1C1OA

Recruiting zinc to mediate potent, specific inhibition of serine proteases
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of potent selective zinc-mediated serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords TRYPSIN
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c1oA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c1oA02
1T8NA 1C2KA 3LIWA 3A83A 1SLUB 1GG6B 1C5UA 2A7CA 4I8GA 1GBMA 1PYTD 1V2MT 1QA7A 1YF4A 1ORFA 3A7VA 2BX4A 3M7TA 4I8HA 4E7RG 2QAAA 1KDQA 1VGCC 3DA9B 2K1QA 4NWKA 2KAIA 1O3BA 2ZF0H 3BEIB 4JZDH 1Z1JA 3SUFA 1ZTLA 1LKBA 1DOJA 4K3JA 3I77A 1O3MA 5HM2A 2G55A 4FUHA 2Q1JA 4XBBA 1LHDH 1AWHB 4ABJA 5A09A 1OP2A 4UEHH 3UOUA 4B2CA 3S7HB 1J16A 3GY2A 6ESTA 1A61H 7ESTE 2BY5X 2W3IA 3K2UA 3SV2H 1KXCA 3E1XB 5FAHA 4FVDA 1AWFH 4E06H 1HXFH 2AS9A 1SGYE 2Q6DA 2TGPZ 1P09A 2XBWA 1WTGH 1BBRE 1GJDB 1ZLRA 2PSXA 3SJKA 1C4V2 1XXFA 3SHCH 1XVMA 3DFJA 4FUEA 1GMCF 1MKWK 1BCUH 2FP7B 4X2YA 1AFQC 1GI9B 2Z9IA 3SJ8A 2ALPA 1QY6A 1TA6A 3P8OA 2ODPA 4ABFA 1GI3A 2PSYA 2ZNKH 1AD8H 2VWNA 1ZGVA 1O38A 4FU9A 4Y0ZE 3WY8A 1X7AC 3NKKA 1DLKB 5E2PA 2V35A 1EZQA 1O2TA 3UREA 1TABE 1OYQA 1EKBB 1HJAB 4J1YA 3MU5A 2CHAB 2STAE 4GLYA 2QXIA 5EXMA 1F0RA 4Q7XA 1MTSA 1BJUA 2HOBA 3VB3A 3GDSA 4GAWA 1ELVA 1TALA 1B5GH 1ZYOA 1JXPA 4X1RU 1AO5A 3MO6A 1MD7A 4OS7A 3TNSA 1C5MD 2ZHEH 1Z7KA 4THNH 2BY6X 1G9IE 2Q6GA 2XWBI 2W5EA 1LPGB 2GGVB 1ZOMA 3RXQA 1KDQB 3R0FA 1MU6B 4NA8A 1C1TA 2IN2A 3SNBA 2PGBB 1VITG 5PTPA 1N8OB 5L30H 1GWAA 1UO6A 2FMJA 3L33A 1RTLA 5L2ZH 4AFZA 1FZZA 2ANWA 2WUBA 2Z6BD 3KQBA 4Y8YA 1FY3A 3D62A 1C2HA 5GCHG 4ZHMU 3SNDA 1ARCA 3SNEA 3RU4D 3SORA 2STBE 2XC0A 5T6GA 3BEFB 4Y71A 3EA8A 1S82A 4FUBA 2FTMA 1LVMA 2GCHG 1K1MA 3ZVDA 2Z94A 1KXEA 2J95A 4WH6A 4IW4E 6LPRA 4NZLA 1GVZA 4OS4A 1Y59T 1ZTKA 3U9AH 3T25A 1FN8A 2BOHB 2ODYB 2ZU4A 4OGXA 1AVWA 1HPGA 1ZGIA 3SU1A 2AEIH 1C1PA 4JYUH 1C2DA 4AORA 4HZHA 3FAOA 1GI7B 1C4U2 3TIUA 3PLKA 2ZKSA 1GHAF 1HAVA 4R8TB 1C5SA 1CA0C 2HGTH 4AG2A 3TJOA 4CHAC 1O3KA 2ZDVH 1ELCA 1TNKA 3LGUA 3A7YA 5DP3A 3MHWU 3F1SB 2H9HA 1GI5A 1GBDA 3PWCA 3KN2A 3BTFE 3BTKE 3K6ZA 2QXJA 4LOYH 3A7TA 1G3EA 3E91A 3KHVA 1HDTH 1IQEA 1GJ7B 1O2HA 1K21H 2BX3A 3VB4A 4F4OC 2HPQH 5DO4H 4X8UH 2BLOA 2PUQH 3MH7A 3L6PA 2BD9A 3OSYA 2WYGA 2ZGXH 4DG4A 3ATWA 1O35A 1OWKA 4JZFH 2ZA5A 3VXEH 3NUMA 5K7RA 3TPIZ 4NIWA 1QJ7B 1DWBH 2NU4E 1Y5AT 3A80A 5EGMA 1C1QA 1TRMA 2C8ZB 1QL8A 1TQ0B 3A7XA 3RMMH 2AH4X 3Q00A 2A4GA 3MNSA 1ACBE 2C8YB 5G4BA 1V2UT 3ZZ9A 1FN6A 1TLDA 1UHBA 1F0UA 2CXVA 3ELAH 3ATIA 1KLJH 2DE9A 4ISLA 1DXWA 3M35A 3FP6E 1A0LA 3SV6A 1SC8U 1GHYH 1EOLA 3PLPA 1CA8B 1RXPA 1N6YA 3F9EA 2ZPRA 2OC0A 1QBVH 3LDXH 3TLOA 1YC0A 1TIOA 2F83A 1WUNH 1SMFE 2FS9A 4MLFB 4YM9A 1TGBA 5C20A 1W12U 1TMUH 5EXNA 4JZEH 3NPSA 2FZZA 4MNVA 2P3FH 2ZU5A 1BTWA 3MNXA 2GMTC 4R0IA 4VGCC 4BXSA 2EEKA 4ISHH 2VVUA 2CGAA 3QLPH 3SUGA 3NXPA 4TY7A 4B71A 4BAMB 3A8CA 3AVZA 1JOUB 1C5PA 1NU7B 1SHYA 4A1TA 3MH6A 4Y11E 3GY8A 2GZ9A 1DFPA 1GI1A 1P9SA 2J92A 1CT2E 2HNTF 3B9FH 1W3CA 1GJ5H 1KIGH 1V2NT 5EQSA 4U2WA 1CHOF 4D9QA 3A89A 1T32A 4D76A 4ESTE 4DJZB 3A88A 4NIVA 1C5OH 1GMHF 2ZHFH 4FXGH 3V12A 6CHAB 5F03A 2BD4A 3ITIA 3ZVFA 1V2PT 2Z9GA 5JPMH 4YT7H 2RDLA 3IWMA 3LC3A 4WMDA 3KQDA 5BPEA 1FJSA 2C8XB 3A7ZA 1FY4A 1YPHC 2A5KA 4U30A 3SW2B 4NIYA 3DFLA 1BRAA 2AERH 3U8OH 1CO7E 3BSQA 1O2QA 3I29A 4YOGA 1CT4E 3RMLH 1WSSH 1TPAE 1S6FA 3KQCA 2P94A 3QN7A 5F6MA 1P2OA 1FY8E 3BTDE 1C2FA 2PV9B 1N8OC 1W10U 1RS0A 4GUXA 5LGOA 4D7FA 1BBRK 4LK4A 4Y7AA 3RXMA 1O3FA 2GD4B 1GI0A 1LHEH 4MDSA 1G32B 1OP8A 1BRCE 2A5AA 3A84A 1EUFA 1QIXB 4B74A 1GJAB 3MFJA 1TGCA 8GCHG 4KGAA 1SGDE 3M5LA 1FY5A 3LGIA 1TGNA 1EPTA 1Z8GA 1WBGB 1QNJA 1K2I1 2C4FH 1PQ7A 1SGPE 1LQEA 3BV9B 4WF8A 2OD3B 1TNIA 5DKMA 2VWLA 3K65B 1YP9A 1V2OT 3SBKA 2R2MB 1ARBA 1AE5A 1CHGA 1Z1IA 2Z3DA 1H8IH 3OU0A 1RIWC 2CV3A 4AB8A 1FMGA 2B9LA 3FP7E 4I32A 1AU8A 2O8WA 4DOQA 2BD3A 1YPJH 3GICB 2VB0A 1ABJH 1PPZA 3URCA 1L0ZA 5DK1A 1EP6A 4FUJA 1V3XA 1J9CH 3ZZBA 1QQUA 2RG3A 2F3CE 1IQJA 2WPKS 1G3CA 2BY9X 1G30B 2FOCA 4UFDH 5GCHF 5B6OA 4OS1A 2BM2A 2BY8X 2JKHA 3TGIE 4ZKRU 3GY5A 1E34B 2ASUB 1LVYA 4NSVA 5FCKA 4VGCB 1YPEH 1VITF 1IQHA 3QGJA 1YKTA 5A8XA 1HBTH 4KKDA 3ATKA 1QL9A 1HAPH 1WYKA 1RRKA 4H42U 7GCHF 3V0XA 1DX5M 2GCTB 3RC6A 1EJAA 1UK2A 4YZUA 2D8WA 3EQ0H 4X8SH 1DM4B 3ENSB 3BG8A 4E05H 1HCGA 5A0BA 2NU2E 1ZJDA 1TWXB 1RFNA 1SG8B 3ZV8A 3O8DA 1UJ1A 3AW0A 4SGAE 1NY22 2GKVE 1C5YB 3Q77A 4JMYA 1TQ7B 3VFEA 2C3SA 4NG9H 2JETB 3UQVA 5JYIA 3TU7H 1K1NA 2V3HH 3ODDA 2SGEE 3LH3A 1BA8B 1GJBB 2BB4A 3BEUA 1YPKH 4JK5A 3A87A 2GZ8A 1S0QA 1CSOE 2PR3A 3RUOA 1UVTH 5J4SA 4TYDA 3ZZ5A 3GDUA 1QRXA 2Y5GA 1A2CH 1UTNA 3U98H 5LPEA 2BDBA 1HB0B 4I7YH 3VEQB 2G4UA 1Z71A 3W95A 4AG1A 1Y3WA 2VGCB 4O9VA 4CBNA 2EA3A 1HAVB 1O3IA 4LZ1H 1B0FA 1DICA 1C1VH 2VIPA 2SGQE 1LPZB 3GCNA 4YTAA 2XBVA 2Z3EA 4IBLH 1GMDG 3VXFH 5E0HA 4K5ZA 2Z9KA 2BYAX 1TX7A 1AKSA 2WUCA 3S69A 1C2GA 5A2MH 1IOEA 1AZ8A 1TNLA 3GOVB 1FUJA 4CR9A 1VCWA 1MKXH 1LDTT 2FWWA 1DE7H 3ZZ7A 1EB1H 1UTMA 2FM2A 5GJ4B 1NFYA 1WAYB 2C8WB 4WXIA 5JBAS 1SGIB 5JBCS 1JRSA 1O3GA 1Y8TA 4H6SB 2AMQA 4YLUA 3EDXB 3C27B 1SL3A 4ABHA 3DD2H 2BDCA 1Y5BT 2BDIA 2SGPE 4I31A 1NC6A 3PLBA 5F8XA 1QR3E 3RLYH 3SV7A 3RXDA 1ZPCA 1GVKB 2PTCE 3U8TH 1RD3B 2AGIX 5AHGH 5DP7A 1WOFA 2XYAA 1XKAC 1SLXB 1RJXB 2BD2A 2ZTYA 1HJ8A 3QK1A 1A4WH 4Q2KA 1F5LA 3P70B 1XUIA 2FLRH 4NFEA 2OTVA 1GI4A 1O5FH 4OGYA 1PPFE 1W11U 2F9BH 4NZQA 5CHAC 3SU4A 1K1LA 1TBRH 1UTPA 1EZSC 2QXGA 1UK4A 5LH8A 5LPRA 1Y3UA 4ABEA 1GBTA 4M7GA 3Q3YA 2OBQA 4GVUA 3TK5A 5GIBA 2OP9A 4MPXA 3RXIA 2FOGA 2XC5A 3VB5A 3VGCC 5FX5A 3QX5H 1P2NA 3GCHC 3MNBA 2H9EH 1IHTH 1V2JT 3U1JB 2DUCA 1XMNB 1NM6A 1C5NH 4INKA 1HAOH 2NWNA 1EP5A 4CH2B 1ESAA 2D26C 3I78A 4JK6A 3RLWH 1QJ6B 3BIVH 2WPJS 2Q6FA 1AB9C 5FPSA 2ZGBH 4IMZA 3RU4E 3OTJE 3QUMP 1QRZA 2LNCA 1E37B 2ZFFH 2M5TA 2A31A 1EOJA 1YM0A 2BLVA 3QTOH 4FVBA 1BB0B 1Q3XA 2W7SA 3E6PH 3T2NA 2ZCLP 2ZFSA 1UCYH 1GI2A 1O2NA 5EPNA 2ZO3H 4TWYA 3HATH 5I25A 3LC5A 3VB7A 5C67A 4FUCA 1QBNA 3JZ1B 4B76A 2ZHDA 1HIAA 2ALVA 1GGDC 2OC1A 1ZRBA 1WTHD 1TOCB 2QIQA 3HK3B 3MH4A 3D49H 4OS2A 1YCPK 3Q3KA 2Z9JA 3MNCA 2IJOB 2W3KA 3UUZA 2QN5T 1IQKA 1TPSA 3GY4A 1CVWH 1K22H 3SHAH 3TK9A 1AB9B 1FNIA 1PPGE 1W2KH 4YO9A 3RXEA 5DPAA 1O2ZA 1OSSA 1E38B 3S9AA 2QA9E 2BZ6H 1BTZA 2ZTZA 1MH0A 4Y8ZA 2HALA 2VINA 1O2KA 3PMJA 2UUYA 1QB1A 1P2QA 1GHXH 1D3QB 1S0RA 3A86A 1O5AB 2PKSB 1K1JA 1P2IA 5I46H 5EQQA 3MU1A 1OYTH 1C5XB 4CBOA 1HAIH 2FX4A 2HNTC 2Z7FE 3ZV9A 4I8KA 3ZZAA 3SNAA 2ESTE 3TGKE 2A32A 2B0FA 3MYWA 2A5IA 2G51A 4NA9H 2H5DA 3FZDA 4TWWA 1P01A 1FDPA 2F9OA 1NPMA 3UNQA 4A92A 3CP7A 4AOQA 3MWIU 1ZHPA 2ZWLH 2O8MA 1NRRH 2V3OH 1EZUC 2FPZA 2R3YA 1C1MA 1ZTJA 2ZI2H 3F6UH 1P03A 3BF6H 1EX3A 3RMOH 4MG3A 2TRMA 1J15A 1T8MA 1LCYA 1SFIA 2FODA 4D8NA 4Y7BA 3UY9A 3KGPA 3GY7A 1P3CA 2ZFRH 2ZCKP 2A7HA 1P11E 2RCEA 5FPTA 1THSH 1EASA 2TGDA 4IC6A 4MPVA 3QGNB 5EOKA 2XWAA 3RXGA 4DURA 1T4VH 2P93A 1TMTH 1G3BA 1D4PB 1AIXH 5EU8A 1RIWB 1KXFA 4ZAEA 1BQYA 1XVOA 1O33A 3QZRA 1ELFA 2FOMB 1OXGA 3SU6A 4ZKNU 1TE0A 2FI5E 2QF3A 2HVXA 1SOTA 1MQ6A 2Z3CA 2VGCC 3ESTA 2OC7A 4K69A 3ZVCA 1UTJA 1ZMJA 2B7DH 1O3JA 3M7UA 5AVDA 3HGNA 1LHCH 1SR5C 3UWJH 1OWIA 4CRCA 4X0WU 7LPRA 1BOQA 3M37A 2TBSA 1EJNA 3ATMA 2ZQ1A 4B1TA 4BTIB 1EAWA 1MMJN 3T26A 1CE5A 1O5BB 1ETRH 1A0JA 5E2OA 4A5TS 4BAQB 2GT7A 1GHVH 2D1JA 4CRFA 2Y7XA 5J4QA 1H9HE 2Y82A 1P06A 2WPIS 1MCTA 2ZFPH 4B75A 1P10A 5EXLA 1HAGE 2OLGA 2O8LA 4BAHB 3SOSA 1GBBA 2FTLE 3RXPA 1MTWA 2Y7ZA 3SU0A 3U69H 5EW2H 1MD8A 4RKOB 1HIAB 2ZDNA 2G81E 2PHBA 1QA0A 1UVSH 2BY7X 3GY3A 3N7OA 3DHKH 3P8GA 1JIMA 2ZIQH 3B23B 1TPPA 1O34A 3G01A 3KEEA 1XUFA 2VIOA 2I6SA 4GCHF 1INCA 1QJ1B 4K8YA 4X1SU 1EJMA 2J34A 1NFUA 1MZDA 3TJNA 3F9HA 1AGJA 3ZVAA 4HTCH 2JH6D 3T29A 5C1UA 1H4WA 1C2LA 4ISIH 1NRSH 2EI8A 3UQOA 2KAIB 2G52A 1IQFA 3NZIA 4Q80A 1VCPA 2DE8A 2ZDKA 3SI4H 1SPJA 4WJG2 2VVVA 1KSNA 2FOAA 3S7KB 3MI4A 1BMLA 3MU4A 1UTLM 3MOCA 3HKJB 5ESTE 5E0JA 3U8RH 2OUAA 3LJOA 4I33A 1Z8JB 1EZXC 2SNVA 1V2WT 3UIRA 1SLWB 4XSKU 1RTKA 4Y76A 1OPHB 3PMHB 2F91A 3KQEA 5DP6A 1O3LA 3NCLA 2GDDA 1SQAA 2BXTH 2GX4A 3GCTF 2CN0H 1XUGA 1N1LA 3RXJA 4HGCA 1A7SA 2BZAA 3S9BA 5JB8S 3SU2A 3ZZCA 1K28D 1S81A 3T5FH 1SGQE 5L2YH 5BRRE 1SBWA 1GJ4H 4Y0YE 2A2XH 4KP0A 2CHAC 4XE4A 2XXLA 2VNTA 2ZGHA 2ZU2A 2P8OB 4UFEH 1F7ZA 3M36A 3STJA 1GHWH 2BD7A 3BTGE 1FY1A 5JBTA 4IS5A 2CF9H 1PQAA 1ZPZA 5AFZH 1MTNC 2ZP0H 2WINI 1DXPA 1XUKA 1D3DB 1H1BA 1O2VA 2F9UA 3LONA 3VB6A 1F92A 4NIXA 3S0NA 9LPRA 4XBDA 1TOMH 1DUEA 3SJ9A 2QGRA 1Y5UT 1AFQB 1H8DH 3E3TA 3LOXA 5TCCA 1DSTA 4AX9H 1HYLA 4ABAA 3SV9A 3TH2H 5JB9S 3VPKA 3O8BA 4RN6A 3EA9A 1D9IA 1QHRB 4BAKB 1KLTA 4O03A 5C5NA 1L1NA 3AAUA 1L1GA 2ANKH 1GJ9B 3P92A 5IDKA 1GDQA 3RXTA 3UWIA 1O2SA 4ZUHA 3PM3A 3GY6A 1AUJA 1C2JA 4YOIA 8GCHF 2GMTB 4NFFA 1F5RA 1V2LT 2XBYA 1ELDE 1AFEH 1V2VT 1A5GH 3A7WA 4WVPE 1O2XA 2TGTA 1DLEA 2BD5A 2VH0A 4Q7ZA 1KTTB 4CRDA 1IQMA 2QF0A 8ESTE 1YPMH 2CJIA 1AKSB 2BD8A 3GDVA 3PROA 4I8LA 5AFYH 2XNIA 1OWJA 2Y6TA 1ZR0A 1GL1A 2W26A 3JZ2B 3P8FA 1P2KA 3KIDU 4IC5A 4KTUA 2UWLA 4H6TA 3UPEA 4AYYB 5L6NH 4MTBA 1UVUH 2OQ5A 3RMNH 1GMCG 1SGFA 2WV4A 3F9FA 1MUEB 4BNRA 2WYJA 1SGNE 1FIZA 3GYMA 4K1SA 4X8TH 3BTHE 1HGTH 3FZZA 5FPYA 3SNCA 1O3NA 4ABBA 2FS8A 4MNWA 2PKSC 4INLA 1DY8A 1HAHH 3OY5U 1QL7A 1S83A 2UUKB 1TGSZ 1VCQA 1TB6H 1VGCB 2GVFA 2FESH 1GBFA 3LU9B 2GCHF 4XDEA 3D23A 1BMNH 2BQ7B 1C1WH 1YPLH 3M61U 5FBEA 2YNAA 3QTVH 1C1RA 3PWBA 1V2RT 1D6RA 2B5TB 3SI3H 4D9RA 1SGTA 4YOJA 1EAUA 1ZPBA 3SN8A 1XKBC 5K0HA 2ZU3A 2BVXH 3RP2A 5FBIA 2A7JA 4GCHG 3S9CA 2H5CA 5HM9A 1MKWH 2QCYA 4WXVA 5F8ZA 1NO9H 1QGFA 3TITA 2EI7A 1HXEH 2TIOA 1Z6JH 1CGJE 4XOJA 5GPIB 1LQDB 3P6ZB 2GV7A 2R2WU 1O2IA 1PQ8A 2HRVA 3QO6A 4MNYA 1Q31A 1O2YA 4CHAB 2VH6A 2Y5HA 2FOHA 4NSYA 1L4ZA 1S85A 4CR5A 3PV4A 1DT2A 1BRUP 2RA0A 5A0CA 1PFXC 1IAUA 4ZKOU 2C93B 4ZMAH 4AN7A 3GCTG 1W7GH 2ODQA 1YBWA 1PPHE 1GBEA 1SGRE 7KMEH 1D3PB 3R3GB 1THRH 1C9PA 1OOKB 2A45B 1NROH 1SQOA 2EC9H 1UTQA 2WV5A 1SSXA 1B7XB 1WCZA 3D65E 3OY6U 4O3UA 1KXAA 3UR6A 1DDJA 3LH1A 2AIQA 4BAOB 1F5KU 3SQHE 4DCDA 1JIRA 3TH3H 4CH8B 1EPTB 4MPUA 4FUFA 1VJAU 4IMQA 1B0EA 1IHSH 2AGGX 3P95A 1VZQH 4X6OA 4JZIA 5EG4A 2BDHA 1NN6A 3A82A 2C90B 3V13A 1SGEE 4IGDA 1BZXE 3TK6A 2O8TA 2G5NA 4ABIA 6GCHF 1GBCA 7GCHG 3RXCA 3TGJE 1AE8H 2R9PA 4Y8XA 3MH5A 3UOPA 1FPCH 1SOZA 5FHTA 1O3HA 1OKXA 1GG6C 3E8LA 3E90B 1O2JA 2FXRA 3FP8E 9ESTA 2A1DB 3GISB 1ANCA 1HJ9A 1EXFA 1PPBH 3UNSA 1Z8IB 5TCAA 1CT0E 4K2YA 4RKJB 3RC4A 3AW1A 3E16B 1P12E 1NU9A 2P16A 4DGJA 4X8VH 1NZQH 1FXYA 6GCHG 4PROA 3Q76A 3ZYDA 5A8YA 2YOLA 2TPIZ 1BBRH 3URDA 4DVAU 1UVPA 3EAJA 3MO9A 2ZEBA 1GHZA 1Y3VA 1L2EA 1O3EA 3ZZDA 3FFGA 4E7NA 2EI6A 1QFKH 3IITA 4Y79A 2PWXA 4UFFH 4A6LA 3BIUH 1O31A 1O3DA 2OQUA 5CE1A 3BG4C 3SO3A 1TNHA 1OX1A 3ATLA 5TJXA 2FO9A 3RXBA 1FPHH 3A8AA 4ASHA 1O2OA 1GL0E 1YPHE 2ZQ2A 2BDYA 4AGJA 1MCVA 2OBOA 1IQLA 8KME2 5C3NA 5HMAA 4Y6DA 3KL6A 1DS2E 1LO6A 1KXBA 3DT0H 1O2RA 2H1UA 1ANDA 2ZFQH 3SUDA 5A0AE 1A0HB 2OXSA 1C2MA 1WU1A 2BLWA 4ABDA 2GTBA 2ZG0H 1F0SA 1EQ9A 2ZPSA 1DWCH 3M7QA 3PYHA 3U1IB 1Z8RA 1AUTC 3SU3A 4OS6A 3VGCB 1A3EH 3H7OA 4GPGA 1J8AA 2ZTXA 4AFSA 1GHBF 1FI8A 1E36B 1MQ5A 1D3TB 1FONA 1P2MA 1QCPA 1O2WA 3FVFB 1JRTA 3H5CB 4D7GA 3UR9A 3B8JA 4F49A 3LGWA 2IPHA 3TVJB 1KTSB 4X2XA 2JETC 2JH0D 2VIDA 1XM1A 1DY9A 1OS8A 4KELA 4ZXYH 3A8DA 5CMXH 1HRTH 4FUDA 2XTTB 3A8BA 2V0BA 4A1VA 5C5OA 1QTFA 2VWOA 1SQTA 5JBBS 2AMPA 2BQ6B 3IG6B 4BANB 2FYRA 1MBMA 2ZDMA 3HPTB 2G5VA 2AMDA 5HGGA 3O8RA 1T31A 3UFAA 3ZVGA 1UK3A 5GWZA 1P04A 2GT8A 2J4IA 1BMAA 2ZHQH 1DANH 1D6WA 5GXPA 4MVNA 3SJIA 4NGAH 1EAIA 1UVOA 2BVSH 1CU1A 5T3HA 2ZDLA 5EQRA 5ETXA 1C5TA 3PTBA 4XFQA 1YCPM 3P8NA 1QRWA 2FDAA 3RM0H 1YLCA 5ESBA 1EB2A 2P3UB 3STIA 1PJPA 1HAXB 3BTWE 4YLQH 1SLVB 2AYWA 3KF2A 2OCVB 4FU8A 1T8OA 1BHXB 1ZSKA 1NRPH 1P05A 1MAYA 2FYQA 3BG4B 1K1PA 4ZH8A 2XW9A 1A5IA 2WPMS 1GMHG 5A8ZA 2H2ZA 1MKXK 3LKWA 1BTYA 1DITH 4X6PA 5EODA 2PLXA 1PPEE 4K1EA 1MTUA 4TPIZ 3RXHA 2ULLA 3SGQE 3T27A 4UONA 1GHBG 1BDAA 4ISNA 4JZ1A 3M3TA 1O39A 5FXLA 2ZGCA 2UWPA 1ZMNA 4H4FA 4X6NA 4DT7B 2FOFA 1O3OA 1C1OA 2A2QH 3E0PB 5T6FA 1LMWB 4QT8C 2PW8H 2QC2A 3ZZ3A 3NWUA 4HI3A 1L1JA 3EA7A 4AB9A 1LHFH 3ZYEA 2VU8E 4X1QU 5ABWA 4FUGA 2VVCA 3BTQE 2JH5D 8LPRA 1AQ7A 1W0ZU 3MMGA 1O2GH 1M9UA 3TNTA 4BXWA 2BQWB 4AFUA 1S6HA 1GCTB 1CBWB 2PGQB 4DIIH 1NFWA 2PKAB 1MU8B 1A46H 1BITA 1OP0A 4NA7A 2FIRH 3RDZA 1F0TA 4MQAA 3LT3A 3SUEA 1Y3YA 1W8BH 1HAYB 1UTKA 1GBJA 2A4QA 1C5VA 3BTTE 1ETSH 4X1PU 1GJ6A 1GBAA 1LTOA 3LJJA 3ZZ6A 1GBHA 2V6NA 1PPCE 1C5ZB 1Q2WA 1SGFG 3GYLB 5C2ZA 4WMFA 2OINA 2VIQA 4ZROA 3CENA 3BTEE 4U01A 5IYTA 1BHXF 1ANEA 1PQ5A 4AGKA 1JBUH 1TAWA 1O2LA 2LPRA 2PTNA 2J94A 1CA0B 1QB6A 3V3MA 2G4TA 5DG6A 1SFQB 3F68H 2WPHS 3RXSA 1IQIA 3M5NA 3BN9A 2H9TH 4GHTA 1MZAA 1GDNA 2O8UA 1GJCB 3RXLA 1O32A 2QV1A 1QB9A 2GP9B 1K9OE 4CRBA 1KY9A 1MTNB 4BTUB 1XXDA 3E0NB 2THFB 1TBQH 2R0LA 1VJ9U 3HKIB 4DW2U 1G3DA 1ELTA 1O2MA 1DPOA 2XCNA 5F8TA 3ZVBA 3RXFA 1O3PB 1J17T 1WQSA 3A85A 2VIVA 1BTHH 1GCDA 2NU0E 4MPWA 4K8BA 2P3TB 1YCPH 5HYOA 3PTNA 4YESB 4KTSA 1O2UA 1VITH 1C2EA 1SGCA 3PO1B 4DY7B 3RXAA 1GI6A 3GCHB 1DSUA 2I6QA 1GCTC 2QY0B 4O97A 1LPKB 1C5LH 2FI4E 3SZNA 1FAXA 2UUJB 1MAXA 3RXRA 1C1UH 2BDAA 1S84A 3L3TA 3HK6B 1ZHRA 3ZVEA 2FLBH 1NFXA 3QWCH 4Q7YA 2WPLS 2ILNA 3QDZB 2J38A 1ETTH 1N6XA 1T8LA 5GDSH 3SGAE 4CREA 1BIOA 3F9GA 1TNJA 5EW1H 3RU4T 5DP4A 1W7XH 2HLCA 1O0DH 4HFPB 1GPZA 2BXUH 1O30A 1KYNA 2XBXA 3RXUA 1P57B 5T6DA 5FCRA 1GBKA 1C5WB 1SI5H 1CGHA 4XBCA 1ELGA 4UDWH 5H4IB 1PYTC 3AAVA 4JYTA 1LKAA 2NU3E 1WV7H 4ABGA 1K1IA 1BTXA 3M5OA 2HWLB 2G00A 1GBIA 1GJ8B 2Y5FA 2Y80A 4WMEA 3T28A 1A3BH 3LGTA 1WQVH 3SQEE 1OWDA 1DWEH 3TH4H 2AFQB 2J9NA 1TRYA 4WH8A 2AGEX 5E0GA 1RTFB 3OYPA 1P02A 4U32A 1SVPA 1K1OA 1BRBE 2ZHWH 1BTUA 3K9XB 1HV7A 2A4OA 2P95A 2ZPQA 1AHTH 1ID5H 3SV8A 5DJ7A 2FX6A 5EPYA 1ZJKA 4Z6AH 1H9LB 3DUXH 2FOEA 2F9NA 4ZKSU 1AVGH 1UHBB 3A81A 1YGCH 2SFAA 1AN1E 5DP5A 2ZECA 3ZZ8A 4OS5A 1AMHA 1HLTH 1QURH 1TA2A 3RXOA 1J14A 1TPOA 4B2BA 1TONA 2ZZUH 4X2VA 1Y3XA 1BJVA 1GDUA 3ZZ4A 2AIPA 1G2MA 2UWOA 1SB1H 4NCYA 3QZQA 4INHA 1CHOG 4AFQA 4Z0KA 3NK8A 2BMGB 1VR1H 2B8OH 2P8OC 2UUFB 2R0KA 1F2SE 3MTYA 1AY6H 4JYVH 1TRNA 2XRCA 2VWMA 2ANYA 2BLQA 1DVAH 4ZHAA 3P17H 4TY6A 4IN2A 2RA3A 3W94A 1FIWA 1ZZZA 3ODFA 5SGAE 1Z6EA 3RM2H 3M3VA 3SGBE 1ZSLA 3V7TA 2GV6A 1BMMH 3FANA 1UCYK 1GI8B 1AI8H 1XUJA 1QQ4A 5C1XA 1P3EA 2ZFTA 1E35B 3HGPA 1P9UA 1BT7A 5LPFA 1C5RA 1FQ3A 3LGVA 5DP9A 1EPTC 5E8EH 3T62A 1MTVA 4ISOA 1L4DA 2H6MA 1HNEE 3PMBB 2D2DA 1JWTA 4KTCA 1W13U 2SGDE 2R3UA 2NU1E 2VIWA 1EAXA 1SHHB 1TBZH 1U6QA 4WWYA 2BDGA 1FAKH 5FX6A 1XX9A 2HNTE 2SNWA 1C1NA 1ZRKA 3M3SA 2FI3E 1OWEA 1C5QA 1O3CA 1XUHA 1GGDB 4J2YB 3SU5A 3KCGH 4TPYA 5JDUB 3MU8A 1UCYE 1TGTA 4SGBE 1IQGA 4RSPA 4X2WA 1LHGH 1C2IA 2IOTA 3K6YA 4MNXA 2TGAA 2XC4A 3O8CA 2PKAA 3UTUH 1P0SH 2F9PA 1FLEE 1YYY1 1GBLA 1E0FD 1P8VC 2ZDAH 3LPRA 3TJUA 1CBWC 1RGQA 3TJVA 2A0QB 4A7IB 1V2QT 1YLDA 1T4UH 1JMOH 3EGKH 4X1NU 5C1YA 1ESTA 1AZZA 1O5CB 4WY3A 1NS3A 4CRAA 2CF8H 1HUTH 1AVXA 1TX6A 1TYNA 1BUIA 4UFGH 1P2JA 2GDEH 3Q3XA 2P59A 1A5HA 2QYIA 4FU7A 1UMAH 5DP8A 2YNBA 1TNGA 1HAZB 3C1KA 1O2PA 1EATA 5DGJA 4IN1A 1HFDA 2O9QA 4LXBH 3PO1C 1TMBH 2G8TA 4I8JA 5HXFA 1O36A 2J2UA 1S5SA 1ZMLA 1TX8A 3EYDA 4GHQA 4A1XA 1ANBA 1GHAG 3RXVA 1ESBA 2QXHA 3H7TA 3MO3A 1NRQH 1O3AA 1CQQA 1O5GH 3PMAB 6CHAC 2BOKA 1GVLA 1O37A 1T7CA 2GCTC 2Y81A 3OX7U 3RXKA 2PFEA 1KXDA 1C4Y2 1G37A 1GMDF 3RC5A 1LVOA 5CHAB 3AASA 4X6MA 1CGIE 3SJOA 4CRGA 2W7UA 1NTPA 2PUXB 1IQNA 1NRNH 1C9TA 4LZ4B 1G36A 4DIHH 4B73A 1V2TT 3GCOA 2SGAA 4UE7H 1YPGH 4YT6H 2BVRH 1LVBA 2GZ7A 4O3TA 4GSOA 1ELEE 2A4RA 2HPPH 1MBQA 3CS7A 3PB1E 2ZC9H 3UNRA 1HJAC 1UTOA 1C1SA 3M5MA 3MU0A 4K60A 1TFXA 4Y10E 4BTTB 3KNXA 4ZHLU 2BHGA 1ZHMA 2ZCHP 4K1TA 1W0YH 1NT1A 5AF9H 1BTPA 1W14U 1V2KT 1G2LA 2F9VA 4ZXXH 2SGFE 3BTME 4UD9H 1ELAA 1A1RA 1THPB 2Z9LA 2ZU1A 3CS0A 1DUAA 1O5EH 2VJ1A 1ELBA 2OC8A 1NESE 1KLIH 4B2AA 1OWHA 1H9IE 4BOHA 3LGYA 1V6DA 4FUIA 2ZGJA 1QBOA 1O5DH 1FV9A 1V2ST 1ZSJA 2CMYA 4AZ2B 1ABIH 2ANMH 2BTCE 2FOBA 4JCNA 2XCFA 4NWLA 2FEQH 3EE0B 1DWDH 4AYVB
chains in the Genus database with same CATH superfamily
1T8NA 1C2KA 3LIWA 3A83A 1SLUB 1GG6B 1C5UA 2A7CA 4I8GA 1GBMA 1PYTD 1V2MT 1QA7A 1YF4A 1ORFA 3A7VA 1VKYA 2BX4A 3M7TA 4I8HA 4E7RG 2QAAA 1KDQA 1VGCC 3DA9B 1WXRA 2K1QA 4NWKA 2KAIA 1O3BA 2ZF0H 3BEIB 4JZDH 1Z1JA 2KX4A 1ZTLA 3SUFA 1LKBA 1DOJA 4K3JA 3I77A 1O3MA 5HM2A 2G55A 4FUHA 2Q1JA 4XBBA 1LHDH 1AWHB 4ABJA 5A09A 4P02A 1OP2A 4UEHH 3UOUA 4B2CA 3S7HB 1J16A 3GY2A 6ESTA 1A61H 7ESTE 2BY5X 2W3IA 3K2UA 3SV2H 1KXCA 3E1XB 5FAHA 4FVDA 1AWFH 4E06H 1HXFH 2AS9A 1SGYE 2Q6DA 2TGPZ 1P09A 2XBWA 1WTGH 1BBRE 1GJDB 1ZLRA 2L6OA 2PSXA 3SJKA 1C4V2 2KCYA 1XXFA 3SHCH 1XVMA 3DFJA 4FUEA 1GMCF 1MKWK 1BCUH 2FP7B 4X2YA 1AFQC 1GI9B 2Z9IA 2J97A 3SJ8A 5IK2D 2ALPA 1QY6A 1TA6A 3FKSD 3P8OA 2ODPA 4ABFA 1GI3A 2PSYA 2ZNKH 1AD8H 2VWNA 1ZGVA 1O38A 4FU9A 4Y0ZE 3WY8A 1X7AC 3NKKA 1DLKB 5E2PA 2V35A 1EZQA 1O2TA 3UREA 1TABE 1OYQA 1EKBB 1HJAB 4J1YA 3MU5A 2CHAB 2STAE 4GLYA 2QXIA 5EXMA 1F0RA 3OAAD 4Q7XA 1MTSA 1BJUA 2HOBA 3VB3A 3GDSA 4GAWA 1ELVA 1TALA 1B5GH 1ZYOA 1JXPA 4X1RU 1AO5A 3MO6A 1MD7A 4OS7A 1S6LA 2YMSC 3TNSA 1C5MD 2ZHEH 1Z7KA 4THNH 2BY6X 1G9IE 2Q6GA 2XWBI 2W5EA 1LPGB 2GGVB 1ZOMA 3RXQA 2JIZD 5EIYA 1KDQB 3R0FA 1MU6B 4NA8A 1C1TA 2IN2A 1WDIA 4RT1A 3SNBA 2PGBB 1VITG 3PRDA 5PTPA 1N8OB 5L30H 1GWAA 1UO6A 2FMJA 3L33A 1RTLA 5L2ZH 4AFZA 1FZZA 2ANWA 2WUBA 2Z6BD 3KQBA 4Y8YA 1FY3A 3D62A 1C2HA 5GCHG 4ZHMU 3SNDA 1ARCA 3SNEA 3RU4D 3SORA 2STBE 2XC0A 5T6GA 3BEFB 4Y71A 3EA8A 1S82A 4FUBA 2J98A 1YY3A 2FTMA 1LVMA 2GCHG 1K1MA 3ZVDA 2Z94A 5HIYA 1KXEA 2J95A 4WH6A 4IW4E 6LPRA 4NZLA 2RFKC 3U28C 1GVZA 4OS4A 1Y59T 1ZTKA 3U9AH 3T25A 1FN8A 2BOHB 2ODYB 2ZU4A 4OGXA 1AVWA 1HPGA 1ZGIA 3SU1A 2AEIH 1C1PA 4JYUH 1C2DA 4AORA 4HZHA 3FAOA 1GI7B 1C4U2 3TIUA 3PLKA 2ZKSA 1GHAF 1HAVA 4R8TB 1C5SA 1CA0C 2HGTH 4AG2A 3TJOA 4CHAC 1O3KA 2ZDVH 1ELCA 1TNKA 3LGUA 3A7YA 5DP3A 3MHWU 3F1SB 2H9HA 1GI5A 1GBDA 2JDID 3PWCA 3KN2A 3BTFE 3BTKE 3K6ZA 2QXJA 4LOYH 3A7TA 1G3EA 3E91A 3KHVA 1HDTH 1IQEA 2QE7D 1GJ7B 1O2HA 1K21H 2BX3A 3VB4A 4F4OC 2HPQH 5DO4H 4X8UH 2BLOA 2PUQH 3MH7A 3L6PA 2BD9A 2KR7A 3OSYA 2WYGA 2ZGXH 4DG4A 3ATWA 1O35A 3F3BA 1OWKA 4JZFH 2ZA5A 3VXEH 3NUMA 5K7RA 3TPIZ 4NIWA 1QJ7B 1DWBH 2NU4E 2XOKD 2V3MA 1Y5AT 3A80A 5EGMA 1C1QA 1TRMA 2C8ZB 1QL8A 1TQ0B 3A7XA 3RMMH 2AH4X 3Q00A 2A4GA 3MNSA 1ACBE 2C8YB 5G4BA 1V2UT 3ZZ9A 1FN6A 1TLDA 1UHBA 1F0UA 3SYJA 2CXVA 3ELAH 3ATIA 1KLJH 2DE9A 4ISLA 1DXWA 3M35A 3FP6E 1A0LA 5KEDA 3SV6A 1SC8U 1GHYH 1EOLA 3PLPA 1CA8B 1RXPA 3KYGA 1N6YA 3F9EA 2ZPRA 2OC0A 1QBVH 3LDXH 3TLOA 1YC0A 1TIOA 2F83A 1WUNH 1SMFE 2FS9A 3PV2A 4MLFB 4YM9A 1TGBA 2J98B 5C20A 1W12U 1TMUH 5EXNA 4JZEH 3NPSA 2FZZA 4MNVA 2P3FH 2W6JD 2ZU5A 1BTWA 3MNXA 2GMTC 4R0IA 4VGCC 4BXSA 2EEKA 4ISHH 2VVUA 2CGAA 3QLPH 3SUGA 3NXPA 4TY7A 4B71A 4BAMB 3A8CA 3AVZA 1JOUB 1C5PA 1NU7B 1SHYA 4A1TA 3MH6A 4Y11E 3GY8A 2GZ9A 1DFPA 1GI1A 1P9SA 2J92A 1CT2E 1OHHD 2HNTF 3B9FH 1W3CA 1GJ5H 1KIGH 1V2NT 5EQSA 4U2WA 1CHOF 4D9QA 3A89A 1T32A 4D76A 3UAIC 4ESTE 4DJZB 3A88A 4NIVA 1C5OH 1GMHF 2ZHFH 4FXGH 3V12A 6CHAB 5F03A 2BD4A 3ITIA 3ZVFA 1V2PT 2Z9GA 5JPMH 4YT7H 2RDLA 3IWMA 3LC3A 4WMDA 3KQDA 5BPEA 1FJSA 2C8XB 3A7ZA 1FY4A 1YPHC 2A5KA 4U30A 3SW2B 5CDFE 4NIYA 3DFLA 1BRAA 2AERH 3U8OH 1CO7E 3BSQA 1O2QA 2J5UA 3I29A 4YOGA 1CT4E 3RMLH 1WSSH 1TPAE 1S6FA 3KQCA 2P94A 3QN7A 5F6MA 1P2OA 1FY8E 5F53A 5HKKD 3BTDE 1C2FA 2PV9B 1N8OC 1W10U 1RS0A 4GUXA 5LGOA 4D7FA 1BBRK 4LK4A 4Y7AA 3RXMA 1O3FA 2GD4B 1GI0A 1LHEH 4MDSA 1G32B 1OP8A 1BRCE 2A5AA 3A84A 1EUFA 1QIXB 4B74A 1GJAB 3MFJA 1TGCA 8GCHG 4KGAA 1SGDE 3M5LA 1FY5A 3LGIA 3OTPA 1TGNA 1EPTA 1Z8GA 3F2GA 1WBGB 1QNJA 1K2I1 2C4FH 1PQ7A 3DCLA 1SGPE 1LQEA 3BV9B 4WF8A 2OD3B 1TNIA 5DKMA 2VWLA 4FOUC 3K65B 1YP9A 1V2OT 3SBKA 2R2MB 1ARBA 1QZ8A 4RT0A 1AE5A 1CHGA 1Z1IA 2Z3DA 1H8IH 3OU0A 1RIWC 2CV3A 4AB8A 1FMGA 2HVYB 2B9LA 3FP7E 4I32A 1AU8A 2O8WA 4DOQA 2BD3A 1YPJH 3GICB 2VB0A 1ABJH 1PPZA 3URCA 1L0ZA 5DK1A 1EP6A 4FUJA 1BMFD 1V3XA 1J9CH 3ZZBA 1QQUA 2RG3A 2F3CE 1IQJA 2WPKS 1G3CA 2BY9X 1G30B 2FOCA 4UFDH 5GCHF 5B6OA 4OS1A 4ZCNA 2BM2A 2BY8X 2JKHA 3TGIE 4ZKRU 3GY5A 1E34B 2ASUB 1LVYA 4NSVA 5FCKA 4VGCB 1YPEH 1VITF 1IQHA 3QGJA 1YKTA 5A8XA 1HBTH 4KKDA 3ATKA 1QL9A 1HAPH 3F2FA 1WYKA 1RRKA 4H42U 7GCHF 3V0XA 1DX5M 2GCTB 3RC6A 1EJAA 1UK2A 4YZUA 2D8WA 3EQ0H 4X8SH 1DM4B 3ENSB 3BG8A 4E05H 1HCGA 5A0BA 2NU2E 1ZJDA 1TWXB 1RFNA 1SG8B 3ZV8A 3O8DA 1UJ1A 3AW0A 3KYFA 4SGAE 1NY22 2GKVE 1C5YB 3Q77A 4JMYA 1TQ7B 3VFEA 2C3SA 4NG9H 2JETB 3UQVA 5JYIA 3TU7H 2WPDD 1K1NA 2V3HH 3ODDA 2SGEE 3LH3A 1BA8B 1GJBB 2BB4A 3BEUA 1YPKH 4JK5A 3A87A 2GZ8A 1S0QA 1CSOE 2PR3A 3RUOA 1UVTH 5J4SA 4TYDA 3ZZ5A 3GDUA 1QRXA 2Y5GA 1A2CH 1UTNA 3U98H 5LPEA 2BDBA 1HB0B 5EJLA 4I7YH 5GNDA 3VEQB 2G4UA 1Z71A 3W95A 4AG1A 1Y3WA 2VGCB 4O9VA 4CBNA 2EA3A 1HAVB 1O3IA 4LZ1H 1B0FA 1DICA 1C1VH 2VIPA 2SGQE 1LPZB 3GCNA 4YTAA 5C17A 2XBVA 2Z3EA 4IBLH 1GMDG 3VXFH 3F0OA 5E0HA 4K5ZA 2Z9KA 2BYAX 1TX7A 1AKSA 2WUCA 3S69A 1C2GA 5A2MH 1IOEA 1AZ8A 1TNLA 3GOVB 1FUJA 4CR9A 1VCWA 1MKXH 1LDTT 2FWWA 1DE7H 3ZZ7A 1EB1H 1UTMA 2FM2A 5GJ4B 1NFYA 1WAYB 3VG8A 1H8ED 2C8WB 4WXIA 1SGIB 5JBCS 5JBAS 1JRSA 1O3GA 1Y8TA 4H6SB 2AMQA 4YLUA 3EDXB 3C27B 1SL3A 4ABHA 3DD2H 2BDCA 1Y5BT 2BDIA 2SGPE 4I31A 1NC6A 3PLBA 5F8XA 1QR3E 3RLYH 3SV7A 2EY4C 1ZPCA 3RXDA 2PP6A 1GVKB 2PTCE 3U8TH 1RD3B 2AGIX 5AHGH 5DP7A 1WOFA 2XYAA 1XKAC 1SLXB 1RJXB 2BD2A 1W0JD 1HJ8A 2ZTYA 5DN6D 3QK1A 1A4WH 4TSFD 4Q2KA 1F5LA 3P70B 3KQ5A 1XUIA 2FLRH 4NFEA 2OTVA 1GI4A 1O5FH 4OGYA 1PPFE 1W11U 4HG6A 2F9BH 4NZQA 5CHAC 3SU4A 1K1LA 1TBRH 1UTPA 1EZSC 2QXGA 1UK4A 5LH8A 5LPRA 1Y3UA 4ABEA 1GBTA 4M7GA 3Q3YA 2OBQA 4GVUA 3TK5A 5GIBA 2OP9A 4MPXA 3RXIA 2FOGA 2XC5A 3VB5A 3VGCC 5FX5A 3QX5H 1P2NA 2WV9A 3GCHC 3MNBA 2H9EH 1IHTH 1V2JT 2OK5A 3U1JB 2DUCA 1XMNB 1NM6A 1C5NH 4INKA 1HAOH 2NWNA 1EP5A 4CH2B 1ESAA 2D26C 3I78A 4JK6A 3RLWH 1QJ6B 3BIVH 2WPJS 2Q6FA 3DSPA 1AB9C 5FPSA 3WWBA 2ZGBH 4IMZA 3RU4E 3OTJE 3QUMP 1QRZA 2LNCA 1E37B 2ZFFH 2M5TA 2A31A 1EOJA 1YM0A 2BLVA 3QTOH 4FVBA 1BB0B 1Q3XA 2W7SA 3E6PH 3T2NA 2ZCLP 2ZFSA 1UCYH 1GI2A 1O2NA 5EPNA 2ZO3H 4TWYA 3HATH 5I25A 3LC5A 3VB7A 5C67A 4FUCA 1QBNA 3JZ1B 4B76A 2ZHDA 1HIAA 2ALVA 1GGDC 2OC1A 1ZRBA 1WTHD 1TOCB 2KCPA 2QIQA 3HK3B 3MH4A 3D49H 4OS2A 1YCPK 3Q3KA 2Z9JA 5KGOA 3MNCA 2IJOB 2W3KA 3UUZA 2QN5T 1IQKA 1TPSA 1E1QD 3GY4A 1CVWH 1K22H 3SHAH 3TK9A 1AB9B 2CK3D 1FNIA 1PPGE 3N7DA 1W2KH 4YO9A 3RXEA 5DPAA 1O2ZA 1OSSA 1E38B 3S9AA 2QA9E 1KMHB 2BZ6H 1BTZA 2ZTZA 1MH0A 4Y8ZA 2HALA 2VINA 1O2KA 3PMJA 2UUYA 1QB1A 1P2QA 1GHXH 1D3QB 1S0RA 3A86A 4YXWD 1O5AB 2PKSB 1K1JA 1P2IA 5I46H 5EQQA 3MU1A 1OYTH 1C5XB 4CBOA 2EQNA 3UB0A 1HAIH 2FX4A 2HNTC 2Z7FE 3ZV9A 4I8KA 3ZZAA 3SNAA 2ESTE 3TGKE 2A32A 2B0FA 3MYWA 2A5IA 2G51A 4NA9H 2H5DA 2QF4A 3FZDA 4TWWA 1P01A 1FDPA 2F9OA 1NPMA 3UNQA 4A92A 3CP7A 4AOQA 3MWIU 1ZHPA 2ZWLH 2O8MA 1NRRH 2V3OH 5EJ1A 1EZUC 2FPZA 2R3YA 2VBCA 1C1MA 1ZTJA 2ZI2H 4F48B 3F6UH 1P03A 3BF6H 1EX3A 3FO8D 4MG3A 3RMOH 2TRMA 1J15A 1T8MA 1LCYA 1SFIA 2FODA 4D8NA 4Y7BA 3UY9A 3KGPA 3GY7A 1P3CA 2ZFRH 2ZCKP 2A7HA 1P11E 2RCEA 5FPTA 1THSH 1EASA 2TGDA 4IC6A 4MPVA 3QGNB 5EOKA 2XWAA 3RXGA 4DURA 1T4VH 2P93A 1TMTH 1G3BA 1D4PB 1AIXH 5EU8A 1RIWB 1KXFA 4ZAEA 2L74A 1BQYA 1XVOA 1O33A 3QZRA 1ELFA 2FOMB 1OXGA 3SU6A 4ZKNU 1TE0A 2FI5E 2QF3A 2HVXA 2KM0A 3MQKC 1SOTA 1MQ6A 2Z3CA 2VGCC 3ESTA 3PRBA 2OC7A 4K69A 3ZVCA 1EFRD 1UTJA 1ZMJA 2B7DH 1O3JA 3M7UA 5AVDA 3CNRA 3HGNA 1LHCH 1SR5C 3UWJH 1OWIA 4CRCA 4X0WU 7LPRA 1BOQA 3M37A 2TBSA 1EJNA 3ATMA 2ZQ1A 4B1TA 4BTIB 1EAWA 1MMJN 3T26A 1CE5A 1O5BB 2RDEA 1ETRH 1A0JA 1K0HA 5E2OA 4A5TS 4BAQB 2GT7A 1GHVH 2D1JA 4CRFA 2Y7XA 5J4QA 1H9HE 2Y82A 1P06A 2WPIS 1MCTA 2ZFPH 4B75A 1P10A 5EXLA 1HAGE 2OLGA 2O8LA 4BAHB 3SOSA 1GBBA 2FTLE 3RXPA 1MTWA 2Y7ZA 3SU0A 3U69H 5EW2H 1MD8A 4RKOB 1HIAB 2ZDNA 2G81E 2PHBA 1QA0A 1UVSH 2BY7X 3GY3A 3N7OA 3EE7A 3DHKH 3P8GA 1JIMA 2ZIQH 3B23B 1TPPA 1O34A 3G01A 3KEEA 1XUFA 2VIOA 2I6SA 4GCHF 5C0UA 1INCA 1QJ1B 4K8YA 4X1SU 2J34A 1EJMA 1NFUA 1MZDA 3TJNA 3F9HA 1AGJA 3ZVAA 1H8HD 4HTCH 2JH6D 3T29A 5C1UA 1H4WA 1C2LA 4ISIH 1NRSH 2EI8A 3UQOA 2KAIB 2G52A 1IQFA 3NZIA 4Q80A 4OM9A 1VCPA 2DE8A 2ZDKA 3SI4H 1SPJA 4WJG2 2VVVA 1KSNA 2FOAA 3S7KB 3MI4A 1BMLA 3MU4A 1UTLM 3MOCA 3HKJB 5ESTE 5E0JA 3U8RH 2OUAA 3LJOA 4I33A 1Z8JB 1EZXC 2SNVA 1UW7A 1V2WT 3UIRA 1SLWB 4XSKU 1RTKA 4Y76A 1OPHB 4DT4A 3PMHB 2F91A 3KQEA 5DP6A 1O3LA 3NCLA 2GDDA 1SQAA 2BXTH 2GX4A 3GCTF 2CN0H 1XUGA 1N1LA 3RXJA 4HGCA 1A7SA 2BZAA 3S9BA 5JB8S 3SU2A 3ZZCA 1K28D 1S81A 3T5FH 1SGQE 5L2YH 5BRRE 1SBWA 1GJ4H 4Y0YE 5HIZA 2A2XH 4KP0A 2CHAC 4XE4A 2XXLA 2VNTA 2ZGHA 2ZU2A 2P8OB 4UFEH 1F7ZA 3M36A 3STJA 1GHWH 2F4LA 2BD7A 3BTGE 1FY1A 5JBTA 4IS5A 2CF9H 1PQAA 1ZPZA 5AFZH 1MTNC 2ZP0H 2WINI 1DXPA 1XUKA 1D3DB 1H1BA 1O2VA 2F9UA 3LONA 3VB6A 1F92A 4NIXA 3S0NA 9LPRA 4XBDA 1TOMH 1DUEA 3SJ9A 2QGRA 1Y5UT 1AFQB 1H8DH 3E3TA 3LOXA 5TCCA 1DSTA 4AX9H 1HYLA 4ABAA 3SV9A 3TH2H 5JB9S 3VPKA 3O8BA 4RN6A 3EA9A 1D9IA 1QHRB 4BAKB 1KLTA 4O03A 5C5NA 1L1NA 2V7QD 3AAUA 1L1GA 2ANKH 1GJ9B 3P92A 5FL7D 5IDKA 1GDQA 3GS9A 3RXTA 3UWIA 1O2SA 4ZUHA 3PM3A 3GY6A 3OE7D 1AUJA 5CHBA 1C2JA 4YOIA 8GCHF 2GMTB 4NFFA 1F5RA 1V2LT 2XBYA 1ELDE 1AFEH 1V2VT 1A5GH 3A7WA 4WVPE 1O2XA 2TGTA 1DLEA 2BD5A 2VH0A 1SKYE 4Q7ZA 1KTTB 4CRDA 1IQMA 2QF0A 8ESTE 1YPMH 2CJIA 1AKSB 2BD8A 3GDVA 3PROA 4I8LA 5AFYH 2XNIA 4I86A 1OWJA 2Y6TA 1ZR0A 1GL1A 2W26A 3JZ2B 3P8FA 1P2KA 3KIDU 4IC5A 4KTUA 2UWLA 4H6TA 5B6LA 3UPEA 4AYYB 5L6NH 4MTBA 1UVUH 2OQ5A 3RMNH 1GMCG 1SGFA 2WV4A 3F9FA 1MUEB 4BNRA 2WYJA 1SGNE 1FIZA 3GYMA 4K1SA 4X8TH 3BTHE 1HGTH 3FZZA 5FPYA 3SNCA 1O3NA 4ABBA 2FS8A 4MNWA 2PKSC 4INLA 1DY8A 1HAHH 3OY5U 1QL7A 1S83A 2UUKB 1TGSZ 1VCQA 1TB6H 1VGCB 2GVFA 2FESH 1GBFA 3LU9B 2GCHF 4XDEA 3D23A 1BMNH 2BQ7B 1C1WH 1YPLH 3M61U 5FBEA 2YNAA 3QTVH 1C1RA 3PWBA 1V2RT 1D6RA 2B5TB 3SI3H 1E1RD 4D9RA 1SGTA 1FX0B 2IPQX 4YOJA 1EAUA 1ZPBA 3SN8A 1XKBC 4ACBA 2ZU3A 3SZEA 2BVXH 5K0HA 3RP2A 5C94A 5FBIA 2A7JA 4GCHG 3S9CA 2H5CA 5HM9A 1MKWH 2QCYA 4WXVA 5F8ZA 1NO9H 1QGFA 3TITA 2EI7A 1HXEH 2TIOA 1Z6JH 1CGJE 4XOJA 5GPIB 1LQDB 3P6ZB 2GV7A 2R2WU 1O2IA 1PQ8A 3PV5A 2HRVA 3QO6A 4MNYA 1Q31A 1O2YA 4CHAB 2VH6A 2Y5HA 2FOHA 4NSYA 1L4ZA 1S85A 4CR5A 3PV4A 1DT2A 1BRUP 2RA0A 5A0CA 1PFXC 1IAUA 4ZKOU 2C93B 4ZMAH 4AN7A 3GCTG 1W7GH 2ODQA 1YBWA 1PPHE 1GBEA 1SGRE 7KMEH 1D3PB 3R3GB 1THRH 1C9PA 1OOKB 2A45B 1NROH 1SQOA 2EC9H 1UTQA 2WV5A 1SSXA 1B7XB 4FETA 1WCZA 3D65E 3OY6U 4O3UA 4XRNA 1KXAA 3UR6A 4F55A 1DDJA 3LH1A 2AIQA 4BAOB 1F5KU 3SQHE 4DCDA 1JIRA 3TH3H 4CH8B 1EPTB 4MPUA 4FUFA 1VJAU 4IMQA 1B0EA 1IHSH 2AGGX 3P95A 1VZQH 4X6OA 4JZIA 5EG4A 2BDHA 1NN6A 3A82A 2C90B 3V13A 1SGEE 4IGDA 1BZXE 3TK6A 2O8TA 2G5NA 4ABIA 6GCHF 1GBCA 7GCHG 1SQRA 3RXCA 1AE8H 3TGJE 2R9PA 3F0PA 4Y8XA 3MH5A 3UOPA 3NRLA 1FPCH 1SOZA 5FHTA 1O3HA 1OKXA 1GG6C 3E8LA 3E90B 1O2JA 2FXRA 3FP8E 9ESTA 2A1DB 3FN8A 3GISB 1ANCA 1HJ9A 1EXFA 1PPBH 3UNSA 1Z8IB 5TCAA 1CT0E 4K2YA 4RKJB 3RC4A 2K0QA 3AW1A 3E16B 2WHXA 1P12E 1NU9A 2P16A 4DGJA 4X8VH 1NZQH 1FXYA 6GCHG 4PROA 3Q76A 3ZYDA 5A8YA 2YOLA 2TPIZ 1BBRH 3URDA 4DVAU 3N99A 1UVPA 3EAJA 3MO9A 2ZEBA 1GHZA 1Y3VA 1L2EA 1O3EA 3ZZDA 3FFGA 4E7NA 2EI6A 1QFKH 3IITA 4Y79A 2PWXA 4UFFH 4A6LA 3BIUH 1O31A 1O3DA 2OQUA 3N7EA 5CE1A 3BG4C 3SO3A 1TNHA 1OX1A 3ATLA 5TJXA 2FO9A 3RXBA 1FPHH 3A8AA 4ASUD 4ASHA 1O2OA 1COWD 1GL0E 1YPHE 2ZQ2A 2XNDD 2BDYA 4AGJA 1MCVA 2OBOA 1IQLA 8KME2 5C3NA 5HMAA 4Y6DA 3KL6A 1DS2E 1LO6A 1KXBA 3DT0H 1O2RA 2H1UA 1ANDA 2ZFQH 3SUDA 5A0AE 1A0HB 2OXSA 1C2MA 1WU1A 2BLWA 4ABDA 2GTBA 2ZG0H 1F0SA 1EQ9A 2ZPSA 1DWCH 3M7QA 3PYHA 3U1IB 1Z8RA 1AUTC 3SU3A 2K8IA 4OS6A 3VGCB 1A3EH 2WZQA 3H7OA 2M2AA 4GPGA 1J8AA 2ZTXA 4AFSA 1GHBF 1FI8A 1E36B 1MQ5A 1D3TB 1FONA 1P2MA 1QCPA 1O2WA 3FVFB 1JRTA 3H5CB 4D7GA 3UR9A 3B8JA 4F49A 3LGWA 2IPHA 3TVJB 1KTSB 4X2XA 2JETC 2JH0D 2VIDA 1XM1A 1DY9A 1OS8A 4KELA 4ZXYH 3A8DA 5CMXH 1HRTH 4FUDA 2XTTB 3A8BA 2V0BA 4A1VA 5C5OA 1QTFA 2VWOA 1SQTA 5JBBS 2IJD1 2AMPA 2BQ6B 3IG6B 1E79D 4BANB 2FYRA 1MBMA 2ZDMA 3HPTB 2JJ1D 2G5VA 2AMDA 5HGGA 3O8RA 1T31A 3UFAA 3ZVGA 1UK3A 5GWZA 1P04A 2GT8A 2J4IA 1MABB 1BMAA 2ZHQH 1DANH 1D6WA 5GXPA 4MVNA 3SJIA 4NGAH 1EAIA 1UVOA 2BVSH 1CU1A 5T3HA 2YMSB 2ZDLA 5EQRA 5ETXA 1C5TA 3PTBA 4XFQA 1YCPM 3P8NA 1QRWA 2FDAA 3RM0H 1YLCA 5ESBA 1EB2A 2P3UB 2GJGA 3STIA 1PJPA 1HAXB 3BTWE 4YLQH 1SLVB 2AYWA 3KF2A 2OCVB 4FU8A 1T8OA 1BHXB 1ZSKA 1NRPH 1P05A 1MAYA 2FYQA 3BG4B 5T1VA 1K1PA 4ZH8A 2XW9A 1A5IA 2WPMS 1GMHG 5A8ZA 2H2ZA 1MKXK 3LKWA 1BTYA 1DITH 4X6PA 5EODA 2PLXA 1PPEE 4K1EA 1MTUA 2HLDD 4TPIZ 3RXHA 2ULLA 3SGQE 3T27A 4UONA 1GHBG 2F43B 1BDAA 4ISNA 4JZ1A 3M3TA 5DSFA 1O39A 5FXLA 2ZGCA 2UWPA 1YWUA 1ZMNA 4H4FA 4X6NA 4DT7B 2FOFA 1O3OA 1C1OA 2A2QH 3E0PB 5T6FA 1LMWB 4QT8C 2PW8H 2QC2A 3ZZ3A 3AK5A 3NWUA 4HI3A 1L1JA 3EA7A 4AB9A 1LHFH 3ZYEA 2VU8E 4X1QU 5ABWA 4FUGA 2VVCA 3BTQE 2JH5D 8LPRA 1AQ7A 1W0ZU 3MMGA 1O2GH 1M9UA 3TNTA 4BXWA 2BQWB 4AFUA 1S6HA 1GCTB 1CBWB 2PGQB 4DIIH 1NFWA 2PKAB 1MU8B 1A46H 1BITA 1OP0A 4B6FA 4NA7A 2FIRH 3RDZA 1F0TA 4MQAA 3LT3A 3SUEA 1Y3YA 1W8BH 1HAYB 1UTKA 1GBJA 2A4QA 1C5VA 3BTTE 1ETSH 4X1PU 1GJ6A 1GBAA 1LTOA 3LJJA 3ZZ6A 1GBHA 2V6NA 1PPCE 1C5ZB 1Q2WA 1SGFG 3GYLB 5C2ZA 4WMFA 2OINA 2VIQA 4ZROA 3CENA 1NBMD 3BTEE 4U01A 5IYTA 1BHXF 1ANEA 1PQ5A 4AGKA 1JBUH 1TAWA 1O2LA 2LPRA 2PTNA 2J94A 1CA0B 1QB6A 5C0TA 3V3MA 2G4TA 5DG6A 1SFQB 3F68H 2WPHS 3RXSA 1IQIA 3M5NA 3BN9A 2H9TH 4GHTA 1MZAA 4Q63A 1GDNA 2O8UA 1GJCB 3RXLA 1O32A 2QV1A 1QB9A 2GP9B 3H09A 1K9OE 4CRBA 1KY9A 1MTNB 4BTUB 2LELA 1XXDA 3E0NB 2THFB 1TBQH 2R0LA 1VJ9U 3HKIB 4DW2U 1G3DA 1ELTA 1O2MA 1DPOA 2XCNA 5F8TA 3ZVBA 3RXFA 1O3PB 1J17T 1WQSA 3A85A 2VIVA 1BTHH 1GCDA 2NU0E 4MPWA 4K8BA 2P3TB 1YCPH 5HYOA 3PTNA 4YESB 4KTSA 1O2UA 1VITH 1C2EA 2AHME 1SGCA 3PO1B 4DY7B 3RXAA 1GI6A 3GCHB 1DSUA 2I6QA 1GCTC 2QY0B 4O97A 1LPKB 1C5LH 2FI4E 3SZNA 1FAXA 2UUJB 1MAXA 3RXRA 1C1UH 2BDAA 1S84A 3L3TA 3HK6B 1ZHRA 3ZVEA 2FLBH 1NFXA 3QWCH 4Q7YA 2WPLS 2ILNA 3QDZB 2J38A 1ETTH 1N6XA 1T8LA 5GDSH 3SGAE 4CREA 1BIOA 3F9GA 1TNJA 5EW1H 3RU4T 5DP4A 1W7XH 2HLCA 1O0DH 4HFPB 1GPZA 2BXUH 1O30A 1KYNA 2XBXA 2WSSD 3RXUA 1P57B 4Q4LA 5T6DA 5FCRA 1GBKA 3OEHD 1C5WB 1SI5H 1CGHA 4XBCA 1ELGA 4UDWH 4AC9A 3W1EA 5H4IB 1PYTC 2KFWA 3OFND 3AAVA 4JYTA 1LKAA 2NU3E 1WV7H 4ABGA 1K1IA 1BTXA 3M5OA 2HWLB 2G00A 1GBIA 1GJ8B 2Y5FA 2Y80A 4WMEA 3T28A 1A3BH 3LGTA 1WQVH 3SQEE 1OWDA 1DWEH 3TH4H 2AFQB 2J9NA 1TRYA 4WH8A 2AGEX 5E0GA 1RTFB 3OYPA 1P02A 4U32A 1SVPA 1K1OA 1BRBE 2ZHWH 1BTUA 3K9XB 1HV7A 2A4OA 2P95A 2ZPQA 1AHTH 1ID5H 3SV8A 5DJ7A 2FX6A 5EPYA 1ZJKA 4Z6AH 1H9LB 3DUXH 2FOEA 2F9NA 4ZKSU 1AVGH 1UHBB 3A81A 1YGCH 2SFAA 1AN1E 4P00A 5DP5A 2ZECA 3ZZ8A 4OS5A 1AMHA 1HLTH 5EJZA 1QURH 1TA2A 3RXOA 1J14A 1TPOA 4B2BA 1TONA 2ZZUH 4X2VA 1Y3XA 1BJVA 1GDUA 3ZZ4A 2AIPA 1G2MA 2UWOA 4B6EA 1SB1H 4NCYA 3QZQA 4INHA 1CHOG 4AFQA 4Z0KA 3NK8A 2BMGB 1VR1H 2B8OH 3ZIAD 2P8OC 2UUFB 2R0KA 1F2SE 3WW7A 3MTYA 1AY6H 4JYVH 1TRNA 2XRCA 2VWMA 2ANYA 2BLQA 1YLNA 1DVAH 4ZHAA 3P17H 4TY6A 4IN2A 2RA3A 3W94A 1FIWA 1ZZZA 4XD7D 3ODFA 5SGAE 1Z6EA 3RM2H 3M3VA 4RI0A 3SGBE 1ZSLA 3V7TA 2GV6A 1BMMH 3FANA 1UCYK 1GI8B 1AI8H 2W6ID 1XUJA 1QQ4A 5C1XA 1P3EA 2ZFTA 1E35B 3HGPA 2LP6A 2QF5A 1P9UA 2KCAA 1BT7A 5LPFA 1C5RA 1FQ3A 3LGVA 5DP9A 1EPTC 5E8EH 3T62A 1MTVA 4ISOA 1L4DA 2H6MA 1HNEE 3PMBB 2D2DA 1JWTA 4KTCA 1W13U 2SGDE 2R3UA 2NU1E 2VIWA 1EAXA 1SHHB 3FOAA 1TBZH 1U6QA 4WWYA 2BDGA 1FAKH 5FX6A 1XX9A 2HNTE 2SNWA 1C1NA 1ZRKA 3M3SA 2FI3E 1OWEA 3F2HA 1C5QA 1O3CA 1XUHA 1GGDB 4J2YB 3SU5A 3KCGH 4TPYA 5JDUB 3MU8A 1UCYE 1TGTA 4SGBE 1IQGA 4RSPA 4X2WA 1LHGH 1C2IA 2IOTA 3K6YA 4MNXA 2TGAA 2XC4A 3O8CA 2PKAA 3UTUH 1P0SH 1W0KD 2F9PA 1FLEE 1YYY1 2JJ2D 1GBLA 1E0FD 1P8VC 2ZDAH 3LPRA 1NBME 3TJUA 1CBWC 1RGQA 3TJVA 2A0QB 4A7IB 1V2QT 1YLDA 1T4UH 1JMOH 2KZ4A 3EGKH 4X1NU 5C1YA 1ESTA 1AZZA 1O5CB 4WY3A 1NS3A 4CRAA 2CF8H 1HUTH 1AVXA 1TX6A 1TYNA 1BUIA 4ACAA 4UFGH 1P2JA 3DSOA 2GDEH 3Q3XA 2P59A 1A5HA 2QYIA 3DSGA 4FU7A 1UMAH 5DP8A 2YNBA 1TNGA 1HAZB 3C1KA 1O2PA 1EATA 5DGJA 4IN1A 1HFDA 2O9QA 4LXBH 3PO1C 1TMBH 2G8TA 4I8JA 5HXFA 1O36A 2J2UA 1S5SA 1ZMLA 1TX8A 3EYDA 4GHQA 4A1XA 1ANBA 1GHAG 3RXVA 1ESBA 2QXHA 3H7TA 3MO3A 1NRQH 1O3AA 1CQQA 1O5GH 3PMAB 6CHAC 2BOKA 1GVLA 1O37A 1T7CA 2GCTC 2Y81A 3OX7U 3RXKA 2PFEA 1KXDA 1C4Y2 3OEED 4TT3D 1G37A 1GMDF 3RC5A 1LVOA 4M9FA 5CHAB 3AASA 4X6MA 1CGIE 3SJOA 4CRGA 2W7UA 1NTPA 2PUXB 1IQNA 1NRNH 1C9TA 4LZ4B 1G36A 4DIHH 4B73A 1V2TT 3GCOA 2SGAA 4UE7H 1YPGH 4YT6H 2BVRH 1LVBA 2GZ7A 4O3TA 4GSOA 1ELEE 2A4RA 2HPPH 1MBQA 2YMSD 3CS7A 3PB1E 2ZC9H 3UNRA 1HJAC 1UTOA 1C1SA 3M5MA 3MU0A 4K60A 1TFXA 4Y10E 4BTTB 3KNXA 4ZHLU 2BHGA 1ZHMA 2ZCHP 4K1TA 1W0YH 1NT1A 5AF9H 1BTPA 1W14U 1V2KT 1G2LA 2F9VA 4ZXXH 2SGFE 3BTME 4UD9H 4Z1MD 1ELAA 1A1RA 1THPB 2Z9LA 2ZU1A 3CS0A 1DUAA 1O5EH 2VJ1A 1ELBA 2OC8A 5KECA 1NESE 1KLIH 4B2AA 1OWHA 1H9IE 4BOHA 2KCOA 3WWFA 3LGYA 1V6DA 4FUIA 2ZGJA 1QBOA 1O5DH 1FV9A 1V2ST 1ZSJA 2CMYA 4AZ2B 1ABIH 2ANMH 2BTCE 2FOBA 4JCNA 2XCFA 4NWLA 2FEQH 3EE0B 1DWDH 4AYVB
chains in the Genus database with same CATH topology
1T8NA 1C2KA 3LIWA 3A83A 1SLUB 1GG6B 1C5UA 2A7CA 4I8GA 1GBMA 1PYTD 1V2MT 1QA7A 1YF4A 1ORFA 3A7VA 2BX4A 3M7TA 4I8HA 4E7RG 2QAAA 1KDQA 1VGCC 3DA9B 2K1QA 4NWKA 2KAIA 1O3BA 2ZF0H 3BEIB 4JZDH 1Z1JA 3SUFA 1ZTLA 1LKBA 1DOJA 4K3JA 3I77A 1O3MA 5HM2A 2G55A 4FUHA 2Q1JA 4XBBA 1LHDH 1AWHB 4ABJA 5A09A 1OP2A 4UEHH 3UOUA 4B2CA 3S7HB 1J16A 3GY2A 6ESTA 1A61H 7ESTE 2BY5X 2W3IA 3K2UA 3SV2H 1KXCA 3E1XB 5FAHA 4FVDA 1AWFH 4E06H 1HXFH 2AS9A 1SGYE 2Q6DA 2TGPZ 1P09A 2XBWA 1WTGH 1BBRE 1GJDB 1ZLRA 2PSXA 3SJKA 1C4V2 1XXFA 3SHCH 1XVMA 3DFJA 4FUEA 1GMCF 1MKWK 1BCUH 2FP7B 4X2YA 1AFQC 1GI9B 2Z9IA 3SJ8A 2ALPA 1QY6A 1TA6A 3P8OA 2ODPA 4ABFA 1GI3A 2PSYA 2ZNKH 1AD8H 2VWNA 1ZGVA 1O38A 4FU9A 4Y0ZE 3WY8A 1X7AC 3NKKA 1DLKB 5E2PA 2V35A 1EZQA 1O2TA 3UREA 1TABE 1OYQA 1EKBB 1HJAB 4J1YA 3MU5A 2CHAB 2STAE 4GLYA 2QXIA 5EXMA 1F0RA 4Q7XA 1MTSA 1BJUA 2HOBA 3VB3A 3GDSA 4GAWA 1ELVA 1TALA 1B5GH 1ZYOA 1JXPA 4X1RU 1AO5A 3MO6A 1MD7A 4OS7A 3TNSA 1C5MD 2ZHEH 1Z7KA 4THNH 2BY6X 1G9IE 2Q6GA 2XWBI 2W5EA 1LPGB 2GGVB 1ZOMA 3RXQA 1KDQB 3R0FA 1MU6B 4NA8A 1C1TA 2IN2A 3SNBA 2PGBB 1VITG 5PTPA 1N8OB 5L30H 1GWAA 1UO6A 2FMJA 3L33A 1RTLA 5L2ZH 4AFZA 1FZZA 2ANWA 2WUBA 2Z6BD 3KQBA 4Y8YA 1FY3A 3D62A 1C2HA 5GCHG 4ZHMU 3SNDA 1ARCA 3SNEA 3RU4D 3SORA 2STBE 2XC0A 5T6GA 3BEFB 4Y71A 3EA8A 1S82A 4FUBA 2FTMA 1LVMA 2GCHG 1K1MA 3ZVDA 2Z94A 1KXEA 2J95A 4WH6A 4IW4E 6LPRA 4NZLA 1GVZA 4OS4A 1Y59T 1ZTKA 3U9AH 3T25A 1FN8A 2BOHB 2ODYB 2ZU4A 4OGXA 1AVWA 1HPGA 1ZGIA 3SU1A 2AEIH 1C1PA 4JYUH 1C2DA 4AORA 4HZHA 3FAOA 1GI7B 1C4U2 3TIUA 3PLKA 2ZKSA 1GHAF 1HAVA 4R8TB 1C5SA 1CA0C 2HGTH 4AG2A 3TJOA 4CHAC 1O3KA 2ZDVH 1ELCA 1TNKA 3LGUA 3A7YA 5DP3A 3MHWU 3F1SB 2H9HA 1GI5A 1GBDA 3PWCA 3KN2A 3BTFE 3BTKE 3K6ZA 2QXJA 4LOYH 3A7TA 1G3EA 3E91A 3KHVA 1HDTH 1IQEA 1GJ7B 1O2HA 1K21H 2BX3A 3VB4A 4F4OC 2HPQH 5DO4H 4X8UH 2BLOA 2PUQH 3MH7A 3L6PA 2BD9A 3OSYA 2WYGA 2ZGXH 4DG4A 3ATWA 1O35A 1OWKA 4JZFH 2ZA5A 3VXEH 3NUMA 5K7RA 3TPIZ 4NIWA 1QJ7B 1DWBH 2NU4E 1Y5AT 3A80A 5EGMA 1C1QA 1TRMA 2C8ZB 1QL8A 1TQ0B 3A7XA 3RMMH 2AH4X 3Q00A 2A4GA 3MNSA 1ACBE 2C8YB 5G4BA 1V2UT 3ZZ9A 1FN6A 1TLDA 1UHBA 1F0UA 2CXVA 3ELAH 3ATIA 1KLJH 2DE9A 4ISLA 1DXWA 3M35A 3FP6E 1A0LA 3SV6A 1SC8U 1GHYH 1EOLA 3PLPA 1CA8B 1RXPA 1N6YA 3F9EA 2ZPRA 2OC0A 1QBVH 3LDXH 3TLOA 1YC0A 1TIOA 2F83A 1WUNH 1SMFE 2FS9A 4MLFB 4YM9A 1TGBA 5C20A 1W12U 1TMUH 5EXNA 4JZEH 3NPSA 2FZZA 4MNVA 2P3FH 2ZU5A 1BTWA 3MNXA 2GMTC 4R0IA 4VGCC 4BXSA 2EEKA 4ISHH 2VVUA 2CGAA 3QLPH 3SUGA 3NXPA 4TY7A 4B71A 4BAMB 3A8CA 3AVZA 1JOUB 1C5PA 1NU7B 1SHYA 4A1TA 3MH6A 4Y11E 3GY8A 2GZ9A 1DFPA 1GI1A 1P9SA 2J92A 1CT2E 2HNTF 3B9FH 1W3CA 1GJ5H 1KIGH 1V2NT 5EQSA 4U2WA 1CHOF 4D9QA 3A89A 1T32A 4D76A 4ESTE 4DJZB 3A88A 4NIVA 1C5OH 1GMHF 2ZHFH 4FXGH 3V12A 6CHAB 5F03A 2BD4A 3ITIA 3ZVFA 1V2PT 2Z9GA 5JPMH 4YT7H 2RDLA 3IWMA 3LC3A 4WMDA 3KQDA 5BPEA 1FJSA 2C8XB 3A7ZA 1FY4A 1YPHC 2A5KA 4U30A 3SW2B 4NIYA 3DFLA 1BRAA 2AERH 3U8OH 1CO7E 3BSQA 1O2QA 3I29A 4YOGA 1CT4E 3RMLH 1WSSH 1TPAE 1S6FA 3KQCA 2P94A 3QN7A 5F6MA 1P2OA 1FY8E 3BTDE 1C2FA 2PV9B 1N8OC 1W10U 1RS0A 4GUXA 5LGOA 4D7FA 1BBRK 4LK4A 4Y7AA 3RXMA 1O3FA 2GD4B 1GI0A 1LHEH 4MDSA 1G32B 1OP8A 1BRCE 2A5AA 3A84A 1EUFA 1QIXB 4B74A 1GJAB 3MFJA 1TGCA 8GCHG 4KGAA 1SGDE 3M5LA 1FY5A 3LGIA 1TGNA 1EPTA 1Z8GA 1WBGB 1QNJA 1K2I1 2C4FH 1PQ7A 1SGPE 1LQEA 3BV9B 4WF8A 2OD3B 1TNIA 5DKMA 2VWLA 3K65B 1YP9A 1V2OT 3SBKA 2R2MB 1ARBA 1AE5A 1CHGA 1Z1IA 2Z3DA 1H8IH 3OU0A 1RIWC 2CV3A 4AB8A 1FMGA 2B9LA 3FP7E 4I32A 1AU8A 2O8WA 4DOQA 2BD3A 1YPJH 3GICB 2VB0A 1ABJH 1PPZA 3URCA 1L0ZA 5DK1A 1EP6A 4FUJA 1V3XA 1J9CH 3ZZBA 1QQUA 2RG3A 2F3CE 1IQJA 2WPKS 1G3CA 2BY9X 1G30B 2FOCA 4UFDH 5GCHF 5B6OA 4OS1A 2BM2A 2BY8X 2JKHA 3TGIE 4ZKRU 3GY5A 1E34B 2ASUB 1LVYA 4NSVA 5FCKA 4VGCB 1YPEH 1VITF 1IQHA 3QGJA 1YKTA 5A8XA 1HBTH 4KKDA 3ATKA 1QL9A 1HAPH 1WYKA 1RRKA 4H42U 7GCHF 3V0XA 1DX5M 2GCTB 3RC6A 1EJAA 1UK2A 4YZUA 2D8WA 3EQ0H 4X8SH 1DM4B 3ENSB 3BG8A 4E05H 1HCGA 5A0BA 2NU2E 1ZJDA 1TWXB 1RFNA 1SG8B 3ZV8A 3O8DA 1UJ1A 3AW0A 4SGAE 1NY22 2GKVE 1C5YB 3Q77A 4JMYA 1TQ7B 3VFEA 2C3SA 4NG9H 2JETB 3UQVA 5JYIA 3TU7H 1K1NA 2V3HH 3ODDA 2SGEE 3LH3A 1BA8B 1GJBB 2BB4A 3BEUA 1YPKH 4JK5A 3A87A 2GZ8A 1S0QA 1CSOE 2PR3A 3RUOA 1UVTH 5J4SA 4TYDA 3ZZ5A 3GDUA 1QRXA 2Y5GA 1A2CH 1UTNA 3U98H 5LPEA 2BDBA 1HB0B 4I7YH 3VEQB 2G4UA 1Z71A 3W95A 4AG1A 1Y3WA 2VGCB 4O9VA 4CBNA 2EA3A 1HAVB 1O3IA 4LZ1H 1B0FA 1DICA 1C1VH 2VIPA 2SGQE 1LPZB 3GCNA 4YTAA 2XBVA 2Z3EA 4IBLH 1GMDG 3VXFH 5E0HA 4K5ZA 2Z9KA 2BYAX 1TX7A 1AKSA 2WUCA 3S69A 1C2GA 5A2MH 1IOEA 1AZ8A 1TNLA 3GOVB 1FUJA 4CR9A 1VCWA 1MKXH 1LDTT 2FWWA 1DE7H 3ZZ7A 1EB1H 1UTMA 2FM2A 5GJ4B 1NFYA 1WAYB 2C8WB 4WXIA 5JBAS 1SGIB 5JBCS 1JRSA 1O3GA 1Y8TA 4H6SB 2AMQA 4YLUA 3EDXB 3C27B 1SL3A 4ABHA 3DD2H 2BDCA 1Y5BT 2BDIA 2SGPE 4I31A 1NC6A 3PLBA 5F8XA 1QR3E 3RLYH 3SV7A 3RXDA 1ZPCA 1GVKB 2PTCE 3U8TH 1RD3B 2AGIX 5AHGH 5DP7A 1WOFA 2XYAA 1XKAC 1SLXB 1RJXB 2BD2A 2ZTYA 1HJ8A 3QK1A 1A4WH 4Q2KA 1F5LA 3P70B 1XUIA 2FLRH 4NFEA 2OTVA 1GI4A 1O5FH 4OGYA 1PPFE 1W11U 2F9BH 4NZQA 5CHAC 3SU4A 1K1LA 1TBRH 1UTPA 1EZSC 2QXGA 1UK4A 5LH8A 5LPRA 1Y3UA 4ABEA 1GBTA 4M7GA 3Q3YA 2OBQA 4GVUA 3TK5A 5GIBA 2OP9A 4MPXA 3RXIA 2FOGA 2XC5A 3VB5A 3VGCC 5FX5A 3QX5H 1P2NA 3GCHC 3MNBA 2H9EH 1IHTH 1V2JT 3U1JB 2DUCA 1XMNB 1NM6A 1C5NH 4INKA 1HAOH 2NWNA 1EP5A 4CH2B 1ESAA 2D26C 3I78A 4JK6A 3RLWH 1QJ6B 3BIVH 2WPJS 2Q6FA 1AB9C 5FPSA 2ZGBH 4IMZA 3RU4E 3OTJE 3QUMP 1QRZA 2LNCA 1E37B 2ZFFH 2M5TA 2A31A 1EOJA 1YM0A 2BLVA 3QTOH 4FVBA 1BB0B 1Q3XA 2W7SA 3E6PH 3T2NA 2ZCLP 2ZFSA 1UCYH 1GI2A 1O2NA 5EPNA 2ZO3H 4TWYA 3HATH 5I25A 3LC5A 3VB7A 5C67A 4FUCA 1QBNA 3JZ1B 4B76A 2ZHDA 1HIAA 2ALVA 1GGDC 2OC1A 1ZRBA 1WTHD 1TOCB 2QIQA 3HK3B 3MH4A 3D49H 4OS2A 1YCPK 3Q3KA 2Z9JA 3MNCA 2IJOB 2W3KA 3UUZA 2QN5T 1IQKA 1TPSA 3GY4A 1CVWH 1K22H 3SHAH 3TK9A 1AB9B 1FNIA 1PPGE 1W2KH 4YO9A 3RXEA 5DPAA 1O2ZA 1OSSA 1E38B 3S9AA 2QA9E 2BZ6H 1BTZA 2ZTZA 1MH0A 4Y8ZA 2HALA 2VINA 1O2KA 3PMJA 2UUYA 1QB1A 1P2QA 1GHXH 1D3QB 1S0RA 3A86A 1O5AB 2PKSB 1K1JA 1P2IA 5I46H 5EQQA 3MU1A 1OYTH 1C5XB 4CBOA 1HAIH 2FX4A 2HNTC 2Z7FE 3ZV9A 4I8KA 3ZZAA 3SNAA 2ESTE 3TGKE 2A32A 2B0FA 3MYWA 2A5IA 2G51A 4NA9H 2H5DA 3FZDA 4TWWA 1P01A 1FDPA 2F9OA 1NPMA 3UNQA 4A92A 3CP7A 4AOQA 3MWIU 1ZHPA 2ZWLH 2O8MA 1NRRH 2V3OH 1EZUC 2FPZA 2R3YA 1C1MA 1ZTJA 2ZI2H 3F6UH 1P03A 3BF6H 1EX3A 3RMOH 4MG3A 2TRMA 1J15A 1T8MA 1LCYA 1SFIA 2FODA 4D8NA 4Y7BA 3UY9A 3KGPA 3GY7A 1P3CA 2ZFRH 2ZCKP 2A7HA 1P11E 2RCEA 5FPTA 1THSH 1EASA 2TGDA 4IC6A 4MPVA 3QGNB 5EOKA 2XWAA 3RXGA 4DURA 1T4VH 2P93A 1TMTH 1G3BA 1D4PB 1AIXH 5EU8A 1RIWB 1KXFA 4ZAEA 1BQYA 1XVOA 1O33A 3QZRA 1ELFA 2FOMB 1OXGA 3SU6A 4ZKNU 1TE0A 2FI5E 2QF3A 2HVXA 1SOTA 1MQ6A 2Z3CA 2VGCC 3ESTA 2OC7A 4K69A 3ZVCA 1UTJA 1ZMJA 2B7DH 1O3JA 3M7UA 5AVDA 3HGNA 1LHCH 1SR5C 3UWJH 1OWIA 4CRCA 4X0WU 7LPRA 1BOQA 3M37A 2TBSA 1EJNA 3ATMA 2ZQ1A 4B1TA 4BTIB 1EAWA 1MMJN 3T26A 1CE5A 1O5BB 1ETRH 1A0JA 5E2OA 4A5TS 4BAQB 2GT7A 1GHVH 2D1JA 4CRFA 2Y7XA 5J4QA 1H9HE 2Y82A 1P06A 2WPIS 1MCTA 2ZFPH 4B75A 1P10A 5EXLA 1HAGE 2OLGA 2O8LA 4BAHB 3SOSA 1GBBA 2FTLE 3RXPA 1MTWA 2Y7ZA 3SU0A 3U69H 5EW2H 1MD8A 4RKOB 1HIAB 2ZDNA 2G81E 2PHBA 1QA0A 1UVSH 2BY7X 3GY3A 3N7OA 3DHKH 3P8GA 1JIMA 2ZIQH 3B23B 1TPPA 1O34A 3G01A 3KEEA 1XUFA 2VIOA 2I6SA 4GCHF 1INCA 1QJ1B 4K8YA 4X1SU 1EJMA 2J34A 1NFUA 1MZDA 3TJNA 3F9HA 1AGJA 3ZVAA 4HTCH 2JH6D 3T29A 5C1UA 1H4WA 1C2LA 4ISIH 1NRSH 2EI8A 3UQOA 2KAIB 2G52A 1IQFA 3NZIA 4Q80A 1VCPA 2DE8A 2ZDKA 3SI4H 1SPJA 4WJG2 2VVVA 1KSNA 2FOAA 3S7KB 3MI4A 1BMLA 3MU4A 1UTLM 3MOCA 3HKJB 5ESTE 5E0JA 3U8RH 2OUAA 3LJOA 4I33A 1Z8JB 1EZXC 2SNVA 1V2WT 3UIRA 1SLWB 4XSKU 1RTKA 4Y76A 1OPHB 3PMHB 2F91A 3KQEA 5DP6A 1O3LA 3NCLA 2GDDA 1SQAA 2BXTH 2GX4A 3GCTF 2CN0H 1XUGA 1N1LA 3RXJA 4HGCA 1A7SA 2BZAA 3S9BA 5JB8S 3SU2A 3ZZCA 1K28D 1S81A 3T5FH 1SGQE 5L2YH 5BRRE 1SBWA 1GJ4H 4Y0YE 2A2XH 4KP0A 2CHAC 4XE4A 2XXLA 2VNTA 2ZGHA 2ZU2A 2P8OB 4UFEH 1F7ZA 3M36A 3STJA 1GHWH 2BD7A 3BTGE 1FY1A 5JBTA 4IS5A 2CF9H 1PQAA 1ZPZA 5AFZH 1MTNC 2ZP0H 2WINI 1DXPA 1XUKA 1D3DB