1C1OA

Recruiting zinc to mediate potent, specific inhibition of serine proteases
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords TRYPSIN
publication title Design of potent selective zinc-mediated serine protease inhibitors.
pubmed doi rcsb
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c1oA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c1oA02
3UWJH 1B5GH 1NESE 3UREA 1O33A 2C8XB 2WPKS 4AFZA 5GDSH 1S0QA 4DW2U 1V6DA 1GMHG 3ATLA 2GVFA 2GZ8A 1GJBB 1QGFA 3KF2A 3W94A 5FPYA 3PWBA 2Y80A 1O3EA 1ETTH 2NU4E 1TE0A 2W7SA 3H7OA 4AX9H 2VVVA 4GCHF 1FAXA 2BXUH 3Q3XA 4I7YH 4DOQA 1QBVH 3M7UA 2W3IA 3BTEE 2PGQB 1DXWA 4JMYA 1NM6A 1TMUH 3A80A 2FOMB 2XYAA 4I33A 3LGTA 3M7QA 4FUCA 1V2PT 3B8JA 5JB8S 3R0FA 1GHAF 4K5ZA 3RXQA 1Y3UA 1WUNH 4K2YA 1LQDB 1XKAC 2BY8X 2UUKB 3P70B 2PGBB 3ZVDA 5C1YA 1DWEH 3E90B 1O3GA 4GPGA 1BRUP 5GCHG 3BTTE 1FNIA 1SHHB 3A89A 2BZAA 4X1QU 1NRQH 1EAUA 3B23B 1OWHA 1GPZA 4FUIA 3U69H 1KXDA 4X6OA 1L2EA 1SHYA 3D23A 3KQCA 1O2LA 3ENSB 3UR9A 1T8MA 2WPIS 3EA8A 3TLOA 3K6ZA 1DICA 1PPHE 3GDUA 1ZJDA 4AFUA 2STAE 1OYQA 2UWLA 1KY9A 3LGWA 1KSNA 1AVXA 5BPEA 2BB4A 2ZU3A 1Z6JH 1EB2A 1EPTB 2BVXH 5A8XA 2B8OH 2OC7A 4IBLH 4WWYA 1ID5H 1W13U 1YPKH 2PSYA 1BBRK 1K21H 1ZLRA 2BX4A 4ZHAA 1C2EA 2CMYA 4OS4A 4PROA 3UNQA 1Q2WA 1ABJH 3RMNH 2F91A 1LPGB 1HIAA 1LHEH 1Y8TA 5LH8A 1C2KA 1SLUB 3S0NA 2FS9A 1ZR0A 1KTTB 3OU0A 1N1LA 2FZZA 2FX6A 3M7TA 3GYLB 3WY8A 2ZU2A 4XE4A 5DP6A 3K9XB 5EPYA 1H9IE 4CH2B 2J95A 4CRCA 3JZ2B 3R3GB 1BHXB 5C1UA 2A31A 4D8NA 4Y0YE 1CU1A 1TA2A 4RN6A 1FY5A 4Q80A 2BLOA 5AF9H 1MMJN 2BD9A 2ANWA 3SNDA 2BY7X 3BN9A 3LC3A 1C5NH 1CGHA 2QY0B 1JRSA 4K1EA 1BRAA 2STBE 3SW2B 1GBLA 2AERH 4GSOA 2J2UA 4X1SU 1ZTKA 2FI4E 1RIWB 3SORA 1LHDH 1BTYA 2FOHA 4JK6A 3TK6A 2ASUB 3ZVCA 5FBIA 2ZEBA 3EGKH 1AMHA 1Y3YA 1XUHA 1P2NA 1O3PB 1FAKH 2ZU5A 3A87A 5DP8A 3UFAA 4AN7A 2VIPA 3A8AA 1P2MA 5L6NH 3FANA 4JCNA 2GP9B 2FEQH 3K2UA 2Y5GA 2F9UA 1HPGA 1K2I1 1Y5AT 1HAIH 1S5SA 2ZDNA 1J15A 1GHWH 2PW8H 1IHSH 1NZQH 1PQ8A 2D2DA 4U2WA 2ZZUH 1K22H 1KTSB 1G32B 1UHBB 2A5IA 4UFGH 3HK6B 1BTZA 1CHGA 1GWAA 2XBVA 1C2FA 2ZDKA 1SLXB 1QJ1B 2A5KA 1M9UA 3BTKE 3UPEA 2WINI 2G5NA 2EI6A 3BEFB 1MZDA 3UQVA 3P8FA 1PYTC 8GCHG 1P10A 5A0BA 1XUKA 1Y5UT 2QC2A 1QL8A 1FN8A 1QR3E 3SGQE 5A09A 1E34B 2FWWA 1TQ7B 2IJOB 1YPGH 1SQTA 2DE8A 3MH7A 1AVWA 1G3CA 3RXGA 5TCCA 2HALA 4KP0A 1CSOE 4DCDA 3ATIA 2RG3A 2ZGBH 2ZTZA 3ZV8A 1GDNA 1DPOA 2BHGA 1AFQC 1G2MA 2ANKH 5FBEA 3SU2A 4XBBA 4TY6A 3T2NA 2VIDA 4NWKA 1HBTH 3SU0A 4YLQH 1TRMA 2FM2A 1T31A 3LT3A 5AFZH 4ABBA 3Q76A 3UUZA 1C1QA 2ZFSA 3HKIB 5EXMA 1LKAA 2VVCA 4B2BA 1LHFH 3L6PA 2BVSH 1THRH 2EEKA 4X1PU 2Z94A 4MLFB 2H1UA 4YTAA 1SMFE 1C1VH 1BBRH 3ZVFA 4Y8XA 1ELGA 3ITIA 3SNAA 4XBDA 5H4IB 1QRXA 4LXBH 1HAHH 1GJCB 2A7HA 3RXLA 1DITH 3VXFH 2FOBA 4FVDA 1QURH 1MCTA 3A8DA 5E0JA 1MD7A 5DGJA 5BRRE 1BRBE 1W12U 1SFQB 2K1QA 3LU9B 5GJ4B 4X2XA 3VB4A 1S83A 3ZZ6A 1QJ7B 1A0JA 2HPQH 3QWCH 1EZSC 3AAUA 3RMOH 4D7FA 2H5DA 4YM9A 1FY8E 2ZQ2A 1O3CA 4CR5A 3RM0H 3S7HB 1BHXF 1ANBA 2H2ZA 3TJUA 1C5ZB 1TGNA 1GBJA 1YP9A 2GGVB 2O8TA 4NZQA 4BTTB 3RXMA 1W10U 2GT7A 2GX4A 4JZEH 1GMCF 1SGFG 2ZFTA 2F9NA 4F4OC 2ZPRA 1FI8A 3UNRA 1UK2A 1QJ6B 3GCTF 3QDZB 2ZCHP 3RDZA 1DY8A 1HDTH 3SV8A 4A7IB 3TK5A 3VPKA 2ZF0H 3RXIA 3KGPA 5FAHA 1TWXB 3RM2H 2XBYA 4WVPE 1ESTA 4INHA 1HNEE 2XW9A 3PMBB 3SV2H 4INLA 3SU6A 1A0LA 2XC0A 1VR1H 4B1TA 4NWLA 1EQ9A 3ZVAA 2TGDA 5K0HA 5HYOA 4ZXXH 1IQIA 3BTGE 4IC6A 1QB1A 2KAIA 3LGIA 1C2GA 4AFSA 2Q6DA 1UCYK 3OX7U 1P03A 2WYJA 3M5NA 4X0WU 3BEUA 1B0EA 3MNSA 1DLKB 4ZUHA 1BMNH 2WPJS 1SGTA 2BQ7B 2P3UB 1VCWA 3SO3A 5CHAC 2HNTE 1O3IA 1O5GH 3MTYA 3P17H 1AFQB 1RXPA 4I8GA 3BTWE 4F49A 1QTFA 1NY22 3ZZDA 1GMHF 2PLXA 2B0FA 1CHOG 2BDBA 2WPLS 1V2QT 1IQKA 3ATWA 3TU7H 1F0RA 4ASHA 1QB9A 4DT7B 1K28D 1AVGH 3HPTB 1NU9A 1P9SA 1YLDA 1W2KH 2Q6GA 1U6QA 3EA7A 1YPHE 1V2RT 1SVPA 1GBMA 1YF4A 1UTLM 2TBSA 3LONA 4O03A 3SHAH 3ZVGA 1V2VT 1PPGE 4D9RA 2J38A 1GBKA 1UMAH 2Y5HA 1E36B 4LZ1H 1LQEA 1T4VH 4IN1A 3HK3B 2H9TH 4SGBE 2GKVE 4TPIZ 1C4Y2 5L2ZH 3NPSA 2EI7A 1LMWB 4E7RG 3EE0B 5JBAS 1C4U2 1E35B 1HB0B 1SQAA 5GCHF 1UVPA 2PSXA 1GJ9B 5TCAA 4BAHB 3GYMA 1C5VA 3QO6A 3KL6A 1BIOA 4ISIH 4A92A 3I29A 3RU4D 3MFJA 3QUMP 1O0DH 2BQ6B 2RCEA 1O2MA 3E8LA 1TNJA 1O2GH 2C4FH 5A0AE 4AYYB 1IQFA 1O2VA 3UNSA 5DP5A 1ELFA 4RKJB 3T5FH 1TABE 3SQEE 1D3DB 1OKXA 2QCYA 1QRZA 1C9PA 3BSQA 1UTMA 1C1NA 2P3FH 3RP2A 1BRCE 5T3HA 1MD8A 4E7NA 1Z1IA 1BBRE 1HUTH 1B7XB 2QXGA 5DP9A 1SGCA 2PKAA 4WY3A 1F0SA 2BYAX 2WUBA 3T27A 1OP8A 3P92A 1GG6C 3E1XB 1RTLA 3DFLA 3A8BA 2EC9H 3FFGA 3TK9A 1UK3A 1K1OA 5DK1A 2GCTC 1SI5H 3K6YA 5T6FA 5EXLA 1D3TB 1THSH 1P11E 2GD4B 2VU8E 2Z9LA 1DSTA 5CMXH 5C3NA 1V2NT 5PTPA 1GI2A 1N8OC 1WSSH 5CHAB 3BEIB 1Y5BT 1ZMNA 1O2UA 5DP3A 3PYHA 1XMNB 3PROA 1ESAA 1GCTC 1TMBH 2QF3A 2WV5A 3SNEA 1JXPA 3ZYDA 4NZLA 1DOJA 2BY9X 2BDYA 5EXNA 1LVOA 1V2JT 1UK4A 3BTDE 4I8HA 1P09A 1V2TT 1O5AB 3MNXA 1YC0A 2SNWA 4AORA 1ESBA 1KXBA 1SGFA 1WYKA 1FV9A 4BAQB 2C93B 1NU7B 3SN8A 1UCYH 1GVKB 2PHBA 1ARCA 1WTHD 1QRWA 2F3CE 1HAZB 4H6SB 4J2YB 2XWAA 1EAXA 1SGNE 4XDEA 3G01A 1RTFB 3GY3A 2GTBA 1C2HA 1VITH 1TNKA 2I6QA 3T25A 4Q7ZA 1EJNA 1KDQB 1TNIA 1V2UT 1P9UA 1L0ZA 1NFXA 4U30A 2HNTC 2FTLE 1V2ST 1AFEH 1UJ1A 4ZH8A 2G5VA 4I8LA 1G3EA 3MO3A 1SFIA 4WXVA 5EW1H 1ZPZA 2ULLA 3F9EA 4B2AA 3PMAB 4X1RU 1AY6H 4Y7BA 1D3PB 4JYUH 1CVWH 1PJPA 2XBWA 3SNBA 2R2WU 8GCHF 1N6YA 2VINA 2Q6FA 5AFYH 3UOUA 3ELAH 3ZYEA 3QZQA 2QGRA 1YPJH 1C5WB 4I31A 1YPHC 3U8RH 2TGPZ 1XX9A 1DUAA 3UIRA 1C5MD 3SNCA 1ZYOA 2ZC9H 4FU7A 1NFYA 1FQ3A 1VCPA 1AHTH 2G8TA 1ZSKA 2O8MA 3F1SB 2BDIA 3PO1C 1FONA 1Z8GA 2Z9JA 4UE7H 3ODFA 2AGIX 1SG8B 1BTHH 1ELCA 2CHAC 5C67A 2RA3A 5EQRA 3LKWA 2B7DH 5F03A 2W5EA 4AZ2B 1MTNC 3IWMA 3M5MA 2SGPE 3PWCA 2ZDAH 1FN6A 1INCA 1NS3A 2A4QA 2ZHDA 3BTME 4FUDA 4XSKU 3C27B 1TGTA 3UTUH 4TYDA 2VWNA 2ZA5A 3LDXH 3ATMA 3CS0A 2A1DB 1BOQA 1EOJA 5I46H 3NKKA 4ISOA 4ZKNU 1O38A 3KQDA 4Y8ZA 1W14U 3KIDU 2TIOA 4R8TB 2A32A 2G51A 4H4FA 1CO7E 3TJOA 3SV6A 3KNXA 2ZQ1A 2Z9GA 2PKSB 1O2QA 3Q77A 1A3BH 4MPWA 2XC4A 5JBBS 3P8NA 3FP6E 1YPMH 1ZGVA 3RXFA 2J4IA 3E91A 4KKDA 4BAKB 5ETXA 2ESTE 2NWNA 2ZO3H 1TYNA 1RTKA 4HFPB 5GWZA 1FPHH 2A5AA 3AASA 1SGEE 3H7TA 4CREA 1HV7A 3F9HA 2AFQB 1OWIA 4ABFA 1O30A 5GXPA 1A3EH 1C2JA 4BANB 4UD9H 1DXPA 2NU1E 1GBDA 2VIWA 1BMLA 3ZVBA 1QQ4A 1HXFH 1KYNA 2LNCA 4FUFA 2SGEE 3MO6A 5FPTA 1C5SA 1HAYB 3GCOA 4Y6DA 3ZZCA 1RD3B 1GBEA 1ARBA 1QA0A 2CV3A 2FLRH 1T7CA 1TX8A 1ELVA 1DSUA 3MOCA 2AH4X 4OS7A 3AW0A 4YOGA 5F8ZA 3VEQB 1RJXB 3SU3A 1E0FD 1QCPA 1UO6A 1XM1A 2HOBA 1UTJA 2GDEH 1EZQA 1H8DH 1LDTT 4NFFA 1EPTA 2PUXB 4GHTA 3SJOA 2C8ZB 2B5TB 2OQUA 2NU0E 1EJMA 1UCYE 1C5PA 1RRKA 2FI3E 2UWOA 3T26A 1ZRKA 4AFQA 1OWJA 4U32A 5J4QA 1TRYA 1ELBA 3GY8A 1ETRH 3PLPA 2CHAB 1D9IA 2Y6TA 3LGYA 3S9AA 2I6SA 1MTNB 4HGCA 1CHOF 1F0UA 1GJ5H 2ANYA 3LOXA 5CE1A 1YPLH 4BAOB 2FPZA 3M3VA 2Z3DA 1P0SH 2C3SA 1GHXH 4CRAA 4CRFA 2JH6D 4IGDA 4A6LA 2V35A 4ISNA 4X2WA 1ZHRA 1HAVB 1MBMA 1YLCA 5C1XA 3FZZA 2O8UA 5G4BA 3SU4A 3PMJA 4YZUA 3BF6H 1FZZA 1P3EA 2ALPA 1GI5A 2ZGCA 4MTBA 3TGJE 2C8WB 1NRNH 4DGJA 3U8OH 1ACBE 1TGSZ 3DT0H 1C1SA 4A1XA 3A83A 2P95A 4IC5A 5DP7A 3Q3KA 3RMLH 4BTIB 1L4DA 2FYQA 1TBRH 2Y5FA 1O39A 1WQVH 2IPHA 3Q3YA 1ANCA 1TX6A 1EP6A 1A5GH 2ZECA 1BCUH 1BJVA 5SGAE 5A8ZA 3VFEA 2RDLA 2HGTH 1CT4E 1MQ5A 3LJOA 4AGKA 4CHAC 2ILNA 4CBNA 2Z3CA 1QA7A 1FDPA 4NIYA 1HJ9A 1V2KT 2ZDVH 5EPNA 3SUGA 3S69A 1GHVH 1G36A 1F5LA 3MU0A 4Y7AA 5T6GA 7ESTE 4CH8B 3URCA 4ZAEA 3LH3A 1EZUC 2ODQA 5DO4H 3SJIA 2AMQA 4XOJA 2A2XH 1LO6A 1C1MA 1UHBA 1WCZA 1GDQA 1P3CA 4KGAA 4MVNA 1GDUA 1QY6A 2C8YB 2NU3E 2ZTXA 3GCHC 1C5UA 1SBWA 1J8AA 1OSSA 2ZU1A 5HGGA 1TBZH 2CF9H 3KCGH 2YNAA 3UQOA 1TPPA 7KMEH 2A7CA 3A86A 2TGAA 2NU2E 4B74A 3TH3H 2CJIA 3U98H 1O3AA 1SGIB 1Z8IB 2V0BA 3RXJA 2H9HA 1J17T 1C4V2 3TH4H 3A7ZA 1B0FA 1TLDA 1W11U 3E0PB 3VB7A 3GOVB 4FUJA 1AB9C 3GICB 1KLJH 3AAVA 2GT8A 4Z0KA 5A2MH 1AUJA 1TBQH 5IDKA 2FP7B 4ABJA 1FMGA 2ZGJA 7LPRA 1HJAC 4ABEA 3QN7A 2TGTA 3TPIZ 2ZU4A 5C2ZA 1WAYB 4JK5A 1K9OE 2GCHF 3BTQE 1K1IA 5GPIB 1TFXA 2GMTC 5J4SA 1CGIE 5DG6A 1TAWA 4TY7A 1LHCH 4HTCH 1AI8H 1CGJE 3L33A 2GDDA 2IN2A 2ZGXH 1TQ0B 4ISHH 1O32A 5IYTA 8KME2 3TNSA 1A5HA 5HMAA 2JETC 1SSXA 2OC0A 1A61H 4MNVA 1GI9B 3NZIA 1S6FA 2Y7ZA 4NIWA 1NFWA 2SNVA 6GCHF 2HRVA 1O5DH 3A85A 3RXTA 1D6RA 1JOUB 5EOKA 5E0GA 1KXAA 1AWHB 3O8CA 1EKBB 3SZNA 4CHAB 3K65B 5E8EH 1A2CH 1AN1E 2FO9A 1A46H 5HM9A 3E0NB 1AKSB 1F2SE 3UY9A 4YLUA 1H8IH 3U1IB 4YT6H 1HAGE 1RGQA 1P04A 6LPRA 3TJVA 1XUFA 4B71A 1O3BA 1DY9A 3A88A 3LIWA 1O2OA 3EYDA 3GCNA 2OINA 4O3UA 3ZVEA 2QN5T 3GCHB 3M5OA 5EGMA 1ELEE 2CGAA 4X8VH 3EDXB 1HFDA 4UFDH 4ZHMU 2HWLB 4UEHH 1GBTA 2A4OA 3RXHA 1EUFA 2FOCA 1MUEB 1H1BA 2ZTYA 1BMMH 1TGBA 3UOPA 5LPEA 1KXCA 1EZXC 1V2LT 2ZDLA 1WOFA 1E37B 1ELAA 1ELTA 4FXGH 1OWDA 2YNBA 1O3NA 3GY5A 4ABDA 1SOTA 2C90B 1P05A 3S9BA 3SU5A 3PTBA 3T62A 1AB9B 3QK1A 2G00A 3SQHE 1JIRA 1CA8B 1GBBA 1TGCA 3NUMA 3KQEA 3NWUA 1TOCB 2BDGA 1GJ7B 1K1JA 4MG3A 3A81A 2J92A 2FI5E 3PLBA 1CT0E 2LPRA 2Y7XA 3BG4C 3I77A 1HJAB 4XBCA 2FYRA 2ZFPH 2ZGHA 2PV9B 6CHAC 1BTWA 2VNTA 4WMFA 1TNHA 3VB3A 2O8WA 1T8LA 2P3TB 4Q7YA 3LJJA 5JPMH 1RFNA 1HAOH 2AEIH 2ZPQA 4GHQA 3RUOA 4JZIA 1W3CA 1C2DA 4HZHA 5K7RA 1CA0C 1VJ9U 4JYVH 3RXVA 2FOFA 1IQNA 2XRCA 2F9BH 4JZDH 2BXTH 1FUJA 2OCVB 2ZFFH 1GHBG 5FHTA 3DD2H 2BDHA 2JETB 4QT8C 3QZRA 1GBHA 5C5NA 1O5BB 1J14A 1NT1A 1EB1H 3VB5A 2F9VA 3P95A 3C1KA 3SHCH 2AGEX 6ESTA 5F8TA 2F83A 2BD2A 1IQLA 1N6XA 3GISB 4I8JA 5I25A 4ESTE 1AU8A 3SUDA 1NRPH 2W3KA 3V7TA 1DM4B 1TALA 1Y3WA 3L3TA 2O8LA 5L2YH 4UONA 3TGIE 3SI3H 1C5OH 2Z9IA 4H42U 1BA8B 3UWIA 4BNRA 1IQGA 3P6ZB 1Q31A 1AQ7A 4MNYA 4OS6A 3A8CA 5C20A 7GCHG 2PKAB 2VGCC 1MU8B 2QV1A 1L1GA 1O35A 1A1RA 4D76A 4ABGA 4Y8YA 4AB8A 1HYLA 3VGCC 2H6MA 4K8BA 4X2VA 4A1VA 3DUXH 3GDSA 1C1PA 2OD3B 4J1YA 1UVTH 4YO9A 2XC5A 3ZZBA 1P57B 2V3OH 1VZQH 1O3HA 3N7OA 4BOHA 3SUEA 3M61U 5FCKA 1QQUA 2BQWB 1GI7B 1UTQA 2JH0D 3BTHE 1THPB 2BDAA 4Y11E 1Z8RA 3EA9A 5E2PA 5L30H 1C5QA 1MTSA 1OWEA 3TITA 3F6UH 2GCHG 1C5RA 5EQQA 1QNJA 4ZROA 1OXGA 2J94A 1EOLA 4U01A 4I32A 1BITA 3I78A 1GJAB 3BG4B 4I8KA 5FCRA 1EX3A 1SPJA 1JBUH 2QYIA 4OS5A 3ZZ8A 1S82A 3F9GA 1W7XH 2W7UA 2IOTA 6CHAB 1MZAA 1LKBA 1Z71A 2ODYB 2J34A 4NFEA 3TJNA 2BX3A 2Z9KA 2XNIA 2ZG0H 4NCYA 1S81A 4M7GA 1MU6B 1TRNA 4D7GA 3ATKA 1QBOA 4GUXA 1CA0B 3O8DA 1DDJA 3A7TA 4MNWA 6GCHG 1HAXB 1G30B 1XUJA 1ZMLA 1KDQA 1PPBH 2XXLA 1ZHPA 4MPUA 3PTNA 1SGDE 2OP9A 1BUIA 1PYTD 5DJ7A 4X6NA 1QBNA 1GI3A 1PQ5A 2WPMS 5JBTA 3VB6A 3A7VA 1BB0B 1LVMA 5EODA 1GGDC 1MAYA 3ZZ9A 1ZSLA 2DE9A 1LPZB 1QL9A 4AG2A 1EAIA 3OSYA 3SI4H 1C1RA 2ZFRH 1KLTA 1VJAU 2GZ9A 4E05H 3RXAA 1Z1JA 1UTKA 1O2ZA 4CBOA 1OX1A 2BZ6H 4NG9H 1EP5A 2ZDMA 2VWMA 2PUQH 1GBFA 1Z8JB 1ANDA 2GV7A 4Y71A 4B76A 1XXFA 2ANMH 1GG6B 2BLQA 1W0ZU 3TGKE 3DFJA 1PPFE 1IQMA 1Z6EA 2GCTB 5A8YA 1GI4A 4B75A 3ZZAA 1TNLA 1ZZZA 2FS8A 3V13A 3FZDA 1HCGA 2FOEA 3VGCB 1OWKA 3URDA 2GV6A 5LGOA 1N8OB 4X8TH 3IG6B 1F0TA 5ABWA 1NROH 2SGDE 2OUAA 3U1JB 1PPEE 4KTUA 1GCTB 1G37A 3NK8A 3OYPA 1K1NA 1D3QB 3LC5A 5F8XA 2P59A 2M5TA 1A7SA 4NIXA 3RC4A 1GJDB 1HLTH 1UTPA 3KHVA 2Y81A 4MQAA 4O97A 1DFPA 1RIWC 1ABIH 2PR3A 3ZV9A 2JKHA 2H5CA 1PFXC 2AS9A 2BLWA 1BJUA 1T8OA 1ZTLA 3T29A 5A0CA 2UUFB 1GHYH 1KIGH 4ZMAH 1XUIA 1ELDE 3PLKA 4KTSA 5FXLA 1V2WT 1XVMA 4NIVA 2ZI2H 1O3LA 3OY6U 2F9PA 9ESTA 5DPAA 4A1TA 2BY5X 3MNBA 4OGXA 3GY4A 2CN0H 1BDAA 3NXPA 3O8BA 2F9OA 2ZFQH 1GI1A 3RLWH 1EATA 3W95A 3STIA 4X2YA 4ZHLU 3CS7A 3PM3A 1O3JA 1IQJA 4DG4A 3MH4A 1T8NA 4NGAH 2G55A 4FVBA 5EU8A 1F5RA 2R0LA 1OOKB 2O9QA 4DJZB 3CENA 4IMZA 4MDSA 1CT2E 3TIUA 1L4ZA 3QGJA 4LOYH 3RMMH 4UFEH 3A82A 1ZPBA 1NC6A 2ZP0H 5AHGH 1SOZA 1GGDB 5F6MA 1DE7H 2G81E 1UVUH 2ZHEH 3A84A 3HGNA 1EJAA 1K1LA 3SJKA 1P8VC 5HM2A 3PB1E 3A7WA 2ALVA 1GL1A 2BDCA 3MU8A 3SUFA 3LGUA 4BAMB 1HIAB 3PO1B 3U8TH 2OQ5A 1XXDA 2VVUA 2Z3EA 3QTOH 4NSYA 1P2OA 3SGBE 2BD8A 3RXDA 2FDAA 3F9FA 1AIXH 3M3TA 2BOHB 1BMAA 1C2IA 1W0YH 1DWCH 3DHKH 2D26C 2VWLA 4DIHH 1MKWK 4X8UH 1TX7A 3FVFB 3GY6A 3QGNB 4KELA 2OC1A 1UTNA 3LH1A 3SBKA 2OTVA 4R0IA 4ZKOU 3SJ8A 4AOQA 3M36A 1P2IA 4RSPA 4BTUB 2AMDA 1O2XA 1QL7A 2VJ1A 1O3OA 1HAVA 2Q1JA 1KLIH 2PWXA 3BG8A 3ZZ4A 3U9AH 4FUGA 2ODPA 5C5OA 1DANH 1GBIA 2SGQE 2A7JA 4NSVA 3MU4A 3SGAE 4TWYA 1XVOA 2BOKA 1ZSJA 1FIWA 3DA9B 1S85A 2YOLA 1O2HA 2SFAA 1DS2E 1GHBF 2ZNKH 1C9TA 2H9EH 2HLCA 1YKTA 1Q3XA 1IAUA 3M35A 4NA9H 1YCPM 1HRTH 1MTUA 1HAPH 3RXCA 1WTGH 2XCNA 2FX4A 2UWPA 2A45B 3IITA 2P93A 1GI0A 3RXOA 4CRDA 1AE8H 3A7YA 1OPHB 4TPYA 2VIQA 5EQSA 2EA3A 2QAAA 2P94A 1H9HE 4GLYA 4DY7B 5JB9S 1JMOH 4DIIH 4D9QA 1C5LH 1P2KA 3PMHB 1MKXK 2FTMA 1AGJA 4IW4E 4WXIA 2TRMA 4OGYA 1YPEH 2ZCKP 3BIUH 4XFQA 1C1UH 1C2MA 1SR5C 1ZOMA 2ZPSA 3SJ9A 3P8GA 2W26A 1NRSH 1E38B 2A0QB 1GJ8B 3Q00A 2OBOA 1XKBC 1O3DA 2QF0A 7GCHF 5ESBA 4AYVB 1TOMH 1GMDG 1A5IA 3P8OA 1BT7A 3RXPA 3M3SA 5LPFA 3E16B 2FODA 3E6PH 3MI4A 2GZ7A 3TH2H 5B6OA 3SU1A 1LVBA 1O2SA 1GBCA 1HJ8A 1O3MA 1PPZA 1UTOA 4K3JA 1K1MA 4WJG2 4WH8A 3RXKA 2HNTF 3S9CA 3O8RA 3D62A 1D6WA 1H9LB 1QHRB 1VITG 4H6TA 2Z7FE 5GIBA 5FX6A 3JZ1B 1P02A 4AGJA 1D4PB 1SLVB 4O9VA 4WMEA 3UR6A 1EAWA 3V0XA 3EQ0H 4BXSA 4Y0ZE 3V12A 4UDWH 1O37A 3OY5U 4K8YA 2BD5A 3KEEA 2VWOA 1ZJKA 1GI8B 1QFKH 2BTCE 3MU5A 1C5XB 4YOJA 1C5TA 1FY1A 4MNXA 4GCHG 1MCVA 1IQHA 2ZKSA 4LK4A 3STJA 1BTUA 2CF8H 1VGCC 4AG1A 4IN2A 1TPSA 4Z6AH 4Y76A 1AUTC 3VXEH 2VIVA 3MHWU 2FESH 1Y59T 1MKWH 3FP8E 5T6DA 1G2LA 1GBAA 2UUYA 1MTVA 1CBWC 1GHAG 1ZTJA 1O2YA 1V2OT 5HXFA 1ANEA 1F7ZA 3QLPH 2ZHQH 3AW1A 1ORFA 2THFB 2BY6X 1SQOA 5TJXA 4ABHA 1TPAE 2AIQA 2R0KA 3E3TA 1VCQA 3ESTA 4VGCC 1PQAA 1DVAH 1O2RA 1AKSA 1BTPA 3SV9A 1V2MT 2UUJB 1SGPE 2DUCA 3A7XA 1YBWA 1CQQA 3T28A 3TNTA 1DUEA 3NCLA 1GHZA 1IOEA 1IQEA 2KAIB 2QIQA 4GAWA 3TVJB 3MWIU 4YT7H 4RKOB 4KTCA 2BD4A 4OS2A 1ZGIA 3RXBA 1EASA 1O2PA 1P12E 4DVAU 4THNH 1O2JA 1O2IA 1TMTH 4B2CA 1MAXA 2A2QH 2FOAA 4MPVA 1FY4A 1G3DA 2VH6A 1QB6A 1K1PA 1SC8U 1YM0A 4JYTA 1IHTH 1MKXH 3PV4A 1H4WA 1GI6A 1W8BH 1O2KA 2QA9E 1BQYA 5EG4A 1TONA 4ABAA 3ZZ3A 4K69A 2AYWA 1C2LA 3FP7E 1O2WA 1P2JA 4X1NU 4ABIA 4ZKSU 3KN2A 4JZFH 3B9FH 4WH6A 4UFFH 4INKA 1C1TA 2P8OC 3CP7A 1BZXE 3QTVH 5LPRA 3D49H 3FAOA 1YGCH 4NA7A 2GMTB 1CE5A 1SGRE 2QXIA 2R9PA 4DURA 1AZZA 2XCFA 1DX5M 1TIOA 1G9IE 1YCPK 2BD7A 2XBXA 2R2MB 1FIZA 2VH0A 4SGAE 3RC6A 1KXFA 1TNGA 3RXRA 1C5YB 2FLBH 1AWFH 1O36A 1VGCB 3BIVH 2BLVA 1DWDH 2PFEA 4WMDA 4ZXYH 1UVSH 1O2TA 1ZMJA 4FUHA 1DLEA 2BM2A 1O5CB 1FLEE 3RXSA 1O3FA 3LGVA 3ZZ5A 1FY3A 1YYY1 2AGGX 1CBWB 3MO9A 5JBCS 5FPSA 3H5CB 2G52A 1TB6H 4GVUA 2ZCLP 5E2OA 4WF8A 1S6HA 1Y3VA 4E06H 5FX5A 2V3HH 3MH6A 3ZZ7A 1SL3A 1NTPA 4AB9A 4LZ4B 1WV7H 1DT2A 1ZRBA 5JDUB 1JWTA 1A4WH 1NFUA 4Q7XA 3RLYH 1PPCE 4VGCB 5ESTE 2PTNA 1MQ6A 1GVLA 3M37A 1GVZA 1C1OA 2SGFE 3RXEA 4ISLA 4Q2KA 1P06A 2J9NA 1RS0A 1T32A 2A4RA 2R3UA 1MBQA 3EAJA 1Z7KA 2A4GA 2SGAA 3F68H 4FU8A 4YOIA 4JZ1A 1LPKB 2OLGA 3V3MA 4ZKRU 1AE5A 2RA0A 1T4UH 5JYIA 2OXSA 1EXFA 1NO9H 2FIRH 2G4TA 4X8SH 1AD8H 1WBGB 2FXRA 2WUCA 1KXEA 1O31A 1FJSA 1BTXA 3HGPA 2JH5D 1GJ4H 1P2QA 1JRTA 1LCYA 2OBQA 8ESTE 2HPPH 3RU4E 4K60A 1L1NA 1F5KU 2V6NA 5EW2H 1AZ8A 5E0HA 3MMGA 2PKSC 1S0RA 1J16A 4O3TA 2XTTB 1XUGA 1GJ6A 2Y82A 3QX5H 3AVZA 2BVRH 1O34A 4IMQA 1OYTH 3KQBA 3MYWA 2P8OB 4BXWA 2FOGA 1L1JA 1C1WH 1OP2A 2FMJA 1GL0E 1WQSA 2HVXA 2ZHFH 1O5FH 1O5EH 3HATH 2BMGB 1F92A 1NRRH 1Y3XA 3D65E 1G3BA 5DKMA 1JIMA 4X6PA 4OS1A 1V3XA 3GY7A 1FPCH 1LHGH 1LVYA 4IS5A 1LTOA 3BTFE 3GY2A 3MH5A 1HXEH 3ODDA 2XWBI 1ZPCA 1SB1H 2WV4A 1ETSH 1NPMA 8LPRA 2ZWLH 3OTJE 3RXUA 2R3YA 2TPIZ 1OS8A 2VB0A 4CRGA 1MH0A 4K1SA 3M5LA 3MNCA 1TA6A 1GMCG 4TWWA 1WU1A 2CXVA 4Y79A 1EPTC 3GCTG 1TPOA 5AVDA 1AO5A 9LPRA 1QIXB 2ZHWH 2D1JA 1A0HB 1YCPH 2P16A 3GDVA 1S84A 3SOSA 1GMDF 4K1TA 4A5TS 3BV9B 2PTCE 4FU9A 4HI3A 1GCDA 3RU4T 3S7KB 4CR9A 2WYGA 1OP0A 4FUBA 1SLWB 4B73A 2ZIQH 1SGQE 1PQ7A 4Y10E 1SGYE 2WPHS 3SV7A 1NN6A 1X7AC 2VIOA 1DWBH 1HGTH 2AIPA 2VGCB 1O3KA 1W7GH 2D8WA 4X6MA 1P01A 3LPRA 1O2NA 1FXYA 1UVOA 1VITF 3RC5A 1ZHMA 2G4UA 2Z6BD 4FUEA 1MTWA 4NA8A 2AMPA 2B9LA 5DP4A 2QXHA 2OC8A 1J9CH 2BD3A 4MPXA 4YESB 4CRBA 2EI8A 2QXJA 3HKJB 3MU1A
chains in the Genus database with same CATH superfamily
3UWJH 3F0OA 1B5GH 1NESE 3UREA 1O33A 2C8XB 2WPKS 4AFZA 5GDSH 1S0QA 4DW2U 1V6DA 1GMHG 3ATLA 2GVFA 2GZ8A 1GJBB 1QGFA 3KF2A 3W94A 5FPYA 3PWBA 2Y80A 1O3EA 1ETTH 2NU4E 1TE0A 2W7SA 3H7OA 4AX9H 2VVVA 4GCHF 1FAXA 2BXUH 3Q3XA 4I7YH 4DOQA 1QBVH 3M7UA 2W3IA 3BTEE 2PGQB 1DXWA 4JMYA 1NM6A 1TMUH 3A80A 2FOMB 2XYAA 4I33A 3LGTA 3M7QA 4FUCA 1V2PT 3B8JA 5JB8S 3R0FA 1GHAF 4K5ZA 3RXQA 2WHXA 1Y3UA 1WUNH 4K2YA 1LQDB 1XKAC 2BY8X 2UUKB 3P70B 2PGBB 3ZVDA 5C1YA 1DWEH 3E90B 1O3GA 4GPGA 1BRUP 5GCHG 3BTTE 1FNIA 1SHHB 3A89A 2BZAA 4X1QU 2KCYA 1NRQH 1EAUA 1YY3A 1OWHA 3B23B 1GPZA 4FUIA 3U69H 1KXDA 4X6OA 1L2EA 1SHYA 3D23A 3KQCA 1O2LA 3ENSB 3UR9A 1T8MA 2WPIS 3EA8A 3TLOA 4F48B 3K6ZA 5HIYA 1DICA 1PPHE 3GDUA 1ZJDA 4AFUA 2STAE 1OYQA 2UWLA 1KY9A 3LGWA 1KSNA 1AVXA 5BPEA 2BB4A 2ZU3A 1Z6JH 1EB2A 1EPTB 2BVXH 5A8XA 2B8OH 2OC7A 4IBLH 4WWYA 1ID5H 1W13U 1YPKH 2PSYA 1BBRK 1K21H 1ZLRA 2BX4A 4ZHAA 1C2EA 2CMYA 4OS4A 4PROA 3UNQA 1Q2WA 1ABJH 5DSFA 3RMNH 2F91A 1LPGB 1HIAA 1LHEH 1Y8TA 5LH8A 1C2KA 1SLUB 3S0NA 2FS9A 1ZR0A 1KTTB 3OU0A 1N1LA 2FZZA 2FX6A 3M7TA 3GYLB 3WY8A 2ZU2A 4XE4A 5DP6A 3K9XB 5EPYA 1H9IE 4CH2B 2J95A 4CRCA 2YMSB 3JZ2B 1EFRD 3R3GB 1BHXB 5C1UA 2A31A 4D8NA 4Y0YE 1CU1A 1TA2A 4RN6A 1FY5A 4Q80A 2BLOA 1UW7A 5AF9H 1MMJN 2BD9A 2ANWA 3SNDA 2BY7X 3BN9A 3LC3A 3W1EA 1C5NH 1CGHA 2QY0B 1JRSA 4K1EA 1BRAA 2STBE 3SW2B 1GBLA 2AERH 4GSOA 2J2UA 4X1SU 1ZTKA 2FI4E 1RIWB 3SORA 1LHDH 1BTYA 2FOHA 4JK6A 3TK6A 2ASUB 3ZVCA 5FBIA 2ZEBA 3EGKH 1AMHA 1Y3YA 1XUHA 1P2NA 1O3PB 1FAKH 2ZU5A 3OTPA 3A87A 5DP8A 3UFAA 4AN7A 2VIPA 3A8AA 1P2MA 5L6NH 3FANA 4JCNA 2KFWA 2GP9B 3NRLA 2FEQH 3K2UA 2Y5GA 2F9UA 1HPGA 1K2I1 1Y5AT 2VBCA 1HAIH 1S5SA 2ZDNA 1J15A 4HG6A 1GHWH 2PW8H 1IHSH 1NZQH 1PQ8A 2D2DA 4U2WA 2ZZUH 1K22H 1KTSB 1G32B 1UHBB 2A5IA 4UFGH 3HK6B 1BTZA 1CHGA 2XOKD 1GWAA 2XBVA 3PV2A 1C2FA 2ZDKA 1SLXB 1QJ1B 2A5KA 1M9UA 3BTKE 3UPEA 2WINI 2G5NA 2EI6A 3BEFB 1MZDA 3UQVA 3P8FA 1PYTC 8GCHG 1P10A 5A0BA 1XUKA 1Y5UT 2QC2A 1QL8A 1FN8A 1QR3E 3SGQE 5A09A 1E34B 2FWWA 1TQ7B 2KCOA 2IJOB 1YPGH 1SQTA 2DE8A 3MH7A 1AVWA 1G3CA 3RXGA 5TCCA 2HALA 2KX4A 4KP0A 1CSOE 4DCDA 3ATIA 2RG3A 2ZGBH 2ZTZA 3ZV8A 1GDNA 1DPOA 2BHGA 1AFQC 1G2MA 2ANKH 5DN6D 5FBEA 3SU2A 4XBBA 4TY6A 3T2NA 2VIDA 4NWKA 1HBTH 3SU0A 5KEDA 4YLQH 1TRMA 2FM2A 1T31A 3LT3A 5AFZH 4ABBA 3Q76A 3UUZA 1C1QA 2ZFSA 3HKIB 5EXMA 1LKAA 2VVCA 4B2BA 1LHFH 3L6PA 2BVSH 1THRH 2EEKA 4X1PU 2Z94A 4MLFB 2H1UA 4YTAA 1SMFE 1C1VH 1BBRH 3ZVFA 4Y8XA 1ELGA 3ITIA 3SNAA 4XBDA 5H4IB 1QRXA 2V7QD 4LXBH 5EJLA 1HAHH 1GJCB 2A7HA 3RXLA 1WXRA 1DITH 3VXFH 2FOBA 4FVDA 4ACBA 1QURH 1MCTA 3A8DA 5E0JA 1MD7A 5DGJA 5BRRE 1BRBE 1W12U 1SFQB 2K1QA 3LU9B 5GJ4B 4X2XA 3VB4A 1S83A 3ZZ6A 1QJ7B 1A0JA 2HPQH 3QWCH 1EZSC 3AAUA 3RMOH 4D7FA 2H5DA 4YM9A 1FY8E 2ZQ2A 1O3CA 4CR5A 3RM0H 3S7HB 1BHXF 1ANBA 2H2ZA 3TJUA 1C5ZB 1TGNA 1GBJA 4FETA 5HKKD 1YP9A 2GGVB 2O8TA 4NZQA 4BTTB 3RXMA 1W10U 2GT7A 2GX4A 4JZEH 1GMCF 1SGFG 2ZFTA 2F9NA 4F4OC 2ZPRA 1FI8A 3UNRA 1UK2A 1QJ6B 3GCTF 3QDZB 2ZCHP 3RDZA 1DY8A 1HDTH 3SV8A 4A7IB 3TK5A 3VPKA 2ZF0H 3RXIA 3KGPA 5FAHA 1TWXB 3RM2H 2XBYA 4WVPE 1ESTA 4INHA 1HNEE 2XW9A 3PMBB 3SV2H 4INLA 3SU6A 1A0LA 2XC0A 1VR1H 4AC9A 4B1TA 4NWLA 1EQ9A 3ZVAA 2TGDA 5K0HA 5HYOA 4ZXXH 1IQIA 3BTGE 4IC6A 2YMSD 1QB1A 2KAIA 3LGIA 1C2GA 4AFSA 2Q6DA 1UCYK 3OX7U 1P03A 2WYJA 1FX0B 3M5NA 4X0WU 3BEUA 1B0EA 3MNSA 1DLKB 4ZUHA 1BMNH 2WPJS 1SGTA 2BQ7B 2P3UB 1VCWA 3SO3A 5CHAC 2HNTE 1O3IA 1O5GH 3MTYA 3P17H 1AFQB 1RXPA 4I8GA 3BTWE 4F49A 1QTFA 1NY22 3ZZDA 1GMHF 2PLXA 2B0FA 1CHOG 2BDBA 2WPLS 1V2QT 1IQKA 3ATWA 3TU7H 1F0RA 4ASHA 1QB9A 4DT7B 1K28D 1AVGH 3HPTB 1NU9A 1P9SA 5EIYA 1YLDA 1W2KH 2Q6GA 1U6QA 3EA7A 2IPQX 1YPHE 3OAAD 1V2RT 1SVPA 1GBMA 1YF4A 1UTLM 2TBSA 3LONA 4O03A 3SHAH 2KCAA 3ZVGA 1V2VT 1PPGE 4D9RA 2J38A 1GBKA 1UMAH 2Y5HA 1E36B 4LZ1H 1LQEA 1T4VH 4IN1A 3HK3B 2H9TH 4SGBE 2GKVE 4TPIZ 1C4Y2 5L2ZH 3NPSA 2EI7A 1LMWB 4E7RG 3EE0B 5JBAS 1C4U2 1E35B 1HB0B 1SQAA 5GCHF 1UVPA 2PSXA 1GJ9B 5TCAA 4BAHB 5C0TA 3GYMA 1C5VA 3QO6A 3KL6A 1BIOA 4ISIH 4A92A 3OEED 3I29A 3RU4D 5GNDA 3MFJA 3QUMP 1O0DH 2BQ6B 2RCEA 1O2MA 3E8LA 1TNJA 1O2GH 2C4FH 5A0AE 1VKYA 4AYYB 1IQFA 1O2VA 3UNSA 5DP5A 1ELFA 4RKJB 3T5FH 1TABE 3SQEE 1D3DB 1OKXA 2QCYA 4Q4LA 1QRZA 1C9PA 3BSQA 1UTMA 1C1NA 1E1QD 2P3FH 3RP2A 1BRCE 5T3HA 1MD8A 4E7NA 1Z1IA 1BBRE 1HUTH 1B7XB 2QXGA 5DP9A 1SGCA 1SKYE 2PKAA 4WY3A 1F0SA 2BYAX 2WUBA 2W6ID 3T27A 1OP8A 3P92A 1GG6C 3E1XB 1RTLA 3DFLA 3ZIAD 3A8BA 2EC9H 3FFGA 3TK9A 4XRNA 1UK3A 1K1OA 5DK1A 2GCTC 1SI5H 3K6YA 5T6FA 5EXLA 1D3TB 1THSH 1P11E 2GD4B 2VU8E 2Z9LA 1DSTA 5CMXH 5C3NA 1V2NT 5PTPA 1GI2A 1N8OC 1WSSH 5CHAB 3BEIB 1Y5BT 1ZMNA 1O2UA 5DP3A 3PYHA 1XMNB 3PROA 1ESAA 1GCTC 1TMBH 2QF3A 2WV5A 3SNEA 1JXPA 3ZYDA 1NBMD 4NZLA 1DOJA 2BY9X 2BDYA 5EXNA 1LVOA 1V2JT 1UK4A 3BTDE 4I8HA 1P09A 1V2TT 1O5AB 3MNXA 2KCPA 1YC0A 2SNWA 4AORA 1ESBA 1KXBA 1SGFA 1WYKA 1FV9A 2AHME 2C93B 4BAQB 1NU7B 3SN8A 1UCYH 1GVKB 2PHBA 1ARCA 1WTHD 1QRWA 2F3CE 1HAZB 3KYFA 4H6SB 2XWAA 4J2YB 1EAXA 1SGNE 4XDEA 3G01A 2L6OA 1RTFB 3GY3A 2GTBA 1C2HA 1VITH 1TNKA 2J98B 2I6QA 3T25A 4Q7ZA 1EJNA 1KDQB 1TNIA 1V2UT 1P9UA 1L0ZA 1NFXA 4U30A 2HNTC 2FTLE 1V2ST 1AFEH 1UJ1A 4ZH8A 2G5VA 4I8LA 1G3EA 3MO3A 1SFIA 4WXVA 5EW1H 1ZPZA 2ULLA 3F9EA 4B2AA 3PMAB 4X1RU 1AY6H 4Y7BA 1D3PB 4JYUH 1CVWH 1PJPA 2XBWA 3SNBA 2R2WU 8GCHF 1N6YA 2VINA 2Q6FA 5AFYH 3UOUA 3ELAH 3ZYEA 3QZQA 2QGRA 1YPJH 1C5WB 4I31A 1YPHC 3U8RH 2TGPZ 1XX9A 1DUAA 3UIRA 1C5MD 2KM0A 5HIZA 3SNCA 1ZYOA 2ZC9H 4FU7A 1NFYA 1FQ3A 1VCPA 1AHTH 2G8TA 1ZSKA 2JIZD 2O8MA 3F1SB 2BDIA 3PO1C 1FONA 1Z8GA 2Z9JA 4UE7H 3ODFA 4P00A 2AGIX 1SG8B 2QF4A 1BTHH 1ELCA 2CHAC 5C67A 2RA3A 5EQRA 3LKWA 2B7DH 5F03A 2W5EA 4AZ2B 3FOAA 1MTNC 3IWMA 3M5MA 2SGPE 3PWCA 2ZDAH 1FN6A 1INCA 1NS3A 1E79D 2A4QA 2ZHDA 3BTME 4FUDA 4XSKU 3C27B 1TGTA 3UTUH 4TYDA 2VWNA 2M2AA 2ZA5A 3LDXH 3ATMA 3CS0A 2A1DB 1BOQA 1EOJA 5I46H 3NKKA 4ISOA 4ZKNU 1O38A 3KQDA 4Y8ZA 1W14U 3KIDU 2TIOA 4R8TB 2A32A 2G51A 4H4FA 1CO7E 3TJOA 3SV6A 3KNXA 2ZQ1A 2Z9GA 2PKSB 1O2QA 3Q77A 1A3BH 4MPWA 2XC4A 5JBBS 3P8NA 3FP6E 1YPMH 1ZGVA 3RXFA 2J4IA 3E91A 4KKDA 4BAKB 5ETXA 2ESTE 2NWNA 2ZO3H 1TYNA 1RTKA 4HFPB 5GWZA 1FPHH 2A5AA 3AASA 1SGEE 3H7TA 4CREA 1HV7A 3F9HA 2AFQB 1OWIA 1K0HA 4ABFA 1O30A 5GXPA 1A3EH 1C2JA 4BANB 4UD9H 1DXPA 2NU1E 2WSSD 1GBDA 1COWD 2VIWA 1BMLA 3ZVBA 1QQ4A 1HXFH 1KYNA 2LNCA 4FUFA 2SGEE 3MO6A 5FPTA 1C5SA 1HAYB 4RI0A 3GCOA 4Y6DA 3ZZCA 1RD3B 1GBEA 1ARBA 1QA0A 2W6JD 3DCLA 2CV3A 2FLRH 1T7CA 1TX8A 1ELVA 1DSUA 3MOCA 2AH4X 4OS7A 3AW0A 4YOGA 5F8ZA 3VEQB 1RJXB 3SU3A 1E0FD 1QCPA 1UO6A 1XM1A 4Z1MD 2HOBA 1UTJA 2GDEH 1EZQA 1H8DH 1LDTT 4NFFA 1EPTA 2PUXB 4GHTA 3SJOA 2C8ZB 2B5TB 2OQUA 2NU0E 1EJMA 3FKSD 1UCYE 1H8HD 1C5PA 1RRKA 2FI3E 2UWOA 3T26A 1ZRKA 4AFQA 1OWJA 4U32A 5J4QA 1TRYA 1ELBA 3GY8A 1ETRH 3PLPA 4RT1A 2CHAB 1D9IA 2Y6TA 3LGYA 3S9AA 2I6SA 1MTNB 4HGCA 1CHOF 1F0UA 1GJ5H 2ANYA 3LOXA 5CE1A 1YPLH 4BAOB 2FPZA 3M3VA 2Z3DA 1P0SH 2C3SA 1GHXH 4CRAA 4CRFA 2JH6D 4IGDA 4A6LA 2V35A 4ISNA 4X2WA 1ZHRA 1HAVB 1MBMA 1YLCA 5C1XA 3FZZA 2O8UA 5G4BA 3SU4A 3PMJA 4YZUA 3BF6H 1FZZA 1P3EA 2ALPA 1GI5A 2ZGCA 4MTBA 3TGJE 2C8WB 1NRNH 4DGJA 3U8OH 1ACBE 4DT4A 1TGSZ 3DT0H 1C1SA 4A1XA 3A83A 2P95A 4IC5A 5DP7A 3Q3KA 3RMLH 4BTIB 1L4DA 2FYQA 1TBRH 2Y5FA 4ZCNA 1O39A 1WQVH 2IPHA 3Q3YA 1ANCA 1TX6A 1EP6A 1A5GH 2ZECA 1BCUH 1BJVA 5SGAE 5A8ZA 3VFEA 2RDLA 2HGTH 1CT4E 1MQ5A 3LJOA 4AGKA 4CHAC 2ILNA 4CBNA 2Z3CA 1QA7A 2EY4C 1FDPA 4NIYA 1HJ9A 1V2KT 2ZDVH 5EPNA 3SUGA 3S69A 1GHVH 1G36A 1F5LA 3MU0A 4Y7AA 5T6GA 7ESTE 4CH8B 3URCA 4ZAEA 3LH3A 1EZUC 2ODQA 5DO4H 3SJIA 2AMQA 4XOJA 2A2XH 1LO6A 1C1MA 1UHBA 1WCZA 3SYJA 1GDQA 1P3CA 4KGAA 4MVNA 2HVYB 1GDUA 1QY6A 2C8YB 2NU3E 2ZTXA 3GCHC 1C5UA 1SBWA 1J8AA 1OSSA 2ZU1A 5HGGA 1TBZH 5EJZA 2CF9H 2JJ2D 3KCGH 2YNAA 3UQOA 1MABB 1TPPA 7KMEH 2KR7A 2A7CA 3A86A 2TGAA 2NU2E 4B74A 3TH3H 2CJIA 3U98H 1O3AA 1SGIB 1Z8IB 2V0BA 3RXJA 2H9HA 5C0UA 1J17T 1C4V2 3TH4H 3A7ZA 1B0FA 1TLDA 1W11U 3E0PB 3PRBA 3VB7A 3GOVB 4FUJA 1AB9C 3GICB 1KLJH 3AAVA 2GT8A 4Z0KA 5A2MH 1AUJA 1TBQH 5IDKA 2FP7B 4ABJA 1FMGA 2ZGJA 7LPRA 1HJAC 4ABEA 3QN7A 2TGTA 3TPIZ 2ZU4A 5C2ZA 1WAYB 4JK5A 1K9OE 1S6LA 2GCHF 3BTQE 1K1IA 5GPIB 1TFXA 2GMTC 5J4SA 1W0JD 1CGIE 5DG6A 1TAWA 4TY7A 1LHCH 4HTCH 1AI8H 1CGJE 3L33A 2GDDA 2IN2A 2ZGXH 1TQ0B 4ISHH 1O32A 5IYTA 8KME2 3TNSA 1A5HA 5HMAA 1SQRA 2JETC 1SSXA 2OC0A 1A61H 4MNVA 1GI9B 3NZIA 4Q63A 3F2HA 1S6FA 4OM9A 2Y7ZA 4NIWA 1NFWA 2SNVA 6GCHF 2HRVA 1O5DH 3A85A 3RXTA 1D6RA 1JOUB 5EOKA 2J5UA 5E0GA 1KXAA 1AWHB 3O8CA 1EKBB 3SZNA 4CHAB 3K65B 5E8EH 1A2CH 1AN1E 2FO9A 1A46H 3WW7A 5HM9A 3E0NB 1AKSB 1F2SE 3UY9A 4TSFD 4YLUA 1H8IH 3U1IB 4YT6H 1HAGE 1RGQA 1P04A 3OE7D 6LPRA 3TJVA 1XUFA 4B71A 1O3BA 1DY9A 3A88A 3LIWA 1O2OA 3EYDA 3GCNA 2OINA 4O3UA 3ZVEA 2QN5T 3GCHB 3M5OA 5EGMA 1ELEE 2RDEA 2CGAA 3MQKC 4X8VH 3EDXB 1HFDA 4UFDH 4ZHMU 2HWLB 4UEHH 1GBTA 2A4OA 3RXHA 1EUFA 2FOCA 1MUEB 1H1BA 4ASUD 2ZTYA 1BMMH 1TGBA 3UOPA 5LPEA 1KXCA 1EZXC 1V2LT 2ZDLA 1WOFA 1E37B 1ELAA 1ELTA 4FXGH 1OWDA 2YNBA 3DSPA 1O3NA 3FO8D 3GY5A 4ABDA 1SOTA 2C90B 1P05A 1W0KD 3S9BA 3F3BA 3SU5A 3PTBA 3T62A 1AB9B 3QK1A 2G00A 3SQHE 1JIRA 1CA8B 1GBBA 1TGCA 3NUMA 3KQEA 3NWUA 1TOCB 2BDGA 1GJ7B 1K1JA 4MG3A 3A81A 2J92A 2FI5E 3PLBA 1CT0E 2LPRA 2Y7XA 4XD7D 3BG4C 3I77A 1HJAB 5EJ1A 4XBCA 2FYRA 2ZFPH 2ZGHA 2PV9B 6CHAC 1BTWA 2VNTA 4WMFA 1TNHA 3VB3A 2O8WA 1T8LA 2P3TB 4Q7YA 3LJJA 5JPMH 1RFNA 1HAOH 2AEIH 2ZPQA 4GHQA 3RUOA 4JZIA 1W3CA 1C2DA 4HZHA 5K7RA 1CA0C 1VJ9U 2V3MA 4JYVH 3RXVA 2FOFA 1IQNA 3OFND 2XRCA 2F9BH 4JZDH 2BXTH 1FUJA 2OCVB 2ZFFH 1GHBG 5FHTA 3DD2H 2BDHA 2PP6A 2JETB 4QT8C 3QZRA 1GBHA 5C5NA 1O5BB 1J14A 1NT1A 1EB1H 3VB5A 2F9VA 3P95A 4RT0A 3C1KA 3SHCH 2AGEX 6ESTA 5F8TA 2F83A 2BD2A 1IQLA 1N6XA 3GISB 4I8JA 5I25A 4ESTE 1AU8A 3SUDA 1NRPH 2W3KA 3OEHD 3V7TA 1DM4B 1TALA 1Y3WA 2F4LA 3L3TA 2O8LA 5L2YH 4UONA 3TGIE 3SI3H 1C5OH 2Z9IA 4H42U 1BA8B 3N7EA 3UWIA 4BNRA 1IQGA 3P6ZB 1Q31A 1AQ7A 4MNYA 4OS6A 3A8CA 5C20A 7GCHG 2PKAB 2VGCC 1MU8B 2QV1A 3DSGA 1L1GA 1O35A 1A1RA 4D76A 4ABGA 4Y8YA 4AB8A 1HYLA 3VGCC 2H6MA 4K8BA 4X2VA 4A1VA 3DUXH 3GDSA 1C1PA 2OD3B 4J1YA 1UVTH 4YO9A 2XC5A 3ZZBA 1P57B 2V3OH 1VZQH 1O3HA 3N7OA 4BOHA 3SUEA 3M61U 5FCKA 1QQUA 2BQWB 1GI7B 2LELA 1UTQA 2JH0D 3BTHE 1THPB 2BDAA 4Y11E 1Z8RA 3EA9A 5E2PA 5L30H 1C5QA 1MTSA 1OWEA 3TITA 3F6UH 2GCHG 5KGOA 1C5RA 5EQQA 1QNJA 4ZROA 1OXGA 2J94A 1EOLA 4U01A 4I32A 1BITA 1KMHB 3I78A 1GJAB 3BG4B 4I8KA 3H09A 5FCRA 3F2GA 1EX3A 1SPJA 1JBUH 2QYIA 4OS5A 3ZZ8A 1S82A 4I86A 3F9GA 1W7XH 5CHBA 2W7UA 2IOTA 6CHAB 1MZAA 5FL7D 1LKBA 1Z71A 2ODYB 2J34A 4NFEA 3TJNA 2BX3A 2Z9KA 4ACAA 2XNIA 2ZG0H 4NCYA 1S81A 4M7GA 1MU6B 1TRNA 4D7GA 3ATKA 1QBOA 4GUXA 1CA0B 3O8DA 1DDJA 3A7TA 4MNWA 6GCHG 2J98A 1HAXB 1G30B 1XUJA 1ZMLA 1KDQA 1PPBH 2XXLA 1ZHPA 4MPUA 3PTNA 1SGDE 2OP9A 1BUIA 1PYTD 5DJ7A 4X6NA 1QBNA 1GI3A 1PQ5A 2WPMS 5JBTA 3VB6A 3A7VA 1BB0B 1LVMA 5EODA 1GGDC 1MAYA 3ZZ9A 1ZSLA 2DE9A 1LPZB 1QL9A 4AG2A 1EAIA 3OSYA 3SI4H 1C1RA 2ZFRH 1KLTA 1VJAU 2GZ9A 2K0QA 4E05H 5C17A 3RXAA 1Z1JA 1NBME 1UTKA 1O2ZA 4CBOA 1OX1A 2BZ6H 4NG9H 1EP5A 2ZDMA 2VWMA 2PUQH 3PRDA 1GBFA 1Z8JB 1ANDA 2GV7A 4Y71A 4B76A 1XXFA 2ANMH 1GG6B 2BLQA 1W0ZU 3TGKE 3DFJA 1PPFE 1IQMA 1Z6EA 2GCTB 5A8YA 1GI4A 4B75A 3ZZAA 1TNLA 1ZZZA 2FS8A 3V13A 2YMSC 3FZDA 3GS9A 5IK2D 1HCGA 2FOEA 3VGCB 1OWKA 3URDA 3KQ5A 2GV6A 5LGOA 1N8OB 4X8TH 3IG6B 1F0TA 5ABWA 1NROH 2SGDE 2OUAA 3U1JB 1PPEE 4KTUA 1GCTB 1G37A 3NK8A 3OYPA 1K1NA 1D3QB 3LC5A 5F8XA 2P59A 2M5TA 1A7SA 4NIXA 3RC4A 1GJDB 1HLTH 1OHHD 1UTPA 3KHVA 2Y81A 4MQAA 4O97A 1DFPA 4FOUC 1RIWC 1ABIH 2PR3A 3ZV9A 2JKHA 2H5CA 1PFXC 2AS9A 3N7DA 2BLWA 1BJUA 1T8OA 1ZTLA 3T29A 5A0CA 2UUFB 1GHYH 1KIGH 4ZMAH 1XUIA 1ELDE 3PLKA 2JDID 4KTSA 5FXLA 1V2WT 1E1RD 1XVMA 2HLDD 4NIVA 2ZI2H 1O3LA 3OY6U 5KECA 2F9PA 9ESTA 5DPAA 4A1TA 2BY5X 3MNBA 4OGXA 3GY4A 2CN0H 1BDAA 3NXPA 3O8BA 2F9OA 2ZFQH 1GI1A 3RLWH 1EATA 3W95A 3STIA 4X2YA 4ZHLU 3CS7A 3PM3A 1O3JA 1IQJA 4DG4A 3MH4A 1T8NA 4NGAH 2G55A 3N99A 4FVBA 1F5RA 5EU8A 2R0LA 1OOKB 2O9QA 4DJZB 3CENA 4IMZA 4MDSA 1CT2E 3TIUA 1L4ZA 3QGJA 4LOYH 3RMMH 4UFEH 3A82A 1ZPBA 1NC6A 2ZP0H 5AHGH 1SOZA 1GGDB 5F6MA 1DE7H 2G81E 1UVUH 2ZHEH 3A84A 3HGNA 1EJAA 1K1LA 3SJKA 2WPDD 1P8VC 5HM2A 3PB1E 3A7WA 2ALVA 2GJGA 1GL1A 2BDCA 3MU8A 3SUFA 3LGUA 4BAMB 1HIAB 3PO1B 3U8TH 2OQ5A 1XXDA 2VVUA 2Z3EA 3QTOH 4NSYA 1P2OA 3SGBE 2BD8A 3RXDA 2FDAA 3F9FA 1AIXH 3M3TA 2BOHB 1BMAA 1C2IA 1W0YH 4M9FA 1DWCH 3DHKH 2D26C 2VWLA 4DIHH 1MKWK 4X8UH 1QZ8A 1TX7A 3FVFB 3GY6A 3QGNB 4KELA 2OC1A 1UTNA 3LH1A 3SBKA 2OTVA 4R0IA 4ZKOU 3SJ8A 4AOQA 3M36A 1P2IA 4RSPA 4BTUB 2AMDA 1O2XA 1QL7A 2VJ1A 2LP6A 1O3OA 1HAVA 2Q1JA 1KLIH 2PWXA 3BG8A 3ZZ4A 3U9AH 4FUGA 2ODPA 5C5OA 1DANH 1GBIA 2SGQE 2A7JA 4NSVA 3MU4A 2F43B 3SGAE 4TWYA 3VG8A 1XVOA 2BOKA 1ZSJA 1FIWA 3DA9B 1S85A 2YOLA 1O2HA 2SFAA 1DS2E 1GHBF 2EQNA 2ZNKH 1C9TA 2H9EH 3FN8A 2HLCA 1YKTA 4F55A 1Q3XA 1IAUA 3M35A 4NA9H 1YCPM 1HRTH 1MTUA 1HAPH 3RXCA 1WTGH 2XCNA 2FX4A 2UWPA 2A45B 3IITA 2P93A 1GI0A 3RXOA 4CRDA 1AE8H 3A7YA 1OPHB 4TPYA 2VIQA 5EQSA 2EA3A 2QAAA 2P94A 1H9HE 4GLYA 4DY7B 5JB9S 1JMOH 4DIIH 4D9QA 1C5LH 1P2KA 3PMHB 1MKXK 2FTMA 1AGJA 4IW4E 4WXIA 2TRMA 4OGYA 1YPEH 2ZCKP 3BIUH 4XFQA 1C1UH 1C2MA 1SR5C 1ZOMA 2ZPSA 3SJ9A 3P8GA 2W26A 1NRSH 1E38B 2A0QB 1GJ8B 3Q00A 2OBOA 1XKBC 1O3DA 2QF0A 7GCHF 5ESBA 4AYVB 1TOMH 1GMDG 1A5IA 3P8OA 1BT7A 3RXPA 3M3SA 5LPFA 3E16B 2FODA 3E6PH 3PV5A 3MI4A 2GZ7A 3TH2H 5B6OA 3SU1A 1LVBA 1O2SA 1GBCA 1HJ8A 1O3MA 1PPZA 1UTOA 4K3JA 1K1MA 4WJG2 4WH8A 3RXKA 2HNTF 3S9CA 5CDFE 3O8RA 1BMFD 3D62A 1D6WA 3WWBA 1H9LB 1QHRB 1VITG 4H6TA 2J97A 2Z7FE 5GIBA 5FX6A 3JZ1B 1P02A 4AGJA 1D4PB 1SLVB 4O9VA 4WMEA 3UR6A 1EAWA 3V0XA 3EQ0H 3AK5A 4BXSA 4Y0ZE 3V12A 4UDWH 1O37A 3OY5U 4K8YA 2BD5A 3KEEA 2VWOA 1ZJKA 1GI8B 1QFKH 2BTCE 3MU5A 1C5XB 4YOJA 1C5TA 1FY1A 4MNXA 4GCHG 1MCVA 1IQHA 2ZKSA 4LK4A 3STJA 1BTUA 2CF8H 1VGCC 4AG1A 4IN2A 1TPSA 4Z6AH 4Y76A 1AUTC 3VXEH 2VIVA 3MHWU 2FESH 1Y59T 1MKWH 3FP8E 1YLNA 5T6DA 1G2LA 1GBAA 2UUYA 1MTVA 1CBWC 1GHAG 1ZTJA 1O2YA 1V2OT 5HXFA 3UB0A 1ANEA 1F7ZA 3QLPH 2ZHQH 3AW1A 2WV9A 1ORFA 2THFB 2BY6X 1SQOA 5TJXA 4ABHA 1TPAE 2AIQA 2R0KA 3CNRA 3E3TA 1VCQA 3ESTA 4VGCC 5B6LA 1PQAA 1DVAH 1O2RA 1AKSA 1BTPA 3SV9A 1V2MT 2UUJB 1SGPE 5F53A 2DUCA 3A7XA 1YBWA 1CQQA 3T28A 3TNTA 1DUEA 3NCLA 1GHZA 1IOEA 1IQEA 2KAIB 2QIQA 4GAWA 1H8ED 3TVJB 3MWIU 4YT7H 4RKOB 4KTCA 2BD4A 4OS2A 1ZGIA 3RXBA 1EASA 1O2PA 1P12E 4DVAU 4THNH 1O2JA 1O2IA 1TMTH 4B2CA 1MAXA 2A2QH 2FOAA 1YWUA 4MPVA 1FY4A 1G3DA 2VH6A 1QB6A 1K1PA 1SC8U 1YM0A 4JYTA 1IHTH 1MKXH 3PV4A 4B6FA 1H4WA 1GI6A 1W8BH 1O2KA 2QA9E 1BQYA 5EG4A 1TONA 4ABAA 3ZZ3A 4K69A 2K8IA 2AYWA 1C2LA 3FP7E 1O2WA 3EE7A 1P2JA 4X1NU 4ABIA 4ZKSU 3KN2A 4JZFH 3B9FH 4WH6A 4UFFH 4INKA 1C1TA 2P8OC 3CP7A 1BZXE 3QTVH 5LPRA 3D49H 3FAOA 1YGCH 4NA7A 2GMTB 1CE5A 1SGRE 2QXIA 2R9PA 4DURA 1WDIA 1AZZA 2XCFA 1DX5M 1TIOA 1G9IE 1YCPK 2BD7A 2XBXA 3F2FA 2R2MB 1FIZA 2VH0A 4SGAE 2KZ4A 3RC6A 1KXFA 1TNGA 3RXRA 1C5YB 2FLBH 1AWFH 1O36A 1VGCB 3BIVH 2BLVA 1DWDH 2PFEA 4WMDA 2WZQA 4ZXYH 1UVSH 1O2TA 1ZMJA 4FUHA 1DLEA 2BM2A 1O5CB 1FLEE 3RXSA 1O3FA 3LGVA 3ZZ5A 1FY3A 1YYY1 2AGGX 1CBWB 3MO9A 5JBCS 5FPSA 3H5CB 2G52A 1TB6H 4GVUA 2ZCLP 3WWFA 5E2OA 4WF8A 4YXWD 1S6HA 1Y3VA 4E06H 5FX5A 2V3HH 3MH6A 3ZZ7A 1SL3A 1NTPA 4AB9A 3U28C 4LZ4B 2OK5A 1WV7H 1DT2A 1ZRBA 5JDUB 1JWTA 1A4WH 1NFUA 4Q7XA 3RLYH 1PPCE 4VGCB 5ESTE 2PTNA 1MQ6A 1GVLA 3M37A 1GVZA 1C1OA 2SGFE 3RXEA 4ISLA 4Q2KA 1P06A 2J9NA 1RS0A 1T32A 2A4RA 2QF5A 2R3UA 1MBQA 3EAJA 1Z7KA 2XNDD 2A4GA 2SGAA 3F68H 4FU8A 2JJ1D 4YOIA 4JZ1A 1LPKB 2OLGA 3V3MA 4ZKRU 2CK3D 1AE5A 2RA0A 1T4UH 5JYIA 2OXSA 1EXFA 1NO9H 2FIRH 2G4TA 4X8SH 1AD8H 1WBGB 2FXRA 2WUCA 1KXEA 1O31A 1FJSA 1BTXA 3HGPA 2JH5D 1GJ4H 1P2QA 1JRTA 1LCYA 2OBQA 8ESTE 2HPPH 3RU4E 4K60A 1L1NA 1F5KU 2V6NA 5EW2H 1AZ8A 5E0HA 3MMGA 2PKSC 1S0RA 1J16A 4O3TA 2XTTB 1XUGA 1GJ6A 2Y82A 3QX5H 3AVZA 2BVRH 1O34A 4IMQA 1OYTH 3KQBA 3MYWA 2P8OB 4BXWA 2FOGA 1L1JA 1C1WH 1OP2A 2FMJA 1GL0E 1WQSA 2L74A 3DSOA 2HVXA 5T1VA 2ZHFH 1O5FH 1O5EH 3HATH 2BMGB 1F92A 1NRRH 1Y3XA 3D65E 1G3BA 5DKMA 1JIMA 4X6PA 4OS1A 1V3XA 3GY7A 1FPCH 1LHGH 1LVYA 3F0PA 4IS5A 1LTOA 3BTFE 3GY2A 3MH5A 1HXEH 3ODDA 2XWBI 1ZPCA 1SB1H 2WV4A 1ETSH 1NPMA 8LPRA 2ZWLH 3OTJE 3RXUA 2R3YA 2TPIZ 1OS8A 2VB0A 4CRGA 1MH0A 4K1SA 3M5LA 3MNCA 1TA6A 1GMCG 4TWWA 1WU1A 2CXVA 4Y79A 1EPTC 3GCTG 5C94A 1TPOA 5AVDA 1AO5A 9LPRA 1QIXB 2ZHWH 2D1JA 1A0HB 1YCPH 2P16A 3GDVA 1S84A 3SOSA 1GMDF 2IJD1 4K1TA 4A5TS 3BV9B 2RFKC 2PTCE 4FU9A 3SZEA 4HI3A 2QE7D 1GCDA 3RU4T 3S7KB 4CR9A 2WYGA 1OP0A 4FUBA 1SLWB 4B73A 2ZIQH 1SGQE 1PQ7A 4P02A 4Y10E 1SGYE 2WPHS 3SV7A 3KYGA 1NN6A 1X7AC 2VIOA 1DWBH 4TT3D 1HGTH 2AIPA 2VGCB 1O3KA 1W7GH 2D8WA 4X6MA 1P01A 3LPRA 1O2NA 1FXYA 1UVOA 4B6EA 1VITF 3RC5A 1ZHMA 2G4UA 2Z6BD 4FUEA 1MTWA 4NA8A 2AMPA 2B9LA 5DP4A 3UAIC 2QXHA 2OC8A 1J9CH 2BD3A 4MPXA 4YESB 4CRBA 2EI8A 2QXJA 3HKJB 3MU1A
chains in the Genus database with same CATH topology
3UWJH 1B5GH 1NESE 3UREA 1O33A 2C8XB 2WPKS 4AFZA 5GDSH 1S0QA 4DW2U 1V6DA 1GMHG 3ATLA 2GVFA 2GZ8A 1GJBB 1QGFA 3KF2A 3W94A 5FPYA 3PWBA 2Y80A 1O3EA 1ETTH 2NU4E 1TE0A 2W7SA 3H7OA 4AX9H 2VVVA 4GCHF 1FAXA 2BXUH 3Q3XA 4I7YH 4DOQA 1QBVH 3M7UA 2W3IA 3BTEE 2PGQB 1DXWA 4JMYA 1NM6A 1TMUH 3A80A 2FOMB 2XYAA 4I33A 3LGTA 3M7QA 4FUCA 1V2PT 3B8JA 5JB8S 3R0FA 1GHAF 4K5ZA 3RXQA 1Y3UA 1WUNH 4K2YA 1LQDB 1XKAC 2BY8X 2UUKB 3P70B 2PGBB 3ZVDA 5C1YA 1DWEH 3E90B 1O3GA 4GPGA 1BRUP 5GCHG 3BTTE 1FNIA 1SHHB 3A89A 2BZAA 4X1QU 1NRQH 1EAUA 3B23B 1OWHA 1GPZA 4FUIA 3U69H 1KXDA 4X6OA 1L2EA 1SHYA 3D23A 3KQCA 1O2LA 3ENSB 3UR9A 1T8MA 2WPIS 3EA8A 3TLOA 3K6ZA 1DICA 1PPHE 3GDUA 1ZJDA 4AFUA 2STAE 1OYQA 2UWLA 1KY9A 3LGWA 1KSNA 1AVXA 5BPEA 2BB4A 2ZU3A 1Z6JH 1EB2A 1EPTB 2BVXH 5A8XA 2B8OH 2OC7A 4IBLH 4WWYA 1ID5H 1W13U 1YPKH 2PSYA 1BBRK 1K21H 1ZLRA 2BX4A 4ZHAA 1C2EA 2CMYA 4OS4A 4PROA 3UNQA 1Q2WA 1ABJH 3RMNH 2F91A 1LPGB 1HIAA 1LHEH 1Y8TA 5LH8A 1C2KA 1SLUB 3S0NA 2FS9A 1ZR0A 1KTTB 3OU0A 1N1LA 2FZZA 2FX6A 3M7TA 3GYLB 3WY8A 2ZU2A 4XE4A 5DP6A 3K9XB 5EPYA 1H9IE 4CH2B 2J95A 4CRCA 3JZ2B 3R3GB 1BHXB 5C1UA 2A31A 4D8NA 4Y0YE 1CU1A 1TA2A 4RN6A 1FY5A 4Q80A 2BLOA 5AF9H 1MMJN 2BD9A 2ANWA 3SNDA 2BY7X 3BN9A 3LC3A 1C5NH 1CGHA 2QY0B 1JRSA 4K1EA 1BRAA 2STBE 3SW2B 1GBLA 2AERH 4GSOA 2J2UA 4X1SU 1ZTKA 2FI4E 1RIWB 3SORA 1LHDH 1BTYA 2FOHA 4JK6A 3TK6A 2ASUB 3ZVCA 5FBIA 2ZEBA 3EGKH 1AMHA 1Y3YA 1XUHA 1P2NA 1O3PB 1FAKH 2ZU5A 3A87A 5DP8A 3UFAA 4AN7A 2VIPA 3A8AA 1P2MA 5L6NH 3FANA 4JCNA 2GP9B 2FEQH 3K2UA 2Y5GA 2F9UA 1HPGA 1K2I1 1Y5AT 1HAIH 1S5SA 2ZDNA 1J15A 1GHWH 2PW8H 1IHSH 1NZQH 1PQ8A 2D2DA 4U2WA 2ZZUH 1K22H 1KTSB 1G32B 1UHBB 2A5IA 4UFGH 3HK6B 1BTZA 1CHGA 1GWAA 2XBVA 1C2FA 2ZDKA 1SLXB 1QJ1B 2A5KA 1M9UA 3BTKE 3UPEA 2WINI 2G5NA 2EI6A 3BEFB 1MZDA 3UQVA 3P8FA 1PYTC 8GCHG 1P10A 5A0BA 1XUKA 1Y5UT 2QC2A 1QL8A 1FN8A 1QR3E 3SGQE 5A09A 1E34B 2FWWA 1TQ7B 2IJOB 1YPGH 1SQTA 2DE8A 3MH7A 1AVWA 1G3CA 3RXGA 5TCCA 2HALA 4KP0A 1CSOE 4DCDA 3ATIA 2RG3A 2ZGBH 2ZTZA 3ZV8A 1GDNA 1DPOA 2BHGA 1AFQC 1G2MA 2ANKH 5FBEA 3SU2A 4XBBA 4TY6A 3T2NA 2VIDA 4NWKA 1HBTH 3SU0A 4YLQH 1TRMA 2FM2A 1T31A 3LT3A 5AFZH 4ABBA 3Q76A 3UUZA 1C1QA 2ZFSA 3HKIB 5EXMA 1LKAA 2VVCA 4B2BA 1LHFH 3L6PA 2BVSH 1THRH 2EEKA 4X1PU 2Z94A 4MLFB 2H1UA 4YTAA 1SMFE 1C1VH 1BBRH 3ZVFA 4Y8XA 1ELGA 3ITIA 3SNAA 4XBDA 5H4IB 1QRXA 4LXBH 1HAHH 1GJCB 2A7HA 3RXLA 1DITH 3VXFH 2FOBA 4FVDA 1QURH 1MCTA 3A8DA 5E0JA 1MD7A 5DGJA 5BRRE 1BRBE 1W12U 1SFQB 2K1QA 3LU9B 5GJ4B 4X2XA 3VB4A 1S83A 3ZZ6A 1QJ7B 1A0JA 2HPQH 3QWCH 1EZSC 3AAUA 3RMOH 4D7FA 2H5DA 4YM9A 1FY8E 2ZQ2A 1O3CA 4CR5A 3RM0H 3S7HB 1BHXF 1ANBA 2H2ZA 3TJUA 1C5ZB 1TGNA 1GBJA 1YP9A 2GGVB 2O8TA 4NZQA 4BTTB 3RXMA 1W10U 2GT7A 2GX4A 4JZEH 1GMCF 1SGFG 2ZFTA 2F9NA 4F4OC 2ZPRA 1FI8A 3UNRA 1UK2A 1QJ6B 3GCTF 3QDZB 2ZCHP 3RDZA 1DY8A 1HDTH 3SV8A 4A7IB 3TK5A 3VPKA 2ZF0H 3RXIA 3KGPA 5FAHA 1TWXB 3RM2H 2XBYA 4WVPE 1ESTA 4INHA 1HNEE 2XW9A 3PMBB 3SV2H 4INLA 3SU6A 1A0LA 2XC0A 1VR1H 4B1TA 4NWLA 1EQ9A 3ZVAA 2TGDA 5K0HA 5HYOA 4ZXXH 1IQIA 3BTGE 4IC6A 1QB1A 2KAIA 3LGIA 1C2GA 4AFSA 2Q6DA 1UCYK 3OX7U 1P03A 2WYJA 3M5NA 4X0WU 3BEUA 1B0EA 3MNSA 1DLKB 4ZUHA 1BMNH 2WPJS 1SGTA 2BQ7B 2P3UB 1VCWA 3SO3A 5CHAC 2HNTE 1O3IA 1O5GH 3MTYA 3P17H 1AFQB 1RXPA 4I8GA 3BTWE 4F49A 1QTFA 1NY22 3ZZDA 1GMHF 2PLXA 2B0FA 1CHOG 2BDBA 2WPLS 1V2QT 1IQKA 3ATWA 3TU7H 1F0RA 4ASHA 1QB9A 4DT7B 1K28D 1AVGH 3HPTB 1NU9A 1P9SA 1YLDA 1W2KH 2Q6GA 1U6QA 3EA7A 1YPHE 1V2RT 1SVPA 1GBMA 1YF4A 1UTLM 2TBSA 3LONA 4O03A 3SHAH 3ZVGA 1V2VT 1PPGE 4D9RA 2J38A 1GBKA 1UMAH 2Y5HA 1E36B 4LZ1H 1LQEA 1T4VH 4IN1A 3HK3B 2H9TH 4SGBE 2GKVE 4TPIZ 1C4Y2 5L2ZH 3NPSA 2EI7A 1LMWB 4E7RG 3EE0B 5JBAS 1C4U2 1E35B 1HB0B 1SQAA 5GCHF 1UVPA 2PSXA 1GJ9B 5TCAA 4BAHB 3GYMA 1C5VA 3QO6A 3KL6A 1BIOA 4ISIH 4A92A 3I29A 3RU4D 3MFJA 3QUMP 1O0DH 2BQ6B 2RCEA 1O2MA 3E8LA 1TNJA 1O2GH 2C4FH 5A0AE 4AYYB 1IQFA 1O2VA 3UNSA 5DP5A 1ELFA 4RKJB 3T5FH 1TABE 3SQEE 1D3DB 1OKXA 2QCYA 1QRZA 1C9PA 3BSQA 1UTMA 1C1NA 2P3FH 3RP2A 1BRCE 5T3HA 1MD8A 4E7NA 1Z1IA 1BBRE 1HUTH 1B7XB 2QXGA 5DP9A 1SGCA 2PKAA 4WY3A 1F0SA 2BYAX 2WUBA 3T27A 1OP8A 3P92A 1GG6C 3E1XB 1RTLA 3DFLA 3A8BA 2EC9H 3FFGA 3TK9A 1UK3A 1K1OA 5DK1A 2GCTC 1SI5H 3K6YA 5T6FA 5EXLA 1D3TB 1THSH 1P11E 2GD4B 2VU8E 2Z9LA 1DSTA 5CMXH 5C3NA 1V2NT 5PTPA 1GI2A 1N8OC 1WSSH 5CHAB 3BEIB 1Y5BT 1ZMNA 1O2UA 5DP3A 3PYHA 1XMNB 3PROA 1ESAA 1GCTC 1TMBH 2QF3A 2WV5A 3SNEA 1JXPA 3ZYDA 4NZLA 1DOJA 2BY9X 2BDYA 5EXNA 1LVOA 1V2JT 1UK4A 3BTDE 4I8HA 1P09A 1V2TT 1O5AB 3MNXA 1YC0A 2SNWA 4AORA 1ESBA 1KXBA 1SGFA 1WYKA 1FV9A 4BAQB 2C93B 1NU7B 3SN8A 1UCYH 1GVKB 2PHBA 1ARCA 1WTHD 1QRWA 2F3CE 1HAZB 4H6SB 4J2YB 2XWAA 1EAXA 1SGNE 4XDEA 3G01A 1RTFB 3GY3A 2GTBA 1C2HA 1VITH 1TNKA 2I6QA 3T25A 4Q7ZA 1EJNA 1KDQB 1TNIA 1V2UT 1P9UA 1L0ZA 1NFXA 4U30A 2HNTC 2FTLE 1V2ST 1AFEH 1UJ1A 4ZH8A 2G5VA 4I8LA 1G3EA 3MO3A 1SFIA 4WXVA 5EW1H 1ZPZA 2ULLA 3F9EA 4B2AA 3PMAB 4X1RU 1AY6H 4Y7BA 1D3PB 4JYUH 1CVWH 1PJPA 2XBWA 3SNBA 2R2WU 8GCHF 1N6YA 2VINA 2Q6FA 5AFYH 3UOUA 3ELAH 3ZYEA 3QZQA 2QGRA 1YPJH 1C5WB 4I31A 1YPHC 3U8RH 2TGPZ 1XX9A 1DUAA 3UIRA 1C5MD 3SNCA 1ZYOA 2ZC9H 4FU7A 1NFYA 1FQ3A 1VCPA 1AHTH 2G8TA 1ZSKA 2O8MA 3F1SB 2BDIA 3PO1C 1FONA 1Z8GA 2Z9JA 4UE7H 3ODFA 2AGIX 1SG8B 1BTHH 1ELCA 2CHAC 5C67A 2RA3A 5EQRA 3LKWA 2B7DH 5F03A 2W5EA 4AZ2B 1MTNC 3IWMA 3M5MA 2SGPE 3PWCA 2ZDAH 1FN6A 1INCA 1NS3A 2A4QA 2ZHDA 3BTME 4FUDA 4XSKU 3C27B 1TGTA 3UTUH 4TYDA 2VWNA 2ZA5A 3LDXH 3ATMA 3CS0A 2A1DB 1BOQA 1EOJA 5I46H 3NKKA 4ISOA 4ZKNU 1O38A 3KQDA 4Y8ZA 1W14U 3KIDU 2TIOA 4R8TB 2A32A 2G51A 4H4FA 1CO7E 3TJOA 3SV6A 3KNXA 2ZQ1A 2Z9GA 2PKSB 1O2QA 3Q77A 1A3BH 4MPWA 2XC4A 5JBBS 3P8NA 3FP6E 1YPMH 1ZGVA 3RXFA 2J4IA 3E91A 4KKDA 4BAKB 5ETXA 2ESTE 2NWNA 2ZO3H 1TYNA 1RTKA 4HFPB 5GWZA 1FPHH 2A5AA 3AASA 1SGEE 3H7TA 4CREA 1HV7A 3F9HA 2AFQB 1OWIA 4ABFA 1O30A 5GXPA 1A3EH 1C2JA 4BANB 4UD9H 1DXPA 2NU1E 1GBDA 2VIWA 1BMLA 3ZVBA 1QQ4A 1HXFH 1KYNA 2LNCA 4FUFA 2SGEE 3MO6A 5FPTA 1C5SA 1HAYB 3GCOA 4Y6DA 3ZZCA 1RD3B 1GBEA 1ARBA 1QA0A 2CV3A 2FLRH 1T7CA 1TX8A 1ELVA 1DSUA 3MOCA 2AH4X 4OS7A 3AW0A 4YOGA 5F8ZA 3VEQB 1RJXB 3SU3A 1E0FD 1QCPA 1UO6A 1XM1A 2HOBA 1UTJA 2GDEH 1EZQA 1H8DH 1LDTT 4NFFA 1EPTA 2PUXB 4GHTA 3SJOA 2C8ZB 2B5TB 2OQUA 2NU0E 1EJMA 1UCYE 1C5PA 1RRKA 2FI3E 2UWOA 3T26A 1ZRKA 4AFQA 1OWJA 4U32A 5J4QA 1TRYA 1ELBA 3GY8A 1ETRH 3PLPA 2CHAB 1D9IA 2Y6TA 3LGYA 3S9AA 2I6SA 1MTNB 4HGCA 1CHOF 1F0UA 1GJ5H 2ANYA 3LOXA 5CE1A 1YPLH 4BAOB 2FPZA 3M3VA 2Z3DA 1P0SH 2C3SA 1GHXH 4CRAA 4CRFA 2JH6D 4IGDA 4A6LA 2V35A 4ISNA 4X2WA 1ZHRA 1HAVB 1MBMA 1YLCA 5C1XA 3FZZA 2O8UA 5G4BA 3SU4A 3PMJA 4YZUA 3BF6H 1FZZA 1P3EA 2ALPA 1GI5A 2ZGCA 4MTBA 3TGJE 2C8WB 1NRNH 4DGJA 3U8OH 1ACBE 1TGSZ 3DT0H 1C1SA 4A1XA 3A83A 2P95A 4IC5A 5DP7A 3Q3KA 3RMLH 4BTIB 1L4DA 2FYQA 1TBRH 2Y5FA 1O39A 1WQVH 2IPHA 3Q3YA 1ANCA 1TX6A 1EP6A 1A5GH 2ZECA 1BCUH 1BJVA 5SGAE 5A8ZA 3VFEA 2RDLA 2HGTH 1CT4E 1MQ5A 3LJOA 4AGKA 4CHAC 2ILNA 4CBNA 2Z3CA 1QA7A 1FDPA 4NIYA 1HJ9A 1V2KT 2ZDVH 5EPNA 3SUGA 3S69A 1GHVH 1G36A 1F5LA 3MU0A 4Y7AA 5T6GA 7ESTE 4CH8B 3URCA 4ZAEA 3LH3A 1EZUC 2ODQA 5DO4H 3SJIA 2AMQA 4XOJA 2A2XH 1LO6A 1C1MA 1UHBA 1WCZA 1GDQA 1P3CA 4KGAA 4MVNA 1GDUA 1QY6A 2C8YB 2NU3E 2ZTXA 3GCHC 1C5UA 1SBWA 1J8AA 1OSSA 2ZU1A 5HGGA 1TBZH 2CF9H 3KCGH 2YNAA 3UQOA 1TPPA 7KMEH 2A7CA 3A86A 2TGAA 2NU2E 4B74A 3TH3H 2CJIA 3U98H 1O3AA 1SGIB 1Z8IB 2V0BA 3RXJA 2H9HA 1J17T 1C4V2 3TH4H 3A7ZA 1B0FA 1TLDA 1W11U 3E0PB 3VB7A 3GOVB 4FUJA 1AB9C 3GICB 1KLJH 3AAVA 2GT8A 4Z0KA 5A2MH 1AUJA 1TBQH 5IDKA 2FP7B 4ABJA 1FMGA 2ZGJA 7LPRA 1HJAC 4ABEA 3QN7A 2TGTA 3TPIZ 2ZU4A 5C2ZA 1WAYB 4JK5A 1K9OE 2GCHF 3BTQE 1K1IA 5GPIB 1TFXA 2GMTC 5J4SA 1CGIE 5DG6A 1TAWA 4TY7A 1LHCH 4HTCH 1AI8H 1CGJE 3L33A 2GDDA 2IN2A 2ZGXH 1TQ0B 4ISHH 1O32A 5IYTA 8KME2 3TNSA 1A5HA 5HMAA 2JETC 1SSXA 2OC0A 1A61H 4MNVA 1GI9B 3NZIA 1S6FA 2Y7ZA 4NIWA 1NFWA 2SNVA 6GCHF 2HRVA 1O5DH 3A85A 3RXTA 1D6RA 1JOUB 5EOKA 5E0GA 1KXAA 1AWHB 3O8CA 1EKBB 3SZNA 4CHAB 3K65B 5E8EH 1A2CH 1AN1E 2FO9A 1A46H 5HM9A 3E0NB 1AKSB