ABIH 1NT1A 2NU0E 4MNXA 4VGCB 4LZ4B 2OLGA 2Z9GA 1BMMH 1UCYE 2AH4X 1GMHF 1N1LA 2XC5A 2QXHA 2HPQH 4K69A 4ZKRU 1T8LA 1C5XB 3OY5U 1W11U 1O37A 3UNRA 1FAXA 2PKSB 1TPAE 1ARCA 2ZA5A 2BY6X 1P57B 4IW4E 5FAHA 8ESTE 3BEUA 1ETRH 2CGAA 1XUFA 4ABEA 3PTNA 2P94A 1S84A 3TK6A 1MTUA 4BAMB 1TPOA 1YC0A 1V2JT 1QL7A 4U01A 2FO9A 3ZVGA 2OQ5A 2GP9B 1DLKB 2VINA 2OC0A 3MWIU 3TJNA 5HGGA 3TJVA 4X8UH 3VB6A 2Y80A 3SQEE 3QN7A 1KXEA 1J8AA 1SPJA 2FESH 2G55A 2UUYA 4NZQA 3M61U 1P09A 2VIDA 1SOZA 1SGEE 1DM4B 1ELGA 1EB2A 3MH6A 3VPKA 1G36A 3ZVDA 1EATA 1HAXB 1P11E 1SLWB 2ZHFH 4GPGA 2VH0A 1CA8B 2FIRH 1Y5AT 2O8UA 4I8HA 1F5RA 2B8OH 1A61H 2V35A 1P12E 2RA3A 1FIZA 2THFB 3SNDA 3SGBE 2ESTE 3T26A 4I31A 2Z9LA 3JZ1B 2AGEX 4JZIA 2VGCC 3Q76A 2CF8H 1GVKB 4DIHH 1A7SA 1BTUA 4FUFA 3UR9A 2H6MA 4FUBA 1G2LA 1C1SA 2HALA 2O8MA 2FOGA 3RXHA 1GBIA 4NGAH 1O3EA 4BTUB 3ZV9A 1FY1A 1LHFH 1O2KA 1AMHA 2FI5E 4ISOA 1SGRE 4LOYH 1Q3XA 1TBZH 2R3YA 1E38B 3RXFA 2VWMA 3TGJE 2WPHS 3UY9A 2G52A 4ABJA 2BD3A 4NG9H 3GY6A 2EA3A 4TY6A 1SMFE 1MKXH 3PYHA 2AIQA 3A8DA 4JZFH 3A7YA 2B0FA 2PTNA 1TX8A 1OYQA 3A86A 2A0QB 1B7XB 4BXWA 4INLA 2GTBA 3S0NA 1GI8B 3SHAH 2OBQA 1ZLRA 5C2ZA 3E6PH 5FBEA 3SU3A 3L6PA 1LHGH 1BMLA 3K9XB 4ISNA 3FZZA 1C5RA 1GCTC 1UCYK 2NU3E 1LQDB 3EA8A 3BEIB 2BD7A 1L1JA 1SSXA 1W10U 4ZH8A 1GHAG 1TA6A 3RXUA 1QR3E 1OPHB 1BTZA 1EZXC 1P04A 3K65B 4Y71A 4M7GA 4U30A 4AB8A 1H4WA 5E8EH 1S0QA 4OS4A 1DWDH 1EZQA 5FX6A 2C8WB 1OWHA 3G01A 1YPJH 1RXPA 1KTTB 2BM2A 1DS2E 3M3VA 1EAUA 1VR1H 2OC1A 3PMAB 3ELAH 1B5GH 4FUGA 1GMCF 2Z9JA 1O30A 8LPRA 1SFQB 1DDJA 5I25A 1J14A 2QC2A 2QF3A 1THPB 3KQDA 1A5IA 1HAPH 4MG3A 1MMJN 3M3TA 1C5WB 4QT8C 3A7VA 4X2XA 2ZGXH 3Q77A 1BTHH 1CA0C 1NRPH 1VCPA 3PWCA 3U1JB 1GHZA 2VIVA 1ZTJA 3RXAA 1NN6A 2G4UA 4X8VH 1CT4E 3E16B 1O3PB 4AORA 1VITH 3RDZA 1O2HA 3QTVH 3RXJA 2VJ1A 2VGCB 1LO6A 1W2KH 2Z7FE 2A32A 3FVFB 3DD2H 3E91A 2AFQB 1JIMA 3MU5A 1O5AB 1TGBA 1K9OE 2FOFA 1T4UH 1ZJDA 3I77A 1THSH 2ZGJA 1GI1A 2ZP0H 2ANYA 4Y79A 2OUAA 1MCVA 1HJ9A 2FODA 1C5NH 1RJXB 2FOEA 4AGJA 3OX7U 2QY0B 2V0BA 1MH0A 4NA9H 1TONA 1FONA 4IGDA 4Y0ZE 1GBHA 1F7ZA 4J2YB 4B2BA 1MAXA 1MQ6A 3QWCH 1J15A 2BDYA 3AAVA 4B74A 3W94A 1HXEH 1Y8TA 2D1JA 4E7RG 1QY6A 1MCTA 4HFPB 7GCHG 4YTAA 1O2PA 4OS1A 3RXEA 4MPVA 1UMAH 5K0HA 3ZVAA 5JBBS 2FDAA 1NU7B 1WTGH 4YT7H 2ALVA 1VGCC 5FBIA 1RFNA 3MNSA 1NFUA 1GCTB 5SGAE 5T6GA 3TLOA 3MU1A 5EODA 1MU6B 1A0JA 3M5OA 2FS9A 3A87A 2WPMS 1F5KU 1UTNA 5C1UA 1V2WT 3RM0H 5T6DA 4KTSA 1V2TT 3TJOA 3PROA 3AW0A 1BQYA 1TNHA 1F2SE 1DFPA 1C5YB 2AS9A 1GBEA 2ZCKP 1XUHA 3A7TA 2HOBA 3HGNA 3Q00A 4TYDA 1O2LA 3GICB 1P8VC 3RU4D 4LXBH 1A5GH 1FIWA 2OTVA 4OS2A 1FPCH 2FX6A 1KXAA 1CA0B 3VB7A 1HAHH 2IN2A 2P8OC 3EDXB 2Z94A 4O3TA 2PSXA 1E36B 4A1VA 3SJIA 3E8LA 1O2MA 3SV6A 1ACBE 2FS8A 1DOJA 3VGCC 1QL9A 2H5CA 1F0TA 4I33A 2W3IA 1ZGVA 2ZFRH 4XOJA 1V2UT 2G5VA 3ATIA 4E06H 1K1NA 5EOKA 4OGXA 1A3EH 4AG2A 1O36A 5IDKA 4CHAC 1XMNB 1S85A 2VIOA 5K7RA 1EZSC 1A1RA 4A7IB 4UONA 1P03A 2BXTH 4X1QU 1AWHB 1ZOMA 2EC9H 2V3OH 4YZUA 2O8TA 2Q6GA 3KQBA 1P2KA 3K6ZA 4K8BA 1TABE 1VJ9U 3IG6B 3UNQA 3P70B 2HLCA 5JBCS 1Y59T 1ZTKA 3LH3A 4Y7BA 2FYQA 4ISLA 3W95A 1IQMA 3V3MA 4NSVA 1ESTA 1W7GH 4DURA 1S82A 4NWLA 2H2ZA 2YNBA 3SORA 1S83A 5JB9S 1A0HB 2VWNA 4NSYA 1VGCB 1AQ7A 1IQJA 3NUMA 4WXVA 1SVPA 5GCHG 2ZHQH 4Q2KA 3ZZ5A 1HRTH 4ZUHA 2AMDA 3UNSA 2BB4A 2C93B 1HIAA 5HMAA 1AVXA 1FN8A 2HGTH 2P3UB 1KTSB 1TA2A 1CGIE 1FDPA 3GY2A 2GV6A 2A5AA 2ILNA 1YPHC 3D65E 1Z6JH 2VIWA 4ABGA 6ESTA 3F6UH 5LPEA 3EGKH 1HAYB 3UOUA 1KXDA 1FLEE 4JZDH 1ZHPA 2ZCLP 3U8TH 2ZPQA 1FNIA 4K2YA 5J4QA 1O5CB 3M5NA 2XC0A 3B8JA 2P16A 2AIPA 1DANH 5EQQA 5TJXA 3VXEH 1IQIA 3NCLA 2ZPSA 2VIPA 1AI8H 1T31A 2ZI2H 1EXFA 2ZU1A 4Z6AH 2P8OB 3T28A 7LPRA 5AVDA 1V2NT 1DICA 1GHWH 1AVGH 1RTFB 2F9BH 2GDEH 3BEFB 5EG4A 2ANMH 2YNAA 1S6HA 2JH0D 5AFYH 4HI3A 4I7YH 2J34A 3F9EA 2FI3E 3CS0A 3SGAE 3VGCB 4OS5A 1FAKH 1JMOH 2ZHEH 3RM2H 1XUKA 4CREA 2UUFB 5A0AE 5DKMA 2FEQH 4O03A 4DCDA 1QL8A 1W14U 3S9CA 1BMNH 2G8TA 2J9NA 1OWKA 4CHAB 1UTJA 1ELBA 8GCHF 1QBOA 1JRTA 5AHGH 5HYOA 2QXJA 3LT3A 1TB6H 1H1BA 4DGJA 3S9BA 1CVWH 1K22H 1MTNC 1ETTH 1A5HA 3DFLA 1H8DH 1PPBH 1GMHG 3RXRA 3A85A 3SU2A 3OTJE 1SGTA 1TOMH 1D3QB 3P8NA 3LGTA 4X6OA 1C2DA 3RXBA 2PUQH 4JZEH 4U32A 1QA0A 3RP2A 4ABBA 1AGJA 1HIAB 2BHGA 3A7ZA 1JOUB 4GHQA 3E0NB 3OSYA 2XC4A 4I8KA 4KKDA 1WSSH 2P3TB 3HK3B 2H5DA 3Q3XA 3RXLA 1QRXA 2BX4A 2F3CE 2FLBH 4AYVB 1IQKA 1KLIH 1CE5A 4KGAA 2JKHA 2IJOB 3UTUH 1ELCA 1RD3B 5C5OA 1PPCE 2O8WA 1QJ6B 2EEKA 1FY5A 1TQ7B 1DXWA 4AB9A 3URCA 3AASA 3K2UA 2Z9IA 4E7NA 2BZ6H 2GT8A 3D62A 3O8RA 1IQLA 1BTXA 2FWWA 1XX9A 1Z8IB 2G81E 4LK4A 1GHBF 5C20A 2I6SA 2A45B 1OS8A 3GY8A 2FOBA 1BDAA 1NM6A 4GLYA 5EQSA 2C8XB 2AGGX 4U2WA 2TGDA 1ZHRA 1GBBA 3SOSA 2ZGCA 4YESB 3LC3A 2P3FH 3RXGA 1HB0B 5PTPA 1MUEB 4BOHA 4CRAA 1DWBH 4A6LA 1TRMA 1SQTA 1XKBC 3PMJA 5GPIB 5C3NA 2FPZA 1Y3YA 2SNVA 1AUJA 2ZG0H 1DWCH 3RXCA 1F0UA 3NZIA 3TU7H 5C5NA 3SUFA 5C67A 3DA9B 3GY5A 3E1XB 4BAHB 1V2ST 2ZDMA 4FUDA 2PR3A 1KXCA 4IC5A 4Q7XA 4CBOA 5F03A 3ODFA 1DUEA 1SGFA 2AEIH 2ANKH 1C4Y2 3BIUH 1Y3UA 3S7HB 1L4DA 5BPEA 1MTNB 2IPHA 1GI7B 4OS7A 2TGPZ 3RUOA 4ZKOU 5EW1H 1O35A 4NIVA 1X7AC 4CBNA 2ZPRA 3RU4E 1A0LA 2ZFSA 4UE7H 1CT0E 5DK1A 3MNBA 1PPEE 1DLEA 2D2DA 3LGVA 3P92A 4XE4A 2HPPH 5DP4A 3A82A 1BHXB 2P59A 2ZWLH 1TGCA 2Z9KA 1D3PB 2W7UA 2C90B 3V12A 1ZR0A 1KLJH 1FY4A 4Q7ZA 3FP7E 1FZZA 4BAOB 3QTOH 1MTSA 1TNIA 1XVMA 3UWIA 1JRSA 2ZFPH 1WV7H 1N6YA 2SGFE 1C5UA 4TWYA 1W8BH 2BY9X 2WYJA 3BG8A 1GI6A 2ZU4A 1BTYA 1OP2A 5AFZH 1G37A 1IHSH 5CHAC 1YPMH 1L1GA 4F4OC 1BJUA 1BA8B 1EB1H 3ZZ9A 2Y5HA 1S6FA 1Z71A 1GMCG 1FY8E 3KQEA 3VB3A 1GI4A 1UTMA 3BTME 1GDQA 5B6OA 1SGPE 2QAAA 3SJ8A 1CHGA 3QUMP 1TMUH 1QB6A 2ZGHA 4GHTA 1O3HA 2Y7XA 1RGQA 4AFQA 4X1RU 1MQ5A 2GKVE 3GCTF 1TX7A 1GJ4H 5HM2A 4A1TA 1SLUB 4X2YA 3HKIB 3IITA 3BTEE 4MNYA 3TNTA 1HJAC 3HKJB 1ANDA 1O2JA 1NY22 1MU8B 1PYTC 1O39A 4UFGH 1ZPCA 5CE1A 1SQOA 2FZZA
chains in the Genus database with same CATH superfamily
4ZCNA 2TRMA 3SZEA 1C9TA 1A3BH 2CXVA 1S81A 1MKWK 5DP6A 1KY9A 1YM0A 1E1RD 2JIZD 4B75A 4UDWH 2Q1JA 1LPGB 4FU9A 1BMFD 3ENSB 2YMSC 2ZKSA 3FP8E 2GT7A 4JCNA 2B7DH 1BZXE 2Z3EA 4IMZA 1Z6EA 1PPFE 2ASUB 4UEHH 1WTHD 1MZAA 1YCPK 4KTCA 4ZMAH 1ORFA 3D23A 3BIVH 3KNXA 5EW2H 2ZCHP 1T8MA 1GBCA 4FUHA 3WW7A 1Z8JB 5EQRA 5IYTA 1PPZA 4ISHH 1H8IH 2ZDNA 4IS5A 5FX5A 4INKA 3RLWH 2VWOA 1UVTH 1TQ0B 2K8IA 1LVYA 2CHAC 3FN8A 1IOEA 1VCWA 2OD3B 3TIUA 2XNIA 2GMTC 4BTTB 3ITIA 2VH6A 1C1OA 1XUJA 1BIOA 3D49H 3BTQE 2KR7A 1FN6A 2ZECA 1VITF 3ZZBA 1TNLA 1TMBH 3ZZ6A 4K3JA 1NRSH 1C2IA 3KHVA 1V2RT 2PW8H 3RXTA 1GBAA 3E3TA 5CHAB 3QDZB 3S9AA 2H9HA 2LELA 2C3SA 2ODPA 3BTDE 4X8SH 2JJ2D 2LNCA 3MHWU 3PTBA 3UR6A 1W12U 1C4U2 1ZGIA 3AVZA 1NS3A 2Z6BD 1ELTA 2BQWB 4O3UA 4XRNA 3BSQA 5KEDA 1T8NA 2TPIZ 1O5FH 1ZPBA 2ODYB 1A2CH 4YOGA 4FU8A 3F9HA 4RSPA 1BBRE 1K1LA 4ESTE 1LDTT 1KDQA 1HJAB 1EAWA 1ARBA 4R8TB 2PFEA 1XVOA 1O3IA 1TPSA 1VCQA 2Q6DA 1Y3XA 1HXFH 5BRRE 3FFGA 1P10A 3QX5H 4GVUA 2VVCA 3EAJA 3ZZCA 1O2OA 1GCDA 5CHBA 2FI4E 2YMSB 4H42U 1VZQH 3RMLH 3T62A 1BJVA 5F8XA 2GZ7A 3LGIA 4F48B 1P2OA 2QCYA 4UD9H 3SBKA 1SGQE 1TIOA 3SV2H 4SGBE 3LGYA 1QHRB 2ZHWH 1HAGE 3FP6E 1PQ7A 2FOHA 1LPZB 1LHDH 3M3SA 1NRQH 4INHA 1O2VA 3OU0A 4MTBA 3MYWA 4MQAA 3L3TA 2BQ6B 5C1YA 4ASUD 2G51A 1WYKA 3B23B 2CHAB 3IWMA 1HLTH 2WPDD 1ZZZA 4WH8A 4Y11E 1YPEH 2EI7A 1GBDA 1E35B 2GMTB 7ESTE 1TBQH 2AYWA 2BX3A 4FUEA 5ABWA 5GJ4B 3A89A 1THRH 2B9LA 1MTWA 1B0FA 2ZFTA 2RCEA 5HIZA 5EXMA 2QXGA 1V2QT 5FCRA 3TJUA 1G3EA 2TIOA 2W3KA 4JZ1A 2ANWA 1O3FA 1D6WA 1FI8A 2O8LA 2XW9A 2RDEA 4D8NA 2IOTA 4E05H 1O5BB 1GWAA 2HNTC 4WXIA 1S0RA 1QA7A 2BZAA 3NKKA 1E37B 5A09A 4Y6DA 3SU5A 1D6RA 2XXLA 3A8CA 2H1UA 3MQKC 1C5MD 3HATH 2FOCA 3JZ2B 4RT0A 2SGPE 2OQUA 1EP5A 1ZSJA 2A4GA 2VIQA 4JYVH 4K5ZA 2C8YB 3SGQE 4I32A 1JIRA 1S6LA 5A0BA 1YKTA 3T2NA 3SNBA 3BTFE 3LPRA 1GJ9B 3UWJH 2ZEBA 1C5OH 1SB1H 3TK5A 4YOIA 1UO6A 4AZ2B 3MU0A 1DT2A 1PFXC 3MNCA 1NRNH 3SU6A 4MNVA 1UTPA 1K1MA 4X2VA 2UWLA 3GCOA 2WYGA 1BTPA 3ATMA 2B5TB 1EOLA 2R0KA 1E79D 5LH8A 1UTQA 4MPUA 4DY7B 1NROH 1QRZA 1YWUA 2WPJS 1ZTLA 1WBGB 1HCGA 1O3AA 1GJDB 1GI9B 1BBRK 2KM0A 3QZQA 3F0PA 4WY3A 8GCHG 1V2VT 1GDNA 1UCYH 4ABAA 5CMXH 1SLVB 2Q6FA 3T25A 1SR5C 2G4TA 5T1VA 3ZIAD 3I78A 3TH4H 1EQ9A 1GI3A 5GWZA 3KGPA 5LPFA 1O3GA 1C5SA 3Q3KA 3A84A 3HPTB 2IJD1 2CF9H 4KELA 1XM1A 1G32B 2GCHF 6LPRA 1NPMA 1TGNA 2FTMA 4I8JA 2XCNA 1L0ZA 3F9GA 1MTVA 1EOJA 1P01A 3BN9A 3ZVFA 3VG8A 2HRVA 4XBBA 1C1UH 1UVSH 4I8LA 2R2WU 6GCHF 5EJ1A 1AKSA 3RMOH 2Y7ZA 3KN2A 1HV7A 3ZZAA 2QN5T 4RKJB 1KYNA 1VKYA 1WDIA 4CH8B 1F92A 3QGNB 1WCZA 4NIYA 1U6QA 3LKWA 3LJOA 1F0RA 1GVLA 1T4VH 1BB0B 1KXBA 3V0XA 2H9EH 1YGCH 3MO9A 1LHCH 1W0ZU 2J2UA 4HTCH 2ZDLA 4CRBA 5C94A 1GL0E 1C2LA 1SI5H 3EE7A 2RA0A 3H7OA 1PPHE 1QJ7B 1P0SH 4H4FA 1SOTA 1GHBG 4YO9A 9LPRA 4JMYA 4UFFH 1ZPZA 1ELEE 4TPIZ 3A8AA 1FXYA 5FCKA 5DPAA 3PMHB 2GDDA 5FPYA 3SJKA 3SNAA 4GAWA 2Y6TA 1EUFA 4F49A 3PV2A 2QIQA 2A7JA 5DP7A 5LGOA 1BRCE 1JBUH 6CHAC 4AGKA 4OM9A 3R3GB 3TVJB 1Y5UT 3H5CB 5TCCA 1QRWA 1LQEA 1ZRKA 1CGHA 1ZYOA 2R9PA 1AFQC 1WOFA 2M5TA 2XWBI 3LU9B 4H6TA 1JXPA 1W0YH 2Z3DA 1BCUH 3SV7A 2G00A 3DSGA 2RG3A 3SV8A 1P2NA 1HFDA 1ZSLA 4OS6A 1YF4A 2JH6D 1G9IE 1O2IA 2OCVB 2BDIA 1P3EA 4DVAU 1FUJA 1V2LT 4NFFA 3ZVBA 3F68H 3OE7D 2BOKA 1D9IA 1QBNA 5A8YA 2ZQ2A 1C4V2 2R3UA 3MMGA 1K2I1 3MH5A 4Y8YA 2QV1A 3A7WA 1G2MA 2WHXA 1V2PT 2GX4A 3MH7A 5FHTA 3U69H 2LPRA 3KIDU 1IAUA 3SHCH 3UAIC 1RTLA 2Y5GA 3KQ5A 1QFKH 3PM3A 3ZZ7A 1AE5A 1SC8U 2A4QA 2AERH 1GHXH 3PMBB 4DT4A 1T7CA 3MU4A 3P8FA 4Z0KA 2P93A 4PROA 3SNEA 3MOCA 1WXRA 1SL3A 2W26A 3DSOA 3TH2H 2PV9B 2KZ4A 3BTWE 2ULLA 1TE0A 3MO6A 3SUEA 1ZMLA 3U28C 4ZHLU 1YPLH 1Y3VA 5EPYA 1SFIA 1H9LB 1O2TA 1C2HA 1SGFG 4X1SU 1OOKB 3UIRA 1DWEH 2J92A 4K60A 2WUCA 2FYRA 1FY3A 1ANBA 1Z8RA 4X1NU 2Y81A 5L2ZH 3URDA 1G3CA 3PLPA 2BXUH 2PKAB 4D7FA 2BMGB 1G3BA 4WMFA 1EZUC 4NA7A 3T27A 2UWOA 2A4OA 1C9PA 1HYLA 3PB1E 3ZVCA 5IK2D 1C5TA 1O31A 2GZ8A 3A81A 5ESBA 1FJSA 1HUTH 3GCTG 3C1KA 1TALA 3E90B 6CHAB 2F4LA 3SUGA 3SQHE 2PWXA 1CQQA 4NFEA 1LVBA 2ZNKH 3RXVA 1O33A 1O38A 4JYTA 2Y82A 1RIWC 2XYAA 1AFQB 3A83A 1C5LH 2V6NA 4RT1A 4D9QA 1C2KA 1WQVH 2SNWA 4CH2B 1NESE 1C1PA 1GJBB 1YPHE 1P2IA 3LGUA 1P2JA 5JBAS 5A0CA 1EKBB 1W0JD 1DVAH 2BDGA 2WZQA 3UB0A 3O8DA 4X0WU 1OWJA 1FPHH 1AVWA 3HK6B 3U8OH 4Q7YA 2PGQB 3GYLB 4H6SB 3M7UA 3C27B 4TT3D 4DG4A 3LDXH 1Z1JA 1D3TB 2OBOA 3FZDA 2PP6A 4ZKSU 3KL6A 1OXGA 2DE8A 3CS7A 3BTTE 2CN0H 4B1TA 1YLDA 5G4BA 1C2GA 3ESTA 4Y0YE 1MKXK 1EPTC 3STIA 1NRRH 1O2XA 4BAQB 2LP6A 3PV4A 1NTPA 3U9AH 4X2WA 4UFEH 3KYFA 5E2OA 4ZROA 3UFAA 3QK1A 3RXQA 3P8GA 1YCPM 1AN1E 1C1QA 1VITG 2VVVA 5L30H 1O2GH 1H9HE 1C1TA 1KDQB 1MBMA 1YLCA 1XKAC 3O8CA 2UUKB 3M36A 4NIXA 1E34B 5T3HA 1GGDC 4THNH 1IQEA 2ZU2A 1Z1IA 2VWLA 4O9VA 1GG6C 1E0FD 2RDLA 1OWIA 3H7TA 1DX5M 1C5ZB 2AHME 4ZHAA 4ZAEA 1BITA 3OTPA 1J16A 1K1OA 1PQ8A 2HNTF 1T8OA 5DP3A 1FQ3A 1O3KA 3HGPA 2WV4A 5JBTA 1ZJKA 3Q3YA 2K0QA 1TYNA 3DHKH 4YM9A 1PQAA 5F8ZA 5LPRA 1OKXA 2HVXA 5GXPA 5DG6A 1CBWC 3TK9A 1NO9H 4CRCA 4HGCA 1MBQA 1O2WA 1CT2E 3TITA 4ZKNU 3GYMA 4HG6A 2FOAA 5HM9A 1ESAA 1O2YA 4B2AA 4AFSA 1TNGA 1SBWA 2STBE 1ANCA 1OP0A 1AZ8A 5C0UA 1UTKA 3RC5A 3ZZ8A 1RIWB 1EP6A 1UHBA 5TCAA 3MO3A 1W13U 1ZSKA 1J9CH 2ALPA 3BTHE 2UWPA 1TNKA 4IN2A 3GDSA 1K1PA 1QB1A 2OP9A 1S5SA 1K28D 2BDBA 2BVRH 4LZ1H 3EYDA 2BD5A 1O3OA 1LVOA 5A8ZA 1C1VH 2TGTA 1MD8A 2VB0A 2JH5D 3RXMA 1TLDA 1UVPA 5A2MH 3B9FH 1V6DA 3VXFH 3PRDA 1QBVH 2QYIA 2XBYA 1AFEH 1B0EA 3SNCA 1O0DH 1HAIH 3EA7A 1Y5BT 4FOUC 3I29A 2PKAA 1O5EH 2ZIQH 1ANEA 4WMEA 2KAIB 4BNRA 1AIXH 1AO5A 4F55A 1W3CA 1P9UA 1BMAA 4OGYA 1EPTB 1EJAA 5HKKD 1SGIB 1GMDF 1LMWB 3PWBA 3F2HA 2FOMB 2NU4E 1G30B 3SO3A 1GHVH 5EXLA 4RKOB 2ZU5A 4GSOA 4A92A 5JYIA 1LHEH 1CU1A 1C2MA 3QO6A 5DP8A 3OY6U 1TBRH 2VU8E 1D4PB 3DT0H 3LH1A 3S7KB 2PLXA 3UPEA 4B76A 1O2ZA 1K1IA 5FPTA 2OXSA 4Y10E 3SW2B 1GBMA 1TAWA 1GGDB 1GHYH 4FUCA 1IQFA 4MDSA 2VNTA 1O2RA 1GG6B 3ZYDA 4MVNA 2ZQ1A 3DCLA 3R0FA 2CJIA 3MH4A 3RXOA 2FMJA 1BTWA 1GJ7B 2A5IA 1UTOA 4ABHA 2GZ9A 1P2MA 8KME2 1SLXB 2BD2A 4Z1MD 1YPKH 4WMDA 1NFWA 5JDUB 2R0LA 1CBWB 1TPPA 1ESBA 1COWD 1GDUA 2A2XH 4BXSA 1W7XH 4BAKB 4AFZA 3GDVA 4B73A 4FXGH 4XDEA 2C8ZB 1DPOA 1SQAA 3GCNA 5ESTE 4Y8XA 2EI6A 4Y7AA 2R2MB 3BF6H 5E2PA 1TRYA 9ESTA 2TBSA 2J38A 1K21H 1ELFA 1PQ5A 1K1JA 2PHBA 4DOQA 1P9SA 3N7DA 3ZZ3A 1DSTA 2BLQA 2WPIS 3RXIA 2DUCA 3BTGE 1UVUH 1OX1A 2SGDE 1J17T 3RMMH 1AKSB 2BVXH 1LTOA 2GCTC 1BRAA 1CSOE 1P02A 2FX4A 1TGTA 1AHTH 1AD8H 2QE7D 4D7GA 5H4IB 4ZHMU 3RXKA 1GJ8B 1SGDE 1QGFA 3F9FA 5DJ7A 4ABDA 3P6ZB 3LJJA 1L4ZA 2WV5A 3VB4A 1DITH 1O5DH 1O2SA 1GBLA 2Z3CA 1WU1A 2AMQA 3UUZA 4CRGA 4K1SA 5I46H 2XCFA 2ZU3A 1GBFA 3RMNH 1DE7H 4B6FA 2GCHG 2C4FH 4YLUA 4BTIB 1AUTC 2BTCE 2AGIX 3GOVB 4JYUH 2PGBB 5DP9A 4ISIH 1A46H 1FMGA 5FPSA 1WUNH 1XUIA 4BANB 4AX9H 2A2QH 5EPNA 4XBCA 5FXLA 1LKBA 1EJMA 4YT6H 2OC7A 5ETXA 3OEED 6GCHG 2ZTZA 2BYAX 1KIGH 2QF4A 5E0HA 2BQ7B 3RXPA 1C2FA 3BG4C 1OWDA 3ATWA 2BOHB 1GJCB 2BD4A 2ZTYA 4KTUA 3UQVA 2WPLS 3ZZ4A 1UK4A 2EI8A 1JWTA 1MAYA 1GJAB 3NRLA 4R0IA 4IBLH 1PPGE 1UW7A 1DUAA 3UREA 1WQSA 4X8TH 2A4RA 3QLPH 3A80A 1PJPA 5AF9H 3F0OA 1O32A 1BHXF 2A31A 2NU2E 2XTTB 3CENA 3NXPA 4FUJA 1RTKA 1LVMA 1MKWH 1DSUA 2BD9A 5GDSH 1F0SA 1AE8H 3ZVEA 4Y76A 4B6EA 1TMTH 2J98A 2JETC 4WWYA 2FLRH 3FO8D 1TOCB 3MI4A 3PLKA 3SN8A 3SU4A 4ACBA 1BRBE 2ZDKA 1TWXB 1YCPH 1P3CA 3RLYH 1SGCA 5CDFE 2I6QA 3VEQB 4XSKU 4DT7B 3M35A 4TY7A 1N8OC 3T5FH 3ZV8A 2F9VA 1DY8A 1AU8A 1SGNE 5JB8S 2KAIA 2QA9E 2BLVA 2SGQE 3F2GA 3NPSA 1EPTA 1GBTA 1NC6A 3ZZDA 1ELAA 3LOXA 1NFXA 1T32A 1GBKA 1QZ8A 3ATLA 1GBJA 3EA9A 4GUXA 1EAIA 2GVFA 4GCHG 2GCTB 1ABJH 7KMEH 3OYPA 3TH3H 1NZQH 2UUJB 4K1EA 2XOKD 2CMYA 4YOJA 2XNDD 3RC6A 3A88A 3UOPA 4A1XA 3AK5A 3TGIE 2BY5X 1C5QA 3P95A 4AYYB 3SJ9A 2QXIA 1SHHB 1YBWA 5EGMA 2G5NA 1KXFA 3PO1C 1EASA 1DXPA 2BY7X 2NU1E 3AW1A 2A1DB 2F9NA 5EU8A 4RN6A 2XBXA 2BDCA 1GHAF 1H9IE 1HAVB 1N6XA 1EJNA 1P05A 2ZZUH 1HAOH 2A5KA 2EY4C 1GVZA 3TPIZ 1IQGA 4AFUA 4SGAE 3BG4B 2QGRA 2OC8A 1YP9A 1SGYE 1V3XA 1ELDE 2F91A 3O8BA 4HZHA 1RS0A 3GDUA 3EQ0H 1OHHD 3MU8A 3E0PB 1OSSA 4WH6A 4AN7A 4FU7A 1L1NA 1IHTH 2XBWA 4X6PA 1O3BA 2FP7B 3FANA 1DY9A 3ODDA 1EX3A 2HWLB 1C5PA 3EE0B 3DFJA 1C5VA 3F1SB 1ELVA 2FXRA 3GY4A 2JETB 4ZXYH 4K8YA 3SU1A 4KP0A 4YXWD 1GPZA 1QNJA 1AY6H 1O5GH 1QURH 4DIIH 3P17H 3U1IB 4MPXA 2ZHDA 5L6NH 2KX4A 3V7TA 3PV5A 1N8OB 3A8BA 4ASHA 1LPKB 2Y5FA 1C1WH 2L6OA 2A7CA 2WSSD 1AB9C 3TNSA 2ZDAH 4XFQA 3QGJA 4DW2U 5DO4H 1HJ8A 2D26C 4JK6A 4CRDA 1HGTH 4X1PU 1KSNA 3AAUA 3FKSD 2HNTE 1ZRBA 1HDTH 2FM2A 4AG1A 4DJZB 1SG8B 1O34A 2KFWA 2WINI 3CP7A 4K1TA 1O3DA 3A7XA 3NWUA 3TGKE 3U8RH 1Y3WA 7GCHF 1KLTA 4TWWA 4NCYA 1BUIA 1GI5A 2F9UA 2NWNA 1LCYA 2BY8X 3PLBA 2GV7A 4GCHF 2BLOA 3OAAD 3PO1B 5HXFA 1O2QA 3GCHC 1A4WH 1D3DB 1E1QD 3MFJA 4NWKA 1BRUP 5HIYA 1CO7E 3VB5A 1OYTH 2GD4B 2ZF0H 2XRCA 3F2FA 1C2JA 1QTFA 1IQNA 5DP5A 2XBVA 1UVOA 3M7TA 5E0JA 1V2MT 4TPYA 2H9TH 3RXSA 3SUDA 3STJA 1O3CA 4NZLA 3ZYEA 3QZRA 1TRNA 2F83A 1WAYB 2F9PA 5T6FA 2SFAA 1ZMJA 4MNWA 4X6NA 1Z8GA 1TGSZ 2PSYA 3BTKE 1GL1A 4X6MA 5E0GA 1QIXB 1UHBB 3UQOA 1O2NA 3PRBA 2J94A 5J4SA 2J4IA 2V3HH 4A5TS 1MD7A 3OFND 1CHOG 5JPMH 4ABFA 1C1RA 2STAE 1NFYA 1XXFA 4FUIA 1HBTH 2GGVB 4Q80A 1GI0A 3MNXA 3SU0A 3KEEA 3BV9B 1ID5H 1QQ4A 1O3NA 1AZZA 1BBRH 1O3JA 2K1QA 3SI3H 1F5LA 1YYY1 1AWFH 2FTLE 2KCAA 1GJ6A 4P02A 4AC9A 3FAOA 1LKAA 5KGOA 1O2UA 1BOQA 1QCPA 4FVBA 3V13A 2BLWA 5L2YH 3M7QA 1AB9B 1HNEE 1HAVA 4AOQA 2QF0A 2W7SA 5DGJA 1M9UA 1C2EA 4B2CA 3SJOA 2DE9A 2D8WA 2ZDVH 4VGCC 1YPGH 3SYJA 1QQUA 3U98H 1PYTD 4XBDA 1RRKA 1L2EA 2AMPA 4ABIA 1VJAU 4J1YA 3VFEA 2VVUA 1ZHMA 2OINA 3SV9A 2BD8A 2BVSH 4CRFA 2O9QA 2BDAA 2XWAA 1ETSH 1ZMNA 3KCGH 2YMSD 3P8OA 3M37A 4P00A 2YOLA 2ZC9H 3LC5A 4WF8A 4Y8ZA 2TGAA 3GISB 3N7OA 2PKSC 1EAXA 5EXNA 4CR5A 2J95A 1MZDA 1P06A 3GCHB 4YLQH 2F9OA 4D76A 5GCHF 3LONA 2CV3A 1C1NA 4FETA 1TNJA 5A8XA 1Z7KA 1OP8A 1QJ1B 3LGWA 3RC4A 1TX6A 4CR9A 1BT7A 1P2QA 2BDHA 1GMDG 1UK3A 1QB9A 2SGAA 2W5EA 1Q2WA 2PTCE 1SQRA 3DUXH 3SI4H 2ZFFH 1TFXA 2ZFQH 1INCA 3K6YA 1GI2A 4IN1A 1V2KT 2SGEE 4IMQA 3S69A 4ZXXH 3SZNA 3M5LA 1HPGA 1UK2A 4JK5A 1Q31A 5F8TA 1V2OT 1FX0B 3KQCA 3T29A 4IC6A 2WV9A 1OWEA 1G3DA 2ODQA 1EFRD 1HAZB 2A7HA 2EQNA 4WVPE 3LIWA 3L33A 2P95A 2PUXB 1O3LA 3RU4T 1NU9A 4MPWA 4MLFB 1CGJE 3M5MA 4NIWA 5GIBA 3RXDA 1CHOF 2ZO3H 3ATKA 3GY7A 1XXDA 4WJG2 1C1MA 1IQHA 3WY8A 1XUGA 1GJ5H 1SHYA 4I8GA 1UJ1A 4UFDH 4D9RA 1FV9A 2WUBA 5C1XA 5F6MA 4NA8A 1UTLM 2ZGBH 3GY3A 3MTYA 4B71A 4O97A 2L74A 2ZTXA 2RFKC 3NK8A 1O3MA 3KF2A 2WPKS 4FVDA 1ABIH 1NT1A 2NU0E 4MNXA 4VGCB 4LZ4B 2OLGA 2Z9GA 1BMMH 1UCYE 2AH4X 1GMHF 1N1LA 2XC5A 2QXHA 5KECA 2HPQH 4K69A 4ZKRU 1T8LA 1C5XB 3OY5U 1W11U 1O37A 5F53A 3UNRA 1FAXA 2PKSB 1TPAE 1ARCA 2ZA5A 2BY6X 1P57B 4IW4E 5FAHA 8ESTE 3BEUA 1ETRH 2CGAA 3FOAA 1XUFA 4ABEA 3PTNA 2P94A 1S84A 3TK6A 1MTUA 4BAMB 1TPOA 1YC0A 1V2JT 1QL7A 4U01A 2FO9A 2J98B 3ZVGA 2OQ5A 2HLDD 2GP9B 1DLKB 2VINA 2OC0A 3MWIU 3TJNA 5HGGA 3TJVA 4X8UH 3VB6A 2Y80A 3SQEE 3QN7A 1KXEA 1J8AA 2J5UA 1SPJA 2FESH 2G55A 2UUYA 4NZQA 3M61U 1P09A 2VIDA 1SOZA 1SGEE 1DM4B 1ELGA 1EB2A 3MH6A 3VPKA 1G36A 3ZVDA 1EATA 1HAXB 1P11E 1SLWB 2ZHFH 4GPGA 2VH0A 1CA8B 2FIRH 1Y5AT 2O8UA 1K0HA 4I8HA 1F5RA 2B8OH 1A61H 2V35A 1P12E 2RA3A 1FIZA 2THFB 3SNDA 3SGBE 2ESTE 3T26A 4I31A 2Z9LA 3JZ1B 2AGEX 4JZIA 2VGCC 3Q76A 2CF8H 1GVKB 4DIHH 1A7SA 1BTUA 4FUFA 3UR9A 2H6MA 4FUBA 1G2LA 1C1SA 2HALA 2FOGA 2O8MA 3RXHA 1GBIA 4NGAH 1O3EA 4BTUB 3ZV9A 1FY1A 1LHFH 1O2KA 1AMHA 2FI5E 4ISOA 1SGRE 4LOYH 1Q3XA 1TBZH 2R3YA 2KCPA 1E38B 3RXFA 2VWMA 3TGJE 2WPHS 3UY9A 2G52A 3N7EA 4ABJA 2BD3A 4NG9H 3GY6A 2EA3A 4TY6A 1SMFE 1MKXH 2J97A 3PYHA 2AIQA 3A8DA 4JZFH 3A7YA 2B0FA 2PTNA 1TX8A 1OYQA 3A86A 2A0QB 1B7XB 4BXWA 4INLA 1H8ED 2GTBA 3S0NA 1GI8B 2JJ1D 3SHAH 2OBQA 1ZLRA 5C2ZA 4ACAA 3E6PH 5FBEA 1MABB 3SU3A 3L6PA 1LHGH 1BMLA 3K9XB 4ISNA 3FZZA 1C5RA 1GCTC 1UCYK 2NU3E 4Q4LA 1LQDB 3EA8A 3BEIB 2BD7A 1L1JA 1SSXA 1W10U 4ZH8A 1GHAG 1TA6A 3RXUA 1QR3E 1OPHB 1BTZA 1EZXC 1P04A 3K65B 4Y71A 4M7GA 4U30A 4AB8A 1H4WA 5E8EH 1S0QA 3DSPA 4OS4A 1DWDH 1EZQA 5FX6A 2C8WB 1OWHA 3G01A 1YPJH 1RXPA 1KTTB 2BM2A 1DS2E 3M3VA 1EAUA 1VR1H 2OC1A 3PMAB 3ELAH 1B5GH 4FUGA 1GMCF 3W1EA 2Z9JA 1O30A 8LPRA 1SFQB 3CNRA 4TSFD 1DDJA 5I25A 1J14A 2QC2A 2QF3A 1THPB 3WWFA 3KQDA 1A5IA 1HAPH 4MG3A 1MMJN 3M3TA 1C5WB 4QT8C 3A7VA 4X2XA 2ZGXH 2JDID 3Q77A 1BTHH 1CA0C 1NRPH 1VCPA 3PWCA 2F43B 3U1JB 4Q63A 1GHZA 2VIVA 1ZTJA 3RXAA 1NN6A 2G4UA 4X8VH 1CT4E 3E16B 1O3PB 4AORA 1VITH 3RDZA 1O2HA 3QTVH 3RXJA 2VJ1A 2VGCB 1LO6A 1W2KH 2Z7FE 2A32A 3FVFB 3DD2H 3E91A 2AFQB 1JIMA 3MU5A 1O5AB 1TGBA 1K9OE 2FOFA 1T4UH 1ZJDA 3I77A 5C0TA 1THSH 2ZGJA 1GI1A 2ZP0H 2ANYA 4Y79A 2OUAA 1MCVA 1HJ9A 2FODA 1C5NH 1RJXB 2FOEA 4AGJA 1KMHB 2QY0B 3OX7U 2V0BA 1MH0A 4NA9H 1TONA 1FONA 4IGDA 4Y0ZE 1GBHA 1F7ZA 4J2YB 4B2BA 1MAXA 1MQ6A 3QWCH 1J15A 2BDYA 3AAVA 4B74A 5C17A 3W94A 1HXEH 1Y8TA 2D1JA 4E7RG 1QY6A 1MCTA 4HFPB 7GCHG 4YTAA 1O2PA 1YLNA 4OS1A 3RXEA 4MPVA 1UMAH 5K0HA 3ZVAA 2V3MA 5JBBS 2FDAA 1NU7B 1WTGH 5DN6D 4YT7H 2ALVA 4XD7D 1VGCC 5FBIA 1RFNA 3MNSA 1NFUA 1GCTB 5SGAE 5T6GA 3TLOA 3MU1A 5EODA 1MU6B 1A0JA 3M5OA 2FS9A 3A87A 2WPMS 1F5KU 1UTNA 2W6JD 5C1UA 1V2WT 3RM0H 5T6DA 4I86A 4KTSA 1V2TT 3TJOA 3PROA 3AW0A 1BQYA 1TNHA 1F2SE 1DFPA 1C5YB 2AS9A 1GBEA 2ZCKP 1XUHA 3A7TA 2HOBA 3HGNA 3Q00A 4TYDA 1O2LA 3GICB 1P8VC 3RU4D 4LXBH 1A5GH 1FIWA 2OTVA 4OS2A 1FPCH 2FX6A 1KXAA 1CA0B 3VB7A 1HAHH 2IN2A 2P8OC 1W0KD 2Z94A 3EDXB 2OK5A 4O3TA 2PSXA 1E36B 5EJLA 4A1VA 3SJIA 3E8LA 1NBMD 3GS9A 1O2MA 3SV6A 1ACBE 2FS8A 1DOJA 3VGCC 1QL9A 2H5CA 1F0TA 4I33A 2W3IA 1ZGVA 2ZFRH 4XOJA 1V2UT 2G5VA 3ATIA 4E06H 3N99A 1K1NA 5EOKA 4OGXA 1A3EH 4AG2A 1O36A 5IDKA 4CHAC 1XMNB 1S85A 2VIOA 5K7RA 1EZSC 1A1RA 4A7IB 4UONA 1P03A 2BXTH 4X1QU 1AWHB 1ZOMA 2EC9H 2V3OH 4YZUA 2O8TA 2Q6GA 3KQBA 1P2KA 3K6ZA 4K8BA 1TABE 1VJ9U 3IG6B 3UNQA 3P70B 2HLCA 5JBCS 1Y59T 1ZTKA 3LH3A 4Y7BA 2FYQA 4ISLA 3W95A 1IQMA 3V3MA 4NSVA 1ESTA 1W7GH 4DURA 1S82A 4NWLA 2H2ZA 2YNBA 3SORA 1S83A 5JB9S 1A0HB 2VWNA 3WWBA 4NSYA 1VGCB 1AQ7A 1IQJA 5EJZA 3NUMA 4WXVA 2HVYB 1SVPA 5GCHG 2ZHQH 4Q2KA 3ZZ5A 1HRTH 2QF5A 4ZUHA 2AMDA 3UNSA 2BB4A 2C93B 1HIAA 5HMAA 2KCYA 1AVXA 1FN8A 2HGTH 2P3UB 1KTSB 1TA2A 1CGIE 1FDPA 3GY2A 2GV6A 2A5AA 2ILNA 1YPHC 3D65E 1Z6JH 2VIWA 4ABGA 6ESTA 3F6UH 5LPEA 3EGKH 1HAYB 3F3BA 4RI0A 3UOUA 1KXDA 1FLEE 4JZDH 1ZHPA 2ZCLP 3U8TH 2ZPQA 1FNIA 4K2YA 5J4QA 1O5CB 3M5NA 2XC0A 3B8JA 2P16A 2AIPA 1DANH 5EQQA 5TJXA 3VXEH 1IQIA 3NCLA 2ZPSA 2VIPA 1AI8H 1T31A 2ZI2H 1EXFA 2ZU1A 4Z6AH 2P8OB 3T28A 7LPRA 5AVDA 1V2NT 1DICA 1GHWH 1AVGH 1RTFB 2F9BH 2GDEH 3BEFB 5EG4A 2ANMH 2YNAA 1S6HA 2JH0D 5AFYH 4HI3A 4I7YH 2J34A 3F9EA 2FI3E 3CS0A 3SGAE 3VGCB 4OS5A 1FAKH 1JMOH 2ZHEH 3RM2H 1XUKA 4CREA 2UUFB 5A0AE 5DKMA 2FEQH 2IPQX 4O03A 4DCDA 1QL8A 1W14U 3S9CA 1BMNH 2G8TA 2J9NA 1OWKA 4CHAB 1UTJA 1ELBA 5B6LA 8GCHF 1QBOA 1JRTA 5AHGH 5HYOA 2QXJA 3LT3A 1TB6H 1H1BA 4DGJA 3S9BA 1CVWH 1K22H 1MTNC 1ETTH 1A5HA 3DFLA 1H8DH 1PPBH 1GMHG 3RXRA 3A85A 3SU2A 3OTJE 1SGTA 1TOMH 1D3QB 3P8NA 3LGTA 4X6OA 1C2DA 3RXBA 2PUQH 4JZEH 4U32A 1QA0A 3RP2A 4ABBA 1AGJA 1HIAB 2BHGA 3A7ZA 1JOUB 4GHQA 3E0NB 3OSYA 2XC4A 4I8KA 4KKDA 1WSSH 2P3TB 3HK3B 2H5DA 3Q3XA 3RXLA 1QRXA 2BX4A 2F3CE 2FLBH 4AYVB 1IQKA 1KLIH 1CE5A 4KGAA 2JKHA 2IJOB 3UTUH 1ELCA 1RD3B 5C5OA 1PPCE 2O8WA 1QJ6B 2EEKA 1FY5A 1TQ7B 1DXWA 4AB9A 3URCA 3AASA 3K2UA 2Z9IA 4E7NA 2BZ6H 2GT8A 3D62A 5FL7D 3O8RA 1IQLA 1BTXA 2FWWA 1XX9A 1Z8IB 2G81E 4LK4A 1GHBF 5C20A 2I6SA 2A45B 1OS8A 3GY8A 2FOBA 1BDAA 1NM6A 4GLYA 5EQSA 2C8XB 2AGGX 4U2WA 2TGDA 1ZHRA 1GBBA 3SOSA 2ZGCA 4YESB 3LC3A 2P3FH 3RXGA 1HB0B 5PTPA 1MUEB 4BOHA 4CRAA 1DWBH 4A6LA 1TRMA 1SQTA 1H8HD 1XKBC 3PMJA 5GPIB 5C3NA 2FPZA 1Y3YA 2SNVA 1AUJA 2CK3D 2ZG0H 1DWCH 3RXCA 1F0UA 3NZIA 3TU7H 5C5NA 3SUFA 5EIYA 5C67A 3DA9B 3GY5A 3E1XB 3OEHD 4BAHB 1V2ST 2ZDMA 4FUDA 2PR3A 1KXCA 4IC5A 4Q7XA 4CBOA 5F03A 3ODFA 1DUEA 1SGFA 2AEIH 2ANKH 1C4Y2 3BIUH 1Y3UA 3S7HB 1L4DA 5BPEA 1MTNB 2IPHA 1GI7B 1SKYE 4OS7A 2TGPZ 3RUOA 4ZKOU 5EW1H 1O35A 4NIVA 1X7AC 4CBNA 2ZPRA 3RU4E 1A0LA 2ZFSA 2M2AA 4UE7H 1CT0E 5DK1A 2KCOA 3MNBA 1PPEE 1DLEA 2D2DA 3LGVA 3P92A 5DSFA 4XE4A 2HPPH 5DP4A 3A82A 1NBME 1BHXB 2P59A 2ZWLH 1TGCA 2Z9KA 1D3PB 2W7UA 2C90B 3V12A 1ZR0A 1KLJH 1FY4A 4Q7ZA 3FP7E 1FZZA 4BAOB 3QTOH 1MTSA 1TNIA 1XVMA 3UWIA 1JRSA 2ZFPH 1WV7H 1N6YA 2SGFE 1C5UA 4TWYA 1W8BH 2BY9X 2WYJA 3BG8A 1GI6A 2ZU4A 1BTYA 1OP2A 5AFZH 5GNDA 1G37A 1YY3A 1IHSH 1YPMH 5CHAC 1L1GA 4F4OC 3H09A 1BJUA 1BA8B 1EB1H 3ZZ9A 2Y5HA 1S6FA 1Z71A 1GMCG 4M9FA 1FY8E 3KQEA 3VB3A 1GI4A 1UTMA 3BTME 1GDQA 5B6OA 1SGPE 2QAAA 3SJ8A 2V7QD 1CHGA 3QUMP 2GJGA 1TMUH 1QB6A 2ZGHA 4GHTA 2W6ID 1O3HA 2Y7XA 1RGQA 4AFQA 4X1RU 1MQ5A 2GKVE 3GCTF 1TX7A 1GJ4H 5HM2A 4A1TA 1SLUB 4X2YA 3HKIB 3IITA 3BTEE 4MNYA 3TNTA 1HJAC 3HKJB 1ANDA 3KYGA 1O2JA 1NY22 1MU8B 1PYTC 1O39A 2VBCA 4UFGH 1ZPCA 5CE1A 1SQOA 2FZZA
chains in the Genus database with same CATH topology
2TRMA 1C9TA 1A3BH 2CXVA 1S81A 1MKWK 5DP6A 1KY9A 1YM0A 4B75A 4UDWH 2Q1JA 1LPGB 4FU9A 3ENSB 2ZKSA 3FP8E 2GT7A 4JCNA 2B7DH 1BZXE 2Z3EA 4IMZA 1Z6EA 1PPFE 2ASUB 4UEHH 1WTHD 1MZAA 1YCPK 4KTCA 4ZMAH 1ORFA 3D23A 3BIVH 3KNXA 5EW2H 2ZCHP 1T8MA 1GBCA 4FUHA 1Z8JB 5EQRA 5IYTA 1PPZA 4ISHH 1H8IH 2ZDNA 4IS5A 5FX5A 4INKA 3RLWH 2VWOA 1UVTH 1TQ0B 1LVYA 2CHAC 1IOEA 1VCWA 2OD3B 3TIUA 2XNIA 2GMTC 4BTTB 3ITIA 2VH6A 1C1OA 1XUJA 1BIOA 3D49H 3BTQE 1FN6A 2ZECA 1VITF 3ZZBA 1TNLA 1TMBH 3ZZ6A 4K3JA 1NRSH 1C2IA 3KHVA 1V2RT 2PW8H 3RXTA 1GBAA 3E3TA 5CHAB 3QDZB 3S9AA 2H9HA 2C3SA 2ODPA 3BTDE 4X8SH 2LNCA 3MHWU 3PTBA 3UR6A 1W12U 1C4U2 1ZGIA 3AVZA 1NS3A 2Z6BD 1ELTA 2BQWB 4O3UA 3BSQA 1T8NA 2TPIZ 1O5FH 1ZPBA 2ODYB 1A2CH 4YOGA 4FU8A 3F9HA 4RSPA 1BBRE 1K1LA 4ESTE 1LDTT 1KDQA 1HJAB 1EAWA 1ARBA 4R8TB 2PFEA 1XVOA 1O3IA 1TPSA 1VCQA 2Q6DA 1Y3XA 1HXFH 5BRRE 3FFGA 1P10A 3QX5H 4GVUA 2VVCA 3EAJA 3ZZCA 1O2OA 1GCDA 2FI4E 4H42U 1VZQH 3RMLH 3T62A 1BJVA 5F8XA 2GZ7A 3LGIA 1P2OA 2QCYA 4UD9H 3SBKA 1SGQE 1TIOA 3SV2H 4SGBE 3LGYA 1QHRB 2ZHWH 1HAGE 3FP6E 1PQ7A 2FOHA 1LPZB 1LHDH 3M3SA 1NRQH 4INHA 1O2VA 3OU0A 4MTBA 3MYWA 4MQAA 3L3TA 2BQ6B 5C1YA 2G51A 1WYKA 3B23B 2CHAB 3IWMA 1HLTH 4WH8A 1ZZZA 4Y11E 1YPEH 2EI7A 1GBDA 1E35B 2GMTB 7ESTE 1TBQH 2AYWA 2BX3A 4FUEA 5ABWA 5GJ4B 3A89A 1THRH 2B9LA 1MTWA 1B0FA 2ZFTA 2RCEA 5EXMA 2QXGA 1V2QT 5FCRA 3TJUA 1G3EA 2TIOA 2W3KA 4JZ1A 2ANWA 1O3FA 1D6WA 1FI8A 2O8LA 2XW9A 4D8NA 2IOTA 4E05H 1O5BB 1GWAA 2HNTC 4WXIA 1S0RA 1QA7A 2BZAA 3NKKA 1E37B 5A09A 4Y6DA 3SU5A 1D6RA 2XXLA 3A8CA 2H1UA 1C5MD 3HATH 2FOCA 3JZ2B 2SGPE 2OQUA 1EP5A 1ZSJA 2A4GA 2VIQA 4JYVH 4K5ZA 2C8YB 3SGQE 4I32A 1JIRA 5A0BA 1YKTA 3T2NA 3SNBA 3BTFE 3LPRA 1GJ9B 3UWJH 2ZEBA 1C5OH 1SB1H 3TK5A 4YOIA 1UO6A 4AZ2B 3MU0A 1DT2A 1PFXC 3MNCA 1NRNH 3SU6A 4MNVA 1UTPA 1K1MA 4X2VA 2UWLA 3GCOA 2WYGA 1BTPA 3ATMA 2B5TB 1EOLA 2R0KA 5LH8A 1UTQA 4MPUA 4DY7B 1NROH 1QRZA 2WPJS 1ZTLA 1WBGB 1HCGA 1O3AA 1GJDB 1GI9B 1BBRK 3QZQA 4WY3A 8GCHG 1V2VT 1GDNA 1UCYH 4ABAA 5CMXH 1SLVB 2Q6FA 3T25A 1SR5C 2G4TA 3I78A 3TH4H 1EQ9A 1GI3A 5GWZA 3KGPA 5LPFA 1O3GA 1C5SA 3Q3KA 3A84A 3HPTB 2CF9H 4KELA 1XM1A 1G32B 2GCHF 6LPRA 1NPMA 1TGNA 2FTMA 4I8JA 2XCNA 1L0ZA 3F9GA 1MTVA 1EOJA 1P01A 3BN9A 3ZVFA 2HRVA 4XBBA 1C1UH 1UVSH 4I8LA 2R2WU 6GCHF 1AKSA 3RMOH 2Y7ZA 3KN2A 1HV7A 3ZZAA 2QN5T 4RKJB 1KYNA 4CH8B 1F92A 3QGNB 1WCZA 4NIYA 1U6QA 3LKWA 3LJOA 1F0RA 1GVLA 1T4VH 1BB0B 1KXBA 3V0XA 2H9EH 1YGCH 3MO9A 1LHCH 1W0ZU 2J2UA 4HTCH 2ZDLA 4CRBA 1GL0E 1C2LA 1SI5H 2RA0A 3H7OA 1PPHE 1QJ7B 1P0SH 4H4FA 1SOTA 1GHBG 4YO9A 9LPRA 4JMYA 4UFFH 1ZPZA 1ELEE 4TPIZ 3A8AA 1FXYA 5FCKA 5DPAA 3PMHB 2GDDA 5FPYA 3SJKA 3SNAA 4GAWA 2Y6TA 1EUFA 4F49A 2QIQA 2A7JA 5DP7A 5LGOA 1BRCE 1JBUH 6CHAC 4AGKA 3R3GB 3TVJB 1Y5UT 3H5CB 5TCCA 1QRWA 1LQEA 1ZRKA 1CGHA 1ZYOA 2R9PA 1AFQC 1WOFA 2M5TA 2XWBI 3LU9B 4H6TA 1JXPA 1W0YH 2Z3DA 1BCUH 3SV7A 2G00A 2RG3A 3SV8A 1P2NA 1HFDA 1ZSLA 4OS6A 1YF4A 2JH6D 1G9IE 1O2IA 2OCVB 2BDIA 1P3EA 4DVAU 1FUJA 1V2LT 4NFFA 3ZVBA 3F68H 2BOKA 1D9IA 1QBNA 5A8YA 2ZQ2A 1C4V2 2R3UA 3MMGA 1K2I1 3MH5A 4Y8YA 2QV1A 3A7WA 1G2MA 1V2PT 2GX4A 3MH7A 5FHTA 3U69H 2LPRA 3KIDU 1IAUA 3SHCH 1RTLA 2Y5GA 1QFKH 3PM3A 3ZZ7A 1AE5A 1SC8U 2A4QA 2AERH 1GHXH 3PMBB 1T7CA 3MU4A 3P8FA 4Z0KA 2P93A 4PROA 3SNEA 3MOCA 1SL3A 2W26A 3TH2H 2PV9B 3BTWE 2ULLA 1TE0A 3MO6A 3SUEA 1ZMLA 4ZHLU 1YPLH 1Y3VA 5EPYA 1SFIA 1H9LB 1O2TA 1C2HA 1SGFG 4X1SU 1OOKB 3UIRA 1DWEH 2J92A 4K60A 2WUCA 2FYRA 1FY3A 1ANBA 1Z8RA 4X1NU 2Y81A 5L2ZH 3URDA 1G3CA 3PLPA 2BXUH 2PKAB 4D7FA 2BMGB 1G3BA 4WMFA 1EZUC 4NA7A 3T27A 2UWOA 2A4OA 1C9PA 1HYLA 3PB1E 3ZVCA 1C5TA 1O31A 2GZ8A 3A81A 5ESBA 1FJSA 1HUTH 3GCTG 3C1KA 1TALA 3E90B 6CHAB 3SUGA 3SQHE 2PWXA 1CQQA 4NFEA 1LVBA 2ZNKH 3RXVA 1O33A 1O38A 4JYTA 2Y82A 1RIWC 2XYAA 1AFQB 3A83A 1C5LH 2V6NA 4D9QA 1C2KA 1WQVH 2SNWA 4CH2B 1NESE 1C1PA 1GJBB 1YPHE 1P2IA 3LGUA 1P2JA 5JBAS 5A0CA 1EKBB 2BDGA 1DVAH 3O8DA 4X0WU 1OWJA 1FPHH 1AVWA 3HK6B 3U8OH 4Q7YA 2PGQB 3GYLB 4H6SB 3M7UA 3C27B 4DG4A 3LDXH 1Z1JA 1D3TB 2OBOA 3FZDA 4ZKSU 3KL6A 1OXGA 2DE8A 3CS7A 3BTTE 2CN0H 4B1TA 1YLDA 5G4BA 1C2GA 3ESTA 4Y0YE 1MKXK 1EPTC 3STIA 1NRRH 1O2XA 4BAQB 3PV4A 1NTPA 3U9AH 4X2WA 4UFEH 5E2OA 4ZROA 3UFAA 3QK1A 3RXQA 3P8GA 1YCPM 1AN1E 1C1QA 1VITG 2VVVA 5L30H 1O2GH 1H9HE 1C1TA 1KDQB 1MBMA 1YLCA 1XKAC 3O8CA 2UUKB 3M36A 4NIXA 1E34B 5T3HA 1GGDC 4THNH 1IQEA 2ZU2A 1Z1IA 2VWLA 4O9VA 1GG6C 1E0FD 2RDLA 1OWIA 3H7TA 1DX5M 1C5ZB 4ZHAA 4ZAEA 1BITA 1J16A 1K1OA 1PQ8A 2HNTF 1T8OA 5DP3A 1FQ3A 1O3KA 3HGPA 2WV4A 5JBTA 1ZJKA 3Q3YA 1TYNA 3DHKH 4YM9A 1PQAA 5F8ZA 5LPRA 1OKXA 2HVXA 5GXPA 5DG6A 1CBWC 3TK9A 1NO9H 4CRCA 4HGCA 1MBQA 1O2WA 1CT2E 3TITA 4ZKNU 3GYMA 2FOAA 5HM9A 1ESAA 1O2YA 4B2AA 4AFSA 1TNGA 1SBWA 2STBE 1ANCA 1OP0A 1AZ8A 1UTKA 3RC5A 3ZZ8A 1RIWB 1EP6A 1UHBA 5TCAA 3MO3A 1W13U 1ZSKA 1J9CH 2ALPA 3BTHE 2UWPA 1TNKA 4IN2A 3GDSA 1K1PA 1QB1A 2OP9A 1S5SA 1K28D 2BDBA 2BVRH 4LZ1H 3EYDA 2BD5A 1O3OA 1LVOA 5A8ZA 1C1VH 2TGTA 1MD8A 2VB0A 2JH5D 3RXMA 1TLDA 1UVPA 5A2MH 3B9FH 1V6DA 3VXFH 1QBVH 2QYIA 2XBYA 1AFEH 1B0EA 3SNCA 1O0DH 1HAIH 3EA7A 1Y5BT 3I29A 2PKAA 1O5EH 2ZIQH 1ANEA 4WMEA 2KAIB 4BNRA 1AIXH 1AO5A 1W3CA 1P9UA 1BMAA 4OGYA 1EPTB 1EJAA 1SGIB 1GMDF 1LMWB 3PWBA 2FOMB 2NU4E 1G30B 3SO3A 1GHVH 5EXLA 4RKOB 2ZU5A 4GSOA 4A92A 5JYIA 1LHEH 1CU1A 1C2MA 3QO6A 5DP8A 3OY6U 1TBRH 2VU8E 1D4PB 3DT0H 3LH1A 3S7KB 2PLXA 3UPEA 4B76A 1O2ZA 1K1IA 5FPTA 2OXSA 4Y10E 3SW2B 1GBMA 1TAWA 1GGDB 1GHYH 4FUCA 1IQFA 4MDSA 2VNTA 1O2RA 1GG6B 3ZYDA 4MVNA 2ZQ1A 3R0FA 2CJIA 3MH4A 3RXOA 2FMJA 1BTWA 1GJ7B 2A5IA 1UTOA 4ABHA 2GZ9A 1P2MA 8KME2 1SLXB 2BD2A 1YPKH 4WMDA 1NFWA 5JDUB 2R0LA 1CBWB 1TPPA 1ESBA 1GDUA 2A2XH 4BXSA 1W7XH 4BAKB 4AFZA 3GDVA 4B73A 4FXGH 4XDEA 2C8ZB 1DPOA 1SQAA 3GCNA 5ESTE 4Y8XA 2EI6A 4Y7AA 2R2MB 3BF6H 5E2PA 1TRYA 9ESTA 2TBSA 2J38A 1K21H 1ELFA 1PQ5A 1K1JA 2PHBA 4DOQA 1P9SA 3ZZ3A 1DSTA 2BLQA 2WPIS 3RXIA 2DUCA 3BTGE 1UVUH 1OX1A 2SGDE 1J17T 3RMMH 1AKSB 2BVXH 1LTOA 2GCTC 1BRAA 1CSOE 1P02A 2FX4A 1TGTA 1AHTH 1AD8H 4D7GA 5H4IB 4ZHMU 3RXKA 1GJ8B 1SGDE 1QGFA 3F9FA 5DJ7A 4ABDA 3P6ZB 3LJJA 1L4ZA 2WV5A 3VB4A 1DITH 1O5DH 1O2SA 1GBLA 2Z3CA 1WU1A 2AMQA 3UUZA 4CRGA 4K1SA 5I46H 2XCFA 2ZU3A 1GBFA 3RMNH 1DE7H 2GCHG 2C4FH 4YLUA 4BTIB 1AUTC 2BTCE 2AGIX 3GOVB 4JYUH 2PGBB 5DP9A 4ISIH 1A46H 1FMGA 5FPSA 1WUNH 1XUIA 4BANB 4AX9H 2A2QH 5EPNA 4XBCA 5FXLA 1LKBA 1EJMA 4YT6H 2OC7A 5ETXA 6GCHG 2ZTZA 2BYAX 1KIGH 5E0HA 3RXPA 2BQ7B 1C2FA 3BG4C 1OWDA 3ATWA 2BOHB 1GJCB 2BD4A 2ZTYA 4KTUA 3UQVA 2WPLS 3ZZ4A 1UK4A 2EI8A 1JWTA 1MAYA 1GJAB 4R0IA 4IBLH 1PPGE 1DUAA 3UREA 1WQSA 4X8TH 2A4RA 3QLPH 3A80A 1PJPA 5AF9H 1O32A 1BHXF 2A31A 2NU2E 2XTTB 3CENA 3NXPA 4FUJA 1RTKA 1LVMA 1MKWH 1DSUA 2BD9A 5GDSH 1F0SA 1AE8H 3ZVEA 4Y76A 1TMTH 2JETC 4WWYA 2FLRH 1TOCB 3MI4A 3PLKA 3SN8A 3SU4A 1BRBE 2ZDKA 1TWXB 1YCPH 1P3CA 3RLYH 1SGCA 2I6QA 3VEQB 4XSKU 4DT7B 3M35A 4TY7A 1N8OC 3T5FH 3ZV8A 2F9VA 1DY8A 1AU8A 1SGNE 5JB8S 2KAIA 2QA9E 2BLVA 2SGQE 3NPSA 1EPTA 1GBTA 1NC6A 3ZZDA 1ELAA 3LOXA 1NFXA 1T32A 1GBKA 3ATLA 3EA9A 1GBJA 4GUXA 1EAIA 2GVFA 4GCHG 2GCTB 1ABJH 7KMEH 3OYPA 3TH3H 1NZQH 2UUJB 4K1EA 2CMYA 4YOJA 3RC6A 3A88A 3UOPA 4A1XA 3TGIE 2BY5X 1C5QA 3P95A 4AYYB 3SJ9A 2QXIA 1SHHB 1YBWA 5EGMA 2G5NA 1KXFA 3PO1C 1EASA 1DXPA 2BY7X 2NU1E 3AW1A 2A1DB 2F9NA 5EU8A 4RN6A 2XBXA 2BDCA 1GHAF 1H9IE 1HAVB 1N6XA 1EJNA 1P05A 2ZZUH 1HAOH 2A5KA 1GVZA 3TPIZ 1IQGA 4AFUA 4SGAE 3BG4B 2QGRA 2OC8A 1YP9A 1SGYE 1V3XA 1ELDE 2F91A 3O8BA 4HZHA 1RS0A 3GDUA 3EQ0H 3MU8A 3E0PB 1OSSA 4WH6A 4AN7A 4FU7A 1L1NA 1IHTH 2XBWA 4X6PA 1O3BA 2FP7B 3FANA 1DY9A 3ODDA 1EX3A 2HWLB 1C5PA 3EE0B 3DFJA 1C5VA 3F1SB 1ELVA 2FXRA 3GY4A 2JETB 4ZXYH 4K8YA 3SU1A 4KP0A 1GPZA 1QNJA 1AY6H 1O5GH 1QURH 4DIIH 3P17H 3U1IB 4MPXA 2ZHDA 5L6NH 3V7TA 1N8OB 3A8BA 4ASHA 1LPKB 2Y5FA 1C1WH 2A7CA 1AB9C 3TNSA 2ZDAH 4XFQA 3QGJA 4DW2U 5DO4H 1HJ8A 2D26C 4JK6A 4CRDA 1HGTH 4X1PU 1KSNA 3AAUA 2HNTE 1ZRBA 1HDTH 2FM2A 4AG1A 4DJZB 1SG8B 1O34A 2WINI 3CP7A 4K1TA 1O3DA 3A7XA 3NWUA 3TGKE 3U8RH 1Y3WA 7GCHF 1KLTA 4TWWA 4NCYA