1V2RT

Trypsin inhibitor in complex with bovine trypsin variant x(ssri)bt.b4
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSRIITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title Understanding protein-ligand interactions: the price of protein flexibility
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 50
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2rT01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2rT02
1EAUA 1P11E 3UPEA 1O3IA 1BHXB 3TH3H 5E8EH 1S0QA 1GI9B 1WV7H 2WPHS 3O8DA 3ZVFA 1HAPH 2J2UA 1W13U 2QF0A 4O3UA 3RU4D 1O2NA 1TONA 4D7GA 1J8AA 2C3SA 1WTHD 1BT7A 1EJMA 1O3HA 1QJ1B 1UCYH 2PKSC 4KGAA 1TRYA 5A0BA 1O34A 1ZYOA 1HXFH 3I78A 3PM3A 1QHRB 1V2PT 1DOJA 1Y3UA 2Z9JA 4UEHH 2STAE 4X8SH 4TWYA 1T31A 4X2VA 1OXGA 3BF6H 4ZMAH 1XXDA 1D3PB 4MNYA 3HGPA 3LGVA 2XC4A 1KTSB 1E36B 3DUXH 1OP0A 1QB1A 1TALA 1ZOMA 5EU8A 4KP0A 1OWKA 1HDTH 4HFPB 5I46H 3TJNA 2AIPA 1BJUA 1GMHG 1BRUP 3GY6A 2ILNA 3LH1A 2FI5E 1YPLH 2V6NA 3UOUA 4FUGA 1GJCB 3SQEE 1MKWK 3BTKE 2XC5A 1EAIA 4IW4E 1O2SA 1HGTH 1WQVH 2G51A 3E91A 1FPCH 1TPAE 5EGMA 2C8YB 2ZIQH 4AORA 4WXIA 3BEUA 5E0HA 2BD3A 1MUEB 1RRKA 2BD2A 2FODA 3QUMP 4LXBH 4RKOB 1Z71A 1GJBB 4H42U 1TYNA 1PQ8A 1QBOA 1TMTH 4GHTA 3RM0H 2OC0A 1TGCA 4DJZB 1GI1A 3OTJE 1P06A 1YYY1 3SU6A 4Z6AH 1CT0E 4DIIH 1GBAA 4OS7A 2EI6A 2GVFA 1YGCH 1G32B 1GJ7B 4E05H 1ELVA 3UIRA 4YT7H 3UWIA 5CMXH 4K2YA 2BQ6B 1HJ8A 1P03A 2FLRH 1O39A 3V3MA 3F1SB 1BUIA 1DVAH 1OWDA 4VGCC 2PR3A 5JBTA 4X1QU 1CE5A 1O37A 3V7TA 1UVUH 2XBVA 1MU8B 4B1TA 4DW2U 4NA7A 3MH4A 1LPZB 5EG4A 4AOQA 2R0KA 4KTSA 1C5QA 3FP6E 4JK6A 2QCYA 3K9XB 3VXFH 1OOKB 1UMAH 1T8MA 1AFQB 1QNJA 1O5AB 3VEQB 1IQIA 3PLKA 1GHXH 1GDUA 1Z1IA 3LGIA 1ZSLA 1A5GH 1MBQA 1ELDE 1GG6B 4I32A 1V2LT 1BRAA 1XUHA 1A0HB 3A7VA 1FI8A 3ODDA 4SGAE 1SGQE 1G3CA 2BD4A 1YF4A 1UTMA 3L3TA 3UQVA 1P2IA 1ZZZA 4KELA 2J92A 2SGEE 4MDSA 1P3EA 2QXHA 1C1OA 4ISOA 3M35A 4YESB 4AG2A 3U1IB 4BTUB 2ZCHP 4JMYA 2RG3A 1C2KA 2WV5A 3ZV8A 4U2WA 1A0JA 1RD3B 2XW9A 3A83A 3A8AA 2CJIA 2XTTB 2ANYA 4BAOB 1VZQH 4DCDA 2A5IA 3ITIA 2H9EH 2FWWA 2HWLB 2R2WU 3TK5A 4HZHA 3P92A 7KMEH 5GCHG 1QIXB 1E38B 2BVXH 2J9NA 2M5TA 2OC8A 1P04A 2CF8H 1SQAA 3TLOA 2G52A 4I8KA 3LGTA 3KGPA 2BY5X 2OBQA 1S0RA 1TPPA 1PPCE 1Y3YA 2PFEA 4Q7ZA 1ZJDA 1ZMLA 1LHDH 4ZKSU 1DY8A 4BANB 1XX9A 2RDLA 4NWKA 4PROA 1FJSA 4YTAA 2RA0A 3D62A 5GIBA 2PHBA 1B0EA 1ETTH 3M37A 1F0TA 4ABBA 1ZSJA 1P01A 3L6PA 2ZDKA 1BMNH 3LGWA 3ZZ3A 3EGKH 2YNAA 1BIOA 2PUXB 3NK8A 5K0HA 3EA9A 1NRPH 4Q7XA 3GY5A 3MOCA 4K8BA 4IS5A 2ZEBA 3A8BA 4UONA 4UFDH 1HAXB 1SHYA 2JETC 1PFXC 2QXGA 3RXLA 1GI8B 3RXPA 1G36A 1EZSC 2PLXA 4BOHA 1LQDB 4FUBA 2FXRA 2AGGX 5BRRE 1NM6A 2ZG0H 3P8NA 3M7TA 3ODFA 1DE7H 1YCPH 4B2CA 2OCVB 1K28D 2Z3CA 2BZAA 2SGAA 4DY7B 3A89A 1BBRK 1W0ZU 1ELEE 1K1JA 1C5UA 1BHXF 2VB0A 2BOHB 1MZDA 2VWMA 3MYWA 1DT2A 3F9HA 3OY5U 3M7QA 2AH4X 1KLTA 1FN8A 2EI7A 1VGCB 2Q6DA 1EASA 1FQ3A 1IQKA 2R3YA 1HRTH 1YPGH 1H9LB 1AO5A 1Q3XA 1P57B 2ZFPH 4R8TB 2BHGA 3LGYA 4U01A 1ZHMA 1F5KU 2I6QA 3HGNA 1Y5AT 5A0CA 2ZGCA 1TNJA 2XBWA 2PGQB 3ZZ4A 1S85A 3SGBE 3FAOA 1T4UH 5FCRA 2GD4B 1BMLA 4I8HA 1QJ7B 1W11U 2GV6A 1CU1A 2BVSH 1DM4B 1NN6A 1N6XA 1SOTA 1OSSA 1YC0A 1P09A 2A5KA 3DHKH 3OY6U 1FLEE 1UTQA 4Y6DA 5CHAB 3S7KB 5J4QA 1A3BH 3E1XB 2PGBB 1ZHRA 3SU4A 1GJ5H 2HNTC 2A32A 1ZTLA 3U1JB 2PUQH 5T6GA 1ZRKA 3TJOA 3QLPH 3FZZA 4Y8YA 3URCA 3MH5A 1DS2E 1YPEH 3ZZ7A 4MPUA 1Z1JA 2V35A 4WJG2 1EZUC 4JYTA 1VJ9U 1C9TA 2VH6A 6CHAB 4Q80A 1XUFA 3GCNA 1WAYB 4ZROA 3NKKA 4B2AA 2PV9B 2OXSA 3E0PB 1AZZA 2FEQH 4FUDA 5L6NH 3BTME 1RTFB 5DG6A 2VIPA 3IWMA 1JOUB 1MKXK 1O3GA 4XSKU 2ALPA 2ANWA 4Y8ZA 2A4OA 1SGIB 3BIUH 2C4FH 2THFB 1NT1A 3MNXA 4MNXA 1QFKH 1C2JA 2QGRA 1YPMH 5E2OA 1O2RA 1CHOF 1OWEA 3P8OA 1P2OA 5BPEA 2WV4A 3A7XA 1EKBB 1HB0B 4JYVH 2UUYA 5E0GA 1S5SA 1PQAA 1V2OT 1DANH 2Y6TA 2ZC9H 4BTTB 2Y7ZA 2BYAX 2FP7B 5DK1A 4FU9A 2ZP0H 7GCHG 1A61H 1CO7E 4JCNA 1SI5H 2W5EA 1N8OC 4YM9A 3AVZA 1YPJH 3Q76A 3PV4A 1L0ZA 4ZKNU 1N6YA 2O8UA 1O5BB 1LO6A 1ID5H 9LPRA 1L4DA 3E6PH 2HNTE 1AVWA 1W12U 4Q2KA 2Y82A 3MO6A 2ZA5A 4K1SA 3T29A 2TGAA 1SL3A 3ZYDA 2ZTYA 3TIUA 1AGJA 4R0IA 3AASA 3ZYEA 2ZNKH 2H5CA 5DKMA 3NUMA 1V2WT 1HJAB 1MCVA 3SUEA 2C8WB 1GPZA 3SV8A 2BLQA 3GISB 1H9IE 1H8DH 4HTCH 2ZPQA 2HGTH 4X1RU 4WMEA 3RXDA 1L1NA 1AFEH 1O2LA 3RP2A 3VPKA 1GHBF 2GDEH 2YNBA 4MTBA 1ZHPA 3RM2H 2FOGA 1GJAB 3SNAA 3KIDU 1FXYA 2PKAA 3PYHA 4KTCA 2OP9A 1G3EA 1GJ4H 1EB1H 1GVZA 1IOEA 4FUIA 3EQ0H 2P95A 4HI3A 4CHAB 1XUKA 1TMUH 2W7UA 4X2WA 4ZHAA 1K1PA 1DY9A 1UTLM 4DIHH 5LPEA 2AERH 1HAZB 4DT7B 1C2LA 3PLBA 2OLGA 2Y80A 1C1MA 1GBDA 3FVFB 5T6FA 3IITA 2O9QA 1AN1E 1KXEA 2JH6D 3GOVB 1MMJN 3BG4B 3FP8E 5ESTE 4KTUA 1C5TA 3M3TA 3P6ZB 2GV7A 1E0FD 3ATLA 1CSOE 2Q6FA 1TWXB 2Z94A 3BTHE 3LJJA 5FPSA 1CGHA 5CE1A 2B8OH 5FPTA 3LJOA 1GCTB 4NIWA 1LDTT 1QJ6B 2BVRH 1ELCA 1V2ST 3T25A 3TNSA 2BZ6H 3UR9A 2JH0D 3RXTA 3O8BA 1H1BA 2F3CE 2HALA 5DP7A 1HAGE 1LHEH 1CVWH 1BRCE 3M3VA 2R2MB 3RXBA 1ACBE 1O3NA 1C1TA 4FUFA 1QR3E 2PKAB 2V3OH 4X0WU 3MI4A 1PPEE 2I6SA 2ZKSA 1GHAF 4GHQA 2GZ8A 2RA3A 2ZFSA 3RXAA 5GWZA 1YPHE 5DO4H 3KEEA 3P95A 4A5TS 2BDIA 2EC9H 1O3BA 2WPKS 5LGOA 2FOMB 2KAIA 2VH0A 3V13A 4DURA 1BMMH 3RU4T 1GMCG 1V2MT 2A5AA 3MNCA 3ENSB 3KQDA 3W95A 4ISHH 3LKWA 3GCTF 2QYIA 1QTFA 2AGEX 3MH6A 3T2NA 5JB9S 1YBWA 3M5MA 1O3PB 1DWDH 1C1PA 3LC3A 2ZGXH 4WWYA 1UK2A 1HNEE 2VINA 1P0SH 1C5NH 3K65B 3HATH 3KQCA 4A6LA 1OP8A 3S9CA 1QGFA 3BIVH 1O36A 1AWFH 1SGCA 3ZZAA 2B9LA 1AMHA 2QXIA 3KQBA 1P2MA 2SFAA 1JMOH 1S6FA 4X1SU 2C90B 4GCHF 2GP9B 1O5FH 3H7TA 4A1VA 1IQJA 2Z3EA 1O35A 3K6ZA 1D3DB 2IPHA 3K2UA 3RMMH 1UK3A 2ZTZA 1GGDB 2BQ7B 3BTTE 3GY4A 2GCTB 1RIWB 4ABJA 2BD8A 2GGVB 1MTNB 1E35B 1EQ9A 2OQUA 1O2OA 2FOBA 1P9UA 2VVCA 4YT6H 3P8GA 1UO6A 5L30H 1D6RA 3I29A 1TBQH 1C4V2 3RMNH 1KXCA 2QV1A 2NU3E 1AWHB 3S69A 3F9FA 2NU0E 4UFEH 1ELBA 1BTXA 1KTTB 1C5XB 2EA3A 4FVBA 1W8BH 2J4IA 2A1DB 1LKBA 1NZQH 4XBCA 3GDUA 1SGDE 1THPB 1V2KT 1Y59T 2B7DH 5L2YH 3F6UH 2VIDA 4WVPE 1C5OH 8KME2 1ELGA 3E3TA 1W7XH 4MPWA 3SJIA 1C5MD 1RFNA 3MH7A 2H9TH 3U8OH 3T62A 2ZGBH 1LMWB 1P8VC 1HV7A 5A2MH 2ASUB 1C2DA 4FUCA 1ARCA 3ESTA 5JBAS 2ZFRH 4MNWA 2FX6A 1HAOH 4Y71A 1T8NA 4YZUA 1QB6A 1MZAA 3EA8A 1O5EH 5IDKA 4FU8A 3S9AA 3AAUA 2Q6GA 2ZWLH 1AKSA 4FU7A 5LPFA 1C4Y2 2FOHA 1LKAA 1T8LA 2AIQA 3U69H 3ZZ8A 1WSSH 3GDVA 2F9NA 4ZHLU 2TRMA 4F49A 1C5ZB 3A7YA 1YLDA 1YM0A 3P8FA 1ZPCA 1HLTH 4OS5A 1W7GH 3EE0B 1JBUH 1AZ8A 1GI2A 1BQYA 1HFDA 1QQUA 2FI3E 3C1KA 1V2RT 1C1QA 2ZTXA 3A80A 2WUBA 1W10U 1TX6A 2G4UA 5E0JA 5F8ZA 5EQRA 2GCHG 2ZU1A 2D1JA 3RXMA 4GPGA 4NIXA 4ZHMU 9ESTA 1G9IE 3BSQA 1AB9C 2FESH 1W14U 2A4RA 2J38A 5LPRA 1GMHF 1OP2A 3MU1A 4CRCA 4UD9H 3B9FH 4QT8C 3MO9A 4ISNA 1NRSH 1F2SE 1GJ8B 3CENA 2GMTB 1UTPA 2RCEA 1GBBA 1K1IA 3R3GB 1SGFA 1AKSB 3A7WA 1QRZA 1EOLA 5GXPA 2F91A 2V0BA 1CQQA 2OUAA 1K21H 4H6SB 1TQ7B 3E90B 4O03A 4RKJB 1K1MA 1RTKA 1K1OA 4YLUA 1WUNH 2CHAB 2B5TB 4Y8XA 4OGXA 1MAYA 1TFXA 2ZGHA 4NFFA 7ESTE 2XWBI 1SQTA 2BXUH 2TGDA 4ZUHA 4GUXA 1PQ7A 1MTWA 1S81A 1UVSH 1UVPA 3QTVH 1ANCA 2F83A 3ATWA 4TY6A 3ZVBA 3GICB 3MWIU 1BA8B 2FZZA 1GBKA 4LZ1H 1THSH 1A2CH 5H4IB 3VGCC 3SU1A 2R3UA 1HYLA 5JDUB 1H4WA 1FIZA 2BLVA 3M36A 4JZEH 3KNXA 4A7IB 5T3HA 1YP9A 4A92A 1BTZA 3SNBA 4E06H 1IQHA 1P05A 4X2YA 1F92A 3MU5A 1C2GA 1C1UH 4FVDA 2OQ5A 2Z3DA 1IHTH 4OS1A 3TH2H 3S7HB 1SFIA 2O8LA 1EAXA 4CH8B 1IHSH 1O2WA 3FZDA 3QZQA 3GY7A 1XUIA 3PROA 1O2TA 1M9UA 2D2DA 3SJOA 1GBEA 4I31A 1FIWA 1WBGB 4LOYH 4FUHA 3V0XA 3MO3A 1RJXB 2K1QA 4WXVA 3RXIA 1UK4A 5TCCA 2FOEA 1FY5A 1O3AA 2ZU5A 5FCKA 4Y7AA 1C2FA 1G2LA 1XKBC 4WH8A 3QZRA 3H7OA 5C1UA 1NC6A 4NSVA 4CR5A 1BBRE 5FBEA 1Y3XA 2Y5HA 1GHZA 5AFYH 1CA0C 2ZU2A 4D8NA 5JB8S 1IQFA 2WPIS 1KXBA 2P59A 3VXEH 2P8OB 1VITG 1C5LH 1WYKA 1KXAA 3MU0A 5DJ7A 3SNEA 3A88A 1TA6A 2ANMH 4YOIA 4AN7A 5AFZH 1UVTH 3ZVGA 1GMDF 3VFEA 2VWNA 4XBBA 1IQGA 1PPFE 5K7RA 4YOJA 1GJ6A 5B6OA 2FOAA 3TK6A 2ZCLP 5C1XA 2P94A 2SNVA 5EW1H 4IC5A 1IQNA 1FAKH 1ZGVA 3PO1C 1OYTH 1SG8B 3QX5H 4Y7BA 1EPTB 3CS0A 2VWOA 3UWJH 2G81E 4O97A 1C2IA 4Y10E 4NA8A 5DP6A 5EPNA 4B75A 1SGTA 1J15A 1ABIH 1MQ6A 1KLIH 3U9AH 3TNTA 1EP6A 2FYQA 2VGCC 2R9PA 2YOLA 1SOZA 1SLVB 2PW8H 3T5FH 1CBWB 4INKA 1NFWA 3ELAH 3SOSA 5FX6A 2BY9X 3SGQE 1E34B 1LHGH 1K2I1 1SSXA 2FOCA 3TVJB 4X8VH 1ZRBA 1O3CA 3BEIB 1HAVA 2PKSB 1FUJA 3PMBB 1GI6A 3Q3YA 2A7JA 3EA7A 4GLYA 3EDXB 1V2NT 1EZXC 2FTMA 3KL6A 2ZCKP 2W7SA 4YO9A 4Z0KA 1MD7A 1TNLA 1ZGIA 3NWUA 2ZHEH 3STIA 4MNVA 1QURH 1CHOG 1XVOA 5GPIB 1TAWA 3M5OA 1AI8H 1FMGA 3BN9A 1Y5UT 5FHTA 1ZTKA 3FFGA 5EQQA 4JYUH 1L4ZA 4TY7A 1IQEA 2C8ZB 3SV7A 4AFZA 1F0SA 1MU6B 1ETSH 2ULLA 3BG8A 3PTBA 3OX7U 1O3LA 3MU8A 3GCHC 1Z8RA 1SMFE 3RXOA 1O2UA 3CP7A 1NU9A 1LVOA 2R0LA 1J17T 1TGSZ 3RMLH 2GKVE 3F9GA 5TJXA 2C8XB 5DP4A 3QWCH 3HK3B 2NU4E 1FDPA 2Y5FA 4AB9A 2A0QB 1HJ9A 2A2QH 3A7TA 2Y81A 2A31A 2HOBA 2SGQE 1PQ5A 1HAVB 2W3IA 1K22H 1WQSA 2FPZA 2BDYA 2BX4A 4B71A 1BBRH 1EJNA 4VGCB 1FY1A 2G00A 1DWEH 1JWTA 5DGJA 1ETRH 5HGGA 1BB0B 1HUTH 1QA7A 4Y11E 3ZZDA 1C4U2 1RXPA 3QDZB 1GBIA 2PWXA 2O8MA 1W2KH 1AE5A 1GI7B 5J4SA 3U8TH 2BOKA 2WPMS 5SGAE 2Q1JA 1BTWA 1LVYA 3NPSA 3A8DA 3ZZ5A 1NRRH 1PJPA 6GCHG 2WPJS 3BTFE 1HAHH 3T28A 2C93B 1AQ7A 3RLWH 2QC2A 3ZZBA 2ZHQH 2FYRA 4U32A 1BTHH 1SGNE 4AFUA 1G37A 1QL7A 4Y0ZE 3Q3XA 1O38A 4ISLA 2F9OA 1NU7B 1CHGA 4JK5A 1LPKB 1BTPA 2ZFQH 1NPMA 3S0NA 4K1TA 2NU2E 2FI4E 4X6NA 3PMJA 4HGCA 4O3TA 3SUFA 3UNQA 1MCTA 2FTLE 3MU4A 5L2ZH 1UTKA 3SHCH 4RSPA 1HAYB 3NXPA 4E7NA 4THNH 2VIQA 1TA2A 1JIMA 1GHAG 4FUEA 1MKXH 3UOPA 2BDCA 1F0UA 4MQAA 4X6OA 1IAUA 4CBOA 4TPYA 4D7FA 2J94A 2ZPRA 1EB2A 4IN1A 1AFQC 2ZFFH 1Z6EA 1MTSA 3STJA 2CV3A 4AYYB 2F9VA 1KXFA 2F9BH 1BZXE 2ZDAH 5JYIA 1O3KA 1XXFA 3FANA 5GDSH 3B23B 3PMHB 1GG6C 2D26C 5ABWA 1QL9A 4ZH8A 3ZZ9A 3TGJE 2BY8X 1KDQB 1O2VA 2BMGB 2VU8E 3TK9A 2TBSA 2ZDNA 2GX4A 4BAQB 4K60A 3TGKE 3UUZA 3LDXH 2JETB 1VR1H 4NA9H 4ABDA 2G4TA 2XC0A 3RC4A 1TPSA 4ZXXH 4AX9H 2AMDA 1BITA 1TMBH 1C1VH 1CA8B 1Z8GA 5FX5A 2EEKA 4GVUA 1UCYK 2F9UA 4KKDA 5A8ZA 1XM1A 1A1RA 2BD5A 1BTYA 1FZZA 5GJ4B 1GDNA 5HMAA 5DP3A 1RGQA 2ZI2H 3TGIE 2TGTA 2ZDMA 1FAXA 1T4VH 3F9EA 4AG1A 2AYWA 1TNKA 1O0DH 1CGIE 2FIRH 1BDAA 1SLXB 3LT3A 4K5ZA 4MPXA 4X2XA 3VB7A 5G4BA 1O3OA 1EJAA 1G3DA 1O2XA 3MTYA 4A1TA 4X1PU 1TOMH 1UTNA 1J16A 3RLYH 3NZIA 5A8YA 8GCHG 1XUGA 1SR5C 3BTWE 1EXFA 2VIWA 1UTOA 3PMAB 1Z7KA 1U6QA 1C1RA 4K1EA 6LPRA 2AFQB 1O2HA 3U8RH 3UREA 2QN5T 2ANKH 2ESTE 4ZKRU 1GBMA 1GCDA 1RS0A 3GYMA 1OPHB 3HPTB 1IQMA 3LONA 5EXLA 3QN7A 1ABJH 3OSYA 4GSOA 3DFLA 1O3FA 1AUJA 4ABIA 1OS8A 5DP8A 1BMAA 2PSXA 4GAWA 1YLCA 3RC6A 3AW1A 1P02A 3N7OA 2H6MA 1GMCF 1O2ZA 5FPYA 4OS2A 1CT2E 2SGPE 1TOCB 3DD2H 2Z6BD 4IN2A 2QXJA 3RMOH 1F5RA 1FPHH 3LU9B 1MTUA 5EXNA 2XNIA 1A4WH 4IC6A 2IJOB 3DT0H 1C1WH 3SUDA 8LPRA 3SU2A 1DX5M 2UUKB 3TH4H 1O2QA 2QIQA 3RC5A 1VGCC 3RXCA 1A5IA 1AVGH 1SB1H 5EOKA 3LOXA 1O3JA 1P12E 1DLEA 1L2EA 1BCUH 3GY2A 1A3EH 1J9CH 2O8WA 4D9RA 2BD9A 4NFEA 4ABFA 2ZHFH 3SU3A 4ABGA 1QBNA 1GJDB 1FONA 2J95A 3M5LA 3BEFB 1QA0A 4UDWH 2ALVA 1SVPA 1P2JA 1VITH 3ZVEA 1C5PA 1TBZH 1TLDA 1X7AC 5CHAC 5IYTA 3RXSA 4B74A 1FY3A 4Y0YE 1NY22 2UUFB 2GDDA 1A46H 3RXEA 1CT4E 1N8OB 1GWAA 2G5VA 5EQSA 3RXFA 4I8LA 3TJUA 4CH2B 1P2KA 1P10A 1VCPA 1O31A 1PPHE 1B7XB 1ZMJA 4TWWA 1UTJA 2DE9A 1TNHA 2Y7XA 3V12A 3JZ2B 3Q00A 2CMYA 3LC5A 2VIVA 3RXRA 1QL8A 6CHAC 4TPIZ 3O8CA 2BB4A 1EZQA 2ODPA 4INLA 3D23A 1AUTC 3SV9A 2HRVA 3SJ8A 1BJVA 3LPRA 1MTVA 2A4QA 3ATIA 4NSYA 1SPJA 3MFJA 4OS4A 2CXVA 1SHHB 1ELTA 4U30A 5C3NA 2NWNA 1PPBH 1HBTH 3U98H 5C5NA 1ANDA 1V2UT 1D6WA 2PSYA 2A4GA 5HYOA 1FN6A 2Z9KA 4AZ2B 5I25A 4OS6A 4DVAU 3M61U 2VIOA 6ESTA 2NU1E 1ELAA 1NFYA 1Z8IB 1WCZA 2ZU4A 3JZ1B 1UHBA 4K8YA 2VNTA 4CRGA 2IOTA 1SLWB 2W26A 3RXVA 3OU0A 3PWBA 1GBCA 4I8JA 5EODA 2PTNA 4YOGA 7LPRA 4NIYA 4Y76A 1GL0E 1T32A 2QA9E 2ODQA 4WMDA 1YCPK 3KN2A 4CRBA 1LPGB 2ZHWH 1TGTA 2STBE 3DA9B 3ZZ6A 2HLCA 3FP7E 1AHTH 1P2QA 1O5DH 1V2QT 5A0AE 1GJ9B 4AB8A 1GBHA 2WPLS 4NGAH 1GBFA 5EPYA 3VB5A 3RXKA 1HJAC 1SGEE 1QCPA 3KHVA 3SGAE 1FNIA 3RXUA 3SBKA 5A09A 1VJAU 1GBLA 2BXTH 1NS3A 2CGAA 4BAHB 1SBWA 1S84A 3T27A 3A86A 2BDHA 3GCOA 2A2XH 2GCHF 1S83A 1B0FA 1AU8A 1ANEA 5DP5A 1KY9A 1L1GA 1ORFA 1V3XA 1IQLA 1ZJKA 2G8TA 2BM2A 4X1NU 1C2MA 3BTEE 3IG6B 4LZ4B 3SUGA 3UNRA 1GDQA 1W3CA 2WYJA 1OWIA 4CRDA 1LVBA 1PYTD 2P3UB 1THRH 3MNBA 4CHAC 3RDZA 4NIVA 1UHBB 3KCGH 2FM2A 1EPTA 3B8JA 1ESTA 1NTPA 1O5CB 1GHVH 1O2IA 3SW2B 1MKWH 1TX7A 3A87A 3RUOA 1KSNA 2GT8A 3MHWU 2HPPH 2OC1A 3Q3KA 3Q77A 3URDA 1XUJA 2FMJA 5FBIA 3M3SA 4H6TA 5JBCS 2HNTF 1GMDG 2FLBH 2BDBA 3BG4C 1C9PA 1LCYA 1LQEA 1TE0A 3ZZCA 2ZZUH 3UNSA 1C5RA 1XVMA 3A7ZA 2O8TA 4E7RG 1NROH 1SGYE 1D9IA 2BY7X 1F7ZA 3VB3A 4FXGH 3EYDA 1GCTC 2H9HA 1ARBA 1D3TB 1SC8U 2XYAA 3RXGA 1LTOA 3UQOA 1ELFA 1O2KA 5GCHF 4IBLH 2XCNA 1O2GH 1TX8A 5F8TA 3ATMA 2J34A 2BDAA 3BV9B 1ZPZA 1AVXA 1RTLA 1ZR0A 3A84A 1GI5A 3G01A 1SQOA 4XBDA 4JZDH 2BD7A 1Y8TA 2FS8A 2ODYB 8ESTE 1HAIH 3M5NA 2VJ1A 1OWHA 1EAWA 4SGBE 1C2HA 2BLOA 2EI8A 1DFPA 1O2PA 4DGJA 1ANBA 2VVVA 1DXWA 1KIGH 4K69A 1UJ1A 4X6MA 3O8RA 1KYNA 4UFFH 1Y3VA 2H1UA 3A85A 2BQWB 5E2PA 4WF8A 1MQ5A 3D65E 5FAHA 1VITF 1D3QB 2G55A 1HIAA 3ZVAA 1ZTJA 2VWLA 4IMQA 5TCAA 1QB9A 2Y5GA 4CRAA 2SGDE 1HPGA 3CS7A 1E37B 4INHA 5DPAA 1P9SA 1FY4A 2GTBA 3HKIB 3A82A 4K3JA 2WUCA 2P93A 1Y3WA 3SO3A 1HCGA 3HKJB 2AS9A 1EUFA 5C67A 1TQ0B 3GY3A 3NCLA 1SLUB 4AGJA 4D9QA 1Y5BT 1GVLA 2OINA 5JBBS 2QF3A 1NO9H 2ZDVH 1AD8H 2LNCA 1GBJA 1K9OE 4ZKOU 5C1YA 2BX3A 1GGDC 3HK6B 4ZAEA 4NZLA 2GCTC 1QRXA 1RIWC 4NG9H 4JZFH 1MTNC 4I7YH 1O5GH 4RN6A 2Z7FE 4ABEA 1SGPE 2Z9GA 4CREA 3LIWA 1DICA 3S9BA 1C5WB 1ESBA 4MG3A 1LVMA 1YKTA 1G30B 1C5VA 3E8LA 5C2ZA 3UTUH 2LPRA 2WINI 2FOFA 2AMPA 1C1NA 4OGYA 4JZ1A 1QQ4A 1C5SA 1DWCH 1KLJH 1ESAA 1WTGH 2ZDLA 1HIAB 1BOQA 1AE8H 1QBVH 1W0YH 2XWAA 1JRTA 1K1LA 3TU7H 3ZVCA 2ZF0H 1TGBA 2V3HH 2BY6X 3QTOH 4ASHA 2W3KA 2ZPSA 3SU0A 2SNWA 1OKXA 3TITA 4H4FA 4DG4A 1TABE 2ZQ2A 5C5OA 1MAXA 3K6YA 2UUJB 3M7UA 1TGNA 1TIOA 3LH3A 1GHBG 1NFXA 2OD3B 4NCYA 3ZV9A 1XKAC 1V2JT 1AB9B 1ZLRA 2DE8A 2XXLA 3A8CA 1O2MA 1V2VT 2SGFE 2FO9A 3UFAA 4MVNA 1P2NA 3QK1A 1EATA 1BTUA 2OBOA 1O33A 4J1YA 3GY8A 2P16A 3KF2A 1T7CA 5ESBA 1SGFG 5EXMA 1EX3A 1TRMA 5HXFA 2BLWA 1S82A 5DP9A 3I77A 2OTVA 1DUEA 1JIRA 1FV9A 5T6DA 2H2ZA 2F9PA 3SNDA 2A45B 1C1SA 2ZHDA 1KDQA 1V2TT 2A7CA 3ATKA 1QRWA 1ZSKA 2GZ9A 3BTQE 2ZO3H 1Z8JB 4BAKB 3SN8A 1S6HA 1F5LA 1OWJA 1KXDA 1TNGA 5F8XA 7GCHF 1JXPA 1DPOA 3EAJA 4XOJA 1YPHC 3W94A 4MPVA 3F68H 2XRCA 1DDJA 4B76A 2AEIH 2ZGJA 1Z6JH 3VGCB 1ZPBA 3TPIZ 1NESE 1UVOA 2DUCA 4UE7H 3MMGA 4LK4A 4CBNA 5FXLA 2ZFTA 1DITH 4XFQA 1TNIA 2G5NA 1WOFA 2QY0B 2CF9H 2WYGA 3RXQA 3RXHA 4AYVB 3PLPA 4NWLA 1B5GH 4B73A 4Y79A 1PPZA 4M7GA 2JKHA 1GHWH 4TYDA 4ZXYH 1VCQA 3RXJA 3RU4E 2QAAA 1AY6H 4NZQA 2HPQH 3LGUA 1O3MA 1YCPM 1C5YB 5C20A 5JPMH 5EW2H 4XDEA 5AF9H 1EP5A 2CN0H 3P70B 6GCHF 5HM9A 2GMTC 4X6PA 1A7SA 1L1JA 1QY6A 2BDGA 1H8IH 4IGDA 3TJVA 3SZNA 4CRFA 2IN2A 4XE4A 3D49H 4D76A 3SJ9A 3UR6A 2H5DA 4J2YB 3T26A 4AFQA 4WH6A 1CGJE 1UCYE 2TPIZ 3E0NB 2XBYA 1FY8E 3GCTG 1GI0A 1GHYH 2AMQA 2CHAC 3BTGE 5ETXA 2VVUA 1Q31A 1CA0B 2JH5D 3SNCA 5LH8A 3WY8A 3KQEA 4BXWA 4X8UH 3SV2H 3SU5A 1DUAA 3QO6A 3PB1E 1G2MA 2PTCE 4X8TH 1MD8A 2GT7A 2ZQ1A 4B2BA 4IMZA 1SGRE 3DFJA 3AW0A 1N1LA 1T8OA 1O2YA 1NRNH 2Z9LA 1HXEH 3BTDE 1A0LA 3UY9A 3SQHE 1Q2WA 1DSUA 1DLKB 1DSTA 4GCHG 2B0FA 4DOQA 1GL1A 1PYTC 3ZVDA 3PO1B 1DXPA 1TBRH 4AFSA 3L33A 4WY3A 2FDAA 1F0RA 1VCWA 2AGIX 4UFGH 1OX1A 4F4OC 1O2JA 4I8GA 1TPOA 2XCFA 1GI3A 1YPKH 4I33A 3H5CB 2VGCB 2TGPZ 1K1NA 2UWOA 1INCA 1DWBH 1V6DA 2FS9A 3VB4A 2UWPA 4YLQH 1MBMA 1J14A 1AIXH 3R0FA 3QGJA 3GYLB 4FUJA 1WU1A 1D4PB 1TRNA 3SV6A 2Z9IA 4ESTE 2TIOA 4CR9A 1GBTA 2UWLA 1SFQB 2GZ7A 1EOJA 3VB6A 4WMFA 2P3TB 3AAVA 4BXSA 1O32A 2XBXA 4BNRA 1O3EA 1GVKB 3PTNA 4MLFB 1NRQH 2P3FH 2P8OC 2ZU3A 5HM2A 4A1XA 3E16B 2ZECA 3PWCA 1TB6H 1O3DA 4BAMB 3SI3H 1O30A 4O9VA 4JZIA 3QGNB 1H9HE 5F6MA 5PTPA 4BTIB 3SORA 1JRSA 1NFUA 1P3CA 3MNSA 1LHFH 1PPGE 2A7HA 1LHCH 3SI4H 1MH0A 4Q7YA 8GCHF 5F03A 4ISIH 1GI4A 3SJKA 2HVXA 4AGKA 3C27B 1EPTC 1C2EA 5AVDA 3GCHB 2FX4A 2KAIB 3SHAH 1A5HA 4ABHA 4ABAA 3OYPA 2D8WA 1BRBE 3P17H 3GDSA 1ZMNA 5AHGH 2OC7A 3A81A 2BTCE 1OYQA 5A8XA 1G3BA 1XMNB 1CBWC
chains in the Genus database with same CATH superfamily
1EAUA 1P11E 3UPEA 1O3IA 1BHXB 3TH3H 3F3BA 5E8EH 1S0QA 1GI9B 1WV7H 2WPHS 3O8DA 4HG6A 3ZVFA 1HAPH 2J2UA 1W13U 2QF0A 3OEHD 4O3UA 3RU4D 1O2NA 1TONA 4D7GA 1J8AA 2C3SA 1WTHD 1BT7A 1EJMA 1O3HA 1QJ1B 1UCYH 2PKSC 4KGAA 1TRYA 5A0BA 1O34A 1ZYOA 1HXFH 3I78A 3PM3A 1QHRB 1V2PT 1DOJA 1Y3UA 2Z9JA 4UEHH 2STAE 4X8SH 4TWYA 1T31A 4X2VA 1OXGA 3BF6H 4ZMAH 1XXDA 1D3PB 4MNYA 3HGPA 5B6LA 1COWD 3LGVA 2XC4A 1KTSB 2AHME 1E36B 3DUXH 1OP0A 1QB1A 1TALA 1ZOMA 3SZEA 5EU8A 4KP0A 1OWKA 1HDTH 4HFPB 5I46H 3TJNA 2AIPA 1BJUA 1GMHG 1BRUP 3GY6A 2ILNA 3LH1A 2FI5E 1YPLH 2KFWA 2V6NA 3UOUA 4FUGA 1GJCB 3SQEE 1MKWK 3BTKE 2XC5A 1EAIA 4IW4E 1O2SA 1HGTH 1WQVH 2G51A 3E91A 1FPCH 1TPAE 5EGMA 2C8YB 2ZIQH 4AORA 3DSGA 4WXIA 3BEUA 5E0HA 2BD3A 1MUEB 1RRKA 2BD2A 2FODA 3QUMP 4LXBH 4RKOB 1Z71A 1GJBB 4H42U 1TYNA 1PQ8A 1QBOA 1TMTH 4GHTA 3RM0H 2OC0A 1TGCA 4DJZB 1GI1A 3OTJE 1P06A 1YYY1 3SU6A 4Z6AH 1CT0E 4DIIH 1GBAA 4OS7A 2EI6A 2GVFA 1YGCH 1G32B 1GJ7B 4E05H 1ELVA 3UIRA 4YT7H 3UWIA 5CMXH 4K2YA 2BQ6B 1HJ8A 1P03A 2FLRH 1O39A 5CDFE 3V3MA 3F1SB 5DN6D 1BUIA 1DVAH 1OWDA 4VGCC 2PR3A 5JBTA 4X1QU 1CE5A 1O37A 3V7TA 1UVUH 2XBVA 1MU8B 4B1TA 4DW2U 4NA7A 3MH4A 1LPZB 5EG4A 4AOQA 2R0KA 4KTSA 1C5QA 3FP6E 4JK6A 2QCYA 3K9XB 3VXFH 1OOKB 1UMAH 1T8MA 1AFQB 1QNJA 2KCPA 1O5AB 3VEQB 1IQIA 3PLKA 1GHXH 1GDUA 1Z1IA 3LGIA 1ZSLA 1A5GH 1MBQA 1ELDE 1GG6B 4I32A 1V2LT 1BRAA 1XUHA 1A0HB 3A7VA 1FI8A 3ODDA 4SGAE 1SGQE 1G3CA 2BD4A 1YF4A 1UTMA 3L3TA 3UQVA 1P2IA 1ZZZA 4KELA 2J92A 2SGEE 4MDSA 1P3EA 2QXHA 1C1OA 4ISOA 3M35A 4YESB 4AG2A 3U1IB 4BTUB 2ZCHP 4JMYA 2RG3A 1C2KA 2WV5A 3ZV8A 4U2WA 1A0JA 2JDID 1RD3B 2XW9A 3A83A 3A8AA 2CJIA 2XTTB 2ANYA 2K8IA 4BAOB 1VZQH 4DCDA 2A5IA 3ITIA 2H9EH 2FWWA 2HWLB 2R2WU 3TK5A 4HZHA 2QF4A 3P92A 7KMEH 5GCHG 1QIXB 1E38B 2BVXH 3WW7A 2J9NA 2M5TA 2OC8A 1P04A 2CF8H 1SQAA 3TLOA 2G52A 4I8KA 3LGTA 2L6OA 3KGPA 2BY5X 2OBQA 3FKSD 1S0RA 1TPPA 1PPCE 1Y3YA 2PFEA 4Q7ZA 1ZJDA 1ZMLA 1LHDH 4ZKSU 1DY8A 4BANB 1XX9A 2RDLA 4NWKA 4PROA 1FJSA 4YTAA 2RA0A 3D62A 5GIBA 2PHBA 1B0EA 1ETTH 1NBMD 3M37A 1F0TA 4ABBA 1ZSJA 1P01A 3L6PA 2ZDKA 1BMNH 3LGWA 3ZZ3A 3EGKH 2YNAA 1BIOA 2PUXB 3NK8A 5K0HA 3EA9A 1NRPH 4Q7XA 4ACBA 3GY5A 3DCLA 2KR7A 3MOCA 4IS5A 4K8BA 2ZEBA 3F0OA 3A8BA 4UONA 4UFDH 1HAXB 1SHYA 4RT0A 2JETC 1PFXC 2QXGA 3RXLA 1GI8B 3RXPA 1G36A 1EZSC 2PLXA 4BOHA 1LQDB 4FUBA 2FXRA 2AGGX 5BRRE 1S6LA 1NM6A 2ZG0H 3P8NA 3M7TA 3ODFA 1DE7H 1YCPH 4B2CA 2OCVB 1K28D 2Z3CA 2BZAA 2SGAA 4DY7B 3A89A 1BBRK 1W0ZU 1ELEE 1K1JA 1C5UA 1BHXF 2VB0A 2BOHB 1MZDA 2VWMA 3MYWA 1DT2A 3F9HA 3OY5U 3M7QA 2AH4X 1KLTA 3H09A 1FN8A 2EI7A 1VGCB 2Q6DA 1EASA 1FQ3A 1IQKA 2R3YA 1HRTH 1YPGH 1H9LB 1AO5A 1Q3XA 1P57B 2ZFPH 4R8TB 2BHGA 3LGYA 4U01A 3OTPA 1ZHMA 1F5KU 2I6QA 3HGNA 1Y5AT 3W1EA 5A0CA 2ZGCA 1TNJA 2XBWA 2PGQB 3ZZ4A 1S85A 3SGBE 3FAOA 1T4UH 3PRBA 5FCRA 2GD4B 1BMLA 4I8HA 1QJ7B 1W11U 2GV6A 1CU1A 2BVSH 1DM4B 1NN6A 1N6XA 1SOTA 1OSSA 1YC0A 1P09A 2A5KA 3DHKH 3F2FA 1FLEE 1UTQA 3OY6U 4Y6DA 5CHAB 3S7KB 5J4QA 1A3BH 3E1XB 2PGBB 1ZHRA 3SU4A 1GJ5H 2HNTC 2A32A 1ZTLA 4TT3D 3U1JB 3F2GA 2PUQH 5T1VA 5T6GA 1ZRKA 3TJOA 3QLPH 3FZZA 4Y8YA 3URCA 3MH5A 1DS2E 1YPEH 3ZZ7A 4MPUA 1Z1JA 2V35A 4WJG2 1EZUC 4JYTA 1VJ9U 1C9TA 2VH6A 6CHAB 4Q80A 1XUFA 3GCNA 1WAYB 4ZROA 3NKKA 4B2AA 2PV9B 2OXSA 3E0PB 1AZZA 2FEQH 4OM9A 4FUDA 5L6NH 3BTME 1RTFB 5DG6A 2VIPA 3IWMA 1JOUB 1MKXK 1O3GA 4XSKU 2ALPA 2ANWA 4Y8ZA 2A4OA 1SGIB 3BIUH 2C4FH 2THFB 1NT1A 3MNXA 4MNXA 1QFKH 1C2JA 2QGRA 1YPMH 5E2OA 1O2RA 1CHOF 1OWEA 3P8OA 1P2OA 5BPEA 2WV4A 3A7XA 1EKBB 1HB0B 3OFND 4JYVH 2UUYA 5E0GA 1S5SA 1PQAA 1V2OT 1DANH 2Y6TA 2OK5A 2ZC9H 4BTTB 2Y7ZA 2BYAX 2FP7B 5DK1A 2J98A 4FU9A 2ZP0H 7GCHG 1A61H 1CO7E 1WDIA 4JCNA 1SI5H 2W5EA 1N8OC 4YM9A 3AVZA 1YPJH 3Q76A 3PV4A 1L0ZA 2WPDD 4ZKNU 1N6YA 2O8UA 1O5BB 1LO6A 1ID5H 9LPRA 1L4DA 3E6PH 2HNTE 1AVWA 1W12U 4Q2KA 2Y82A 3MO6A 2ZA5A 4K1SA 3T29A 2TGAA 1SL3A 3ZYDA 2ZTYA 3TIUA 1AGJA 4R0IA 3AASA 3ZYEA 2ZNKH 2H5CA 5DKMA 3NUMA 1V2WT 1HJAB 1MCVA 3SUEA 2C8WB 1GPZA 3SV8A 2BLQA 3GISB 1H9IE 1H8DH 4HTCH 2ZPQA 2HGTH 4X1RU 4WMEA 3RXDA 1L1NA 1AFEH 1O2LA 3RP2A 3VPKA 1GHBF 2GDEH 2YNBA 4MTBA 1ZHPA 3RM2H 2FOGA 1GJAB 3SNAA 3KIDU 1FXYA 1SQRA 2PKAA 3PYHA 5C94A 4KTCA 2OP9A 1G3EA 1GJ4H 1EB1H 1GVZA 1IOEA 4FUIA 3EQ0H 2P95A 4HI3A 4CHAB 1XUKA 1TMUH 2W7UA 4X2WA 4ZHAA 1K1PA 1DY9A 1UTLM 4DIHH 5LPEA 2AERH 1HAZB 3SYJA 4DT7B 1C2LA 3OAAD 3PLBA 2OLGA 2Y80A 1C1MA 1GBDA 2GJGA 3FVFB 5T6FA 3IITA 2O9QA 1AN1E 1KXEA 2JH6D 3GOVB 1MMJN 3BG4B 3FP8E 5ESTE 4KTUA 1C5TA 3M3TA 3P6ZB 2GV7A 1E0FD 3ATLA 1CSOE 2Q6FA 1TWXB 2Z94A 3BTHE 3LJJA 5EIYA 5FPSA 1CGHA 5CE1A 2B8OH 5FPTA 3LJOA 1GCTB 4NIWA 1LDTT 1QJ6B 2BVRH 1ELCA 1V2ST 3T25A 3TNSA 2BZ6H 3UR9A 2JH0D 3RXTA 3O8BA 1H1BA 5F53A 2F3CE 2HALA 5DP7A 1HAGE 1LHEH 1CVWH 1BRCE 3M3VA 2R2MB 3RXBA 1ACBE 1O3NA 1C1TA 4FUFA 1QR3E 2PKAB 2V3OH 4X0WU 3MI4A 1PPEE 2I6SA 2ZKSA 1GHAF 4GHQA 2GZ8A 2RA3A 2ZFSA 3RXAA 5GWZA 1YPHE 5DO4H 3KEEA 3P95A 4A5TS 2BDIA 2EC9H 1O3BA 2WPKS 5LGOA 2FOMB 2KAIA 2VH0A 3V13A 4DURA 1BMMH 3RU4T 1GMCG 1V2MT 2A5AA 3MNCA 3ENSB 3KQDA 3W95A 4ISHH 3LKWA 3GCTF 2QYIA 1QTFA 2AGEX 3MH6A 3T2NA 5JB9S 1YBWA 3M5MA 1O3PB 1DWDH 1C1PA 3DSOA 2ZGXH 3LC3A 1UK2A 4WWYA 1HNEE 2VINA 1P0SH 1C5NH 3K65B 3HATH 3KQCA 4A6LA 1OP8A 3S9CA 1QGFA 3BIVH 1O36A 1AWFH 1SGCA 3ZZAA 2B9LA 1AMHA 2QXIA 3KQBA 1P2MA 2SFAA 1JMOH 1S6FA 4X1SU 2C90B 4GCHF 2GP9B 1O5FH 3H7TA 4A1VA 1IQJA 2Z3EA 1O35A 3K6ZA 1D3DB 2IPHA 3K2UA 3RMMH 1UK3A 2ZTZA 2PP6A 1GGDB 2BQ7B 3BTTE 3GY4A 2GCTB 1RIWB 4ABJA 2BD8A 2GGVB 1MTNB 1E35B 1EQ9A 2OQUA 1O2OA 2FOBA 1P9UA 2VVCA 4YT6H 4FOUC 3P8GA 1UO6A 5L30H 1D6RA 3I29A 1TBQH 1C4V2 3RMNH 1KXCA 2QV1A 2NU3E 1AWHB 3S69A 3F9FA 2NU0E 4UFEH 5C0TA 1ELBA 1BTXA 1KTTB 1C5XB 2EA3A 4FVBA 1W8BH 2J4IA 2A1DB 1LKBA 1NZQH 4XBCA 3GDUA 1SGDE 1THPB 1V2KT 1Y59T 2B7DH 5L2YH 3F6UH 2VIDA 4WVPE 1C5OH 8KME2 1ELGA 3E3TA 1W7XH 4MPWA 3SJIA 1C5MD 1RFNA 3MH7A 2H9TH 3U8OH 3T62A 2ZGBH 1LMWB 1P8VC 5C0UA 1HV7A 3N7EA 2ASUB 5A2MH 1C2DA 4FUCA 1ARCA 3ESTA 2JIZD 5JBAS 2ZFRH 4MNWA 2FX6A 1HAOH 4Y71A 1T8NA 4YZUA 1QB6A 1MZAA 3EA8A 1O5EH 5IDKA 4FU8A 3S9AA 3AAUA 2Q6GA 2ZWLH 1AKSA 4FU7A 5LPFA 1C4Y2 2FOHA 1LKAA 1BMFD 1T8LA 2AIQA 3U69H 3ZZ8A 1WSSH 3GDVA 2F9NA 4ZHLU 2TRMA 4F49A 3GS9A 1C5ZB 3A7YA 1YLDA 1YM0A 3P8FA 1ZPCA 1HLTH 4OS5A 3KYGA 1W7GH 3EE0B 1JBUH 1AZ8A 3PV2A 1GI2A 1BQYA 1HFDA 1QQUA 2FI3E 3C1KA 3OE7D 1V2RT 1C1QA 2ZTXA 3A80A 2WUBA 1W10U 1TX6A 2G4UA 5E0JA 5F8ZA 5EQRA 2GCHG 2ZU1A 2D1JA 3RXMA 2CK3D 4GPGA 4NIXA 4ZHMU 9ESTA 1G9IE 3BSQA 1AB9C 2FESH 1W14U 2A4RA 2J38A 5LPRA 1GMHF 1OP2A 3MU1A 4CRCA 4UD9H 3B9FH 4I86A 4QT8C 3MO9A 4ISNA 1NRSH 1F2SE 1GJ8B 3CENA 4Q63A 2GMTB 1UTPA 2RCEA 1GBBA 1K1IA 3R3GB 1SGFA 1AKSB 3A7WA 2HVYB 1QRZA 1EOLA 5GXPA 2F91A 2V0BA 1CQQA 2OUAA 1K21H 4H6SB 1E79D 1TQ7B 3E90B 4O03A 4RKJB 1K1MA 1RTKA 1K1OA 4YLUA 1WUNH 2CHAB 2B5TB 4Y8XA 2W6JD 4OGXA 1MAYA 1TFXA 2ZGHA 4NFFA 7ESTE 2XWBI 1SQTA 2BXUH 2TGDA 2KCYA 4ZUHA 4GUXA 1PQ7A 1MTWA 1S81A 1UVSH 1UVPA 3QTVH 1ANCA 2F83A 3ATWA 4TSFD 4TY6A 3ZVBA 3GICB 3MWIU 1BA8B 2FZZA 1GBKA 4LZ1H 1THSH 1A2CH 5H4IB 3VGCC 3SU1A 1E1RD 2R3UA 1HYLA 5JDUB 1H4WA 1FIZA 2BLVA 3M36A 4JZEH 3KNXA 4A7IB 5T3HA 1YP9A 4A92A 1BTZA 3SNBA 4E06H 1IQHA 1P05A 4X2YA 1F92A 3MU5A 1C2GA 1C1UH 4FVDA 2OQ5A 2Z3DA 1IHTH 4OS1A 3TH2H 3S7HB 1SFIA 2O8LA 2W6ID 1EAXA 4CH8B 1IHSH 1O2WA 3FZDA 3QZQA 3GY7A 1XUIA 3PROA 1O2TA 1M9UA 2KM0A 2D2DA 3SJOA 1GBEA 4I31A 1FIWA 1EFRD 1WBGB 4LOYH 4FUHA 3V0XA 3MO3A 1RJXB 2K1QA 4WXVA 3RXIA 1UK4A 5TCCA 2FOEA 1FY5A 1O3AA 2ZU5A 5FCKA 4Y7AA 1C2FA 1G2LA 1XKBC 4WH8A 3QZRA 3H7OA 5C1UA 1NC6A 4NSVA 4CR5A 1BBRE 5FBEA 1Y3XA 2Y5HA 3PV5A 1GHZA 5AFYH 1CA0C 2ZU2A 4D8NA 5JB8S 1IQFA 2WPIS 4P00A 1KXBA 2P59A 3VXEH 3AK5A 2P8OB 1VITG 1C5LH 3PRDA 1WYKA 1KXAA 3MU0A 5DJ7A 3SNEA 3A88A 1TA6A 2ANMH 4YOIA 4AN7A 5AFZH 1UVTH 3ZVGA 1GMDF 3VFEA 2VWNA 4XBBA 1IQGA 1PPFE 5K7RA 4YOJA 1GJ6A 5B6OA 2FOAA 3TK6A 4F48B 2ZCLP 5C1XA 2P94A 2SNVA 5EW1H 4IC5A 1IQNA 1FAKH 1ZGVA 3PO1C 4RI0A 1OYTH 1SG8B 3QX5H 4Y7BA 1EPTB 3CS0A 2VWOA 3UWJH 2G81E 4O97A 1C2IA 4Y10E 4NA8A 5DP6A 2YMSC 5EPNA 1SGTA 1J15A 1ABIH 4B75A 1MQ6A 1KLIH 3U9AH 3TNTA 1EP6A 2FYQA 2VGCC 2R9PA 2YOLA 1SOZA 1SLVB 2PW8H 3T5FH 1CBWB 1W0JD 4INKA 1NFWA 3ELAH 3SOSA 5FX6A 2BY9X 3SGQE 1E34B 1LHGH 1K2I1 1SSXA 2FOCA 3TVJB 4X8VH 1ZRBA 1O3CA 3BEIB 1HAVA 2PKSB 1FUJA 3PMBB 1GI6A 3Q3YA 2A7JA 3EA7A 4GLYA 4FETA 3EDXB 1V2NT 1EZXC 2FTMA 3KL6A 5EJLA 2ZCKP 2W7SA 4YO9A 4Z0KA 1MD7A 1TNLA 1ZGIA 3NWUA 2ZHEH 3STIA 4MNVA 1QURH 1CHOG 1XVOA 5GPIB 1TAWA 3M5OA 1AI8H 1FMGA 3BN9A 1Y5UT 5FHTA 1ZTKA 3FFGA 5EQQA 4JYUH 1L4ZA 4TY7A 1IQEA 2C8ZB 3SV7A 4AFZA 1F0SA 1MU6B 1ETSH 2ULLA 3BG8A 3PTBA 3OX7U 1O3LA 3MU8A 3GCHC 1Z8RA 1SMFE 3RXOA 1O2UA 3CP7A 1NU9A 1LVOA 2R0LA 1J17T 1TGSZ 1QZ8A 2GKVE 3RMLH 3F9GA 3WWFA 5TJXA 2C8XB 5DP4A 3QWCH 2WV9A 3HK3B 2NU4E 1FDPA 2Y5FA 4AB9A 2A0QB 1HJ9A 2A2QH 3UB0A 3A7TA 5HKKD 2Y81A 2A31A 2HOBA 2SGQE 1PQ5A 1HAVB 2W3IA 1K22H 1WQSA 2FPZA 2BDYA 2BX4A 4B71A 1BBRH 1EJNA 4VGCB 1FY1A 2G00A 1DWEH 1JWTA 5DGJA 1ETRH 5HGGA 1BB0B 1HUTH 1QA7A 4Y11E 3ZZDA 1C4U2 1RXPA 3QDZB 1GBIA 2PWXA 2O8MA 3N7DA 1W2KH 1AE5A 1GI7B 5J4SA 3U8TH 2WZQA 2BOKA 2WPMS 5SGAE 2Q1JA 1BTWA 1LVYA 3NPSA 3A8DA 3ZZ5A 4AC9A 1NRRH 1PJPA 6GCHG 2WPJS 3BTFE 2RFKC 4XD7D 1HAHH 3T28A 2C93B 1AQ7A 3RLWH 2QC2A 3ZZBA 2ZHQH 2FYRA 4U32A 1BTHH 3DSPA 1SGNE 4AFUA 4ASUD 1G37A 1QL7A 4Y0ZE 3Q3XA 1O38A 4ISLA 2F9OA 1NU7B 1CHGA 4JK5A 1LPKB 3OEED 1BTPA 2ZFQH 1NPMA 3S0NA 1UW7A 4K1TA 2NU2E 2FI4E 4X6NA 3PMJA 4HGCA 2XNDD 4O3TA 3SUFA 3UNQA 1MCTA 2FTLE 3MU4A 5L2ZH 1UTKA 3SHCH 4RSPA 1HAYB 3NXPA 4E7NA 4THNH 2VIQA 1TA2A 1JIMA 1GHAG 4FUEA 1MKXH 3UOPA 2BDCA 1F0UA 1VKYA 4MQAA 4X6OA 1IAUA 4CBOA 4TPYA 4D7FA 2J94A 2ZPRA 1EB2A 4IN1A 1AFQC 2ZFFH 1Z6EA 1MTSA 3STJA 2CV3A 4AYYB 2F9VA 1KXFA 2F9BH 1BZXE 2ZDAH 2K0QA 5JYIA 1O3KA 1XXFA 3FANA 5GDSH 4Z1MD 3B23B 3PMHB 1GG6C 2D26C 5ABWA 1QL9A 4ZH8A 3ZZ9A 3TGJE 2EY4C 2BY8X 1KDQB 1O2VA 2BMGB 2VU8E 3TK9A 1YY3A 2TBSA 2GX4A 2ZDNA 4BAQB 4K60A 3TGKE 3UUZA 3LDXH 2JETB 1VR1H 4NA9H 4ABDA 2G4TA 2XC0A 3RC4A 2KX4A 1TPSA 4ZXXH 4AX9H 2AMDA 1BITA 1TMBH 1C1VH 1CA8B 1Z8GA 5FX5A 2EEKA 4GVUA 1UCYK 2F9UA 4KKDA 5A8ZA 1XM1A 1A1RA 2BD5A 1BTYA 1FZZA 5GJ4B 1GDNA 5HMAA 5DP3A 1RGQA 2ZI2H 3TGIE 2TGTA 2ZDMA 1FAXA 1T4VH 3F9EA 4AG1A 3F0PA 2AYWA 1TNKA 1O0DH 1CGIE 2FIRH 1BDAA 1SLXB 3LT3A 4K5ZA 4MPXA 4X2XA 5KEDA 3VB7A 5G4BA 1O3OA 1EJAA 1G3DA 1O2XA 3MTYA 4A1TA 4X1PU 1TOMH 1UTNA 1J16A 3RLYH 3NZIA 5A8YA 8GCHG 1XUGA 1SR5C 3BTWE 1EXFA 2VIWA 1UTOA 3PMAB 1Z7KA 1U6QA 1C1RA 4K1EA 6LPRA 2AFQB 1O2HA 5EJZA 3U8RH 3UREA 4YXWD 2QN5T 2ANKH 2ESTE 4ZKRU 1GBMA 1GCDA 1RS0A 3GYMA 1OPHB 3HPTB 1IQMA 3LONA 2JJ1D 3QN7A 5EXLA 1ABJH 3OSYA 4GSOA 3DFLA 1O3FA 1AUJA 3MQKC 4ABIA 1OS8A 5DP8A 1BMAA 2PSXA 4GAWA 1YLCA 3RC6A 3AW1A 1P02A 3N7OA 5KECA 2H6MA 2M2AA 1GMCF 1O2ZA 5FPYA 4OS2A 1CT2E 2SGPE 1TOCB 3DD2H 2Z6BD 3NRLA 1H8ED 4IN2A 2QXJA 3RMOH 1F5RA 1FPHH 3LU9B 1MTUA 4M9FA 5EXNA 2XNIA 3FN8A 1A4WH 4IC6A 2IJOB 3DT0H 1C1WH 3SUDA 8LPRA 3SU2A 1DX5M 2UUKB 3TH4H 1O2QA 2F4LA 2QIQA 3RC5A 1VGCC 3RXCA 1A5IA 1AVGH 1SB1H 5EOKA 3LOXA 1O3JA 3VG8A 1P12E 1DLEA 1L2EA 1BCUH 3GY2A 1A3EH 1J9CH 2O8WA 4D9RA 2BD9A 4NFEA 4ABFA 2ZHFH 3SU3A 4ABGA 1QBNA 1GJDB 1FONA 2J95A 3M5LA 2WHXA 3BEFB 1QA0A 4UDWH 2ALVA 1SVPA 1P2JA 1VITH 3ZVEA 1C5PA 1TBZH 1TLDA 1X7AC 5CHAC 5IYTA 3RXSA 4B74A 1FY3A 4Y0YE 1NY22 2UUFB 2GDDA 3FOAA 1A46H 3RXEA 1CT4E 1N8OB 1GWAA 2G5VA 1NBME 5EQSA 3RXFA 4I8LA 3TJUA 4CH2B 1P2KA 1P10A 1VCPA 1O31A 1PPHE 1B7XB 1ZMJA 1FX0B 4TWWA 2KZ4A 1UTJA 2DE9A 1TNHA 2Y7XA 3V12A 3JZ2B 3Q00A 2CMYA 3LC5A 2VIVA 3RXRA 1QL8A 6CHAC 4TPIZ 3O8CA 2BB4A 1EZQA 2ODPA 4INLA 3D23A 1AUTC 5IK2D 3SV9A 2HRVA 3SJ8A 1BJVA 3LPRA 4ZCNA 1MTVA 2A4QA 3ATIA 4NSYA 1SPJA 3MFJA 4OS4A 2CXVA 1SHHB 1ELTA 4U30A 5C3NA 2NWNA 1PPBH 1HBTH 3U98H 5C5NA 1ANDA 1V2UT 1D6WA 2PSYA 2A4GA 5HYOA 1FN6A 2Z9KA 4AZ2B 5I25A 4OS6A 4DVAU 3M61U 3N99A 2VIOA 6ESTA 2NU1E 1ELAA 1NFYA 1Z8IB 1WCZA 2ZU4A 3JZ1B 1UHBA 4K8YA 5HIZA 2VNTA 4CRGA 2IOTA 1SLWB 2W26A 3RXVA 3OU0A 3PWBA 1GBCA 4I8JA 5EODA 2PTNA 4YOGA 5KGOA 7LPRA 4NIYA 4Y76A 1GL0E 1T32A 2QA9E 2ODQA 4WMDA 4B6EA 1YCPK 3CNRA 3KN2A 4CRBA 1LPGB 2ZHWH 1TGTA 2STBE 3DA9B 3ZZ6A 2HLCA 3FP7E 1AHTH 1P2QA 1O5DH 1V2QT 2LELA 5A0AE 2HLDD 1GJ9B 4AB8A 1GBHA 2WPLS 4NGAH 1GBFA 5EPYA 3VB5A 3RXKA 1HJAC 1SGEE 1QCPA 4XRNA 3KHVA 3SGAE 1FNIA 1YLNA 3RXUA 3SBKA 5A09A 1VJAU 1GBLA 2BXTH 1NS3A 2CGAA 4BAHB 1SBWA 1S84A 3T27A 3A86A 2BDHA 3GCOA 2A2XH 2GCHF 2V3MA 1S83A 1B0FA 5FL7D 1AU8A 1ANEA 5DP5A 3EE7A 1KY9A 1L1GA 1ORFA 1V3XA 1IQLA 1ZJKA 2G8TA 2BM2A 4X1NU 1C2MA 3BTEE 3IG6B 4LZ4B 3SUGA 3UNRA 1GDQA 1W3CA 2WYJA 1OWIA 4CRDA 1LVBA 1PYTD 2P3UB 1THRH 3MNBA 4ACAA 4CHAC 3RDZA 4NIVA 1UHBB 3KCGH 2FM2A 1EPTA 3B8JA 1ESTA 1NTPA 1O5CB 1GHVH 1O2IA 3SW2B 1MKWH 1TX7A 3A87A 3RUOA 1KSNA 2KCAA 2GT8A 3MHWU 2HPPH 2OC1A 3Q3KA 3Q77A 3URDA 1XUJA 2FMJA 5FBIA 3M3SA 4H6TA 5JBCS 2HNTF 1GMDG 2FLBH 1YWUA 2XOKD 2BDBA 3BG4C 1C9PA 1LCYA 1LQEA 1TE0A 3ZZCA 2ZZUH 3UNSA 1C5RA 1XVMA 3A7ZA 2O8TA 4E7RG 1NROH 1SGYE 1D9IA 2BY7X 4RT1A 1F7ZA 4P02A 3VB3A 4FXGH 3EYDA 1GCTC 2H9HA 1ARBA 1D3TB 1SC8U 2XYAA 3RXGA 1LTOA 3UQOA 1ELFA 1O2KA 5GCHF 4IBLH 2XCNA 1O2GH 1TX8A 5F8TA 3ATMA 2J34A 2BDAA 3BV9B 1ZPZA 1AVXA 1RTLA 1ZR0A 3A84A 1GI5A 2KCOA 3G01A 1SQOA 4XBDA 4JZDH 2BD7A 1Y8TA 2FS8A 2ODYB 8ESTE 1HAIH 3M5NA 2VJ1A 1OWHA 1EAWA 4SGBE 1C2HA 2BLOA 2EI8A 1DFPA 1O2PA 4DGJA 1H8HD 1ANBA 2VVVA 1DXWA 1KIGH 4K69A 1UJ1A 4X6MA 3O8RA 1KYNA 4UFFH 1Y3VA 2H1UA 2QE7D 3A85A 2BQWB 2LP6A 5CHBA 5E2PA 5DSFA 4WF8A 1MQ5A 3D65E 5FAHA 1VITF 1D3QB 2G55A 1HIAA 3ZVAA 1ZTJA 2VWLA 4IMQA 5TCAA 1QB9A 1W0KD 2Y5GA 4CRAA 2SGDE 1HPGA 3CS7A 1E37B 4INHA 5DPAA 1P9SA 1FY4A 2GTBA 3HKIB 4Q4LA 3A82A 4K3JA 2WUCA 2P93A 1Y3WA 3SO3A 1HCGA 3HKJB 2AS9A 1EUFA 5C67A 1TQ0B 3GY3A 4F55A 3NCLA 1SLUB 4AGJA 4D9QA 1Y5BT 1GVLA 2OINA 5JBBS 3UAIC 2QF3A 1NO9H 2EQNA 2ZDVH 1AD8H 3ZIAD 2LNCA 1GBJA 1K9OE 4ZKOU 5C1YA 2BX3A 1GGDC 3HK6B 4ZAEA 4NZLA 2GCTC 1QRXA 1RIWC 4NG9H 4JZFH 3KQ5A 1MTNC 4I7YH 2VBCA 1O5GH 5C17A 4RN6A 2Z7FE 2QF5A 4ABEA 1SGPE 2Z9GA 4CREA 3LIWA 1DICA 3S9BA 1C5WB 1ESBA 4MG3A 1LVMA 1YKTA 1G30B 1C5VA 3E8LA 5C2ZA 3UTUH 2LPRA 2WINI 2FOFA 2AMPA 1C1NA 4OGYA 3KYFA 4JZ1A 1QQ4A 1C5SA 1DWCH 1KLJH 1ESAA 1WTGH 2ZDLA 1HIAB 1BOQA 1AE8H 1QBVH 1W0YH 2XWAA 1JRTA 1K1LA 3TU7H 1SKYE 2ZF0H 3ZVCA 1TGBA 2V3HH 2BY6X 5HIYA 3QTOH 4ASHA 2W3KA 2ZPSA 3SU0A 2SNWA 1OKXA 3TITA 4H4FA 5GNDA 4DG4A 1TABE 2ZQ2A 5C5OA 1MAXA 3K6YA 2UUJB 3M7UA 1TGNA 1TIOA 3LH3A 1GHBG 1NFXA 2OD3B 4NCYA 3ZV9A 1XKAC 1V2JT 1AB9B 1ZLRA 2DE8A 1K0HA 2XXLA 3A8CA 1O2MA 1V2VT 2SGFE 2FO9A 3UFAA 4MVNA 1P2NA 3QK1A 1EATA 1BTUA 2OBOA 1O33A 1OHHD 4J1YA 3GY8A 2P16A 3KF2A 1T7CA 5ESBA 1SGFG 5EXMA 1EX3A 3WWBA 1TRMA 5HXFA 2BLWA 1S82A 3U28C 5DP9A 3I77A 2OTVA 1DUEA 1JIRA 1FV9A 2RDEA 5T6DA 2H2ZA 2F9PA 3SNDA 2A45B 2J5UA 1C1SA 2ZHDA 1KDQA 1V2TT 2A7CA 3ATKA 1QRWA 1ZSKA 2GZ9A 3BTQE 2ZO3H 1Z8JB 4BAKB 3SN8A 1S6HA 1F5LA 1OWJA 1KXDA 1TNGA 5F8XA 7GCHF 1JXPA 2J97A 1DPOA 3EAJA 4XOJA 1YPHC 3W94A 4MPVA 3F68H 2XRCA 1DDJA 2WSSD 4B76A 2AEIH 2ZGJA 1Z6JH 3VGCB 1ZPBA 3TPIZ 1NESE 1UVOA 2DUCA 4UE7H 3MMGA 4LK4A 4CBNA 5FXLA 2ZFTA 1DITH 4XFQA 1TNIA 2G5NA 1WOFA 2QY0B 2CF9H 2WYGA 2JJ2D 3RXHA 3RXQA 4AYVB 3PLPA 4NWLA 1B5GH 4B73A 4Y79A 1PPZA 4M7GA 2JKHA 1GHWH 4TYDA 4ZXYH 1VCQA 3RXJA 3RU4E 2J98B 2QAAA 1AY6H 4NZQA 2HPQH 3LGUA 1O3MA 1YCPM 1C5YB 5C20A 2IJD1 5JPMH 5EW2H 4XDEA 5AF9H 1EP5A 2CN0H 3P70B 6GCHF 5HM9A 2GMTC 4X6PA 1A7SA 1L1JA 1QY6A 5EJ1A 2BDGA 2L74A 1H8IH 4IGDA 3TJVA 3SZNA 4CRFA 2IN2A 4XE4A 3D49H 4D76A 3SJ9A 3UR6A 2H5DA 4J2YB 3T26A 4AFQA 4WH6A 1CGJE 1UCYE 2TPIZ 3E0NB 2XBYA 1FY8E 3GCTG 1GI0A 1GHYH 2AMQA 2CHAC 2V7QD 3BTGE 5ETXA 2VVUA 1Q31A 1CA0B 2JH5D 3SNCA 5LH8A 3WY8A 3KQEA 4BXWA 4X8UH 3SV2H 3SU5A 1DUAA 3FO8D 3QO6A 3PB1E 1G2MA 2PTCE 4X8TH 3F2HA 1MD8A 2GT7A 2ZQ1A 4B2BA 4IMZA 1SGRE 3DFJA 3AW0A 1N1LA 1T8OA 1O2YA 1NRNH 2Z9LA 1HXEH 3BTDE 1A0LA 2F43B 3UY9A 3SQHE 4DT4A 1Q2WA 1DSUA 1DLKB 1DSTA 4GCHG 2B0FA 4DOQA 1GL1A 1PYTC 3ZVDA 3PO1B 1DXPA 1TBRH 4AFSA 3L33A 4WY3A 2FDAA 1F0RA 1VCWA 2AGIX 4UFGH 1OX1A 4F4OC 1O2JA 4I8GA 4B6FA 1TPOA 2YMSB 2XCFA 1GI3A 1YPKH 2YMSD 4I33A 3H5CB 2VGCB 2TGPZ 1K1NA 2UWOA 1INCA 1DWBH 1V6DA 2FS9A 3VB4A 2UWPA 4YLQH 1MBMA 1J14A 1AIXH 3R0FA 3QGJA 3GYLB 4FUJA 1WU1A 1D4PB 1TRNA 3SV6A 2Z9IA 4ESTE 2TIOA 4CR9A 1GBTA 2IPQX 2UWLA 1SFQB 2GZ7A 1EOJA 3VB6A 4WMFA 2P3TB 3AAVA 4BXSA 1O32A 2XBXA 4BNRA 1O3EA 1GVKB 1WXRA 3PTNA 4MLFB 1NRQH 2P3FH 2P8OC 2ZU3A 5HM2A 4A1XA 3E16B 2ZECA 3PWCA 1TB6H 1O3DA 4BAMB 3SI3H 1O30A 4O9VA 4JZIA 3QGNB 1H9HE 1KMHB 5PTPA 5F6MA 4BTIB 3SORA 1JRSA 1NFUA 1P3CA 3MNSA 1LHFH 1PPGE 2A7HA 1LHCH 3SI4H 1MH0A 4Q7YA 8GCHF 1MABB 5F03A 4ISIH 1GI4A 1E1QD 3SJKA 2HVXA 4AGKA 3C27B 1EPTC 1C2EA 5AVDA 3GCHB 2FX4A 2KAIB 3SHAH 1A5HA 4ABHA 4ABAA 3OYPA 2D8WA 1BRBE 3P17H 3GDSA 1ZMNA 5AHGH 2OC7A 3A81A 2BTCE 1OYQA 5A8XA 1G3BA 1XMNB 1CBWC
chains in the Genus database with same CATH topology
1EAUA 1P11E 3UPEA 1O3IA 1BHXB 3TH3H 5E8EH 1S0QA 1GI9B 1WV7H 2WPHS 3O8DA 3ZVFA 1HAPH 2J2UA 1W13U 2QF0A 4O3UA 3RU4D 1O2NA 1TONA 4D7GA 1J8AA 2C3SA 1WTHD 1BT7A 1EJMA 1O3HA 1QJ1B 1UCYH 2PKSC 4KGAA 1TRYA 5A0BA 1O34A 1ZYOA 1HXFH 3I78A 3PM3A 1QHRB 1V2PT 1DOJA 1Y3UA 2Z9JA 4UEHH 2STAE 4X8SH 4TWYA 1T31A 4X2VA 1OXGA 3BF6H 4ZMAH 1XXDA 1D3PB 4MNYA 3HGPA 3LGVA 2XC4A 1KTSB 1E36B 3DUXH 1OP0A 1QB1A 1TALA 1ZOMA 5EU8A 4KP0A 1OWKA 1HDTH 4HFPB 5I46H 3TJNA 2AIPA 1BJUA 1GMHG 1BRUP 3GY6A 2ILNA 3LH1A 2FI5E 1YPLH 2V6NA 3UOUA 4FUGA 1GJCB 3SQEE 1MKWK 3BTKE 2XC5A 1EAIA 4IW4E 1O2SA 1HGTH 1WQVH 2G51A 3E91A 1FPCH 1TPAE 5EGMA 2C8YB 2ZIQH 4AORA 4WXIA 3BEUA 5E0HA 2BD3A 1MUEB 1RRKA 2BD2A 2FODA 3QUMP 4LXBH 4RKOB 1Z71A 1GJBB 4H42U 1TYNA 1PQ8A 1QBOA 1TMTH 4GHTA 3RM0H 2OC0A 1TGCA 4DJZB 1GI1A 3OTJE 1P06A 1YYY1 3SU6A 4Z6AH 1CT0E 4DIIH 1GBAA 4OS7A 2EI6A 2GVFA 1YGCH 1G32B 1GJ7B 4E05H 1ELVA 3UIRA 4YT7H 3UWIA 5CMXH 4K2YA 2BQ6B 1HJ8A 1P03A 2FLRH 1O39A 3V3MA 3F1SB 1BUIA 1DVAH 1OWDA 4VGCC 2PR3A 5JBTA 4X1QU 1CE5A 1O37A 3V7TA 1UVUH 2XBVA 1MU8B 4B1TA 4DW2U 4NA7A 3MH4A 1LPZB 5EG4A 4AOQA 2R0KA 4KTSA 1C5QA 3FP6E 4JK6A 2QCYA 3K9XB 3VXFH 1OOKB 1UMAH 1T8MA 1AFQB 1QNJA 1O5AB 3VEQB 1IQIA 3PLKA 1GHXH 1GDUA 1Z1IA 3LGIA 1ZSLA 1A5GH 1MBQA 1ELDE 1GG6B 4I32A 1V2LT 1BRAA 1XUHA 1A0HB 3A7VA 1FI8A 3ODDA 4SGAE 1SGQE 1G3CA 2BD4A 1YF4A 1UTMA 3L3TA 3UQVA 1P2IA 1ZZZA 4KELA 2J92A 2SGEE 4MDSA 1P3EA 2QXHA 1C1OA 4ISOA 3M35A 4YESB 4AG2A 3U1IB 4BTUB 2ZCHP 4JMYA 2RG3A 1C2KA 2WV5A 3ZV8A 4U2WA 1A0JA 1RD3B 2XW9A 3A83A 3A8AA 2CJIA 2XTTB 2ANYA 4BAOB 1VZQH 4DCDA 2A5IA 3ITIA 2H9EH 2FWWA 2HWLB 2R2WU 3TK5A 4HZHA 3P92A 7KMEH 5GCHG 1QIXB 1E38B 2BVXH 2J9NA 2M5TA 2OC8A 1P04A 2CF8H 1SQAA 3TLOA 2G52A 4I8KA 3LGTA 3KGPA 2BY5X 2OBQA 1S0RA 1TPPA 1PPCE 1Y3YA 2PFEA 4Q7ZA 1ZJDA 1ZMLA 1LHDH 4ZKSU 1DY8A 4BANB 1XX9A 2RDLA 4NWKA 4PROA 1FJSA 4YTAA 2RA0A 3D62A 5GIBA 2PHBA 1B0EA 1ETTH 3M37A 1F0TA 4ABBA 1ZSJA 1P01A 3L6PA 2ZDKA 1BMNH 3LGWA 3ZZ3A 3EGKH 2YNAA 1BIOA 2PUXB 3NK8A 5K0HA 3EA9A 1NRPH 4Q7XA 3GY5A 3MOCA 4K8BA 4IS5A 2ZEBA 3A8BA 4UONA 4UFDH 1HAXB 1SHYA 2JETC 1PFXC 2QXGA 3RXLA 1GI8B 3RXPA 1G36A 1EZSC 2PLXA 4BOHA 1LQDB 4FUBA 2FXRA 2AGGX 5BRRE 1NM6A 2ZG0H 3P8NA 3M7TA 3ODFA 1DE7H 1YCPH 4B2CA 2OCVB 1K28D 2Z3CA 2BZAA 2SGAA 4DY7B 3A89A 1BBRK 1W0ZU 1ELEE 1K1JA 1C5UA 1BHXF 2VB0A 2BOHB 1MZDA 2VWMA 3MYWA 1DT2A 3F9HA 3OY5U 3M7QA 2AH4X 1KLTA 1FN8A 2EI7A 1VGCB 2Q6DA 1EASA 1FQ3A 1IQKA 2R3YA 1HRTH 1YPGH 1H9LB 1AO5A 1Q3XA 1P57B 2ZFPH 4R8TB 2BHGA 3LGYA 4U01A 1ZHMA 1F5KU 2I6QA 3HGNA 1Y5AT 5A0CA 2ZGCA 1TNJA 2XBWA 2PGQB 3ZZ4A 1S85A 3SGBE 3FAOA 1T4UH 5FCRA 2GD4B 1BMLA 4I8HA 1QJ7B 1W11U 2GV6A 1CU1A 2BVSH 1DM4B 1NN6A 1N6XA 1SOTA 1OSSA 1YC0A 1P09A 2A5KA 3DHKH 3OY6U 1FLEE 1UTQA 4Y6DA 5CHAB 3S7KB 5J4QA 1A3BH 3E1XB 2PGBB 1ZHRA 3SU4A 1GJ5H 2HNTC 2A32A 1ZTLA 3U1JB 2PUQH 5T6GA 1ZRKA 3TJOA 3QLPH 3FZZA 4Y8YA 3URCA 3MH5A 1DS2E 1YPEH 3ZZ7A 4MPUA 1Z1JA 2V35A 4WJG2 1EZUC 4JYTA 1VJ9U 1C9TA 2VH6A 6CHAB 4Q80A 1XUFA 3GCNA 1WAYB 4ZROA 3NKKA 4B2AA 2PV9B 2OXSA 3E0PB 1AZZA 2FEQH 4FUDA 5L6NH 3BTME 1RTFB 5DG6A 2VIPA 3IWMA 1JOUB 1MKXK 1O3GA 4XSKU 2ALPA 2ANWA 4Y8ZA 2A4OA 1SGIB 3BIUH 2C4FH 2THFB 1NT1A 3MNXA 4MNXA 1QFKH 1C2JA 2QGRA 1YPMH 5E2OA 1O2RA 1CHOF 1OWEA 3P8OA 1P2OA 5BPEA 2WV4A 3A7XA 1EKBB 1HB0B 4JYVH 2UUYA 5E0GA 1S5SA 1PQAA 1V2OT 1DANH 2Y6TA 2ZC9H 4BTTB 2Y7ZA 2BYAX 2FP7B 5DK1A 4FU9A 2ZP0H 7GCHG 1A61H 1CO7E 4JCNA 1SI5H 2W5EA 1N8OC 4YM9A 3AVZA 1YPJH 3Q76A 3PV4A 1L0ZA 4ZKNU 1N6YA 2O8UA 1O5BB 1LO6A 1ID5H 9LPRA 1L4DA 3E6PH 2HNTE 1AVWA 1W12U 4Q2KA 2Y82A 3MO6A 2ZA5A 4K1SA 3T29A 2TGAA 1SL3A 3ZYDA 2ZTYA 3TIUA 1AGJA 4R0IA 3AASA 3ZYEA 2ZNKH 2H5CA 5DKMA 3NUMA 1V2WT 1HJAB 1MCVA 3SUEA 2C8WB 1GPZA 3SV8A 2BLQA 3GISB 1H9IE 1H8DH 4HTCH 2ZPQA 2HGTH 4X1RU 4WMEA 3RXDA 1L1NA 1AFEH 1O2LA 3RP2A 3VPKA 1GHBF 2GDEH 2YNBA 4MTBA 1ZHPA 3RM2H 2FOGA 1GJAB 3SNAA 3KIDU 1FXYA 2PKAA 3PYHA 4KTCA 2OP9A 1G3EA 1GJ4H 1EB1H 1GVZA 1IOEA 4FUIA 3EQ0H 2P95A 4HI3A 4CHAB 1XUKA 1TMUH 2W7UA 4X2WA 4ZHAA 1K1PA 1DY9A 1UTLM 4DIHH 5LPEA 2AERH 1HAZB 4DT7B 1C2LA 3PLBA 2OLGA 2Y80A 1C1MA 1GBDA 3FVFB 5T6FA 3IITA 2O9QA 1AN1E 1KXEA 2JH6D 3GOVB 1MMJN 3BG4B 3FP8E 5ESTE 4KTUA 1C5TA 3M3TA 3P6ZB 2GV7A 1E0FD 3ATLA 1CSOE 2Q6FA 1TWXB 2Z94A 3BTHE 3LJJA 5FPSA 1CGHA 5CE1A 2B8OH 5FPTA 3LJOA 1GCTB 4NIWA 1LDTT 1QJ6B 2BVRH 1ELCA 1V2ST 3T25A 3TNSA 2BZ6H 3UR9A 2JH0D 3RXTA 3O8BA 1H1BA 2F3CE 2HALA 5DP7A 1HAGE 1LHEH 1CVWH 1BRCE 3M3VA 2R2MB 3RXBA 1ACBE 1O3NA 1C1TA 4FUFA 1QR3E 2PKAB 2V3OH 4X0WU 3MI4A 1PPEE 2I6SA 2ZKSA 1GHAF 4GHQA 2GZ8A 2RA3A 2ZFSA 3RXAA 5GWZA 1YPHE 5DO4H 3KEEA 3P95A 4A5TS 2BDIA 2EC9H 1O3BA 2WPKS 5LGOA 2FOMB 2KAIA 2VH0A 3V13A 4DURA 1BMMH 3RU4T 1GMCG 1V2MT 2A5AA 3MNCA 3ENSB 3KQDA 3W95A 4ISHH 3LKWA 3GCTF 2QYIA 1QTFA 2AGEX 3MH6A 3T2NA 5JB9S 1YBWA 3M5MA 1O3PB 1DWDH 1C1PA 3LC3A 2ZGXH 4WWYA 1UK2A 1HNEE 2VINA 1P0SH 1C5NH 3K65B 3HATH 3KQCA 4A6LA 1OP8A 3S9CA 1QGFA 3BIVH 1O36A 1AWFH 1SGCA 3ZZAA 2B9LA 1AMHA 2QXIA 3KQBA 1P2MA 2SFAA 1JMOH 1S6FA 4X1SU 2C90B 4GCHF 2GP9B 1O5FH 3H7TA 4A1VA 1IQJA 2Z3EA 1O35A 3K6ZA 1D3DB 2IPHA 3K2UA 3RMMH 1UK3A 2ZTZA 1GGDB 2BQ7B 3BTTE 3GY4A 2GCTB 1RIWB 4ABJA 2BD8A 2GGVB 1MTNB 1E35B 1EQ9A 2OQUA 1O2OA 2FOBA 1P9UA 2VVCA 4YT6H 3P8GA 1UO6A 5L30H 1D6RA 3I29A 1TBQH 1C4V2 3RMNH 1KXCA 2QV1A 2NU3E 1AWHB 3S69A 3F9FA 2NU0E 4UFEH 1ELBA 1BTXA 1KTTB 1C5XB 2EA3A 4FVBA 1W8BH 2J4IA 2A1DB 1LKBA 1NZQH 4XBCA 3GDUA 1SGDE 1THPB 1V2KT 1Y59T 2B7DH 5L2YH 3F6UH 2VIDA 4WVPE 1C5OH 8KME2 1ELGA 3E3TA 1W7XH 4MPWA 3SJIA 1C5MD 1RFNA 3MH7A 2H9TH 3U8OH 3T62A 2ZGBH 1LMWB 1P8VC 1HV7A 5A2MH 2ASUB 1C2DA 4FUCA 1ARCA 3ESTA 5JBAS 2ZFRH 4MNWA 2FX6A 1HAOH 4Y71A 1T8NA 4YZUA 1QB6A 1MZAA 3EA8A 1O5EH 5IDKA 4FU8A 3S9AA 3AAUA 2Q6GA 2ZWLH 1AKSA 4FU7A 5LPFA 1C4Y2 2FOHA 1LKAA 1T8LA 2AIQA 3U69H 3ZZ8A 1WSSH 3GDVA 2F9NA 4ZHLU 2TRMA 4F49A 1C5ZB 3A7YA 1YLDA 1YM0A 3P8FA 1ZPCA 1HLTH 4OS5A 1W7GH 3EE0B 1JBUH 1AZ8A 1GI2A 1BQYA 1HFDA 1QQUA 2FI3E 3C1KA 1V2RT 1C1QA 2ZTXA 3A80A 2WUBA 1W10U 1TX6A 2G4UA 5E0JA 5F8ZA 5EQRA 2GCHG 2ZU1A 2D1JA 3RXMA 4GPGA 4NIXA 4ZHMU 9ESTA 1G9IE 3BSQA 1AB9C 2FESH 1W14U 2A4RA 2J38A 5LPRA 1GMHF 1OP2A 3MU1A 4CRCA 4UD9H 3B9FH 4QT8C 3MO9A 4ISNA 1NRSH 1F2SE 1GJ8B 3CENA 2GMTB 1UTPA 2RCEA 1GBBA 1K1IA 3R3GB 1SGFA 1AKSB 3A7WA 1QRZA 1EOLA 5GXPA 2F91A 2V0BA 1CQQA 2OUAA 1K21H 4H6SB 1TQ7B 3E90B 4O03A 4RKJB 1K1MA 1RTKA 1K1OA 4YLUA 1WUNH 2CHAB 2B5TB 4Y8XA 4OGXA 1MAYA 1TFXA 2ZGHA 4NFFA 7ESTE 2XWBI 1SQTA 2BXUH 2TGDA 4ZUHA 4GUXA 1PQ7A 1MTWA 1S81A 1UVSH 1UVPA 3QTVH 1ANCA 2F83A 3ATWA 4TY6A 3ZVBA 3GICB 3MWIU 1BA8B 2FZZA 1GBKA 4LZ1H 1THSH 1A2CH 5H4IB 3VGCC 3SU1A 2R3UA 1HYLA 5JDUB 1H4WA 1FIZA 2BLVA 3M36A 4JZEH 3KNXA 4A7IB 5T3HA 1YP9A 4A92A 1BTZA 3SNBA 4E06H 1IQHA 1P05A 4X2YA 1F92A 3MU5A 1C2GA 1C1UH 4FVDA 2OQ5A 2Z3DA 1IHTH 4OS1A 3TH2H 3S7HB 1SFIA 2O8LA 1EAXA 4CH8B 1IHSH 1O2WA 3FZDA 3QZQA 3GY7A 1XUIA 3PROA 1O2TA 1M9UA 2D2DA 3SJOA 1GBEA 4I31A 1FIWA 1WBGB 4LOYH 4FUHA 3V0XA 3MO3A 1RJXB 2K1QA 4WXVA 3RXIA 1UK4A 5TCCA 2FOEA 1FY5A 1O3AA 2ZU5A 5FCKA 4Y7AA 1C2FA 1G2LA 1XKBC 4WH8A 3QZRA 3H7OA 5C1UA 1NC6A 4NSVA 4CR5A 1BBRE 5FBEA 1Y3XA 2Y5HA 1GHZA 5AFYH 1CA0C 2ZU2A 4D8NA 5JB8S 1IQFA 2WPIS 1KXBA 2P59A 3VXEH 2P8OB 1VITG 1C5LH 1WYKA 1KXAA 3MU0A 5DJ7A 3SNEA 3A88A 1TA6A 2ANMH 4YOIA 4AN7A 5AFZH 1UVTH 3ZVGA 1GMDF 3VFEA 2VWNA 4XBBA 1IQGA 1PPFE 5K7RA 4YOJA 1GJ6A 5B6OA 2FOAA 3TK6A 2ZCLP 5C1XA 2P94A 2SNVA 5EW1H 4IC5A 1IQNA 1FAKH 1ZGVA 3PO1C 1OYTH 1SG8B 3QX5H 4Y7BA 1EPTB 3CS0A 2VWOA 3UWJH 2G81E 4O97A 1C2IA 4Y10E 4NA8A 5DP6A 5EPNA 4B75A 1SGTA 1J15A 1ABIH 1MQ6A 1KLIH 3U9AH 3TNTA 1EP6A 2FYQA 2VGCC 2R9PA 2YOLA 1SOZA 1SLVB 2PW8H 3T5FH 1CBWB 4INKA 1NFWA 3ELAH 3SOSA 5FX6A 2BY9X 3SGQE 1E34B 1LHGH 1K2I1 1SSXA 2FOCA 3TVJB 4X8VH 1ZRBA 1O3CA 3BEIB 1HAVA 2PKSB 1FUJA 3PMBB 1GI6A 3Q3YA 2A7JA 3EA7A 4GLYA 3EDXB 1V2NT 1EZXC 2FTMA 3KL6A 2ZCKP 2W7SA 4YO9A 4Z0KA 1MD7A 1TNLA 1ZGIA 3NWUA 2ZHEH 3STIA 4MNVA 1QURH 1CHOG 1XVOA 5GPIB 1TAWA 3M5OA 1AI8H 1FMGA 3BN9A 1Y5UT