1N6XA

Rip-phasing on bovine trypsin
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsinogen, cationic
publication title Specific Radiation-Damage Can Be Used To Solve Macromolecular Crystal Structures
pubmed doi rcsb
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2002-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1n6xA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1n6xA02
1GI5A 5ESTE 1IOEA 1OYTH 2PHBA 4Y71A 1HPGA 1GBKA 2BY9X 1P8VC 3A8AA 1TRYA 3UY9A 4UFDH 3O8DA 1V2WT 1EZQA 1W12U 5TJXA 1TWXB 3UIRA 3RXDA 1UTPA 2DUCA 1G36A 2H9EH 4ISIH 1GL0E 1ZSJA 2F9NA 1SSXA 3SGQE 3T26A 3W94A 2Z3CA 1O3DA 1H9IE 4FUCA 1SLWB 2QV1A 3MWIU 2J92A 2GX4A 1EAUA 5ABWA 1IQFA 1K1PA 5T3HA 2OP9A 3RLWH 2ULLA 5EW2H 2G81E 1S0QA 1W8BH 1C1UH 1EAXA 1HCGA 1DXWA 1HGTH 2QC2A 1QFKH 3SO3A 3QTVH 1HJAC 1DWEH 1RIWC 1O2XA 2C8WB 2VIWA 3CS7A 5TCAA 8KME2 3BG4C 1WBGB 1MU8B 3A7XA 4MPVA 2P95A 1C9TA 1D3TB 4KGAA 3SU3A 1JIMA 1EB1H 2XBVA 4OS7A 1ZTLA 1OWDA 2W3IA 4GPGA 1L4DA 1OWEA 1TBZH 1GI3A 2QXGA 4Y8XA 2IN2A 2R3UA 2UWOA 4YZUA 2BQ7B 1HRTH 2BY5X 4E7NA 3BTWE 1RRKA 2BQWB 1ELCA 1SLUB 1GMDF 1KXBA 2C93B 1FMGA 4I8HA 4OGXA 5AVDA 1BJUA 3SBKA 1GHZA 2J2UA 3KIDU 4NFEA 7KMEH 2FDAA 1DY9A 4X8SH 4XSKU 1SGTA 1HAZB 1EB2A 2A4GA 4WH8A 3KEEA 5A8YA 3T29A 1ZSKA 2FS9A 3MNBA 1TBQH 1GBMA 3P17H 1SGFA 3UOUA 3VFEA 5A8XA 2XXLA 1CBWC 1TQ0B 1PPHE 3DT0H 4OS5A 1O2TA 3A86A 2PGQB 3MNSA 3LONA 3ESTA 5DG6A 1V2LT 5C2ZA 1TAWA 4SGBE 5DP4A 1FPCH 1GJ7B 1A4WH 1TX8A 1VCPA 1O34A 1BA8B 3ODDA 1DSUA 1UK4A 3RXKA 3S0NA 2ANWA 4IS5A 4K1EA 1IQMA 3Q76A 4ABIA 1O3AA 1PPGE 1C1OA 2AGIX 1O2NA 1QY6A 1GVZA 1YM0A 3OSYA 3UOPA 1TMTH 4WH6A 1V2ST 5JBCS 3S7HB 1GBAA 1MCVA 2BVSH 3TITA 3O8CA 1ZSLA 1DE7H 2A32A 3SZNA 2OD3B 4FUBA 4CH8B 1J14A 2ANMH 1C1QA 1AE5A 1MTWA 1O5BB 1OYQA 5L30H 3UTUH 3A7WA 3C1KA 3RXLA 1ZGVA 5EPYA 1A1RA 2BLWA 2P93A 1WCZA 1DFPA 1FY3A 4PROA 2BDYA 1O3BA 1K1NA 3ATMA 2FIRH 4Y8YA 3Q00A 4Y0ZE 1HAVA 1SGPE 2WPMS 5FPTA 1W11U 3P8OA 1MQ6A 4CRFA 3LKWA 1UVPA 1UTQA 2F9OA 1OSSA 3SV6A 4NFFA 1ELTA 4HFPB 2FX6A 1S82A 1GMCG 2CXVA 3RDZA 2Y81A 4F49A 5CHAC 3UREA 3LGUA 1CE5A 2BD8A 2FYQA 1ZMJA 2FLRH 2H9HA 1BMNH 2G5VA 3RM0H 1VITH 1ANDA 2FEQH 1W0ZU 1ARCA 3QO6A 1INCA 1MH0A 5C1UA 2GCHG 1AVXA 1A46H 2BZ6H 3MMGA 4ZKNU 2NU2E 1C5ZB 1T8LA 1OWKA 1ELDE 2AIPA 4ABFA 2FXRA 4LZ4B 3SV2H 1QL8A 3TPIZ 1O5DH 1ESAA 1EASA 1TNJA 1V2KT 4XBBA 1SGIB 1V2OT 2PKAA 2FOEA 2VIQA 5T6FA 3MFJA 3T62A 2ZEBA 2ZHDA 3SU1A 1HJAB 1RIWB 4X0WU 4CREA 2G51A 1GHBG 3DFLA 1O38A 1YPLH 4E05H 4I31A 2QXHA 3M3SA 1ELBA 1GJ8B 1O5CB 3M7QA 3U98H 3PTNA 1GHAF 2PTNA 2UUFB 2IJOB 2NU0E 3MU1A 1QJ1B 2ZF0H 1XXFA 3HKJB 4K5ZA 1FY8E 1J17T 3AASA 4D76A 1DM4B 4ISOA 2PKSC 3AAUA 1F5LA 3R3GB 1JXPA 5H4IB 3M3TA 1EQ9A 1IQLA 4NSYA 3S9AA 1QGFA 3GDSA 2XBWA 4YT6H 5K7RA 3BTEE 1F2SE 1ZRKA 1T4VH 1MAYA 2D26C 3GDVA 1Y3XA 3NUMA 2GKVE 4FUJA 5DKMA 1TMBH 3WY8A 1CBWB 2Z9IA 4B75A 1HXFH 2P94A 1GVKB 2OQ5A 1UTMA 2OC0A 1FZZA 3KN2A 1YPHE 4NGAH 1C5OH 3SU6A 3BTME 4LXBH 3L6PA 3MO9A 1BTWA 1YLCA 5FPSA 3LDXH 4IMQA 1LHDH 1VJ9U 2C8XB 1SGQE 3ODFA 4KKDA 3V12A 2GT8A 4MDSA 1YPJH 4WMFA 3SGBE 1L2EA 1FY1A 1DOJA 4IN1A 1GG6C 1EP6A 3KNXA 4X6MA 1O32A 1DY8A 5I46H 4WMEA 1QJ6B 4RKOB 3AVZA 1NZQH 2C3SA 2Z6BD 1OWJA 2CF8H 1QBOA 2ZU5A 5E0JA 1GI2A 2RA0A 5EU8A 3SHAH 3MI4A 2ILNA 1F0SA 1PYTC 1KYNA 1VJAU 2P8OC 2ZDNA 1XUGA 1DUAA 5BPEA 2BD3A 3RU4D 1KXCA 4CBNA 1SFQB 2OXSA 1RD3B 2SNVA 2VU8E 1QA0A 3U8TH 2CN0H 1OP0A 2QN5T 1O3HA 4WXVA 2WPJS 3TNTA 3D23A 1KDQA 2SGAA 4YOIA 3VEQB 4YT7H 1C2EA 3A8CA 2ZI2H 2BVRH 2V3OH 3FP6E 2C90B 1VZQH 2LPRA 4LK4A 2TGDA 4MQAA 2Z3DA 2C4FH 4XDEA 5DP6A 1HJ8A 3UNQA 4A1XA 5CHAB 3ZYEA 1K1MA 2SGDE 2ODQA 9ESTA 2BOHB 4MTBA 1P05A 1A2CH 1DX5M 3EGKH 1BBRH 3BTDE 1B7XB 1C2GA 2XC0A 4BAQB 1LDTT 1N1LA 1THRH 2BY7X 1P3CA 2GTBA 3UWIA 4K8BA 1BMLA 3UNSA 2PGBB 2CGAA 2AGGX 3BTHE 2XBYA 1XKBC 2ODYB 5GCHF 1S6FA 2Y80A 1CHOF 1ABIH 2BDHA 2QF3A 5G4BA 2ZIQH 1O3KA 3BTFE 2H5DA 3M5OA 1V2UT 1W0YH 4AFQA 2CJIA 1L0ZA 2CHAC 1WTHD 1TX7A 4OS6A 3BSQA 3PLPA 4Q7XA 4AFUA 1WU1A 4IC5A 2UWLA 1A0JA 4ISHH 3TNSA 3VXEH 1K1LA 1CA0C 5GWZA 4XBDA 4ASHA 1AUJA 2Y5HA 1BTYA 2FM2A 2OINA 3U8RH 1LHEH 1LVOA 2ZHFH 4NIWA 1DWCH 1QB6A 1AKSB 2TIOA 1RJXB 2G8TA 2BXTH 1PPEE 3RXIA 1MAXA 2GZ8A 1L1NA 1GBFA 1TPOA 3QTOH 2O8LA 2PW8H 1Z7KA 3ZZ8A 4CRGA 2Z94A 3P8FA 1MD8A 5DP7A 1H9HE 1KY9A 1QB9A 1FI8A 5FHTA 1UCYE 1DITH 2FOFA 3ZZ6A 5FBIA 3A84A 2ZU4A 1NRSH 2BX4A 2A5IA 1LO6A 1QR3E 2VB0A 3OY6U 1C5WB 1YPEH 2V35A 3K9XB 1XXDA 2BZAA 3HK6B 1Y3VA 3FP7E 3A7TA 1QL9A 1V2MT 2ZWLH 1C1VH 5DP8A 3RXSA 2GP9B 6ESTA 5DP3A 1GVLA 1QURH 3ZZAA 4A6LA 4KP0A 2ZFSA 3LH1A 5HMAA 1QRWA 4CRCA 1CQQA 1T32A 5LPRA 1LMWB 4YM9A 2BVXH 1S85A 5E8EH 3RMMH 1TGCA 1FUJA 2ZTYA 3L33A 4WY3A 2TGPZ 1WAYB 2Z9GA 1Y5AT 5EQRA 1SGRE 3RXRA 3ZZ4A 4AYVB 1ZOMA 3GCNA 3PYHA 4D8NA 1QHRB 3L3TA 2ESTE 2OUAA 2RA3A 1DPOA 1HAGE 1YPMH 4X6NA 2FTMA 4XFQA 2O8UA 5LH8A 1GG6B 2BLVA 5TCCA 1HIAA 2AMDA 3MO3A 4TPYA 5A8ZA 2ZFPH 1FY5A 3DFJA 5J4SA 5FAHA 1SOZA 1JIRA 3LJOA 3PMAB 5F8TA 5FCRA 1KXAA 3A7VA 3QX5H 1A0HB 2ZHQH 3EA8A 1UCYH 1EATA 2BYAX 1GBHA 2GDEH 2AFQB 3URDA 1XMNB 3EAJA 2TBSA 5E0HA 2VVVA 1CHGA 3ZVDA 4D9QA 3B23B 3SNEA 1FV9A 4FUEA 1PYTD 1DLEA 2VIPA 1O2MA 4A7IB 4ZAEA 1GI4A 1GBEA 1BB0B 1DXPA 1B5GH 1GL1A 1SC8U 3H7OA 1ANCA 5FPYA 3M5LA 1BHXF 3SU4A 2HNTE 1NFYA 4NCYA 1WV7H 1FAKH 5K0HA 4GAWA 4TWYA 3A87A 2O8TA 1BUIA 2YNBA 1BITA 3FZZA 1QB1A 1H8IH 2C8YB 6GCHF 2AH4X 3SQHE 3LGIA 3SI4H 2FOMB 1HAOH 1AMHA 1SPJA 2A5AA 3UUZA 3SQEE 1EJAA 1O2QA 4DCDA 4U01A 3KQBA 1GMHG 5HGGA 1QIXB 1P04A 3KCGH 2HLCA 2WYJA 3ZVBA 1J15A 2STAE 5EGMA 5DP9A 2V0BA 1KTSB 5E2OA 1VGCC 1O5EH 1TALA 4Q7ZA 2CHAB 2H9TH 2NU3E 2VWNA 1EOJA 1YC0A 3HKIB 3F6UH 3FAOA 1TNHA 1C1WH 1CA0B 2A0QB 1HAXB 4CH2B 3V13A 1C4Y2 1PFXC 1Z6JH 2FO9A 1MZAA 3A81A 1C2MA 1FJSA 2GDDA 5JPMH 2XCNA 1TNKA 3MNXA 2A4OA 2O8MA 1NPMA 2VNTA 1A61H 4A1VA 1GDUA 3TH2H 1A5GH 4J2YB 1EKBB 5B6OA 1TOMH 1BMAA 1DS2E 4DURA 1IQHA 2UUJB 1ETSH 3UR9A 1PQAA 1AD8H 4YLUA 4YLQH 2EI8A 4YESB 2IPHA 3A85A 2PUXB 5GPIB 1ELGA 4ZROA 1BQYA 1T8OA 3HGNA 4I8LA 4AG1A 1CVWH 5A0BA 1SGFG 1E35B 2A5KA 1IHSH 1AO5A 4FU9A 1P0SH 2BQ6B 4IC6A 4ABBA 1QBVH 3FP8E 1ARBA 1K28D 3BF6H 1C5SA 4YOGA 5GJ4B 4IW4E 1TA6A 1WSSH 3M61U 4GHTA 1C2KA 2J94A 4HZHA 3SUDA 3RMNH 3DA9B 1LKAA 4UEHH 3QLPH 1LVMA 1O3IA 3P8GA 3D65E 3GY4A 2SGPE 3SJ9A 3RXCA 2Y5GA 2FODA 1TOCB 4JZIA 2BLQA 4DG4A 1UTKA 1QCPA 3QZRA 3ZVAA 1NC6A 2Q6DA 1G3EA 1OP2A 3SNBA 3BEUA 1WTGH 5LPFA 4ABGA 2BDAA 4JZFH 1G2MA 5GXPA 1EOLA 3STIA 1AVWA 4JYVH 4H6SB 1FXYA 2ZPRA 4LZ1H 3RMLH 1E0FD 5A2MH 1C9PA 1O2SA 2G4UA 1AZZA 1XVOA 1HAIH 1EPTA 1GI6A 2J9NA 1V2NT 2V3HH 3F9FA 7LPRA 1MD7A 4NA8A 2ZC9H 1ZJKA 4AN7A 1LHFH 1BTHH 3UPEA 1OWIA 1FY4A 3ZVGA 1NU9A 2XCFA 4ABDA 4ZMAH 1JWTA 1VITF 1YCPK 2KAIA 2ZDAH 3RLYH 4NA9H 2WPHS 2ZCKP 4ABEA 2Z9LA 1AHTH 4JZDH 1HAYB 7GCHF 4CRBA 3ZYDA 1Z6EA 1X7AC 3TVJB 1NN6A 1ZHPA 4OS1A 2FI5E 3V3MA 1FIWA 1ZTJA 3HGPA 1O2LA 1QTFA 3RXTA 3N7OA 3KF2A 1CT0E 1IQJA 1DSTA 2PSYA 1Q31A 1O2PA 1J16A 1DLKB 2BM2A 2ZQ2A 3UQOA 3GY8A 3KQCA 2ZU3A 1HAVB 2GT7A 1TPAE 1F0UA 2XRCA 1LVBA 3UR6A 2W3KA 1AN1E 1BTPA 2FOAA 5I25A 4DT7B 4GCHF 3P95A 2CF9H 3U69H 2Q1JA 2PV9B 3TK6A 2R9PA 4AGKA 1TGBA 1ZJDA 1BT7A 5EQQA 2ZGXH 1Z8RA 1NU7B 2F91A 4JZEH 1QRXA 5DGJA 1TFXA 3AAVA 4BAKB 3PMBB 4AYYB 2W5EA 1ID5H 1P11E 1SHYA 2G52A 6CHAC 1W2KH 2QXIA 4B73A 1SBWA 1P2JA 1O3EA 4DOQA 2ZDVH 1UO6A 3GOVB 1CO7E 4F4OC 1CGIE 1IQIA 1BRUP 1VGCB 1TLDA 3P70B 1GHAG 2B0FA 1P2OA 3M7TA 3RXPA 1GI8B 5A09A 1K1JA 1PQ5A 2ZTZA 1A0LA 4Y11E 5FX6A 4M7GA 3BEFB 3ZVEA 1O3GA 3BTTE 1U6QA 3RXQA 1CT2E 3ATWA 1BDAA 1TNIA 5DK1A 1KSNA 3AW1A 2Z9KA 1OXGA 5JBTA 4NWLA 1AZ8A 1EZSC 2PKAB 1O3NA 1GBBA 1TRMA 4ZKOU 4INHA 1BCUH 1TNLA 8LPRA 3JZ1B 4NIVA 1P2IA 1ABJH 2JKHA 3SORA 3TK9A 1O3CA 1LPZB 3F68H 4VGCB 1S0RA 1SI5H 1C2IA 4AFZA 2FTLE 1KTTB 1Y8TA 3BG8A 4ZHAA 2J95A 2AGEX 5C5OA 1YPGH 3SJKA 1TGTA 3MO6A 1NO9H 1GDNA 3LT3A 1YCPH 4FVBA 1AY6H 3FANA 1O2WA 1OP8A 3SNCA 2FWWA 1HDTH 4U30A 2ALPA 1GWAA 1C5VA 2B5TB 4OS2A 4BXWA 4AOQA 1NT1A 3TJNA 5SGAE 1DDJA 2TGTA 3MOCA 1UVSH 1Z71A 1L1GA 3PLBA 3QDZB 2RCEA 4GLYA 3BTKE 4FUGA 4JCNA 2W7SA 1MKWK 2GCHF 3SV9A 1G3CA 2BDBA 1O5GH 1TGNA 3P8NA 1FN8A 3A80A 1C1RA 3E90B 1RTLA 1F92A 1EP5A 1SGYE 4Y8ZA 4B71A 2PLXA 1D3QB 1C1PA 2K1QA 3ATKA 1A3EH 4FUFA 1P01A 4CRAA 3MYWA 2BD7A 1NROH 3URCA 1GHBF 1XUKA 1YF4A 3RXBA 2VJ1A 2Y6TA 3SNAA 2QF0A 5L6NH 1NS3A 1O2OA 1GGDB 1T31A 5F8XA 1A3BH 1GBTA 1MTVA 3FFGA 2FOHA 1EX3A 2PFEA 3PO1B 5EOKA 4DY7B 1O37A 5JYIA 2R3YA 3PROA 4GVUA 4BXSA 1AGJA 3M5NA 3E3TA 4KTSA 8GCHF 4MPUA 5JBAS 1AE8H 2XYAA 3ENSB 3M3VA 3E6PH 5F6MA 3B9FH 1AIXH 4IMZA 3RXAA 1GJBB 3FZDA 3K65B 3LJJA 4GUXA 1WQSA 3U9AH 4NIYA 3Q77A 3MH4A 4I32A 2QXJA 5CMXH 5EXMA 2NU4E 3BIUH 3S69A 3CP7A 4B1TA 2D8WA 2BD9A 1ANBA 1KDQB 1Y5UT 3O8BA 5GCHG 3E91A 1O5FH 1Q3XA 3RU4E 1GI9B 4K2YA 4K69A 2FX4A 2RDLA 1TYNA 1C5MD 2BLOA 2ZO3H 1O2KA 4ZKSU 2HGTH 7ESTE 3LU9B 1H4WA 1TPSA 1GHXH 4Y6DA 1Z8IB 5AFYH 4Y7AA 3SJ8A 4E7RG 3CENA 4B2AA 2FOBA 1ELEE 1ORFA 2ZCHP 1TE0A 5F03A 3H5CB 3LGYA 4XE4A 6CHAB 4MNWA 5FCKA 3A8BA 1TBRH 1N6YA 3RC5A 3FVFB 4WF8A 2ZU1A 4HTCH 1EAWA 2XC5A 3QZQA 1O2GH 4K1SA 2VWOA 3ZZCA 3A82A 3E0PB 1RS0A 1HAHH 4ISLA 2AMQA 4HGCA 1P57B 4BTTB 4UDWH 1MKWH 1O3PB 2Q6GA 1NFXA 2BDGA 1SQTA 1RFNA 2XW9A 5GDSH 4R8TB 1WUNH 3SU5A 1OKXA 1H8DH 2FOGA 3Q3KA 3TH3H 2ZHWH 2VINA 1PPZA 4SGAE 5JDUB 3ATLA 4KELA 1E34B 4X1SU 2FS8A 2FZZA 2ASUB 4IBLH 2SFAA 2GMTB 3RMOH 2EI7A 2BY6X 2BD4A 2P3FH 1C5PA 1TMUH 2ODPA 2R2WU 4R0IA 3SHCH 1LQDB 4XBCA 3PWBA 4OS4A 4U2WA 4INKA 4ZXYH 3TGKE 4Z6AH 4X1NU 3I77A 1BMMH 3ITIA 4X8TH 4Y76A 1FLEE 1GPZA 1T8NA 1UJ1A 1OOKB 2H5CA 1HFDA 2CV3A 1ELFA 2BDIA 3DHKH 3U1JB 1GI7B 2ALVA 1MKXK 1EJNA 2JH6D 1E38B 4MNXA 4Y10E 1PPBH 1SLXB 1O33A 4Z0KA 4J1YA 2ZTXA 3M37A 1OX1A 4ABJA 5JBBS 3SUGA 2OC1A 3NCLA 1P09A 1UHBA 4I8GA 1GDQA 2ZPSA 3T28A 2ZNKH 3QGJA 3CS0A 4FUHA 4NSVA 1GJ4H 1XX9A 2A2XH 3RXEA 4AX9H 1TABE 1LHCH 5ESBA 3GY7A 5IDKA 3S9CA 3ZZ5A 1AUTC 1ZHRA 3EYDA 2I6SA 1VCQA 2WPKS 5E0GA 1G30B 4X2YA 1HLTH 4X1RU 3Q3YA 2XC4A 4I33A 1MZDA 1GJCB 1HIAB 1IAUA 1P12E 1ZLRA 4YOJA 1BRCE 4AGJA 1D3PB 4UFFH 1ZGIA 4E06H 1EPTC 2F9BH 3AW0A 1P02A 3EE0B 1P2KA 1DICA 2DE8A 2WUCA 3S9BA 2BXUH 1ZR0A 6GCHG 1YPKH 4AB8A 1A5IA 3GDUA 2VVUA 2SGFE 3O8RA 1G2LA 4XOJA 1C5LH 2J4IA 3RXFA 3S7KB 1TA2A 2OCVB 2ZKSA 1ZYOA 1BOQA 1SB1H 1KXFA 2FOCA 1BHXB 4BAMB 4JYUH 2VVCA 1O2RA 2ZCLP 1G9IE 1NESE 3IG6B 4HI3A 3SW2B 1AWFH 3C27B 3RM2H 1K22H 1LTOA 2ZDLA 4MG3A 4Y79A 1UK2A 2GZ7A 1JMOH 4O3UA 1NRQH 3SGAE 1MTNC 4WMDA 1O5AB 1T4UH 2HNTF 3NXPA 1P06A 1UVTH 3KQDA 3SV7A 1V2QT 3ZZ9A 2V6NA 1Y5BT 4D9RA 2WPIS 2ZU2A 4WJG2 2ZFRH 1BTXA 1RXPA 2B7DH 1HV7A 3I78A 4AB9A 3TU7H 2ZGHA 2Y5FA 2OC8A 2QGRA 2Y7XA 3GY5A 4BAHB 1PPFE 2F9UA 3MNCA 1F0TA 1GBCA 1J9CH 1QA7A 2B9LA 2QA9E 3MU8A 3IWMA 3UNRA 3PTBA 1RGQA 4DW2U 1C5TA 2QAAA 1N6XA 4NWKA 3NPSA 1IQKA 2A45B 1EXFA 3OU0A 1KLJH 4DIHH 1LCYA 3A88A 2BMGB 3LGWA 1OWHA 3SJIA 1SGCA 3QN7A 5JB9S 3RXUA 1O39A 3ZZBA 1D6RA 1GMDG 4AG2A 2GV6A 1O3MA 1ELAA 1EZXC 1NY22 4FU7A 1ESTA 3R0FA 1E36B 3GCTF 1FN6A 1O2IA 3NZIA 3RXOA 2VWMA 1O3FA 4X6OA 5E2PA 5T6GA 2PSXA 2EI6A 1AFEH 4WVPE 1O30A 2NWNA 4VGCC 4ZKRU 1GCTB 3MTYA 1K9OE 2GZ9A 2F9VA 1OS8A 5FX5A 1UTNA 3PLKA 1MMJN 2HPPH 1Z1IA 3U8OH 1TGSZ 4RN6A 1C1TA 2ANKH 3SUFA 1GHWH 2HPQH 3MU5A 2HVXA 4O3TA 1W10U 3LOXA 1F5KU 3SU2A 1ELVA 1DWBH 5HM9A 2ZDKA 1GI1A 1BIOA 2ZHEH 1ETRH 1ACBE 1GMHF 1ESBA 1D3DB 3ZVCA 5A0AE 1S5SA 2UUKB 2PR3A 1YKTA 3MHWU 1NFWA 2VGCC 1LQEA 1VITG 2VH0A 1MTUA 2XWBI 4I7YH 2A7HA 2J38A 3BN9A 4OGYA 1V2TT 4H42U 1O3JA 1F5RA 3K6YA 7GCHG 5J4QA 3RC4A 4JMYA 4GSOA 1SVPA 4TWWA 2Y7ZA 1TPPA 1TQ7B 1V2VT 3ZV9A 1CA8B 1BJVA 3RC6A 4UFGH 2BDCA 3ZZ7A 1YPHC 1PPCE 1SGDE 1EPTB 1AVGH 1F7ZA 2C8ZB 4U32A 2FI4E 1DANH 3VXFH 2EC9H 3RUOA 1CT4E 1QBNA 4CHAC 5HM2A 4Q80A 3HATH 1C5NH 2KAIB 2A7JA 2OC7A 2DE9A 1GGDC 4BANB 4ZHLU 4TYDA 4X2WA 4GCHG 1YGCH 3SNDA 1SGNE 5LPEA 2FYRA 2QYIA 2P16A 3T27A 3QGNB 3VB6A 3PO1C 1T8MA 1XUHA 2Z7FE 2AIQA 2AEIH 2GV7A 1TRNA 3P92A 2R2MB 4NA7A 1C4U2 3RXVA 5GIBA 1XUIA 1W7GH 1T7CA 5AF9H 2F83A 3OYPA 1G3DA 2WUBA 3U1IB 1MTNB 3F9EA 4JZ1A 1YP9A 1XUJA 2LNCA 2FESH 3EQ0H 1K2I1 2BTCE 3EA7A 1QQUA 4UD9H 2P59A 2A4RA 1IQNA 2YOLA 5C5NA 1P2MA 1ANEA 3VB5A 1C5RA 1C2LA 4X8VH 1K21H 1LHGH 3QK1A 1AQ7A 3E1XB 1BTZA 2EEKA 2B8OH 2WV4A 3OTJE 2Z3EA 1GJ9B 1O31A 3ZZDA 3GICB 1MTSA 1AU8A 2JH5D 1K1IA 4I8KA 1W3CA 1SFIA 1GJ6A 1UMAH 4MPXA 3HK3B 1O2JA 2ZG0H 1SQOA 8ESTE 4DGJA 3BTQE 4BAOB 4K8YA 3F9GA 2ZFFH 5F8ZA 1Q2WA 4ISNA 1SQAA 1W14U 3MH7A 1W13U 5CE1A 1GBIA 5BRRE 1QL7A 4ZH8A 1HB0B 4O03A 3TH4H 3GYLB 1P3EA 3ELAH 4NG9H 2PUQH 1TIOA 4H6TA 4TY7A 1WOFA 1YCPM 3ZVFA 3VGCC 1B0EA 4UFEH 2D1JA 3UFAA 1IQGA 4I8JA 3VB7A 3RP2A 3EA9A 1ZPCA 2XTTB 1GJDB 1D9IA 2GMTC 2HRVA 1MCTA 1ZPZA 4K60A 3OX7U 3NWUA 3GYMA 1SGEE 2AERH 1CGJE 3TJVA 4H4FA 2FMJA 5C67A 2F9PA 2XNIA 3A83A 1UVOA 1NTPA 1V2RT 1AFQC 3MU4A 2TPIZ 1O36A 1GMCF 1HNEE 3PMHB 4MNVA 3F1SB 4WWYA 1KXDA 5FXLA 1KIGH 1NRRH 3A7ZA 4BTUB 1L4ZA 2JH0D 1C1SA 9LPRA 1JRSA 3BG4B 3E8LA 3NK8A 3PB1E 4X6PA 4CR5A 1Y3YA 2BY8X 2JETC 2VGCB 5EXNA 2WPLS 4A92A 1JOUB 4ABHA 1L1JA 2TGAA 2FI3E 1TONA 1GJAB 2BB4A 2D2DA 2GGVB 4ESTE 1O0DH 3MH6A 1BBRK 8GCHG 1YLDA 2A7CA 3TGIE 2J34A 3P6ZB 2TRMA 4FUIA 1LVYA 1SLVB 3V0XA 2FLBH 1A5HA 3KL6A 1IHTH 4GHQA 3K2UA 3KQEA 1YYY1 4MLFB 1DVAH 5EW1H 1XM1A 3RU4T 4LOYH 2EA3A 2W26A 4NZLA 1N8OC 2G5NA 1C1MA 4BNRA 2GCTC 2Q6FA 1C2DA 1Z8GA 2W7UA 2SGQE 1C5YB 1LPKB 1AI8H 4CHAB 5DJ7A 2ZA5A 5FBEA 4O9VA 1A7SA 3LC3A 3A8DA 1GCDA 3LGVA 3JZ2B 1O3LA 1BTUA 3VPKA 1WYKA 5DO4H 3SV8A 3ZZ3A 1K1OA 3QUMP 1ZHMA 2SNWA 3QWCH 1NRNH 1HJ9A 4JK6A 3UQVA 1G32B 1Y3WA 5A0CA 4MNYA 1FQ3A 4FXGH 1BBRE 2WYGA 1F0RA 2ZP0H 3EDXB 2QIQA 5EXLA 1AWHB 1ZZZA 2BOKA 2GD4B 1MBMA 1SG8B 4RKJB 4YTAA 1HUTH 4UONA 3PMJA 4X1QU 1MQ5A 1H9LB 1GI0A 3M7UA 4JYTA 5C1YA 1HYLA 1S6HA 3ATIA 2ZPQA 3RXJA 2ZECA 4Q7YA 1V6DA 4QT8C 2M5TA 2SGEE 1CHOG 1C5QA 1NM6A 1SR5C 2NU1E 1ZPBA 2HNTC 1QNJA 3GCHC 4X2XA 1O3OA 3BTGE 4NIXA 3T25A 1C2JA 1XUFA 1BRAA 4DIIH 1IQEA 1C2FA 2A2QH 4K1TA 3D62A 2I6QA 4O97A 1V2JT 1UVUH 3SU0A 1GBDA 1W7XH 1GHYH 1ZMNA 1C1NA 2VWLA 1GBJA 2ZFTA 4AORA 3SI3H 2R0KA 2STBE 1P2QA 1WQVH 2F3CE 3E0NB 2QY0B 1RTFB 3LH3A 3D49H 2WINI 1NRPH 2H6MA 1DUEA 1O2UA 2ANYA 1AB9C 4IGDA 4D7FA 4Y0YE 3SJOA 1O2ZA 3B8JA 3LIWA 5DPAA 2OQUA 1EJMA 2AYWA 2OBQA 1HAPH 2THFB 1XVMA 1JBUH 4KTUA 3LC5A 1QRZA 3VGCB 4ZUHA 1Y3UA 5AFZH 2ZGBH 3GISB 5C20A 3KGPA 3TJUA 3GY2A 2ZDMA 1P2NA 1FAXA 1C2HA 3BIVH 2BD5A 2QCYA 1FNIA 1ZRBA 1UCYK 3HPTB 5EPNA 2ZFQH 1XKAC 2IOTA 1C5XB 5JB8S 1GHVH 1EUFA 1C5UA 2AS9A 1KLTA 3M36A 2HALA 3TK5A 4CR9A 2ZGJA 2Z9JA 1AFQB 1YBWA 3BV9B 1SOTA 4THNH 1M9UA 1P10A 1Z8JB 4BOHA 5HYOA 4DJZB 1V3XA 3M5MA 2ZGCA 3W95A 3K6ZA 1SHHB 1UTLM 1DWDH 1GCTC 3GCOA 3E16B 3TIUA 1MBQA 2BX3A 2JETB 4CRDA 3T5FH 4UE7H 4ZXXH 4CBOA 4Y7BA 2G00A 3V7TA 1AKSA 1LPGB 1UK3A 3TJOA 5C1XA 4A5TS 1Y59T 1MUEB 2R0LA 1BZXE 3LGTA 1UTJA 1CSOE 2A4QA 2UWPA 2PKSB 3RXHA 1SL3A 4IN2A 1UHBB 2WV5A 1O2HA 4TY6A 1EAIA 1E37B 2VIDA 2BD2A 2OBOA 5DP5A 1VR1H 4ABAA 4ZHMU 5AHGH 1N8OB 5L2ZH 2VH6A 2GCTB 1S84A 1THSH 2G55A 1P9SA 4X2VA 1SMFE 2XWAA 1Z1JA 2H2ZA 1H1BA 3A7YA 2RG3A 2Y82A 5EG4A 1DT2A 3PV4A 4Q2KA 5LGOA 1PJPA 1J8AA 3GY3A 1P03A 4FVDA 4MVNA 3RXMA 4BTIB 1BRBE 5EQSA 3MU0A 5IYTA 4B74A 3TLOA 1GBLA 1PQ8A 1RTKA 2UUYA 1FDPA 2PWXA 4K3JA 1V2PT 6LPRA 3ZV8A 1VCWA 2PTCE 4B76A 2P3TB 2HWLB 1S81A 3NKKA 2FPZA 1C4V2 1FONA 1TNGA 3STJA 5T6DA 4FU8A 3SUEA 2VIOA 1KLIH 3H7TA 4MPWA 5ETXA 1UTOA 3GY6A 2ZQ1A 1QQ4A 3VB4A 1EZUC 2A31A 2P8OB 2G4TA 2ZZUH 2HOBA 1OPHB 3PM3A 4WXIA 3GCHB 3SOSA 4A1TA 1B0FA 4AFSA 3KHVA 1ZTKA 3VB3A 3DUXH 2A1DB 1JRTA 1FIZA 1G3BA 4B2CA 1O2YA 4TPIZ 4X8UH 5PTPA 1D4PB 1HXEH 2OTVA 1KXEA 3G01A 1P9UA 1LKBA 1ZMLA 1G37A 2YNAA 5HXFA 2OLGA 1D6WA 3DD2H 4INLA 3PWCA 3F9HA 3GCTG 1GJ5H 1AB9B 1THPB 4NZQA 4X1PU 4B2BA 3T2NA 1QJ7B 4DVAU 1HBTH 2FP7B 2GVFA 3SN8A 1TX6A 1MKXH 1ETTH 5C3NA 1PQ7A 3IITA 1O2VA 4RSPA 1CU1A 4FUDA 4D7GA 3I29A 4AZ2B 3Q3XA 1MU6B 3UWJH 2H1UA 1FPHH 3MH5A 3A89A 3LPRA 1S83A 1O35A 1CGHA 3TGJE 1NFUA 2P3UB 2CMYA 3OY5U 4JK5A 3RXGA 5L2YH 2XBXA 2O8WA 5EODA 3BEIB 2AMPA 2BHGA 1TB6H 4KTCA 3M35A 4YO9A 2VIVA 2O9QA
chains in the Genus database with same CATH superfamily
1GI5A 5ESTE 1IOEA 1OYTH 2PHBA 4Y71A 1HPGA 1GBKA 2K0QA 2BY9X 1P8VC 3A8AA 1TRYA 3UY9A 4UFDH 3O8DA 1V2WT 1EZQA 2XNDD 1W12U 5TJXA 1TWXB 3UIRA 3RXDA 1UTPA 2DUCA 1G36A 2H9EH 4ISIH 1GL0E 1ZSJA 2F9NA 1SSXA 3SGQE 3T26A 3W94A 2Z3CA 1O3DA 1H9IE 4FUCA 1SLWB 2QV1A 3MWIU 2J92A 2GX4A 1EAUA 5ABWA 1IQFA 1K1PA 5T3HA 2OP9A 3RLWH 2ULLA 5EW2H 2G81E 1S0QA 1W8BH 1C1UH 1EAXA 1HCGA 1VKYA 1DXWA 1HGTH 2QC2A 1QFKH 3SO3A 3QTVH 1HJAC 1DWEH 1RIWC 1O2XA 2C8WB 2VIWA 3CS7A 5TCAA 8KME2 3BG4C 1WBGB 1MU8B 3A7XA 4MPVA 2P95A 1C9TA 1D3TB 4KGAA 3SU3A 1JIMA 1EB1H 2XBVA 2LELA 3EE7A 4OS7A 1ZTLA 1OWDA 2W3IA 4GPGA 1L4DA 1OWEA 1TBZH 1GI3A 2QXGA 4Y8XA 2IN2A 2R3UA 2UWOA 4YZUA 2BQ7B 1HRTH 2BY5X 4E7NA 3BTWE 1RRKA 2BQWB 1ELCA 1SLUB 1GMDF 1KXBA 2C93B 2JDID 1FMGA 4I8HA 4OGXA 5AVDA 1BJUA 3SBKA 1GHZA 2J2UA 3KIDU 4NFEA 7KMEH 2FDAA 1DY9A 4FOUC 4X8SH 4XSKU 3NRLA 1SGTA 1HAZB 1EB2A 2A4GA 3F2FA 4WH8A 3KEEA 5A8YA 3T29A 1ZSKA 2FS9A 3MNBA 1TBQH 1GBMA 3P17H 1SGFA 3UOUA 3VFEA 5A8XA 2XXLA 1CBWC 1TQ0B 1PPHE 3DT0H 4OS5A 1O2TA 3A86A 2PGQB 3MNSA 3LONA 3ESTA 5DG6A 1OHHD 1V2LT 5DN6D 5C2ZA 1TAWA 4SGBE 5DP4A 1FPCH 1GJ7B 1A4WH 1TX8A 1VCPA 1O34A 1BA8B 3ODDA 1DSUA 1UK4A 3RXKA 3S0NA 2ANWA 4IS5A 4K1EA 1IQMA 3Q76A 4ABIA 1O3AA 1PPGE 1C1OA 2AGIX 1O2NA 1QY6A 1GVZA 1YM0A 3OSYA 3UOPA 1TMTH 4WH6A 1V2ST 5JBCS 3S7HB 1GBAA 1MCVA 2BVSH 3TITA 3O8CA 1ZSLA 1DE7H 2A32A 3SZNA 2OD3B 4FUBA 4CH8B 1J14A 2ANMH 1C1QA 1AE5A 1MTWA 1O5BB 1OYQA 5L30H 3UTUH 3A7WA 3C1KA 3RXLA 1ZGVA 5EPYA 1A1RA 2BLWA 2P93A 1WCZA 1DFPA 1FY3A 4PROA 2BDYA 1O3BA 1K1NA 3ATMA 2FIRH 4Y8YA 3Q00A 4Y0ZE 1HAVA 2IJD1 2J97A 1SGPE 2WPMS 5FPTA 1W11U 3P8OA 1MQ6A 4CRFA 1NBMD 3LKWA 1UVPA 1UTQA 2F9OA 2LP6A 1OSSA 3SV6A 4NFFA 1ELTA 4HFPB 2FX6A 1S82A 1GMCG 2CXVA 3RDZA 2Y81A 4F49A 5CHAC 3UREA 3LGUA 1CE5A 2BD8A 2FYQA 1ZMJA 2FLRH 2H9HA 1BMNH 2G5VA 3RM0H 2WHXA 1VITH 1ANDA 2FEQH 1W0ZU 1ARCA 3QO6A 1INCA 1MH0A 5C1UA 2GCHG 1AVXA 1A46H 2BZ6H 3MMGA 4ZKNU 2NU2E 1C5ZB 1T8LA 1OWKA 1ELDE 2AIPA 4ABFA 2FXRA 4LZ4B 2WPDD 3SV2H 1QL8A 3TPIZ 1O5DH 1ESAA 1EASA 1TNJA 1V2KT 5C94A 4XBBA 1SGIB 1V2OT 2PKAA 2FOEA 2VIQA 5T6FA 3MFJA 3T62A 2ZEBA 2ZHDA 3SU1A 1HJAB 1RIWB 4X0WU 4CREA 2G51A 1GHBG 3DFLA 1O38A 1YPLH 4E05H 4I31A 2QXHA 3M3SA 1ELBA 1GJ8B 1O5CB 3M7QA 3U98H 3PTNA 1GHAF 2PTNA 2UUFB 2IJOB 2NU0E 3MU1A 1QJ1B 2ZF0H 1XXFA 3HKJB 4K5ZA 1FY8E 1J17T 3AASA 4D76A 1DM4B 4ISOA 2PKSC 5B6LA 4P02A 3AAUA 1F5LA 3R3GB 1JXPA 5H4IB 3M3TA 1EQ9A 1YLNA 1IQLA 4NSYA 3S9AA 1QGFA 3GDSA 2XBWA 4YT6H 5K7RA 3BTEE 1F2SE 1ZRKA 1T4VH 1MAYA 2D26C 3GDVA 1Y3XA 3NUMA 2GKVE 4FUJA 5DKMA 1TMBH 3WY8A 1CBWB 2Z9IA 4B75A 1HXFH 2P94A 1GVKB 2OQ5A 1UTMA 2OC0A 1FZZA 3KN2A 1YPHE 4NGAH 1C5OH 3SU6A 3BTME 4LXBH 1H8ED 3L6PA 3MO9A 1BTWA 1YLCA 5FPSA 3LDXH 4IMQA 1LHDH 1VJ9U 2C8XB 1SGQE 3ODFA 4KKDA 3V12A 2GT8A 4MDSA 1YPJH 4WMFA 3SGBE 1L2EA 1FY1A 1DOJA 4IN1A 1GG6C 3W1EA 1EP6A 3KNXA 3GS9A 4X6MA 1O32A 1DY8A 5I46H 4WMEA 1QJ6B 4RKOB 3AVZA 1NZQH 2C3SA 2Z6BD 2HLDD 1OWJA 2CF8H 1QBOA 2ZU5A 5E0JA 1GI2A 2RA0A 5EU8A 3SHAH 3MI4A 2ILNA 1F0SA 1PYTC 1KYNA 1VJAU 2P8OC 2ZDNA 1XUGA 1DUAA 5BPEA 2BD3A 3RU4D 1KXCA 4CBNA 1SFQB 2OXSA 1RD3B 2SNVA 2VU8E 1QA0A 3U8TH 2CN0H 1OP0A 2QN5T 1O3HA 4WXVA 2WPJS 3TNTA 3D23A 1KDQA 2SGAA 4YOIA 3VEQB 1K0HA 4YT7H 1C2EA 3A8CA 2ZI2H 2BVRH 2V3OH 3KYGA 3FP6E 2C90B 1VZQH 2LPRA 4LK4A 3F2HA 2TGDA 4MQAA 2Z3DA 2C4FH 2OK5A 4XDEA 5DP6A 1HJ8A 3UNQA 4A1XA 5CHAB 3ZYEA 1K1MA 2SGDE 2ODQA 9ESTA 2BOHB 4MTBA 1P05A 1A2CH 1DX5M 3EGKH 1BBRH 3BTDE 1B7XB 1C2GA 2XC0A 4BAQB 1LDTT 1N1LA 1THRH 2BY7X 1P3CA 2GTBA 3UWIA 4K8BA 1BMLA 2W6JD 3UNSA 2PGBB 2CGAA 2AGGX 3BTHE 2XBYA 1XKBC 2ODYB 5GCHF 3PRDA 1S6FA 2Y80A 1CHOF 1ABIH 2BDHA 4AC9A 2QF3A 5G4BA 2ZIQH 1O3KA 5C0UA 3BTFE 2H5DA 3M5OA 1V2UT 1W0YH 4AFQA 2CJIA 1L0ZA 1BMFD 2CHAC 1WTHD 1TX7A 4OS6A 3BSQA 3PLPA 4Q7XA 4AFUA 1WU1A 4IC5A 2UWLA 1A0JA 4ISHH 3TNSA 3VXEH 1K1LA 1CA0C 5GWZA 4XBDA 4ASHA 1AUJA 3KQ5A 2Y5HA 1BTYA 2FM2A 2OINA 3U8RH 1LHEH 1LVOA 2ZHFH 4NIWA 1DWCH 1QB6A 1AKSB 2TIOA 1RJXB 2G8TA 2BXTH 1PPEE 3RXIA 1MAXA 2GZ8A 1L1NA 1GBFA 1TPOA 3QTOH 2O8LA 2PW8H 1Z7KA 3ZZ8A 4CRGA 2Z94A 3P8FA 1MD8A 5DP7A 1H9HE 1KY9A 1QB9A 1FI8A 5FHTA 1UCYE 1DITH 2FOFA 3ZZ6A 5FBIA 3A84A 4FETA 2ZU4A 1NRSH 2BX4A 2A5IA 1LO6A 1QR3E 2VB0A 3OY6U 1C5WB 1YPEH 2V35A 3K9XB 1XXDA 2BZAA 3HK6B 1Y3VA 3FP7E 3A7TA 1QL9A 1V2MT 2ZWLH 1C1VH 5DP8A 3RXSA 3PV2A 2GP9B 6ESTA 5DP3A 1GVLA 1QURH 3ZZAA 4A6LA 4KP0A 2ZFSA 3LH1A 5HMAA 1QRWA 4CRCA 1CQQA 1T32A 5LPRA 1LMWB 4YM9A 2BVXH 4M9FA 1S85A 5E8EH 3RMMH 1TGCA 1FUJA 2ZTYA 3L33A 4WY3A 2TGPZ 4F48B 1WAYB 2Z9GA 1Y5AT 5EQRA 1SGRE 3RXRA 2EY4C 3ZZ4A 4AYVB 1ZOMA 3GCNA 3PYHA 4D8NA 1QHRB 3L3TA 2ESTE 2OUAA 2RA3A 1DPOA 1HAGE 1YPMH 4X6NA 2FTMA 4XFQA 2O8UA 5LH8A 1GG6B 2BLVA 5TCCA 1HIAA 2AMDA 3MO3A 4TPYA 5A8ZA 2ZFPH 1FY5A 3CNRA 3DFJA 5J4SA 5FAHA 1SOZA 1JIRA 3LJOA 3PMAB 5F8TA 5FCRA 1KXAA 3A7VA 3QX5H 1A0HB 2ZHQH 3EA8A 1UCYH 1EATA 2BYAX 1GBHA 2GDEH 2AFQB 3URDA 1XMNB 3EAJA 2TBSA 5E0HA 2VVVA 1CHGA 3ZVDA 4D9QA 3B23B 3SNEA 1FV9A 4FUEA 1PYTD 1DLEA 2VIPA 1O2MA 4A7IB 4XD7D 4ZAEA 1GI4A 1GBEA 1BB0B 1DXPA 1B5GH 1GL1A 1SC8U 3H7OA 1ANCA 5FPYA 3M5LA 1BHXF 3SU4A 2HNTE 1NFYA 4NCYA 1WV7H 1FAKH 5K0HA 4GAWA 4TWYA 3A87A 2O8TA 1BUIA 2YNBA 1BITA 3FZZA 1QB1A 1H8IH 2C8YB 2J98B 6GCHF 2QE7D 2AH4X 3SQHE 3LGIA 3SI4H 2FOMB 1HAOH 1AMHA 1SPJA 2A5AA 3UUZA 3DSGA 3SQEE 1EJAA 1O2QA 4DCDA 4U01A 3KQBA 1GMHG 5HGGA 1QIXB 1P04A 2KR7A 3KCGH 2HLCA 2WYJA 3ZVBA 3SZEA 1J15A 2STAE 5EGMA 5DP9A 2V0BA 1KTSB 5E2OA 1VGCC 1O5EH 1TALA 4Q7ZA 2CHAB 2H9TH 2NU3E 2VWNA 1EOJA 1YC0A 3HKIB 3F6UH 3FAOA 1TNHA 1C1WH 4I86A 1CA0B 2A0QB 1HAXB 4CH2B 3V13A 1C4Y2 1PFXC 1Z6JH 2FO9A 1MZAA 3A81A 1C2MA 1FJSA 2GDDA 5JPMH 2XCNA 1TNKA 3MNXA 2A4OA 2O8MA 1NPMA 2VNTA 1A61H 4A1VA 1GDUA 3TH2H 1A5GH 4J2YB 4B6EA 1EKBB 5B6OA 1TOMH 1BMAA 1DS2E 4DURA 1IQHA 2UUJB 1ETSH 3UR9A 1PQAA 1AD8H 4YLUA 4YLQH 2EI8A 5C17A 4YESB 5HIZA 2IPHA 3A85A 2PUXB 5GPIB 1ELGA 4ZROA 1BQYA 1T8OA 3HGNA 4I8LA 4AG1A 1CVWH 5A0BA 1SGFG 2RFKC 1E35B 2A5KA 1IHSH 1AO5A 4FU9A 1P0SH 2BQ6B 4IC6A 4ABBA 1QBVH 3FP8E 1KMHB 1ARBA 1K28D 3BF6H 1C5SA 4YOGA 5GJ4B 4IW4E 1TA6A 1WSSH 4F55A 4ACBA 3M61U 4GHTA 1C2KA 2J94A 4HZHA 5EJZA 3SUDA 2L6OA 3RMNH 3DA9B 1LKAA 4UEHH 3QLPH 1LVMA 1O3IA 3P8GA 3D65E 3GY4A 2SGPE 3SJ9A 3RXCA 2Y5GA 2FODA 1TOCB 4JZIA 2BLQA 4DG4A 1UTKA 1QCPA 3QZRA 3ZVAA 1NC6A 1COWD 2Q6DA 1G3EA 1OP2A 3SNBA 3BEUA 1WTGH 5LPFA 4ABGA 2BDAA 4JZFH 1G2MA 5GXPA 1EOLA 3STIA 1AVWA 4JYVH 4H6SB 1FXYA 2ZPRA 4LZ1H 3RMLH 1E0FD 5A2MH 1C9PA 1O2SA 2G4UA 1AZZA 1XVOA 1HAIH 1EPTA 1GI6A 2J9NA 1V2NT 2V3HH 3DSPA 3F9FA 1MD7A 4NA8A 2ZC9H 7LPRA 1ZJKA 4AN7A 1LHFH 1BTHH 3UPEA 1OWIA 1FY4A 3ZVGA 1NU9A 2XCFA 4ABDA 4ZMAH 1JWTA 1VITF 1YCPK 2KAIA 2ZDAH 3RLYH 2KZ4A 4NA9H 2WPHS 2ZCKP 3KYFA 4ABEA 2Z9LA 1AHTH 4JZDH 1HAYB 7GCHF 4CRBA 3ZYDA 1Z6EA 1X7AC 2V7QD 3TVJB 1NN6A 1ZHPA 4OS1A 2FI5E 3V3MA 1FIWA 2IPQX 1ZTJA 3HGPA 1O2LA 1QTFA 3RXTA 3N7OA 3KF2A 1CT0E 1IQJA 1DSTA 2PSYA 1Q31A 1O2PA 1J16A 1DLKB 2BM2A 2ZQ2A 3UQOA 3GY8A 3KQCA 2ZU3A 1HAVB 2GT7A 1TPAE 1F0UA 2XRCA 1LVBA 3UR6A 2W3KA 1AN1E 1BTPA 5T1VA 2FOAA 5I25A 4DT7B 4GCHF 3P95A 2CF9H 3U69H 2Q1JA 2PV9B 3TK6A 2R9PA 4AGKA 1TGBA 1ZJDA 1BT7A 5EQQA 2ZGXH 1NBME 3OEHD 1Z8RA 1NU7B 2F91A 2F4LA 4JZEH 1QRXA 5DGJA 1TFXA 3AAVA 4BAKB 3PMBB 4AYYB 2W5EA 1ID5H 1P11E 1SHYA 2G52A 6CHAC 1W2KH 2QXIA 4B73A 1SBWA 1P2JA 1O3EA 4DOQA 2ZDVH 1UO6A 3GOVB 3F0OA 1CO7E 4F4OC 1CGIE 1IQIA 1BRUP 1VGCB 1TLDA 4YXWD 3P70B 1GHAG 2B0FA 1P2OA 3M7TA 3RXPA 1GI8B 5A09A 1K1JA 1PQ5A 2ZTZA 1A0LA 4Y11E 5FX6A 4M7GA 3BEFB 3ZVEA 1O3GA 3BTTE 1U6QA 3RXQA 1CT2E 3ATWA 4DT4A 1BDAA 1TNIA 5DK1A 1KSNA 5KGOA 3AW1A 2Z9KA 1OXGA 5JBTA 4NWLA 1AZ8A 1EZSC 2PKAB 1O3NA 5EJ1A 1GBBA 1TRMA 4ZKOU 4INHA 1BCUH 1TNLA 8LPRA 3JZ1B 4NIVA 1P2IA 1ABJH 2JKHA 3SORA 3TK9A 1O3CA 3UB0A 1LPZB 3F68H 4VGCB 1S0RA 1SI5H 1C2IA 4AFZA 2FTLE 1KTTB 1Y8TA 3BG8A 4ZHAA 2J95A 1E79D 2AGEX 5C5OA 1YPGH 3SJKA 1TGTA 3MO6A 1NO9H 1GDNA 3LT3A 1YCPH 4FVBA 1AY6H 1WDIA 3FANA 1O2WA 1OP8A 3SNCA 2FWWA 1HDTH 4U30A 2ALPA 1GWAA 1C5VA 2B5TB 4OS2A 4BXWA 4AOQA 1NT1A 3TJNA 5SGAE 1DDJA 2TGTA 3MOCA 1UVSH 1Z71A 1L1GA 3PLBA 3QDZB 2RCEA 4GLYA 3BTKE 2KX4A 4FUGA 4JCNA 2W7SA 1MKWK 2GCHF 3SV9A 1G3CA 2BDBA 1O5GH 1TGNA 3P8NA 1FN8A 3A80A 1C1RA 3E90B 1RTLA 1F92A 1EP5A 5DSFA 1SGYE 4Y8ZA 4B71A 2PLXA 1D3QB 1C1PA 2K1QA 3ATKA 1A3EH 4FUFA 1P01A 2J5UA 4CRAA 3MYWA 2BD7A 1NROH 3URCA 1GHBF 1XUKA 1YF4A 3RXBA 2VJ1A 2Y6TA 3SNAA 2QF0A 5L6NH 1NS3A 1O2OA 1GGDB 1T31A 5F8XA 1A3BH 1GBTA 2KCOA 1MTVA 3FFGA 2FOHA 1EX3A 2PFEA 3PO1B 5EOKA 4DY7B 1O37A 5JYIA 2R3YA 3PROA 4GVUA 4BXSA 1AGJA 3M5NA 3E3TA 4KTSA 8GCHF 4MPUA 5JBAS 1AE8H 2XYAA 3ENSB 3M3VA 3E6PH 5F6MA 3B9FH 1AIXH 4IMZA 3RXAA 1GJBB 3FZDA 3K65B 3LJJA 4GUXA 3N7DA 1WQSA 3U9AH 4NIYA 3Q77A 3MH4A 4I32A 2QXJA 5CMXH 5EXMA 2JJ2D 2NU4E 3BIUH 3S69A 3CP7A 4B1TA 2D8WA 2BD9A 1ANBA 1KDQB 1Y5UT 3O8BA 5GCHG 4B6FA 3E91A 1O5FH 1Q3XA 3RU4E 1GI9B 4K2YA 4K69A 2FX4A 2RDLA 1TYNA 1C5MD 3VG8A 2BLOA 2ZO3H 1O2KA 4ZKSU 4ACAA 2HGTH 7ESTE 3LU9B 1H4WA 1W0JD 1TPSA 1GHXH 4Y6DA 1Z8IB 5AFYH 4Y7AA 3SJ8A 4E7RG 3CENA 4B2AA 2FOBA 2K8IA 1ELEE 1ORFA 2ZCHP 1TE0A 5F03A 3H5CB 3LGYA 4XE4A 6CHAB 4MNWA 5FCKA 3A8BA 1TBRH 1N6YA 3RC5A 2KM0A 3FVFB 4WF8A 2ZU1A 5HKKD 2V3MA 4HTCH 1EAWA 2WZQA 2XC5A 3QZQA 1O2GH 4K1SA 2VWOA 3ZZCA 2JIZD 3A82A 3E0PB 4Q4LA 1RS0A 1HAHH 2QF5A 2AMQA 4HGCA 4ISLA 1P57B 4BTTB 4UDWH 1MKWH 1O3PB 2Q6GA 1NFXA 2BDGA 1SQTA 1RFNA 2XW9A 5GDSH 4R8TB 1WUNH 3SU5A 1OKXA 1H8DH 2FOGA 3Q3KA 3TH3H 1SKYE 2ZHWH 2VINA 1PPZA 4SGAE 5JDUB 3ATLA 4KELA 1E34B 4X1SU 2FS8A 2FZZA 2ASUB 4IBLH 2SFAA 2GMTB 3RMOH 2EI7A 2BY6X 2BD4A 2P3FH 1C5PA 1TMUH 2ODPA 2R2WU 4R0IA 3SHCH 1LQDB 4XBCA 3PWBA 4OS4A 4U2WA 4INKA 4ZXYH 3TGKE 4Z6AH 4X1NU 4HG6A 3I77A 5FL7D 1BMMH 3ITIA 4X8TH 5EJLA 4Y76A 1FLEE 1GPZA 1T8NA 1UJ1A 1OOKB 2H5CA 1HFDA 2CV3A 1ELFA 2BDIA 3DHKH 3U1JB 1GI7B 2ALVA 1MKXK 1EJNA 3MQKC 2JH6D 1E38B 4MNXA 4Y10E 1PPBH 1SLXB 1O33A 4Z0KA 4J1YA 2ZTXA 3M37A 1OX1A 4ABJA 5JBBS 3SUGA 2OC1A 3NCLA 1P09A 1UHBA 4I8GA 1GDQA 2ZPSA 3T28A 2ZNKH 3QGJA 3CS0A 4FUHA 4NSVA 1GJ4H 1XX9A 2A2XH 3RXEA 4AX9H 2HVYB 1TABE 1LHCH 5ESBA 3GY7A 5IDKA 3S9CA 3ZZ5A 1AUTC 1ZHRA 3EYDA 2I6SA 1VCQA 2WPKS 5E0GA 1G30B 4X2YA 1HLTH 4X1RU 3Q3YA 2XC4A 4I33A 1MZDA 1GJCB 1HIAB 1IAUA 1P12E 1ZLRA 4YOJA 1BRCE 4AGJA 1D3PB 4UFFH 1ZGIA 4E06H 5CHBA 1EPTC 2F9BH 3AW0A 1P02A 3EE0B 1P2KA 1DICA 2DE8A 2WUCA 3S9BA 2BXUH 2GJGA 1ZR0A 6GCHG 1YPKH 4AB8A 1A5IA 3WWFA 3GDUA 2VVUA 2SGFE 3O8RA 1G2LA 4XOJA 1C5LH 2J4IA 3RXFA 3S7KB 1TA2A 2OCVB 2ZKSA 1ZYOA 1BOQA 1SB1H 1KXFA 2FOCA 1BHXB 4BAMB 4JYUH 2VVCA 1O2RA 2ZCLP 1G9IE 1NESE 3IG6B 4HI3A 3SW2B 1AWFH 3C27B 3RM2H 1K22H 1LTOA 2ZDLA 4MG3A 4Y79A 1YY3A 3OE7D 1UK2A 2GZ7A 1JMOH 4O3UA 1NRQH 3SGAE 1MTNC 4WMDA 1O5AB 1T4UH 2HNTF 3NXPA 1P06A 1UVTH 3KQDA 3SV7A 1V2QT 3ZZ9A 2V6NA 1Y5BT 4D9RA 2WPIS 2ZU2A 4WJG2 2ZFRH 1BTXA 1RXPA 2B7DH 1HV7A 3I78A 4AB9A 3TU7H 2ZGHA 2Y5FA 2OC8A 2QGRA 2Y7XA 3GY5A 4BAHB 1PPFE 2F9UA 3MNCA 1F0TA 1GBCA 1J9CH 1QA7A 2B9LA 2QA9E 3MU8A 4RT1A 3IWMA 3UNRA 3PTBA 1RGQA 4DW2U 2J98A 1C5TA 2QAAA 1N6XA 4NWKA 3NPSA 1IQKA 2A45B 1EXFA 3OU0A 1KLJH 4DIHH 1LCYA 3A88A 2BMGB 3LGWA 1OWHA 3SJIA 1SGCA 3QN7A 5JB9S 3RXUA 1O39A 3ZZBA 1D6RA 1GMDG 4AG2A 3U28C 2GV6A 1O3MA 1ELAA 1EZXC 1NY22 4FU7A 1ESTA 3R0FA 1E36B 3GCTF 1FN6A 1O2IA 3NZIA 3RXOA 2VWMA 1O3FA 4X6OA 5E2PA 5T6GA 2PSXA 2EI6A 4TT3D 1AFEH 4WVPE 1O30A 2NWNA 4VGCC 4ZKRU 1GCTB 3MTYA 1K9OE 2GZ9A 2F9VA 1OS8A 5FX5A 1UTNA 5HIYA 3PLKA 1E1RD 1MMJN 1YWUA 1Z1IA 2HPPH 3U8OH 1TGSZ 4RN6A 1C1TA 2ANKH 3SUFA 1GHWH 2HPQH 3MU5A 2HVXA 3OAAD 4O3TA 1W10U 3LOXA 1F5KU 5GNDA 3SU2A 1ELVA 1DWBH 5HM9A 2WV9A 2ZDKA 1GI1A 1BIOA 2ZHEH 1ETRH 1ACBE 1GMHF 1ESBA 1D3DB 3ZVCA 5A0AE 1S5SA 2UUKB 2PR3A 1YKTA 3MHWU 1NFWA 2VGCC 1LQEA 1VITG 2VH0A 3FN8A 1MTUA 2XWBI 4I7YH 2A7HA 2J38A 3BN9A 4OGYA 1V2TT 4H42U 1O3JA 1F5RA 3K6YA 7GCHG 5J4QA 3RC4A 4JMYA 4GSOA 1SVPA 4TWWA 2Y7ZA 1TPPA 3WWBA 1TQ7B 1V2VT 2CK3D 3ZV9A 1CA8B 1BJVA 3RC6A 4UFGH 2BDCA 3ZZ7A 1YPHC 1PPCE 1SGDE 1EPTB 1AVGH 1F7ZA 2C8ZB 4U32A 2FI4E 1DANH 3VXFH 2EC9H 3RUOA 1CT4E 1QBNA 4CHAC 5HM2A 4Q80A 3HATH 1C5NH 2KAIB 2A7JA 2OC7A 2DE9A 1GGDC 2PP6A 4BANB 4ZHLU 4TYDA 1SQRA 4X2WA 4GCHG 1YGCH 3SNDA 1SGNE 4XRNA 5KECA 5LPEA 2FYRA 2QYIA 2P16A 3T27A 3QGNB 3VB6A 3PO1C 1T8MA 1XUHA 2Z7FE 2AIQA 2YMSC 2AEIH 3UAIC 2GV7A 1TRNA 3P92A 3OFND 2M2AA 2R2MB 4NA7A 1C4U2 3RXVA 5GIBA 1XUIA 1W7GH 1T7CA 5AF9H 2F83A 3OYPA 3WW7A 1G3DA 2WUBA 3U1IB 1MTNB 3F9EA 3N7EA 4JZ1A 4P00A 3H09A 1YP9A 2RDEA 1XUJA 2LNCA 2FESH 3EQ0H 1K2I1 2BTCE 3EA7A 1QQUA 4UD9H 2P59A 2A4RA 1IQNA 2YOLA 5C5NA 1P2MA 1ANEA 3VB5A 1C5RA 1C2LA 4X8VH 1K21H 1LHGH 3QK1A 1AQ7A 4RT0A 3E1XB 1BTZA 2EEKA 2B8OH 2WV4A 3OTJE 2Z3EA 1GJ9B 1O31A 3ZZDA 3GICB 1MTSA 1AU8A 2JH5D 1K1IA 4I8KA 1W3CA 1SFIA 1GJ6A 1UMAH 2VBCA 3F0PA 4MPXA 3HK3B 5IK2D 1O2JA 2ZG0H 1SQOA 8ESTE 4DGJA 3BTQE 4BAOB 3DSOA 3F9GA 4K8YA 2ZFFH 5F8ZA 1Q2WA 4ISNA 1SQAA 1W14U 3MH7A 1W13U 5CE1A 1GBIA 5BRRE 1QL7A 4ZH8A 1HB0B 4O03A 3TH4H 3GYLB 1P3EA 3ELAH 4NG9H 2PUQH 1TIOA 3FO8D 4H6TA 4TY7A 1WOFA 1YCPM 3ZVFA 3VGCC 1B0EA 4UFEH 2D1JA 3UFAA 1IQGA 4I8JA 4ASUD 3VB7A 3RP2A 3EA9A 1ZPCA 2XTTB 1GJDB 1MABB 1D9IA 2GMTC 2HRVA 1MCTA 1ZPZA 4K60A 3OX7U 2F43B 3NWUA 3GYMA 1SGEE 2AERH 1CGJE 2W6ID 3TJVA 4H4FA 2FMJA 5C67A 2F9PA 2XNIA 3A83A 1UVOA 1NTPA 1V2RT 1AFQC 2JJ1D 3MU4A 2TPIZ 1O36A 1GMCF 1HNEE 3PMHB 4MNVA 3F3BA 3F1SB 4WWYA 1KXDA 5FXLA 1KIGH 1NRRH 3A7ZA 4BTUB 1L4ZA 2JH0D 1C1SA 9LPRA 1EFRD 1JRSA 3BG4B 2AHME 3E8LA 3NK8A 3PB1E 4X6PA 4CR5A 1Y3YA 2BY8X 2JETC 2VGCB 5EXNA 2WPLS 4A92A 1JOUB 4ABHA 1L1JA 2TGAA 2FI3E 1TONA 1GJAB 2BB4A 2D2DA 2KCAA 2GGVB 4ESTE 1O0DH 3MH6A 1BBRK 8GCHG 1YLDA 5KEDA 2A7CA 1UW7A 3TGIE 2J34A 3P6ZB 2TRMA 4FUIA 1LVYA 1SLVB 3V0XA 2FLBH 1A5HA 3KL6A 3PV5A 1IHTH 4GHQA 3K2UA 3KQEA 1YYY1 3N99A 4MLFB 1DVAH 5EW1H 1XM1A 3RU4T 4LOYH 2EA3A 2W26A 4NZLA 1N8OC 2G5NA 1C1MA 4BNRA 2GCTC 2Q6FA 1C2DA 1Z8GA 2W7UA 2SGQE 1C5YB 1LPKB 1AI8H 4CHAB 5DJ7A 2ZA5A 5FBEA 4O9VA 1A7SA 3LC3A 3A8DA 3DCLA 1GCDA 3LGVA 3JZ2B 1O3LA 1BTUA 3VPKA 1WYKA 5DO4H 3SV8A 3ZZ3A 1W0KD 1K1OA 3QUMP 1ZHMA 2SNWA 2YMSB 1NRNH 3QWCH 1HJ9A 4JK6A 3UQVA 1G32B 1Y3WA 3FKSD 4MNYA 5A0CA 1FQ3A 4FXGH 1BBRE 2WYGA 1F0RA 2ZP0H 3EDXB 2QIQA 5EXLA 1AWHB 1ZZZA 2BOKA 2GD4B 1MBMA 1SG8B 4RKJB 2YMSD 4YTAA 5CDFE 4UONA 1HUTH 3PMJA 4X1QU 2KCYA 1WXRA 1MQ5A 1H9LB 1GI0A 3M7UA 4JYTA 5C1YA 1HYLA 1S6HA 1E1QD 3ATIA 2ZPQA 3RXJA 2ZECA 4Q7YA 1V6DA 4QT8C 2M5TA 2SGEE 1CHOG 4Q63A 1C5QA 1NM6A 1SR5C 2NU1E 1ZPBA 2HNTC 1QNJA 3GCHC 4X2XA 1O3OA 3BTGE 4NIXA 3T25A 1C2JA 1XUFA 1BRAA 4DIIH 1IQEA 1C2FA 2A2QH 4OM9A 4K1TA 3D62A 2I6QA 4O97A 1V2JT 1UVUH 3SU0A 1GBDA 1W7XH 1GHYH 1ZMNA 1C1NA 2QF4A 2VWLA 1GBJA 2ZFTA 4AORA 3SI3H 2R0KA 2STBE 1P2QA 1WQVH 2F3CE 3E0NB 2QY0B 1RTFB 3LH3A 3D49H 2WINI 1NRPH 2H6MA 1DUEA 1O2UA 2ANYA 1AB9C 4IGDA 4D7FA 4Y0YE 3SJOA 1O2ZA 3B8JA 3LIWA 2XOKD 5DPAA 1EJMA 2OBQA 2AYWA 2OQUA 1HAPH 2THFB 2KFWA 1XVMA 1JBUH 4KTUA 3LC5A 1QRZA 3VGCB 4ZUHA 1Y3UA 5AFZH 2ZGBH 3GISB 5C20A 2WSSD 3KGPA 3TJUA 3GY2A 2ZDMA 1P2NA 1FAXA 1C2HA 3BIVH 2BD5A 2QCYA 1FNIA 1ZRBA 1UCYK 3HPTB 5EPNA 2ZFQH 1XKAC 2IOTA 1C5XB 5JB8S 1GHVH 1EUFA 1C5UA 2AS9A 1KLTA 3M36A 2HALA 3TK5A 4CR9A 2ZGJA 2Z9JA 1AFQB 1YBWA 3BV9B 1SOTA 4THNH 1M9UA 1P10A 1Z8JB 4BOHA 5C0TA 4DJZB 5HYOA 1V3XA 3M5MA 1FX0B 2ZGCA 3W95A 3K6ZA 1SHHB 1UTLM 1DWDH 1GCTC 3GCOA 3E16B 5EIYA 3TIUA 1MBQA 2BX3A 2JETB 2KCPA 4CRDA 3T5FH 4UE7H 4ZXXH 4CBOA 4Y7BA 2G00A 3V7TA 1AKSA 1LPGB 1UK3A 3TJOA 5C1XA 4A5TS 1Y59T 1MUEB 2R0LA 1BZXE 3LGTA 1UTJA 1CSOE 2A4QA 2UWPA 2PKSB 3PRBA 3RXHA 1SL3A 4Z1MD 4IN2A 1UHBB 2WV5A 1O2HA 4TY6A 1EAIA 1E37B 2VIDA 2BD2A 2OBOA 5DP5A 1VR1H 4ABAA 4ZHMU 5AHGH 1N8OB 5L2ZH 2VH6A 2GCTB 1S84A 1THSH 2G55A 1QZ8A 1P9SA 4X2VA 1SMFE 2XWAA 1Z1JA 2H2ZA 1H1BA 3A7YA 2RG3A 2Y82A 5EG4A 1DT2A 3PV4A 4Q2KA 5LGOA 1PJPA 1J8AA 3GY3A 1P03A 4FVDA 4MVNA 3RXMA 4BTIB 1BRBE 5EQSA 3MU0A 5IYTA 4B74A 3TLOA 1GBLA 1H8HD 1PQ8A 1RTKA 2UUYA 3AK5A 1FDPA 2PWXA 4K3JA 3FOAA 1V2PT 6LPRA 4ZCNA 3ZV8A 1VCWA 2PTCE 4B76A 2P3TB 2HWLB 1S81A 3NKKA 2FPZA 1C4V2 1FONA 1TNGA 3STJA 5T6DA 4FU8A 2EQNA 3SUEA 2VIOA 1KLIH 3H7TA 4MPWA 5ETXA 1UTOA 3GY6A 2ZQ1A 1QQ4A 5F53A 3VB4A 1EZUC 2A31A 2P8OB 2G4TA 2ZZUH 2HOBA 1OPHB 3PM3A 4WXIA 3GCHB 3SOSA 4A1TA 3SYJA 1B0FA 1S6LA 4AFSA 3KHVA 1ZTKA 3VB3A 3DUXH 2A1DB 1JRTA 1FIZA 1G3BA 4B2CA 1O2YA 4TPIZ 4X8UH 5PTPA 1D4PB 1HXEH 4TSFD 2OTVA 1KXEA 3G01A 3OTPA 1P9UA 1LKBA 1ZMLA 1G37A 3OEED 2YNAA 5HXFA 4RI0A 3ZIAD 2OLGA 1D6WA 3DD2H 4INLA 2L74A 3PWCA 3F9HA 3GCTG 1GJ5H 1AB9B 1THPB 4NZQA 4X1PU 4B2BA 3T2NA 1QJ7B 4DVAU 1HBTH 2FP7B 2GVFA 3SN8A 1TX6A 1MKXH 1ETTH 5C3NA 1PQ7A 3IITA 1O2VA 4RSPA 1CU1A 4FUDA 4D7GA 3I29A 4AZ2B 3Q3XA 1MU6B 3UWJH 2H1UA 1FPHH 3MH5A 3A89A 3LPRA 3F2GA 1S83A 1O35A 1CGHA 3TGJE 1NFUA 2P3UB 2CMYA 3OY5U 4JK5A 3RXGA 5L2YH 2XBXA 2O8WA 5EODA 3BEIB 2AMPA 2BHGA 1TB6H 4KTCA 3M35A 4YO9A 2VIVA 2O9QA
chains in the Genus database with same CATH topology
1GI5A 5ESTE 1IOEA 1OYTH 2PHBA 4Y71A 1HPGA 1GBKA 2BY9X 1P8VC 3A8AA 1TRYA 3UY9A 4UFDH 3O8DA 1V2WT 1EZQA 1W12U 5TJXA 1TWXB 3UIRA 3RXDA 1UTPA 2DUCA 1G36A 2H9EH 4ISIH 1GL0E 1ZSJA 2F9NA 1SSXA 3SGQE 3T26A 3W94A 2Z3CA 1O3DA 1H9IE 4FUCA 1SLWB 2QV1A 3MWIU 2J92A 2GX4A 1EAUA 5ABWA 1IQFA 1K1PA 5T3HA 2OP9A 3RLWH 2ULLA 5EW2H 2G81E 1S0QA 1W8BH 1C1UH 1EAXA 1HCGA 1DXWA 1HGTH 2QC2A 1QFKH 3SO3A 3QTVH 1HJAC 1DWEH 1RIWC 1O2XA 2C8WB 2VIWA 3CS7A 5TCAA 8KME2 3BG4C 1WBGB 1MU8B 3A7XA 4MPVA 2P95A 1C9TA 1D3TB 4KGAA 3SU3A 1JIMA 1EB1H 2XBVA 4OS7A 1ZTLA 1OWDA 2W3IA 4GPGA 1L4DA 1OWEA 1TBZH 1GI3A 2QXGA 4Y8XA 2IN2A 2R3UA 2UWOA 4YZUA 2BQ7B 1HRTH 2BY5X 4E7NA 3BTWE 1RRKA 2BQWB 1ELCA 1SLUB 1GMDF 1KXBA 2C93B 1FMGA 4I8HA 4OGXA 5AVDA 1BJUA 3SBKA 1GHZA 2J2UA 3KIDU 4NFEA 7KMEH 2FDAA 1DY9A 4X8SH 4XSKU 1SGTA 1HAZB 1EB2A 2A4GA 4WH8A 3KEEA 5A8YA 3T29A 1ZSKA 2FS9A 3MNBA 1TBQH 1GBMA 3P17H 1SGFA 3UOUA 3VFEA 5A8XA 2XXLA 1CBWC 1TQ0B 1PPHE 3DT0H 4OS5A 1O2TA 3A86A 2PGQB 3MNSA 3LONA 3ESTA 5DG6A 1V2LT 5C2ZA 1TAWA 4SGBE 5DP4A 1FPCH 1GJ7B 1A4WH 1TX8A 1VCPA 1O34A 1BA8B 3ODDA 1DSUA 1UK4A 3RXKA 3S0NA 2ANWA 4IS5A 4K1EA 1IQMA 3Q76A 4ABIA 1O3AA 1PPGE 1C1OA 2AGIX 1O2NA 1QY6A 1GVZA 1YM0A 3OSYA 3UOPA 1TMTH 4WH6A 1V2ST 5JBCS 3S7HB 1GBAA 1MCVA 2BVSH 3TITA 3O8CA 1ZSLA 1DE7H 2A32A 3SZNA 2OD3B 4FUBA 4CH8B 1J14A 2ANMH 1C1QA 1AE5A 1MTWA 1O5BB 1OYQA 5L30H 3UTUH 3A7WA 3C1KA 3RXLA 1ZGVA 5EPYA 1A1RA 2BLWA 2P93A 1WCZA 1DFPA 1FY3A 4PROA 2BDYA 1O3BA 1K1NA 3ATMA 2FIRH 4Y8YA 3Q00A 4Y0ZE 1HAVA 1SGPE 2WPMS 5FPTA 1W11U 3P8OA 1MQ6A 4CRFA 3LKWA 1UVPA 1UTQA 2F9OA 1OSSA 3SV6A 4NFFA 1ELTA 4HFPB 2FX6A 1S82A 1GMCG 2CXVA 3RDZA 2Y81A 4F49A 5CHAC 3UREA 3LGUA 1CE5A 2BD8A 2FYQA 1ZMJA 2FLRH 2H9HA 1BMNH 2G5VA 3RM0H 1VITH 1ANDA 2FEQH 1W0ZU 1ARCA 3QO6A 1INCA 1MH0A 5C1UA 2GCHG 1AVXA 1A46H 2BZ6H 3MMGA 4ZKNU 2NU2E 1C5ZB 1T8LA 1OWKA 1ELDE 2AIPA 4ABFA 2FXRA 4LZ4B 3SV2H 1QL8A 3TPIZ 1O5DH 1ESAA 1EASA 1TNJA 1V2KT 4XBBA 1SGIB 1V2OT 2PKAA 2FOEA 2VIQA 5T6FA 3MFJA 3T62A 2ZEBA 2ZHDA 3SU1A 1HJAB 1RIWB 4X0WU 4CREA 2G51A 1GHBG 3DFLA 1O38A 1YPLH 4E05H 4I31A 2QXHA 3M3SA 1ELBA 1GJ8B 1O5CB 3M7QA 3U98H 3PTNA 1GHAF 2PTNA 2UUFB 2IJOB 2NU0E 3MU1A 1QJ1B 2ZF0H 1XXFA 3HKJB 4K5ZA 1FY8E 1J17T 3AASA 4D76A 1DM4B 4ISOA 2PKSC 3AAUA 1F5LA 3R3GB 1JXPA 5H4IB 3M3TA 1EQ9A 1IQLA 4NSYA 3S9AA 1QGFA 3GDSA 2XBWA 4YT6H 5K7RA 3BTEE 1F2SE 1ZRKA 1T4VH 1MAYA 2D26C 3GDVA 1Y3XA 3NUMA 2GKVE 4FUJA 5DKMA 1TMBH 3WY8A 1CBWB 2Z9IA 4B75A 1HXFH 2P94A 1GVKB 2OQ5A 1UTMA 2OC0A 1FZZA 3KN2A 1YPHE 4NGAH 1C5OH 3SU6A 3BTME 4LXBH 3L6PA 3MO9A 1BTWA 1YLCA 5FPSA 3LDXH 4IMQA 1LHDH 1VJ9U 2C8XB 1SGQE 3ODFA 4KKDA 3V12A 2GT8A 4MDSA 1YPJH 4WMFA 3SGBE 1L2EA 1FY1A 1DOJA 4IN1A 1GG6C 1EP6A 3KNXA 4X6MA 1O32A 1DY8A 5I46H 4WMEA 1QJ6B 4RKOB 3AVZA 1NZQH 2C3SA 2Z6BD 1OWJA 2CF8H 1QBOA 2ZU5A 5E0JA 1GI2A 2RA0A 5EU8A 3SHAH 3MI4A 2ILNA 1F0SA 1PYTC 1KYNA 1VJAU 2P8OC 2ZDNA 1XUGA 1DUAA 5BPEA 2BD3A 3RU4D 1KXCA 4CBNA 1SFQB 2OXSA 1RD3B 2SNVA 2VU8E 1QA0A 3U8TH 2CN0H 1OP0A 2QN5T 1O3HA 4WXVA 2WPJS 3TNTA 3D23A 1KDQA 2SGAA 4YOIA 3VEQB 4YT7H 1C2EA 3A8CA 2ZI2H 2BVRH 2V3OH 3FP6E 2C90B 1VZQH 2LPRA 4LK4A 2TGDA 4MQAA 2Z3DA 2C4FH 4XDEA 5DP6A 1HJ8A 3UNQA 4A1XA 5CHAB 3ZYEA 1K1MA 2SGDE 2ODQA 9ESTA 2BOHB 4MTBA 1P05A 1A2CH 1DX5M 3EGKH 1BBRH 3BTDE 1B7XB 1C2GA 2XC0A 4BAQB 1LDTT 1N1LA 1THRH 2BY7X 1P3CA 2GTBA 3UWIA 4K8BA 1BMLA 3UNSA 2PGBB 2CGAA 2AGGX 3BTHE 2XBYA 1XKBC 2ODYB 5GCHF 1S6FA 2Y80A 1CHOF 1ABIH 2BDHA 2QF3A 5G4BA 2ZIQH 1O3KA 3BTFE 2H5DA 3M5OA 1V2UT 1W0YH 4AFQA 2CJIA 1L0ZA 2CHAC 1WTHD 1TX7A 4OS6A 3BSQA 3PLPA 4Q7XA 4AFUA 1WU1A 4IC5A 2UWLA 1A0JA 4ISHH 3TNSA 3VXEH 1K1LA 1CA0C 5GWZA 4XBDA 4ASHA 1AUJA 2Y5HA 1BTYA 2FM2A 2OINA 3U8RH 1LHEH 1LVOA 2ZHFH 4NIWA 1DWCH 1QB6A 1AKSB 2TIOA 1RJXB 2G8TA 2BXTH 1PPEE 3RXIA 1MAXA 2GZ8A 1L1NA 1GBFA 1TPOA 3QTOH 2O8LA 2PW8H 1Z7KA 3ZZ8A 4CRGA 2Z94A 3P8FA 1MD8A 5DP7A 1H9HE 1KY9A 1QB9A 1FI8A 5FHTA 1UCYE 1DITH 2FOFA 3ZZ6A 5FBIA 3A84A 2ZU4A 1NRSH 2BX4A 2A5IA 1LO6A 1QR3E 2VB0A 3OY6U 1C5WB 1YPEH 2V35A 3K9XB 1XXDA 2BZAA 3HK6B 1Y3VA 3FP7E 3A7TA 1QL9A 1V2MT 2ZWLH 1C1VH 5DP8A 3RXSA 2GP9B 6ESTA 5DP3A 1GVLA 1QURH 3ZZAA 4A6LA 4KP0A 2ZFSA 3LH1A 5HMAA 1QRWA 4CRCA 1CQQA 1T32A 5LPRA 1LMWB 4YM9A 2BVXH 1S85A 5E8EH 3RMMH 1TGCA 1FUJA 2ZTYA 3L33A 4WY3A 2TGPZ 1WAYB 2Z9GA 1Y5AT 5EQRA 1SGRE 3RXRA 3ZZ4A 4AYVB 1ZOMA 3GCNA 3PYHA 4D8NA 1QHRB 3L3TA 2ESTE 2OUAA 2RA3A 1DPOA 1HAGE 1YPMH 4X6NA 2FTMA 4XFQA 2O8UA 5LH8A 1GG6B 2BLVA 5TCCA 1HIAA 2AMDA 3MO3A 4TPYA 5A8ZA 2ZFPH 1FY5A 3DFJA 5J4SA 5FAHA 1SOZA 1JIRA 3LJOA 3PMAB 5F8TA 5FCRA 1KXAA 3A7VA 3QX5H 1A0HB 2ZHQH 3EA8A 1UCYH 1EATA 2BYAX 1GBHA 2GDEH 2AFQB 3URDA 1XMNB 3EAJA 2TBSA 5E0HA 2VVVA 1CHGA 3ZVDA 4D9QA 3B23B 3SNEA 1FV9A 4FUEA 1PYTD 1DLEA 2VIPA 1O2MA 4A7IB 4ZAEA 1GI4A 1GBEA 1BB0B 1DXPA 1B5GH 1GL1A 1SC8U 3H7OA 1ANCA 5FPYA 3M5LA 1BHXF 3SU4A 2HNTE 1NFYA 4NCYA 1WV7H 1FAKH 5K0HA 4GAWA 4TWYA 3A87A 2O8TA 1BUIA 2YNBA 1BITA 3FZZA 1QB1A 1H8IH 2C8YB 6GCHF 2AH4X 3SQHE 3LGIA 3SI4H 2FOMB 1HAOH 1AMHA 1SPJA 2A5AA 3UUZA 3SQEE 1EJAA 1O2QA 4DCDA 4U01A 3KQBA 1GMHG 5HGGA 1QIXB 1P04A 3KCGH 2HLCA 2WYJA 3ZVBA 1J15A 2STAE 5EGMA 5DP9A 2V0BA 1KTSB 5E2OA 1VGCC 1O5EH 1TALA 4Q7ZA 2CHAB 2H9TH 2NU3E 2VWNA 1EOJA 1YC0A 3HKIB 3F6UH 3FAOA 1TNHA 1C1WH 1CA0B 2A0QB 1HAXB 4CH2B 3V13A 1C4Y2 1PFXC 1Z6JH 2FO9A 1MZAA 3A81A 1C2MA 1FJSA 2GDDA 5JPMH 2XCNA 1TNKA 3MNXA 2A4OA 2O8MA 1NPMA 2VNTA 1A61H 4A1VA 1GDUA 3TH2H 1A5GH 4J2YB 1EKBB 5B6OA 1TOMH 1BMAA 1DS2E 4DURA 1IQHA 2UUJB 1ETSH 3UR9A 1PQAA 1AD8H 4YLUA 4YLQH 2EI8A 4YESB 2IPHA 3A85A 2PUXB 5GPIB 1ELGA 4ZROA 1BQYA 1T8OA 3HGNA 4I8LA 4AG1A 1CVWH 5A0BA 1SGFG 1E35B 2A5KA 1IHSH 1AO5A 4FU9A 1P0SH 2BQ6B 4IC6A 4ABBA 1QBVH 3FP8E 1ARBA 1K28D 3BF6H 1C5SA 4YOGA 5GJ4B 4IW4E 1TA6A 1WSSH 3M61U 4GHTA 1C2KA 2J94A 4HZHA 3SUDA 3RMNH 3DA9B 1LKAA 4UEHH 3QLPH 1LVMA 1O3IA 3P8GA 3D65E 3GY4A 2SGPE 3SJ9A 3RXCA 2Y5GA 2FODA 1TOCB 4JZIA 2BLQA 4DG4A 1UTKA 1QCPA 3QZRA 3ZVAA 1NC6A 2Q6DA 1G3EA 1OP2A 3SNBA 3BEUA 1WTGH 5LPFA 4ABGA 2BDAA 4JZFH 1G2MA 5GXPA 1EOLA 3STIA 1AVWA 4JYVH 4H6SB 1FXYA 2ZPRA 4LZ1H 3RMLH 1E0FD 5A2MH 1C9PA 1O2SA 2G4UA 1AZZA 1XVOA 1HAIH 1EPTA 1GI6A 2J9NA 1V2NT 2V3HH 3F9FA 7LPRA 1MD7A 4NA8A 2ZC9H 1ZJKA 4AN7A 1LHFH 1BTHH 3UPEA 1OWIA 1FY4A 3ZVGA 1NU9A 2XCFA 4ABDA 4ZMAH 1JWTA 1VITF 1YCPK 2KAIA 2ZDAH 3RLYH 4NA9H 2WPHS 2ZCKP 4ABEA 2Z9LA 1AHTH 4JZDH 1HAYB 7GCHF 4CRBA 3ZYDA 1Z6EA 1X7AC 3TVJB 1NN6A 1ZHPA 4OS1A 2FI5E 3V3MA 1FIWA 1ZTJA 3HGPA 1O2LA 1QTFA 3RXTA 3N7OA 3KF2A 1CT0E 1IQJA 1DSTA 2PSYA 1Q31A 1O2PA 1J16A 1DLKB 2BM2A 2ZQ2A 3UQOA 3GY8A 3KQCA 2ZU3A 1HAVB 2GT7A 1TPAE 1F0UA 2XRCA 1LVBA 3UR6A 2W3KA 1AN1E 1BTPA 2FOAA 5I25A 4DT7B 4GCHF 3P95A 2CF9H 3U69H 2Q1JA 2PV9B 3TK6A 2R9PA 4AGKA 1TGBA 1ZJDA 1BT7A 5EQQA 2ZGXH 1Z8RA 1NU7B 2F91A 4JZEH 1QRXA 5DGJA 1TFXA 3AAVA 4BAKB 3PMBB 4AYYB 2W5EA 1ID5H 1P11E 1SHYA 2G52A 6CHAC 1W2KH 2QXIA 4B73A 1SBWA 1P2JA 1O3EA 4DOQA 2ZDVH 1UO6A 3GOVB 1CO7E 4F4OC 1CGIE 1IQIA 1BRUP 1VGCB 1TLDA 3P70B 1GHAG 2B0FA 1P2OA 3M7TA 3RXPA 1GI8B 5A09A 1K1JA 1PQ5A 2ZTZA 1A0LA 4Y11E 5FX6A 4M7GA 3BEFB 3ZVEA 1O3GA 3BTTE 1U6QA 3RXQA 1CT2E 3ATWA 1BDAA 1TNIA 5DK1A 1KSNA 3AW1A 2Z9KA 1OXGA 5JBTA 4NWLA 1AZ8A 1EZSC 2PKAB 1O3NA 1GBBA 1TRMA 4ZKOU 4INHA 1BCUH 1TNLA 8LPRA 3JZ1B 4NIVA 1P2IA 1ABJH 2JKHA 3SORA 3TK9A 1O3CA 1LPZB 3F68H 4VGCB 1S0RA 1SI5H 1C2IA 4AFZA 2FTLE 1KTTB 1Y8TA 3BG8A 4ZHAA 2J95A 2AGEX 5C5OA 1YPGH 3SJKA 1TGTA 3MO6A 1NO9H 1GDNA 3LT3A 1YCPH 4FVBA 1AY6H 3FANA 1O2WA 1OP8A 3SNCA 2FWWA 1HDTH 4U30A 2ALPA 1GWAA 1C5VA 2B5TB 4OS2A 4BXWA 4AOQA 1NT1A 3TJNA 5SGAE 1DDJA 2TGTA 3MOCA 1UVSH 1Z71A 1L1GA 3PLBA 3QDZB 2RCEA 4GLYA 3BTKE 4FUGA 4JCNA 2W7SA 1MKWK 2GCHF 3SV9A 1G3CA 2BDBA 1O5GH 1TGNA 3P8NA 1FN8A 3A80A 1C1RA 3E90B 1RTLA 1F92A 1EP5A 1SGYE 4Y8ZA 4B71A 2PLXA 1D3QB 1C1PA 2K1QA 3ATKA 1A3EH 4FUFA 1P01A 4CRAA 3MYWA 2BD7A 1NROH 3URCA 1GHBF 1XUKA 1YF4A 3RXBA 2VJ1A 2Y6TA 3SNAA 2QF0A 5L6NH 1NS3A 1O2OA 1GGDB 1T31A 5F8XA 1A3BH 1GBTA 1MTVA 3FFGA 2FOHA 1EX3A 2PFEA 3PO1B 5EOKA