1V2RT

Trypsin inhibitor in complex with bovine trypsin variant x(ssri)bt.b4
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSRIITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title Understanding protein-ligand interactions: the price of protein flexibility
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 50
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2rT01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2rT02
1GBTA 1ZMLA 2OUAA 1RD3B 4Q7XA 5DP6A 1TNGA 5EODA 1EX3A 4I8KA 3VB3A 3PMJA 4A1TA 2A31A 3FZDA 1H9IE 3SBKA 2V35A 3OU0A 2G81E 2PSXA 1ZRKA 1MKWK 3RMNH 4UONA 1AE8H 1C1NA 2ZHDA 5E0HA 1BIOA 1XVOA 2V3OH 1SGPE 1JMOH 1D6RA 3ZZ8A 2I6SA 4BNRA 7KMEH 1AO5A 1GI0A 2ZGBH 3KIDU 3BIVH 1SGIB 3ZZBA 3M7TA 1QB9A 3RXRA 3PMBB 4R8TB 1TPAE 1CO7E 3L33A 2CXVA 1DICA 1P3EA 2P8OB 2Y80A 2Z94A 3SU6A 2ALPA 2OQ5A 6ESTA 2SGDE 1QA7A 3PO1C 2P16A 1YF4A 1BTUA 2FOGA 1B7XB 1MCVA 3VXEH 1O0DH 1CA0C 1GBAA 3U1JB 1LKBA 2VIWA 2ZHQH 4ABIA 2CHAB 1V3XA 3UWIA 1SVPA 2VWLA 1LQEA 4TWWA 8LPRA 2UWLA 1BRUP 2UWPA 3S9AA 3W94A 1GJ4H 2ASUB 4BXSA 4B74A 3MH6A 4FUGA 4WF8A 5TJXA 4OS1A 4CRGA 3RXCA 5C2ZA 2A7JA 3RU4T 2ZGCA 1O3GA 2Q6FA 1PQ8A 4YO9A 3LGVA 4NA7A 4U01A 2XCFA 4X1QU 2ZFFH 2BOHB 3RXQA 3ZZ7A 1OPHB 1Y8TA 2WPJS 1AVGH 4CBNA 2FYQA 2AGGX 1C5NH 4HFPB 4AB9A 1SOZA 4NSVA 1ZRBA 2GD4B 4E06H 1EB1H 2W3KA 4LZ1H 4DVAU 1MTUA 4MNWA 1C1MA 3EA9A 4I8LA 2AIQA 1GI3A 4A7IB 2PKSC 1O2YA 3MU5A 4CREA 4X1SU 2VVCA 2ZECA 4NFFA 1T31A 3ZZ5A 1GCTB 2DUCA 3FP6E 1Z8GA 1EP6A 3UOUA 2ZWLH 3DHKH 2HLCA 1A5GH 3PO1B 2WYGA 1HJ9A 5E2OA 1BMAA 1OP8A 3RU4D 1PQAA 2GX4A 1N6XA 4O97A 4Y7AA 1CA0B 3PTBA 5DP7A 3K65B 1DVAH 3AW0A 1PPHE 4ZMAH 3TNSA 1IQLA 2QXHA 4WXVA 2PV9B 2A7CA 1YPMH 1P09A 2PTCE 2XC4A 3E16B 1QRZA 1TNLA 2GGVB 1DUEA 1A7SA 1AE5A 1QB1A 4IW4E 1U6QA 3ATIA 1K9OE 4DT7B 2HRVA 8ESTE 1KXAA 1PFXC 5L30H 3M7QA 2PWXA 5GPIB 3TPIZ 2GZ7A 1DSTA 4DIIH 3NUMA 1O2TA 1XUKA 1O3IA 1C1SA 3WY8A 1UJ1A 1DWCH 1IQNA 1F92A 1RFNA 2BD4A 1WU1A 1TYNA 2HGTH 2RG3A 1P9SA 3RXJA 1D6WA 2FXRA 2OC8A 4CRBA 9ESTA 1GHAF 3H7OA 3JZ2B 4CRCA 2STBE 1IQGA 1LHFH 2TGPZ 3Q3YA 4X2WA 1EB2A 1TLDA 3TJNA 5HYOA 4AG1A 1MTNB 2BHGA 3CENA 3B23B 2OD3B 1KXDA 4ABFA 1C2DA 1KXBA 1MBQA 1E35B 1IAUA 1Y3WA 2BX3A 1O2PA 1E34B 1W8BH 4AFUA 4YT7H 1F0TA 2BZ6H 1C2JA 2KAIA 1BUIA 2BY7X 2H9HA 1A3BH 5DP3A 1SLUB 4Q7YA 2ANMH 3GCNA 5FCKA 1ORFA 3ATMA 1UCYE 1C5UA 1G3BA 1J9CH 2SGAA 1EJNA 1IQJA 2BVSH 3RXDA 2GDEH 4YT6H 2QA9E 1UTNA 4GLYA 4OGYA 2PLXA 5EW1H 1ANDA 5EQRA 5EOKA 2R3UA 4I8HA 1GI4A 1C1QA 3TK5A 5GCHF 3VB4A 2AMQA 3GCOA 4CRAA 3OX7U 1G32B 2VJ1A 5C5NA 3U1IB 3SUFA 1SGCA 1LO6A 2OTVA 5FCRA 5FPTA 2BD8A 2BMGB 3TJOA 4AFZA 5I46H 3PROA 1EZSC 3ZVGA 2G52A 3UR9A 1CGHA 1EZUC 1VITG 1SBWA 4NFEA 1GHAG 1L1JA 1GGDB 3PWCA 3SUDA 3SI3H 2BQ6B 2GV6A 4O9VA 3RXPA 1MKXH 4WY3A 2B8OH 2VWMA 3F9HA 3PTNA 2C90B 4U2WA 3LOXA 4FUJA 2AMDA 4RN6A 1TBZH 3KGPA 2J2UA 3O8CA 1QY6A 3D49H 1WQSA 1HJ8A 3DT0H 3M3VA 3RC5A 2LNCA 1RGQA 1O2VA 4AFQA 1ZPCA 2FM2A 5A8YA 4XBBA 3SI4H 1FPCH 2OQUA 2D8WA 1Y5UT 1OXGA 2Q6DA 1O3FA 3A7WA 2VVVA 3SU1A 2ZC9H 3KL6A 5EQQA 3TH3H 1EUFA 3LGWA 1HPGA 3MH4A 1O3JA 4MTBA 2Z9GA 2ZG0H 3S69A 1O30A 1O2IA 1ZTLA 2O8MA 3A8BA 1Z8IB 5HMAA 1VJAU 2XWAA 1Y3UA 3TU7H 1O2WA 3H5CB 1C1PA 1O2HA 1YPEH 2KAIB 2GMTC 2H6MA 2C8WB 3HK6B 3LGYA 5L2ZH 1GBDA 1F0SA 4MPWA 2F9NA 2FODA 4XBDA 1Y5BT 1HAVB 1HGTH 1L2EA 1XUIA 3VGCC 1O2NA 1WYKA 3UR6A 4FXGH 2W5EA 1O3PB 1AMHA 1GVZA 2QIQA 1BBRE 1Y3YA 1FNIA 2ZDMA 1GHYH 2CF8H 3SHAH 1V2PT 4CRFA 3A83A 2IOTA 4ABHA 3JZ1B 1S6HA 4A1XA 1QBNA 3VPKA 3BSQA 1YPHC 1ESTA 2A4QA 2A1DB 1CQQA 4INHA 2ULLA 3D65E 2VINA 4GAWA 3LH1A 1K22H 4AGJA 2H9TH 3LU9B 3ZVBA 1GBMA 4KGAA 1GCDA 1H9HE 1FN8A 3ZZ9A 2FI5E 2PHBA 1G30B 3T26A 1X7AC 4ZHAA 2FLRH 2VH6A 1TALA 2V6NA 4BTIB 2J95A 3M7UA 2FOMB 1Z71A 4UDWH 2BD2A 1P0SH 3RP2A 3T25A 1THSH 2Y82A 2AIPA 4A1VA 1OKXA 1LKAA 1W10U 4MQAA 1XVMA 4ESTE 1BRBE 4NWLA 2ZPRA 5DJ7A 1DWEH 2Y6TA 3RXAA 3ATKA 3ZZ6A 5C67A 5F8XA 1TRYA 2AYWA 3ODDA 3TGJE 1ZMNA 5ETXA 4O03A 4OS5A 5E2PA 1O3MA 2OCVB 4ISLA 3ZZDA 1G3DA 1EZXC 2O8LA 5AF9H 1ZR0A 2WV5A 1D3PB 1GBJA 3KN2A 3FZZA 1LHEH 2A5KA 2GMTB 1CGIE 1O5GH 3I77A 1CHOF 1HIAA 3VGCB 4H4FA 3GDSA 4JZ1A 2STAE 3O8RA 3A7YA 2A5AA 3RC4A 1LHCH 3SV9A 1ARBA 1NO9H 2FOEA 3T2NA 2DE8A 4ISIH 1DS2E 2JKHA 4MDSA 2A4OA 1A3EH 3T29A 1XUHA 1HAYB 2UWOA 4ZHLU 1TNIA 1JIMA 1OWDA 2FX4A 1ZLRA 1CSOE 3A80A 1HAPH 1JRTA 2BQWB 5TCAA 2ZO3H 2CN0H 2ZA5A 3SHCH 2HPQH 1HFDA 2H1UA 3RXSA 4Q2KA 4DCDA 2VIOA 1AB9B 2R0LA 1GHWH 1TGCA 3K6ZA 3PLPA 3E91A 1NRRH 4E7NA 4K1SA 1EJAA 1YPGH 2D1JA 3SU3A 2C3SA 1IQEA 1NROH 4OS7A 4WVPE 2FZZA 1SLXB 2A5IA 3RXMA 2CMYA 4AYVB 1EQ9A 3B8JA 5DG6A 2YNBA 1UTMA 1W12U 4B1TA 1FN6A 2PKAB 2Z6BD 1QHRB 3TLOA 1GWAA 1NPMA 1Z6EA 2VWOA 1CHOG 2R0KA 3FAOA 3TNTA 3SQEE 1BITA 4MVNA 4INLA 3SORA 1BZXE 2J92A 4TYDA 6CHAC 2BD9A 1UCYH 4BAMB 3ZVCA 5JPMH 1MAYA 1TPOA 4F4OC 3DD2H 1BHXF 2GT7A 1QBVH 1F0UA 1J8AA 1O2OA 3E90B 1KSNA 4UFGH 5EQSA 1TX6A 4GUXA 4B76A 1ETSH 2QV1A 1TFXA 1MZAA 4ZXXH 4WH6A 4DW2U 3RMLH 1RTFB 3MMGA 1NU9A 3EQ0H 4DJZB 1P2QA 3TK6A 3SOSA 2FYRA 5LH8A 2ZU3A 2FEQH 5C1XA 4NA8A 1IQIA 1O5FH 1QB6A 1C5RA 2PW8H 4X6NA 2W3IA 4XFQA 4DY7B 2VIVA 5IDKA 3DFLA 3AAVA 1MD7A 1KXEA 1AVXA 2H5DA 1TBQH 2Q1JA 1HIAB 2J4IA 1C5LH 2FS8A 3BTEE 1A5IA 1DX5M 3ELAH 1JBUH 1C2GA 1V2TT 4I8GA 4O3UA 2ZTXA 1V2MT 3KQEA 5JBTA 3RXVA 1TOMH 4CR5A 1P2KA 3P8OA 2EI6A 5K7RA 3P8FA 5GIBA 4DGJA 2ZU2A 2HOBA 1CHGA 1ANEA 3URCA 1BTPA 2A2QH 2ZU1A 3V3MA 2XCNA 1NN6A 5J4QA 1IQMA 3MO9A 1VGCC 2O8UA 1OYTH 3PLBA 1C2LA 3VFEA 4D7GA 4UD9H 2ZU4A 1GI6A 3TGIE 4I8JA 3UQVA 3NWUA 2H9EH 4JK6A 3TK9A 2PFEA 4CR9A 5HXFA 1S85A 4BAHB 3E1XB 2ODPA 4JMYA 4X2YA 1C5TA 1SLVB 3ZZ3A 1EASA 3SU4A 5F6MA 1BMLA 1VITH 2ZFSA 1EATA 2PTNA 3MOCA 4NSYA 5DP9A 1LDTT 3ZYDA 1W7GH 4BOHA 1QBOA 1HXEH 3F9FA 1O2KA 2Z3EA 3OSYA 1OWEA 1O5BB 1YP9A 5IYTA 1BQYA 1XUFA 2EI7A 4GHQA 1FLEE 1PPZA 3QK1A 3MNXA 1P2OA 1FY1A 1GJCB 3NZIA 3VEQB 3ZZ4A 3SNBA 2P3UB 1BBRH 1QQ4A 1XUGA 1P9UA 1SGQE 2QAAA 3GCHC 1DITH 2C8ZB 5CMXH 3STIA 1O3HA 1O35A 5A8XA 4WMEA 3VB7A 1A5HA 1FAKH 5A0CA 4INKA 1GJ8B 1SHYA 3RLYH 2QN5T 5T6DA 4IGDA 2SGEE 4AZ2B 4MG3A 1O36A 1YCPH 3KQBA 1T4UH 5EU8A 4R0IA 5K0HA 2BY6X 1T32A 4K69A 1V2KT 1QL7A 2F9VA 2BY5X 1V6DA 4A5TS 2PGBB 1ACBE 3PM3A 4RKJB 3SV7A 3SUEA 1GBFA 1YKTA 4WWYA 3TH4H 5LPEA 3BTHE 5HGGA 1L4DA 2A32A 1C5XB 2PUXB 3RC6A 1C2EA 4AORA 1INCA 3URDA 1BJUA 1QJ7B 4YOIA 3QUMP 2OC1A 1TOCB 3RXUA 1O5AB 1UTOA 3CS0A 4IS5A 1MBMA 1ZZZA 3UUZA 2HVXA 1C5ZB 4Y6DA 2NU2E 3GY7A 1KIGH 3FVFB 4MPXA 4YOJA 1EXFA 1AIXH 3SGBE 3SU5A 3Q77A 1ZPZA 4FU7A 1SSXA 2THFB 2V0BA 4NWKA 1H8IH 2QCYA 1J15A 1C5YB 2ZDNA 2VB0A 1ESAA 1V2VT 2BY8X 2OBQA 1GPZA 2ZQ1A 1Y59T 3DA9B 4FUBA 4I7YH 2ZFQH 4K5ZA 4CHAC 1P57B 3A86A 2CGAA 1TA6A 1ELVA 1EAXA 2A45B 4Y11E 2FI4E 2C8YB 1O2JA 1TQ7B 1SPJA 3T5FH 1C2MA 1ZTKA 5FAHA 3QGJA 4E7RG 1GG6C 1VJ9U 3PYHA 2JH0D 2ZQ2A 3IITA 1YLCA 1G3EA 1NU7B 5JB8S 2DE9A 5TCCA 1ETRH 2SNWA 1O2QA 1YBWA 2VWNA 1AQ7A 2R2MB 4NZLA 7GCHF 5EGMA 1C1RA 2BLQA 2NU1E 2NU4E 3UOPA 2Z9LA 1J14A 1MKWH 3RXHA 1FONA 1TRNA 5F8TA 2FTLE 3MNCA 1C2HA 3A7ZA 1TBRH 5FPYA 1Z8JB 2ZCKP 1EOJA 3S9CA 1AWHB 1SGEE 4MLFB 3BTFE 1GI9B 4U30A 1VITF 3CS7A 1O3LA 2HPPH 2FESH 2SFAA 2CF9H 2BD5A 4K60A 1XXDA 1ANBA 1FDPA 4JZFH 1PQ7A 5JBBS 2IPHA 1TAWA 2ZFRH 2YNAA 2C93B 4I33A 1ELBA 2PKSB 1TX8A 4GPGA 3HK3B 2ZNKH 2G4TA 5H4IB 1DY9A 1TGBA 2ZCLP 1HUTH 2AMPA 3ZVAA 2R9PA 1AFQC 1GJBB 2FIRH 1QA0A 3SJOA 1A0JA 1ELEE 2G4UA 4Y10E 2ZDAH 1SLWB 1TABE 3AW1A 4D9RA 1JOUB 1HAIH 2LPRA 2O8WA 1L4ZA 4Y8ZA 3L6PA 1HYLA 3N7OA 2OINA 4OS4A 3HGNA 3SU0A 4CHAB 2ZGJA 4X2XA 7GCHG 3MNBA 4JYTA 1O31A 3UNQA 1T7CA 1THPB 3O8BA 4Y76A 3SNAA 3DUXH 3PWBA 5A2MH 1EP5A 1NRSH 2UUKB 5FBEA 3A87A 3PV4A 3SGQE 2FWWA 4AX9H 1ZSJA 4Y0ZE 1G2MA 1A46H 3Q00A 3T28A 2BDAA 2FOHA 3VB5A 3BV9B 5LPFA 3RXEA 7LPRA 1C1OA 2FI3E 2WPIS 4OGXA 3BTTE 1WOFA 5A0BA 2ZF0H 3QDZB 1BTYA 1DSUA 1NZQH 3A84A 5AVDA 3MU4A 2OC0A 1GHZA 3U98H 2AGIX 4QT8C 5C1UA 1ZJKA 1W0YH 1KY9A 5HM9A 5FPSA 2R3YA 5DK1A 5SGAE 1FJSA 1G9IE 4E05H 2QXGA 1V2OT 4J1YA 1MQ6A 2JH5D 1ELFA 3ATWA 3RXBA 3HPTB 3F1SB 4ABEA 1YPLH 2ANWA 2F9PA 3MU0A 4X1NU 3Q76A 1TRMA 1F5RA 4GHTA 4UE7H 3RMOH 1T8LA 1KDQA 1FIWA 4AB8A 1AFQB 2BYAX 3FANA 3G01A 4YESB 2VNTA 4XDEA 1EKBB 1O5EH 3SJ9A 2GZ8A 1RS0A 1ABIH 1F0RA 4JYVH 4KKDA 4LK4A 2VIQA 3EGKH 4ZUHA 2EI8A 1IQFA 1J17T 3ZVFA 2HALA 3OTJE 3PMAB 1ZPBA 2F91A 2FP7B 1VR1H 1PPGE 4HTCH 5E8EH 3ESTA 1Q2WA 2PR3A 2BDHA 3LIWA 3F9EA 3KCGH 4VGCC 1AVWA 1BT7A 2TGAA 4IBLH 1C1UH 1LPGB 5BRRE 3S9BA 1D4PB 4JZEH 1HAOH 2EA3A 4AN7A 2AS9A 2VU8E 2Z9KA 4XSKU 1SGRE 1LPKB 2ZU5A 1F7ZA 1QRWA 2FOFA 1L1GA 2F3CE 1XKAC 3QTVH 5DO4H 1F5KU 3KNXA 1GL0E 2AEIH 2F9OA 1XUJA 3EDXB 3UPEA 3MU8A 5L6NH 1Y3VA 1GDUA 2ODYB 1DWDH 2JH6D 3V7TA 1NESE 4X1PU 3LKWA 1C4Y2 3SV2H 2B7DH 2ZFPH 2JETC 1L1NA 1GJ6A 1P01A 3OY6U 2WUCA 1GHVH 1C5PA 1MTVA 1MAXA 1K1PA 3M5OA 1SFIA 1GI7B 3EAJA 2Z9IA 2Z3CA 1EAUA 1RJXB 2A7HA 2RCEA 1EAIA 1EPTA 2HNTE 2J94A 5FX5A 1DLEA 2TPIZ 3MI4A 3T27A 4NIXA 2XTTB 5E0GA 2C8XB 1ELCA 5JBAS 1FY3A 5CHAC 3ZZAA 2GVFA 1QIXB 3LJOA 4KP0A 2WUBA 3Q3KA 1B0FA 4MNYA 3RXKA 1LQDB 2P94A 2QXJA 1GJ5H 3S7HB 2BLOA 1O2LA 2XBVA 2BDCA 1EPTC 4B2CA 1KDQB 1MUEB 1BB0B 4VGCB 5GDSH 1AI8H 1AUTC 3QO6A 3M35A 5JB9S 1QL8A 3GDVA 1ZMJA 4FU9A 3ITIA 2UUYA 2ZHFH 4Y79A 5C20A 1C9TA 2GT8A 2H2ZA 1UK3A 1O33A 3R3GB 5DKMA 1CBWC 1EOLA 1Q3XA 1TGNA 4X2VA 4RKOB 1ELAA 1NY22 3MO6A 1O3AA 1SC8U 3KQCA 1MH0A 2EEKA 3ZV8A 1TNHA 1K1OA 1GI2A 1K1LA 2TRMA 4KTUA 3EE0B 3GYMA 4AYYB 1Z1JA 1SI5H 4HI3A 1N8OC 4MPUA 1NC6A 5GWZA 1S82A 2JETB 1BBRK 2OLGA 9LPRA 1O2XA 1OWKA 1W11U 1GBKA 3A81A 1E36B 2QYIA 1KXCA 1XXFA 2WYJA 2D26C 1UTKA 4X8VH 3A82A 4K8BA 4TPIZ 3GY3A 3M37A 2BLWA 1CT0E 2BZAA 4NA9H 4X1RU 2B0FA 2NU3E 1W13U 3A7TA 1SGFG 2B5TB 2SNVA 2W7SA 3RM0H 3UWJH 1ZGVA 4ZAEA 3A8AA 2P93A 4I31A 1V2WT 3TJUA 1QJ1B 3NXPA 1HAZB 1SQTA 3GCTG 3SO3A 1OWIA 2ZI2H 1C1WH 1DT2A 1HXFH 1TWXB 3GDUA 2GP9B 1KTTB 1S0RA 1S84A 5CHAB 1GJ7B 5HM2A 2GCTC 4AOQA 1O2UA 4TY6A 1GJAB 1JXPA 1RTLA 1G2LA 3SJIA 1SMFE 1UVOA 3Q3XA 3I29A 1PPCE 4IMQA 2ODQA 1CT4E 1SG8B 3GISB 4ZROA 1E38B 1EPTB 1WUNH 3AAUA 4NIWA 2K1QA 2ZHEH 1Z7KA 5I25A 4Q7ZA 4JK5A 1P3CA 1V2ST 1AHTH 4FVBA 1GBIA 1NFUA 2BD7A 3A8CA 3SJKA 1O3NA 2VH0A 1DLKB 1BRCE 1GBEA 1TONA 3MWIU 2G00A 1A4WH 1HV7A 4UFDH 2Y5GA 1CBWB 1SGDE 1O2MA 4IC5A 1THRH 1MU8B 2P3TB 1G37A 1ESBA 3BTKE 3E6PH 3HKIB 5A0AE 4NCYA 1O38A 2TIOA 2SGQE 2G55A 6LPRA 2FOAA 2BVXH 5AHGH 1OOKB 4YTAA 3ZVEA 4FUDA 1ABJH 1SGFA 5EW2H 1LHGH 1GMCG 1HRTH 3S7KB 1SGNE 1DPOA 1UVUH 4Y71A 1QL9A 1GBLA 3TIUA 1TIOA 2VVUA 3U8OH 1A0LA 1UHBA 4Y8YA 4OS6A 1TNJA 3TGKE 1O2RA 1D3QB 3SUGA 1NFYA 1ELGA 1NRQH 2FOBA 3ENSB 3GICB 1S83A 4DIHH 4SGBE 1BA8B 3D62A 4YOGA 1MZDA 3U9AH 2XWBI 3DFJA 1RXPA 2UUFB 3B9FH 1SB1H 1O3OA 3BTQE 3P92A 1OP2A 1DXWA 4HGCA 3SV6A 1MD8A 2XBXA 3T62A 2V3HH 2ZGHA 6CHAB 2GCTB 3HGPA 5G4BA 1ZHPA 3K9XB 1HBTH 1JIRA 3V12A 3RLWH 1TPPA 1O39A 1O5CB 4ZKOU 1KLIH 4H42U 3E3TA 4YZUA 4CH2B 1C5SA 1SQAA 3LPRA 2FLBH 3P17H 1T8NA 7ESTE 4K2YA 1QURH 1KLTA 3VXFH 1P03A 2BOKA 1L0ZA 1O3KA 1E0FD 1W0ZU 1E37B 2RA3A 2GCHF 3GY5A 4WJG2 1GCTC 2A2XH 2BXTH 1OWHA 4YLUA 3ODFA 3C27B 2ANYA 1LVBA 2BB4A 1AZZA 1DM4B 1TGSZ 1P11E 4BAQB 2O8TA 1GI1A 2GV7A 1IQHA 2WPLS 2C4FH 3MH5A 1Z8RA 1UMAH 3RXIA 1VCPA 4XOJA 3RXLA 1SGTA 1FY4A 5C1YA 4GVUA 1GI8B 1C1VH 5FXLA 1A2CH 5EPNA 1FMGA 3BF6H 1GI5A 2ZHWH 1C5VA 5BPEA 1BTXA 1P06A 1VGCB 4ZHMU 1NFWA 5B6OA 4HZHA 1VCWA 4NGAH 2J34A 3LDXH 2TGTA 3S0NA 5JBCS 3STJA 3MO3A 1TQ0B 2WPHS 4IC6A 1MTSA 3MHWU 1D3DB 2F83A 4ZKRU 3RMMH 3E8LA 3P8NA 1OP0A 4Q80A 1QQUA 1P2JA 2ZDKA 1ZSLA 1XMNB 2Y7XA 1V2UT 5EG4A 5DGJA 2GKVE 3UNRA 1TGTA 4NIVA 1UHBB 1MKXK 1ELTA 1FV9A 1NS3A 4BTTB 3IG6B 3QGNB 2GCHG 3MNSA 1PQ5A 4JZDH 1D3TB 5DP8A 1T4VH 1Y5AT 5FBIA 1QNJA 1FZZA 4BANB 4PROA 4CH8B 1FY5A 2F9UA 4B73A 1UTPA 4WH8A 3FFGA 1OSSA 4CBOA 3TH2H 4AFSA 1MTNC 4K8YA 1K21H 4UFFH 2ZGXH 4CRDA 2XBYA 1G36A 1V2NT 1AN1E 3UREA 1O2GH 3KEEA 2ZFTA 3EYDA 3M5NA 3MTYA 4X6PA 3EA8A 1YCPM 1C5OH 4B75A 5F8ZA 1HCGA 1FPHH 3GCHB 2BXUH 2IJOB 4THNH 2P95A 4AGKA 1H4WA 3F9GA 4Z0KA 2BM2A 4I32A 3SU2A 2ANKH 3RU4E 2BDBA 1ZGIA 1WAYB 3HKJB 1C2IA 2ZPSA 2J38A 4X8SH 5DP5A 2QF0A 5GXPA 1ARCA 2WPKS 1ZSKA 4JCNA 2FS9A 4FUFA 2XBWA 3IWMA 1RRKA 3SW2B 3SZNA 3M5MA 1GL1A 4ZH8A 2PSYA 3LGIA 2ZTYA 4U32A 4Y0YE 2CV3A 1IOEA 4D8NA 1RIWC 3M5LA 1M9UA 2OXSA 3SNCA 1YYY1 1LPZB 4H6SB 3TVJB 3GY8A 4F49A 4KTSA 1O2ZA 3I78A 4IN2A 1HJAC 3PMHB 1PJPA 3UNSA 1BHXB 2ZKSA 3U8RH 4ABJA 1MU6B 1T8OA 5ABWA 3C1KA 3QX5H 2G8TA 1GGDC 3UTUH 1O3CA 1H9LB 2Z7FE 3BTWE 1O2SA 5DP4A 3MFJA 1GHBF 1ZOMA 2P59A 3BTDE 1C5QA 1ZTJA 1O3BA 1P04A 1C2KA 1DOJA 4ZXYH 3BIUH 2HWLB 1N1LA 3KHVA 1BMNH 1UTQA 3LJJA 1P02A 4XBCA 2ILNA 4ISNA 1BOQA 1LVYA 3RXFA 1O37A 2EC9H 2FOCA 1ZJDA 1FXYA 1LTOA 1ELDE 3PB1E 1KXFA 1WQVH 4X0WU 3PLKA 1JWTA 1OX1A 5DPAA 3K6YA 1IQKA 1FY8E 1GBCA 3GY6A 5EXNA 1HAVA 4K1TA 1GVLA 4KELA 1CA8B 2Y81A 1GVKB 2GDDA 3V13A 4O3TA 3KQDA 1F2SE 1GG6B 1PYTD 2FDAA 3F68H 4KTCA 2ALVA 3BEIB 1V2QT 1AZ8A 3U69H 3SNEA 1QCPA 5L2YH 1LVOA 2QGRA 1GDQA 1HAHH 4NZQA 1LMWB 2WINI 1GJDB 4RSPA 1CGJE 2ZCHP 3UY9A 1GJ9B 2FMJA 1FI8A 1K1JA 2RA0A 2GTBA 1TPSA 5C5OA 2Z9JA 1RIWB 3SV8A 1GHBG 1JRSA 2XC5A 3GYLB 1FIZA 1ZYOA 2HNTF 4BTUB 2ZDLA 1HJAB 4FUCA 1ID5H 2W26A 4UEHH 1WBGB 4LXBH 2ZEBA 5JDUB 1J16A 3D23A 2PGQB 4JZIA 1O32A 3RXTA 4D76A 1QGFA 1AWFH 1IHSH 3EA7A 1UVSH 1A61H 1K1NA 1PYTC 3W95A 2ZIQH 3SJ8A 2A0QB 2VIPA 2XC0A 2XNIA 2ZDVH 3SN8A 3V0XA 4A92A 1FQ3A 1SGYE 8KME2 2OC7A 1P2NA 3E0PB 1TB6H 1CT2E 4FUIA 1EZQA 3R0FA 2F9BH 1AKSA 1IHTH 2ZTZA 6GCHF 4YLQH 3BG4C 4ABGA 1OS8A 1DDJA 3BTME 5E0JA 1ETTH 2Q6GA 2AGEX 1O5DH 2BVRH 3RDZA 3P8GA 3QWCH 2FX6A 1BCUH 2SGPE 1WSSH 4ZKSU 1SOTA 3LT3A 4JYUH 4TY7A 2XRCA 5GCHG 1YPHE 1AU8A 1GBBA 3QZRA 3UQOA 1PPBH 4BXWA 1YM0A 3BN9A 2BY9X 4NIYA 4SGAE 4BAOB 1MQ5A 4WXIA 5J4SA 2BDYA 3OYPA 3L3TA 1S6FA 3H7TA 3P70B 4OS2A 2BDGA 1D9IA 4Y7BA 4D7FA 1VZQH 1P05A 1TMTH 4FVDA 1XX9A 1EJMA 1C5WB 1K1IA 3BTGE 1UCYK 4B2BA 1LHDH 1F5LA 2XW9A 1V2LT 5GJ4B 1C4U2 2BDIA 2VGCC 2ZPQA 1NTPA 2RDLA 1FAXA 1TA2A 4K3JA 5CE1A 3AVZA 3ZVDA 1SL3A 1UVPA 1QJ6B 1GHXH 1O3DA 1P8VC 4BAKB 1BTZA 3UIRA 1Z6JH 3F6UH 1SQOA 1N6YA 1RTKA 2J9NA 1GMDF 1H1BA 2I6QA 1LVMA 1Z1IA 5EXMA 2O9QA 3FP7E 6GCHG 3P95A 4ABAA 1EAWA 3ZYEA 3NCLA 4MNVA 1NT1A 1AUJA 3M3TA 1WTHD 1QTFA 1Y3XA 1OYQA 1UK4A 4K1EA 1VCQA 2XXLA 3NPSA 3LONA 1AD8H 2PKAA 1WTGH 4FUHA 1AFEH 3VB6A 5JYIA 1AB9C 2Y5FA 4DG4A 1Q31A 5T6GA 2QXIA 5ESTE 2QF3A 1DY8A 1NM6A 1UTLM 1BTWA 4ISOA 4XE4A 3BG4B 1S0QA 3A7XA 1PPEE 1YC0A 1A1RA 1P2MA 4H6TA 1HNEE 1DFPA 1A0HB 1YPKH 1LCYA 3OY5U 2IN2A 4X6MA 4ASHA 3LC5A 1ZHMA 1HLTH 2AERH 3RXOA 3BEFB 3M61U 3GCTF 4YM9A 1UO6A 1NRPH 2FTMA 2H5CA 1AKSB 1GMHF 1KTSB 5LPRA 1CE5A 3TJVA 1GBHA 4J2YB 1P2IA 1W7XH 4Y8XA 2WV4A 4B71A 2ESTE 1SHHB 1WCZA 5A8ZA 3QTOH 1DANH 1C5MD 1QFKH 2PUQH 1K28D 3ATLA 2D2DA 2M5TA 1GMDG 2HNTC 4ABDA 4X8UH 2VGCB 2Y7ZA 3NKKA 2P3FH 5LGOA 3BEUA 1DXPA 1HDTH 4WMDA 1MTWA 1YLDA 4M7GA 1HB0B 1H8DH 2NWNA 3MYWA 3RUOA 3ZZCA 1QR3E 4WMFA 3U8TH 1C9PA 1TNKA 3MH7A 3AASA 3A7VA 1SFQB 4ABBA 1XM1A 4D9QA 1GDNA 1OWJA 4FUEA 1DE7H 4B2AA 2FPZA 3QN7A 2BD3A 8GCHF 2G51A 1HAGE 3P6ZB 2UUJB 1G3CA 2BLVA 2FO9A 1C2FA 1AY6H 1YPJH 2OBOA 2BTCE 1T8MA 1BMMH 1QRXA 3HATH 2W7UA 1FUJA 3TITA 3QLPH 1W2KH 3E0NB 2BX4A 1V2RT 1GMCF 1YCPK 4ZKNU 2B9LA 2WPMS 2A4RA 1YGCH 2XYAA 3UFAA 4GCHF 1GMHG 1K1MA 1DUAA 3BG8A 1AGJA 5PTPA 1P12E 1KYNA 2QY0B 2G5NA 4MPVA 1XKBC 3O8DA 5EXLA 3M36A 1UK2A 3MU1A 1TMBH 2GZ9A 1MCTA 1CU1A 3FP8E 4AG2A 1C4V2 4LOYH 3A88A 1NRNH 1PPFE 1S5SA 4TPYA 2YOLA 3LGUA 1BDAA 2ZP0H 1ANCA 3KF2A 1V2JT 3K2UA 3M3SA 1MMJN 1UTJA 3A89A 2BQ7B 2OP9A 2TBSA 4IN1A 2A4GA 5FHTA 4NG9H 4TWYA 4DOQA 1W3CA 2G5VA 5T6FA 4ISHH 3GY2A 4A6LA 4GSOA 2Y5HA 4LZ4B 4IMZA 3CP7A 1DWBH 2P8OC 2TGDA 3ZV9A 1K2I1 1NFXA 3GOVB 3RXGA 1C1TA 1UVTH 2Z3DA 3SGAE 3A85A 5ESBA 1P10A 5A09A 1BJVA 1W14U 1TMUH 4MNXA 1BRAA 8GCHG 4Z6AH 3SQHE 1CVWH 5AFYH 1B0EA 1TE0A 4DURA 1SR5C 5EPYA 1O34A 3RM2H 4UFEH 2CJIA 1TX7A 1N8OB 2R2WU 2CHAC 5F03A 1S81A 3LGTA 3QZQA 1WV7H 5T3HA 4X8TH 5C3NA 5FX6A 4GCHG 3LH3A 2VIDA 2ZZUH 1BTHH 5AFZH 2AFQB 3NK8A 2AH4X 4X6OA 1ZHRA 2SGFE 1O3EA 3A8DA 1KLJH 3SNDA 1B5GH 2NU0E 4FU8A 2QC2A 1HAXB 3GY4A 3LC3A
chains in the Genus database with same CATH superfamily
1GBTA 1ZMLA 2OUAA 1RD3B 4Q7XA 4P02A 1TNGA 5DP6A 5EODA 1EX3A 4I8KA 3VB3A 3PMJA 4A1TA 2A31A 3FZDA 1H9IE 3SBKA 2V35A 1E79D 3OU0A 2G81E 2PSXA 1ZRKA 1MKWK 2VBCA 3RMNH 4UONA 1AE8H 1C1NA 2ZHDA 5E0HA 1BIOA 1XVOA 2V3OH 5GNDA 1SGPE 1JMOH 1D6RA 3ZZ8A 2I6SA 4BNRA 7KMEH 3H09A 1AO5A 1GI0A 2ZGBH 3KIDU 3BIVH 1SGIB 3ZZBA 3M7TA 1QB9A 3RXRA 3PMBB 4R8TB 1TPAE 1CO7E 3L33A 2CXVA 1DICA 1P3EA 2P8OB 2Y80A 2Z94A 3SU6A 2ALPA 2OQ5A 2F4LA 6ESTA 2IJD1 2SGDE 3KYGA 1QA7A 3PO1C 2P16A 1YF4A 1BTUA 2FOGA 1B7XB 1MCVA 3VXEH 1O0DH 1CA0C 1GBAA 3U1JB 1LKBA 2VIWA 2ZHQH 4ABIA 2CHAB 1V3XA 3UWIA 1SVPA 2VWLA 1LQEA 4TWWA 8LPRA 2UWLA 1BRUP 2UWPA 3S9AA 3W94A 1GJ4H 2ASUB 4BXSA 4B74A 3MH6A 4FUGA 4WF8A 5TJXA 4OS1A 4CRGA 3RXCA 5C2ZA 2A7JA 3RU4T 2ZGCA 1O3GA 2Q6FA 1PQ8A 4YO9A 3LGVA 4NA7A 4U01A 2XCFA 4X1QU 2ZFFH 2BOHB 3RXQA 3ZZ7A 1OPHB 1Y8TA 2WPJS 1AVGH 4FETA 4CBNA 2FYQA 3PV2A 2AGGX 1C5NH 4HFPB 4AB9A 1SOZA 4NSVA 1ZRBA 2GD4B 4E06H 1EB1H 2W3KA 3DSGA 4LZ1H 4DVAU 1MTUA 4MNWA 1C1MA 3EA9A 4I8LA 2AIQA 1GI3A 4A7IB 2PKSC 1O2YA 3MU5A 4CREA 4X1SU 2VVCA 2ZECA 4NFFA 1T31A 3ZZ5A 1GCTB 2DUCA 3FP6E 1Z8GA 1EP6A 3UOUA 2ZWLH 3OFND 3DHKH 2KCAA 2HLCA 1A5GH 3F2HA 3PO1B 2WYGA 1HJ9A 5E2OA 1BMAA 1OP8A 3RU4D 1PQAA 2GX4A 1N6XA 4O97A 4Y7AA 1CA0B 3PTBA 5DP7A 3K65B 1DVAH 3AW0A 1PPHE 4ZMAH 3UAIC 1COWD 3TNSA 1IQLA 2QXHA 4WXVA 2PV9B 2A7CA 1YPMH 1P09A 2PTCE 1K0HA 2XC4A 3E16B 1QRZA 1TNLA 2GGVB 1DUEA 1A7SA 1AE5A 1QB1A 4IW4E 1U6QA 3ATIA 1K9OE 4DT7B 4YXWD 2HRVA 3OEED 8ESTE 1KXAA 1PFXC 4RT0A 5L30H 3M7QA 2PWXA 5GPIB 3TPIZ 2GZ7A 3PV5A 1DSTA 4DIIH 3NUMA 1O2TA 1XUKA 1O3IA 1C1SA 3WY8A 1UJ1A 1DWCH 1IQNA 1F92A 1RFNA 2L74A 2BD4A 1WU1A 1TYNA 2HGTH 2RG3A 1P9SA 3RXJA 1D6WA 4F55A 2FXRA 2OC8A 4CRBA 9ESTA 1GHAF 3H7OA 3JZ2B 4CRCA 2STBE 1IQGA 1LHFH 2TGPZ 3Q3YA 4X2WA 1EB2A 1TLDA 3TJNA 5HYOA 4AG1A 1MTNB 2BHGA 3CENA 3B23B 2OD3B 1KXDA 4ABFA 1C2DA 1KXBA 1MBQA 1E35B 1IAUA 1Y3WA 2BX3A 1S6LA 1O2PA 1E34B 1W8BH 4AFUA 4YT7H 1F0TA 2BZ6H 3OEHD 1C2JA 2KAIA 1BUIA 2BY7X 2H9HA 1A3BH 5DP3A 1SLUB 4Q7YA 2ANMH 3GCNA 5FCKA 1ORFA 3ATMA 1UCYE 1C5UA 1G3BA 1J9CH 2SGAA 1EJNA 1IQJA 2BVSH 3RXDA 2GDEH 4YT6H 2QA9E 1UTNA 3WW7A 3WWBA 4GLYA 4OGYA 2PLXA 5EW1H 1ANDA 5EQRA 5EOKA 2R3UA 3ZIAD 4I8HA 1GI4A 1C1QA 3TK5A 5GCHF 3VB4A 2AMQA 3GCOA 4CRAA 3OX7U 1G32B 2VJ1A 5C5NA 3U1IB 3SUFA 3DSOA 1SGCA 1LO6A 2OTVA 2PP6A 5FCRA 5FPTA 2BD8A 2BMGB 3TJOA 4AFZA 5I46H 3PROA 1EZSC 3ZVGA 2G52A 3UR9A 1CGHA 1EZUC 1VITG 1SBWA 4NFEA 1GHAG 1L1JA 1GGDB 3PWCA 3SUDA 3N7EA 2BQ6B 3SI3H 2GV6A 4O9VA 3RXPA 1MKXH 4WY3A 2B8OH 2VWMA 3F9HA 3PTNA 2C90B 2IPQX 4U2WA 3LOXA 4FUJA 2AMDA 4RN6A 1TBZH 3W1EA 3KGPA 2J2UA 3O8CA 1QY6A 3D49H 1WQSA 1HJ8A 3DT0H 3M3VA 3F0PA 3RC5A 2LNCA 1RGQA 1O2VA 4AFQA 4FOUC 1ZPCA 2FM2A 5A8YA 3MQKC 4XBBA 3SI4H 1FPCH 2OQUA 2D8WA 1Y5UT 1OXGA 2Q6DA 1O3FA 3A7WA 2VVVA 3SU1A 2ZC9H 3KL6A 5EQQA 3TH3H 1EUFA 3LGWA 4XRNA 1HPGA 3MH4A 1O3JA 4MTBA 2Z9GA 4I86A 2ZG0H 3S69A 1O30A 1O2IA 1ZTLA 2O8MA 3A8BA 1Z8IB 5HMAA 1VJAU 1OHHD 2XWAA 1Y3UA 3TU7H 2EY4C 1O2WA 3H5CB 1C1PA 1O2HA 1YPEH 2KAIB 2GMTC 2H6MA 2C8WB 3HK6B 3LGYA 5L2ZH 1GBDA 1F0SA 4MPWA 2F9NA 2FODA 4XBDA 1Y5BT 1HAVB 1HGTH 1L2EA 1XUIA 3VGCC 1O2NA 1WYKA 3UR6A 4FXGH 2W5EA 1O3PB 1AMHA 1GVZA 2QIQA 1BBRE 1Y3YA 1FNIA 2ZDMA 1GHYH 2CF8H 3SHAH 1V2PT 4CRFA 3A83A 2IOTA 4ABHA 3JZ1B 1S6HA 4A1XA 1QBNA 1SQRA 3VPKA 3BSQA 1UW7A 1YPHC 1ESTA 2A4QA 2A1DB 1CQQA 4INHA 2ULLA 2CK3D 3D65E 2VINA 4GAWA 3LH1A 1K22H 4AGJA 2H9TH 3LU9B 2F43B 3ZVBA 1GBMA 4KGAA 1GCDA 1H9HE 1FN8A 3ZZ9A 2FI5E 2PHBA 1G30B 3T26A 1X7AC 4ZHAA 2FLRH 5HKKD 2VH6A 1TALA 2V6NA 4BTIB 2J95A 3M7UA 2FOMB 1EFRD 1Z71A 4UDWH 4Q4LA 2BD2A 1P0SH 3RP2A 3T25A 1THSH 2Y82A 2AIPA 4A1VA 1OKXA 1LKAA 1W10U 4MQAA 1XVMA 3N7DA 4ESTE 1BRBE 4NWLA 2ZPRA 1NBMD 5DJ7A 1DWEH 2Y6TA 3RXAA 3ATKA 3ZZ6A 5C67A 5F8XA 1TRYA 2AYWA 3ODDA 3TGJE 1ZMNA 5ETXA 4O03A 4OS5A 5E2PA 1O3MA 2M2AA 2OCVB 4ISLA 3ZZDA 1G3DA 1EZXC 2O8LA 5AF9H 1ZR0A 2WV5A 1D3PB 1GBJA 3KN2A 3FZZA 1LHEH 2A5KA 2GMTB 1CGIE 1O5GH 3I77A 1CHOF 1HIAA 3VGCB 4H4FA 3GDSA 4JZ1A 2STAE 3O8RA 3A7YA 2A5AA 3RC4A 1LHCH 3SV9A 1ARBA 1NO9H 2FOEA 3CNRA 3T2NA 2DE8A 4ISIH 1DS2E 2JKHA 4MDSA 2A4OA 1A3EH 3T29A 2KX4A 2WHXA 1XUHA 1HAYB 2UWOA 4ZHLU 1TNIA 1JIMA 1OWDA 2FX4A 3KYFA 1ZLRA 1CSOE 3A80A 4ACAA 1HAPH 1JRTA 2BQWB 5TCAA 2ZO3H 2CN0H 5IK2D 2ZA5A 3SHCH 3F3BA 2HPQH 1HFDA 2H1UA 3RXSA 4Q2KA 4DCDA 2VIOA 1AB9B 2R0LA 1GHWH 3DCLA 1TGCA 3K6ZA 3PLPA 3E91A 1NRRH 4E7NA 4K1SA 1EJAA 1YPGH 2D1JA 3SU3A 2C3SA 1IQEA 1NROH 4OS7A 4WVPE 2FZZA 1SLXB 2A5IA 3RXMA 2CMYA 4AYVB 1EQ9A 2QE7D 3B8JA 5DG6A 2YNBA 1UTMA 1W12U 4B1TA 1FN6A 2PKAB 2Z6BD 1QHRB 3TLOA 1GWAA 1NPMA 1Z6EA 2VWOA 1CHOG 2R0KA 3FAOA 3TNTA 4HG6A 1BITA 3SQEE 4MVNA 4INLA 3SORA 1BZXE 2J92A 4TYDA 6CHAC 2K8IA 2BD9A 1UCYH 4BAMB 3ZVCA 5JPMH 1MAYA 1TPOA 4F4OC 3DD2H 1BHXF 2GT7A 1QBVH 1F0UA 1J8AA 1O2OA 3E90B 1KSNA 4UFGH 5EQSA 1TX6A 4GUXA 4B76A 1ETSH 2QV1A 1TFXA 1MZAA 4ZXXH 4WH6A 4DW2U 3RMLH 1RTFB 3MMGA 1NU9A 3EQ0H 4DJZB 1P2QA 3TK6A 3SOSA 2FYRA 5LH8A 2ZU3A 2FEQH 5C1XA 4NA8A 1IQIA 1O5FH 1QB6A 1C5RA 2PW8H 4X6NA 2W3IA 4XFQA 4DY7B 2VIVA 5IDKA 3DFLA 3AAVA 1MD7A 1KXEA 1AVXA 2H5DA 1TBQH 2Q1JA 1HIAB 2J4IA 1C5LH 2FS8A 3BTEE 5HIZA 3F0OA 1A5IA 1DX5M 3ELAH 1JBUH 1C2GA 1V2TT 4I8GA 4O3UA 2ZTXA 1V2MT 3KQEA 5JBTA 3RXVA 1TOMH 4CR5A 1P2KA 3P8OA 2EI6A 5K7RA 3P8FA 5GIBA 4DGJA 2ZU2A 2HOBA 1CHGA 1ANEA 3URCA 2GJGA 1BTPA 2A2QH 2ZU1A 3V3MA 2XCNA 1NN6A 5J4QA 1IQMA 3MO9A 5EIYA 1VGCC 2O8UA 1OYTH 3PLBA 1C2LA 3VFEA 4D7GA 4UD9H 2ZU4A 1GI6A 3TGIE 4I8JA 3UQVA 3NWUA 2H9EH 4JK6A 3TK9A 2PFEA 4CR9A 5HXFA 1S85A 4BAHB 3E1XB 5C0UA 2ODPA 4JMYA 4X2YA 1C5TA 1SLVB 3ZZ3A 1EASA 3SU4A 5F6MA 1BMLA 1VITH 2ZFSA 1EATA 2PTNA 3MOCA 4NSYA 5DP9A 1LDTT 3ZYDA 1W7GH 4BOHA 2J5UA 1QBOA 1HXEH 5CHBA 3F9FA 1O2KA 2Z3EA 3OSYA 1OWEA 1O5BB 1YP9A 5IYTA 1BQYA 1XUFA 2EI7A 4GHQA 1FLEE 1PPZA 3QK1A 3MNXA 1P2OA 1FY1A 1GJCB 3NZIA 3VEQB 3ZZ4A 1BMFD 2P3UB 3SNBA 1BBRH 1QQ4A 1XUGA 1P9UA 1SGQE 2QAAA 3GCHC 1DITH 2C8ZB 5CMXH 3STIA 1O3HA 1O35A 5A8XA 4WMEA 3VB7A 1A5HA 1FAKH 5A0CA 2V3MA 4INKA 1GJ8B 1SHYA 3RLYH 2QN5T 5T6DA 4IGDA 2SGEE 4AZ2B 4MG3A 1O36A 3OTPA 1YCPH 3KQBA 1T4UH 5EU8A 4R0IA 5K0HA 2BY6X 1T32A 4K69A 1V2KT 2J97A 1QL7A 2F9VA 2BY5X 1V6DA 4A5TS 2PGBB 1ACBE 3PM3A 4RKJB 3SV7A 3SUEA 1GBFA 1YKTA 4WWYA 3TH4H 5LPEA 3BTHE 5HGGA 5KGOA 1L4DA 2A32A 1C5XB 2PUXB 3RC6A 1C2EA 4AORA 1INCA 3URDA 2XNDD 1BJUA 1QJ7B 4YOIA 3QUMP 2OC1A 1TOCB 3RXUA 1O5AB 1UTOA 3CS0A 4IS5A 1MBMA 1ZZZA 3UUZA 2HVXA 1C5ZB 4Y6DA 2NU2E 3GY7A 1KIGH 3FVFB 4MPXA 4YOJA 1EXFA 1YLNA 1AIXH 3SGBE 3SU5A 3Q77A 1E1RD 1ZPZA 4FU7A 1SSXA 2THFB 2V0BA 4NWKA 1H8IH 2QCYA 5B6LA 5C94A 1J15A 1C5YB 2ZDNA 2VB0A 1ESAA 1V2VT 2BY8X 2OBQA 1GPZA 2ZQ1A 1Y59T 3DA9B 4FUBA 4I7YH 2ZFQH 2KR7A 4K5ZA 1P57B 4CHAC 3A86A 2CGAA 1TA6A 1ELVA 1EAXA 2A45B 4Y11E 2FI4E 2C8YB 1O2JA 1TQ7B 1SPJA 3T5FH 1C2MA 1ZTKA 5FAHA 3QGJA 4E7RG 1GG6C 1VJ9U 5KEDA 3PYHA 2JH0D 4RT1A 2ZQ2A 3IITA 1YLCA 1G3EA 1NU7B 5JB8S 2DE9A 5TCCA 1ETRH 2SNWA 1O2QA 1YBWA 2VWNA 1AQ7A 2R2MB 4NZLA 7GCHF 5EGMA 1C1RA 2BLQA 2NU1E 2NU4E 3F2FA 2Z9LA 3UOPA 1J14A 1MKWH 3RXHA 1FONA 1TRNA 5F8TA 2FTLE 3MNCA 1C2HA 3A7ZA 1TBRH 5FPYA 1Z8JB 2ZCKP 1EOJA 3S9CA 1AWHB 1SGEE 4MLFB 3BTFE 1GI9B 3FKSD 4U30A 1VITF 3CS7A 1O3LA 2HPPH 2FESH 2SFAA 2CF9H 2BD5A 4K60A 1XXDA 1ANBA 1FDPA 4JZFH 1PQ7A 5JBBS 2IPHA 1TAWA 2ZFRH 2YNAA 2C93B 3WWFA 4I33A 1ELBA 2PKSB 1TX8A 4GPGA 3HK3B 2ZNKH 2G4TA 5H4IB 1DY9A 1TGBA 2ZCLP 1HUTH 2AMPA 3ZVAA 2R9PA 1AFQC 1GJBB 2FIRH 1QA0A 3SJOA 1A0JA 1ELEE 2G4UA 4Y10E 2ZDAH 1SLWB 1TABE 4ZCNA 2WV9A 3AW1A 4D9RA 1JOUB 1HAIH 2LPRA 2O8WA 1L4ZA 4Y8ZA 3L6PA 1HYLA 3N7OA 2OINA 4OS4A 3HGNA 5HIYA 3SU0A 4CHAB 5EJ1A 2ZGJA 4X2XA 7GCHG 3MNBA 4JYTA 1O31A 3UNQA 1T7CA 1THPB 3O8BA 4Y76A 3SNAA 3DUXH 3PWBA 5A2MH 3FO8D 1EP5A 1NRSH 2UUKB 5FBEA 3A87A 3PV4A 3SGQE 2FWWA 4AX9H 1ZSJA 4Y0ZE 1G2MA 1A46H 3Q00A 3T28A 2BDAA 2FOHA 3VB5A 3BV9B 5LPFA 5F53A 3RXEA 7LPRA 3FOAA 1C1OA 2FI3E 2WPIS 4OGXA 3BTTE 1WOFA 5A0BA 2ZF0H 3QDZB 1BTYA 5DSFA 1DSUA 4TT3D 1NZQH 3A84A 5AVDA 3MU4A 2OC0A 1GHZA 3U98H 2AGIX 4QT8C 5C1UA 2L6OA 1ZJKA 2V7QD 1W0YH 1KY9A 5HM9A 5FPSA 2R3YA 5DK1A 5SGAE 1FJSA 1G9IE 4E05H 2QXGA 1V2OT 2QF4A 4J1YA 1MQ6A 2WPDD 2JH5D 1ELFA 3ATWA 3RXBA 3HPTB 3F1SB 3GS9A 4ABEA 1YPLH 2ANWA 2F9PA 2KCYA 3MU0A 4X1NU 3Q76A 1TRMA 1F5RA 4GHTA 4UE7H 3RMOH 1T8LA 1KDQA 1FIWA 4AB8A 1AFQB 2BYAX 3FANA 3G01A 4YESB 2VNTA 4XDEA 1EKBB 1O5EH 3SJ9A 2GZ8A 1FX0B 1RS0A 1ABIH 1F0RA 4JYVH 4KKDA 4LK4A 2VIQA 3EGKH 4ZUHA 2EI8A 1IQFA 1J17T 3ZVFA 1VKYA 2HALA 3OTJE 3PMAB 1ZPBA 2F91A 2FP7B 1VR1H 1PPGE 4HTCH 5E8EH 3ESTA 1Q2WA 2PR3A 2BDHA 3LIWA 3F9EA 3KCGH 4VGCC 1AVWA 1BT7A 2TGAA 4IBLH 1C1UH 1LPGB 5BRRE 3S9BA 1D4PB 4JZEH 3AK5A 1HAOH 2EA3A 4AN7A 2AS9A 2VU8E 2Z9KA 4XSKU 1SGRE 1LPKB 2ZU5A 2LP6A 1F7ZA 1QRWA 2FOFA 1L1GA 2F3CE 1XKAC 3QTVH 3U28C 5DO4H 1F5KU 3KNXA 1GL0E 2AEIH 2F9OA 1XUJA 3EDXB 3KQ5A 3UPEA 3MU8A 5L6NH 1Y3VA 1GDUA 2ODYB 1DWDH 2JH6D 3V7TA 1NESE 4X1PU 3LKWA 1C4Y2 3SV2H 2B7DH 2ZFPH 2JETC 1L1NA 3FN8A 1GJ6A 1P01A 3OY6U 2WUCA 3OAAD 1GHVH 1C5PA 1MTVA 1MAXA 1K1PA 3M5OA 1SFIA 2JJ2D 1GI7B 3EAJA 2Z9IA 2Z3CA 1EAUA 1RJXB 2A7HA 2RCEA 1EAIA 1EPTA 2HNTE 2J94A 5FX5A 2RFKC 1DLEA 2TPIZ 3MI4A 3T27A 4NIXA 2XTTB 5E0GA 2C8XB 1ELCA 5JBAS 1FY3A 5CHAC 3ZZAA 2GVFA 1QIXB 3LJOA 4KP0A 2WUBA 3Q3KA 1B0FA 4MNYA 3RXKA 1LQDB 2P94A 2QXJA 1GJ5H 3S7HB 2BLOA 1O2LA 2XBVA 2BDCA 1EPTC 1NBME 4B2CA 1KDQB 1MUEB 1BB0B 4VGCB 5GDSH 1AI8H 1AUTC 3QO6A 3DSPA 3M35A 1QL8A 5JB9S 3GDVA 1ZMJA 4FU9A 3ITIA 2W6ID 2UUYA 2ZHFH 2QF5A 4Y79A 4M9FA 5C20A 1C9TA 2GT8A 2H2ZA 1UK3A 1O33A 3R3GB 5DKMA 1CBWC 1EOLA 4Z1MD 1Q3XA 1TGNA 4X2VA 1WXRA 4RKOB 1ELAA 1NY22 3MO6A 1O3AA 3PRBA 1SC8U 3KQCA 1MH0A 2EEKA 3ZV8A 1TNHA 1K1OA 1GI2A 1K1LA 2TRMA 4KTUA 3EE0B 3GYMA 4AYYB 1Z1JA 1SI5H 4HI3A 1N8OC 4MPUA 5EJZA 1NC6A 5GWZA 1S82A 2JETB 1BBRK 2OLGA 9LPRA 5CDFE 1O2XA 1OWKA 1W11U 1GBKA 3A81A 1E36B 2QYIA 1KXCA 1XXFA 2WYJA 2D26C 1UTKA 4X8VH 3A82A 4K8BA 4TPIZ 3GY3A 3M37A 2BLWA 1CT0E 2BZAA 4NA9H 4X1RU 2B0FA 2NU3E 1W13U 3A7TA 1SGFG 2B5TB 2SNVA 2W7SA 3RM0H 3UWJH 1ZGVA 4ZAEA 3A8AA 2P93A 4I31A 1V2WT 3TJUA 1QJ1B 3NXPA 1HAZB 1SQTA 3GCTG 3SO3A 1OWIA 2ZI2H 1C1WH 1DT2A 1HXFH 1TWXB 3GDUA 2GP9B 1KTTB 1S0RA 1S84A 5CHAB 1GJ7B 5HM2A 2GCTC 4AOQA 1O2UA 4TY6A 1GJAB 1JXPA 1RTLA 4DT4A 1G2LA 3SJIA 1SMFE 1UVOA 3Q3XA 3I29A 1PPCE 4IMQA 1CT4E 1SG8B 2ODQA 3GISB 4ZROA 1E38B 1EPTB 1WUNH 3AAUA 4NIWA 2K1QA 2ZHEH 1Z7KA 5I25A 4Q7ZA 4JK5A 1P3CA 1V2ST 1AHTH 4FVBA 1GBIA 1NFUA 2BD7A 3A8CA 3SJKA 1O3NA 2VH0A 1DLKB 1BRCE 1GBEA 1TONA 3MWIU 2G00A 1A4WH 1HV7A 4UFDH 2Y5GA 1CBWB 1SGDE 1O2MA 4IC5A 1THRH 1MU8B 2P3TB 1G37A 1ESBA 3BTKE 3E6PH 3HKIB 5A0AE 4NCYA 1O38A 2TIOA 2SGQE 2G55A 6LPRA 2FOAA 2BVXH 5AHGH 1OOKB 4YTAA 3ZVEA 4FUDA 1ABJH 1SGFA 5EW2H 1LHGH 1GMCG 5C0TA 1HRTH 1H8HD 3S7KB 1SGNE 1DPOA 1UVUH 4Y71A 5T1VA 1QL9A 1GBLA 3TIUA 4ASUD 1TIOA 2VVUA 3U8OH 1A0LA 1UHBA 4Y8YA 4OS6A 1TNJA 3TGKE 1O2RA 1D3QB 3SUGA 1NFYA 1ELGA 1NRQH 2FOBA 3ENSB 3GICB 1S83A 4DIHH 4SGBE 2KZ4A 1BA8B 3D62A 4YOGA 1MZDA 3U9AH 2XWBI 3DFJA 1RXPA 2UUFB 3B9FH 1SB1H 1O3OA 3BTQE 3P92A 1OP2A 1DXWA 4HGCA 3SV6A 1MD8A 2XBXA 3T62A 2V3HH 2ZGHA 6CHAB 2GCTB 3HGPA 5G4BA 1ZHPA 3K9XB 1HBTH 1JIRA 3V12A 3RLWH 1TPPA 1O39A 1O5CB 4ZKOU 1KLIH 4H42U 3E3TA 4YZUA 4B6FA 4CH2B 1C5SA 1SQAA 3LPRA 2FLBH 3P17H 1T8NA 7ESTE 4K2YA 1QURH 1KLTA 5FL7D 3VXFH 1P03A 2BOKA 1L0ZA 1O3KA 1E0FD 1W0ZU 1E37B 2RA3A 2GCHF 3GY5A 4WJG2 1GCTC 2A2XH 2BXTH 1OWHA 4YLUA 3ODFA 3C27B 2ANYA 1LVBA 2BB4A 1AZZA 2JIZD 1DM4B 1TGSZ 1P11E 2K0QA 4BAQB 2O8TA 1GI1A 2GV7A 1IQHA 2WPLS 2C4FH 3MH5A 3OE7D 1Z8RA 1UMAH 3RXIA 1VCPA 2WSSD 4XOJA 3RXLA 1SGTA 4B6EA 1FY4A 5C1YA 4GVUA 1GI8B 1C1VH 5FXLA 1A2CH 5EPNA 1FMGA 3BF6H 1SKYE 3N99A 1GI5A 2ZHWH 1C5VA 4ACBA 5BPEA 1BTXA 5EJLA 1P06A 1VGCB 4ZHMU 1NFWA 5B6OA 4HZHA 1VCWA 4NGAH 2J34A 3LDXH 2TGTA 3S0NA 5JBCS 3STJA 3MO3A 1TQ0B 2WPHS 4IC6A 1MTSA 3MHWU 1D3DB 2F83A 4ZKRU 3RMMH 3E8LA 3P8NA 1OP0A 4Q80A 1QQUA 1P2JA 2ZDKA 1ZSLA 1XMNB 2Y7XA 1V2UT 5EG4A 1YY3A 5DGJA 2GKVE 3UNRA 1TGTA 4NIVA 1UHBB 1MKXK 1ELTA 1FV9A 1NS3A 4BTTB 3IG6B 3QGNB 2GCHG 3MNSA 1PQ5A 4JZDH 1D3TB 5DP8A 1T4VH 1Y5AT 5FBIA 1QNJA 1FZZA 4BANB 4PROA 2HLDD 4CH8B 1FY5A 2F9UA 4B73A 1UTPA 4WH8A 3FFGA 1OSSA 4CBOA 3TH2H 4AFSA 1MTNC 4K8YA 1K21H 2YMSD 4UFFH 2ZGXH 4CRDA 2XBYA 1G36A 1V2NT 4RI0A 1AN1E 3UREA 1O2GH 3KEEA 2ZFTA 3EYDA 3M5NA 3MTYA 3SYJA 4X6PA 3EA8A 1YCPM 1C5OH 4B75A 5F8ZA 1HCGA 1FPHH 3GCHB 2BXUH 2IJOB 3PRDA 4THNH 2P95A 4AGKA 1H4WA 3F9GA 4Z0KA 2BM2A 4I32A 3SU2A 2ANKH 3RU4E 2BDBA 1ZGIA 1WAYB 3HKJB 1C2IA 2ZPSA 2J38A 4X8SH 5DP5A 2QF0A 5GXPA 2HVYB 1ARCA 2WPKS 1ZSKA 4JCNA 2FS9A 4FUFA 2XBWA 3IWMA 1RRKA 3SW2B 3SZNA 4XD7D 3M5MA 1GL1A 4ZH8A 2PSYA 3LGIA 2ZTYA 4U32A 4Y0YE 2CV3A 1IOEA 2YMSC 4D8NA 1RIWC 3M5LA 1M9UA 2OXSA 3SNCA 1YYY1 1LPZB 4H6SB 3TVJB 3GY8A 4F49A 4KTSA 1O2ZA 3I78A 4IN2A 1HJAC 3PMHB 1PJPA 3UNSA 1BHXB 2ZKSA 3U8RH 4ABJA 1MU6B 1T8OA 1KMHB 5ABWA 3C1KA 3QX5H 2G8TA 1GGDC 3UTUH 1O3CA 1H9LB 2Z7FE 3BTWE 1O2SA 5DP4A 3MFJA 1GHBF 1ZOMA 2P59A 3BTDE 1C5QA 1ZTJA 1O3BA 1P04A 1YWUA 1C2KA 1DOJA 4ZXYH 3BIUH 2HWLB 1N1LA 3KHVA 1BMNH 1UTQA 3LJJA 1P02A 4XBCA 2ILNA 4ISNA 1BOQA 1LVYA 3RXFA 1O37A 2EC9H 2FOCA 1ZJDA 1FXYA 1LTOA 1ELDE 3PB1E 1KXFA 1WQVH 4X0WU 3PLKA 1JWTA 1OX1A 5DPAA 3K6YA 1IQKA 1FY8E 2XOKD 1GBCA 2KFWA 3GY6A 5EXNA 1HAVA 4K1TA 1GVLA 4KELA 1CA8B 2Y81A 4Q63A 1GVKB 2GDDA 3V13A 4O3TA 3KQDA 1F2SE 1GG6B 1PYTD 2FDAA 3F68H 4KTCA 2ALVA 3BEIB 1V2QT 1WDIA 1AZ8A 3U69H 3SNEA 1QCPA 5L2YH 1LVOA 2QGRA 1E1QD 1GDQA 1HAHH 4NZQA 1LMWB 2WINI 1GJDB 4RSPA 1CGJE 2ZCHP 3UY9A 1GJ9B 2FMJA 1FI8A 1K1JA 2RA0A 2GTBA 1TPSA 2YMSB 5C5OA 2Z9JA 1RIWB 3SV8A 1GHBG 1JRSA 2XC5A 3GYLB 1FIZA 1ZYOA 2HNTF 4BTUB 2ZDLA 1HJAB 4FUCA 1ID5H 2W26A 4UEHH 1WBGB 4LXBH 2ZEBA 5JDUB 1J16A 3D23A 2PGQB 4JZIA 1O32A 3RXTA 4D76A 1QGFA 1AWFH 1IHSH 3EA7A 1UVSH 1A61H 1K1NA 1PYTC 3W95A 2ZIQH 3SJ8A 2A0QB 2VIPA 2XC0A 2XNIA 2ZDVH 3SN8A 3V0XA 4A92A 1FQ3A 1SGYE 8KME2 5KECA 2OC7A 1P2NA 3E0PB 1TB6H 3SZEA 1CT2E 4FUIA 1EZQA 3R0FA 2F9BH 1AKSA 1IHTH 2ZTZA 6GCHF 4YLQH 3BG4C 4ABGA 1OS8A 1DDJA 3BTME 5E0JA 1ETTH 2Q6GA 2AGEX 1O5DH 2BVRH 3RDZA 3P8GA 3QWCH 2FX6A 1BCUH 2SGPE 1WSSH 4ZKSU 1SOTA 3LT3A 4JYUH 4TY7A 4TSFD 1QZ8A 2XRCA 5GCHG 1YPHE 1AU8A 1GBBA 3QZRA 3UQOA 1PPBH 4BXWA 1YM0A 3BN9A 2BY9X 4NIYA 4SGAE 4BAOB 1MQ5A 3EE7A 4WXIA 5J4SA 2BDYA 3OYPA 3L3TA 1S6FA 3H7TA 3P70B 2J98A 4OS2A 2BDGA 1D9IA 4Y7BA 4D7FA 1VZQH 1P05A 1TMTH 4FVDA 1XX9A 1EJMA 1C5WB 1K1IA 3BTGE 1UCYK 4B2BA 1LHDH 1F5LA 2XW9A 1V2LT 5GJ4B 1C4U2 2BDIA 2VGCC 2ZPQA 1NTPA 2RDLA 1FAXA 1TA2A 4K3JA 5CE1A 2OK5A 3AVZA 3ZVDA 1SL3A 1MABB 1UVPA 1QJ6B 1GHXH 1O3DA 1P8VC 2JDID 4BAKB 1BTZA 3UIRA 1Z6JH 3F6UH 1SQOA 1N6YA 3NRLA 1RTKA 2J9NA 1GMDF 1H1BA 2I6QA 1LVMA 1Z1IA 5EXMA 2O9QA 3FP7E 6GCHG 3P95A 4ABAA 1EAWA 3ZYEA 4P00A 3NCLA 4MNVA 1NT1A 1AUJA 1H8ED 3M3TA 1WTHD 1QTFA 1Y3XA 1OYQA 1UK4A 4K1EA 1VCQA 2XXLA 3NPSA 3F2GA 3LONA 1AD8H 2PKAA 1WTGH 4FUHA 1AFEH 3VB6A 5JYIA 1AB9C 2Y5FA 4DG4A 1Q31A 5T6GA 2QXIA 5ESTE 2QF3A 1DY8A 1NM6A 1UTLM 1BTWA 2EQNA 4ISOA 4XE4A 5DN6D 1W0JD 3BG4B 1S0QA 3A7XA 1PPEE 1YC0A 1A1RA 1P2MA 4H6TA 1HNEE 1DFPA 1A0HB 1YPKH 1LCYA 3OY5U 2IN2A 4X6MA 4ASHA 3LC5A 1ZHMA 1HLTH 2AERH 3RXOA 3BEFB 3M61U 3GCTF 4YM9A 1UO6A 1NRPH 2FTMA 2H5CA 1AKSB 1GMHF 1KTSB 5LPRA 1CE5A 3TJVA 1GBHA 4J2YB 1P2IA 4F48B 1W7XH 4Y8XA 2WV4A 4B71A 2ESTE 1SHHB 2KM0A 1WCZA 5A8ZA 5C17A 3QTOH 1DANH 1C5MD 1QFKH 2PUQH 1K28D 2LELA 3ATLA 2D2DA 2M5TA 1GMDG 2HNTC 4ABDA 4X8UH 2VGCB 2Y7ZA 3NKKA 2P3FH 5LGOA 3BEUA 1DXPA 1HDTH 4WMDA 1MTWA 1YLDA 4M7GA 1HB0B 1H8DH 2NWNA 3MYWA 3RUOA 2J98B 3ZZCA 1QR3E 4WMFA 3U8TH 1C9PA 1TNKA 3MH7A 3AASA 3A7VA 1SFQB 4ABBA 1XM1A 4D9QA 1GDNA 1OWJA 4FUEA 1DE7H 4B2AA 2FPZA 3QN7A 2BD3A 8GCHF 2G51A 1HAGE 3P6ZB 2UUJB 1G3CA 2BLVA 2FO9A 1C2FA 1AY6H 1YPJH 2OBOA 2BTCE 1T8MA 1BMMH 1QRXA 3HATH 2W7UA 3VG8A 1FUJA 2W6JD 3TITA 3QLPH 1W2KH 3E0NB 3UB0A 2BX4A 1V2RT 1GMCF 1YCPK 4ZKNU 2B9LA 2WPMS 2A4RA 1YGCH 2XYAA 3UFAA 4GCHF 1GMHG 1K1MA 1DUAA 3BG8A 1AGJA 5PTPA 1P12E 1KYNA 2QY0B 2G5NA 4MPVA 1XKBC 3O8DA 5EXLA 3M36A 1UK2A 3MU1A 1TMBH 2GZ9A 1MCTA 1CU1A 3FP8E 4AG2A 1C4V2 2AHME 4LOYH 3A88A 1NRNH 1PPFE 1S5SA 4TPYA 2YOLA 3LGUA 1BDAA 2ZP0H 1ANCA 1W0KD 1V2JT 3KF2A 2KCPA 3K2UA 3M3SA 1MMJN 1UTJA 3A89A 2BQ7B 2OP9A 2TBSA 4IN1A 2A4GA 5FHTA 4NG9H 4TWYA 4DOQA 1W3CA 2G5VA 5T6FA 4ISHH 3GY2A 4A6LA 4GSOA 2Y5HA 4LZ4B 4IMZA 3CP7A 1DWBH 2P8OC 2TGDA 3ZV9A 1K2I1 1NFXA 3GOVB 3RXGA 1C1TA 1UVTH 4OM9A 2Z3DA 3SGAE 3A85A 5ESBA 1P10A 5A09A 1BJVA 1W14U 1TMUH 4MNXA 1BRAA 4AC9A 8GCHG 4Z6AH 3SQHE 1CVWH 5AFYH 1B0EA 1TE0A 4DURA 1SR5C 5EPYA 1O34A 3RM2H 4UFEH 2CJIA 2KCOA 1TX7A 1N8OB 2R2WU 2CHAC 5F03A 1S81A 2WZQA 3LGTA 1WV7H 3QZQA 5T3HA 4X8TH 5C3NA 5FX6A 4GCHG 3LH3A 2JJ1D 2VIDA 2ZZUH 1BTHH 5AFZH 2AFQB 3NK8A 2AH4X 4X6OA 1ZHRA 2SGFE 1O3EA 3A8DA 2RDEA 1KLJH 3SNDA 1B5GH 2NU0E 4FU8A 2QC2A 1HAXB 3GY4A 3LC3A
chains in the Genus database with same CATH topology
1GBTA 1ZMLA 2OUAA 1RD3B 4Q7XA 5DP6A 1TNGA 5EODA 1EX3A 4I8KA 3VB3A 3PMJA 4A1TA 2A31A 3FZDA 1H9IE 3SBKA 2V35A 3OU0A 2G81E 2PSXA 1ZRKA 1MKWK 3RMNH 4UONA 1AE8H 1C1NA 2ZHDA 5E0HA 1BIOA 1XVOA 2V3OH 1SGPE 1JMOH 1D6RA 3ZZ8A 2I6SA 4BNRA 7KMEH 1AO5A 1GI0A 2ZGBH 3KIDU 3BIVH 1SGIB 3ZZBA 3M7TA 1QB9A 3RXRA 3PMBB 4R8TB 1TPAE 1CO7E 3L33A 2CXVA 1DICA 1P3EA 2P8OB 2Y80A 2Z94A 3SU6A 2ALPA 2OQ5A 6ESTA 2SGDE 1QA7A 3PO1C 2P16A 1YF4A 1BTUA 2FOGA 1B7XB 1MCVA 3VXEH 1O0DH 1CA0C 1GBAA 3U1JB 1LKBA 2VIWA 2ZHQH 4ABIA 2CHAB 1V3XA 3UWIA 1SVPA 2VWLA 1LQEA 4TWWA 8LPRA 2UWLA 1BRUP 2UWPA 3S9AA 3W94A 1GJ4H 2ASUB 4BXSA 4B74A 3MH6A 4FUGA 4WF8A 5TJXA 4OS1A 4CRGA 3RXCA 5C2ZA 2A7JA 3RU4T 2ZGCA 1O3GA 2Q6FA 1PQ8A 4YO9A 3LGVA 4NA7A 4U01A 2XCFA 4X1QU 2ZFFH 2BOHB 3RXQA 3ZZ7A 1OPHB 1Y8TA 2WPJS 1AVGH 4CBNA 2FYQA 2AGGX 1C5NH 4HFPB 4AB9A 1SOZA 4NSVA 1ZRBA 2GD4B 4E06H 1EB1H 2W3KA 4LZ1H 4DVAU 1MTUA 4MNWA 1C1MA 3EA9A 4I8LA 2AIQA 1GI3A 4A7IB 2PKSC 1O2YA 3MU5A 4CREA 4X1SU 2VVCA 2ZECA 4NFFA 1T31A 3ZZ5A 1GCTB 2DUCA 3FP6E 1Z8GA 1EP6A 3UOUA 2ZWLH 3DHKH 2HLCA 1A5GH 3PO1B 2WYGA 1HJ9A 5E2OA 1BMAA 1OP8A 3RU4D 1PQAA 2GX4A 1N6XA 4O97A 4Y7AA 1CA0B 3PTBA 5DP7A 3K65B 1DVAH 3AW0A 1PPHE 4ZMAH 3TNSA 1IQLA 2QXHA 4WXVA 2PV9B 2A7CA 1YPMH 1P09A 2PTCE 2XC4A 3E16B 1QRZA 1TNLA 2GGVB 1DUEA 1A7SA 1AE5A 1QB1A 4IW4E 1U6QA 3ATIA 1K9OE 4DT7B 2HRVA 8ESTE 1KXAA 1PFXC 5L30H 3M7QA 2PWXA 5GPIB 3TPIZ 2GZ7A 1DSTA 4DIIH 3NUMA 1O2TA 1XUKA 1O3IA 1C1SA 3WY8A 1UJ1A 1DWCH 1IQNA 1F92A 1RFNA 2BD4A 1WU1A 1TYNA 2HGTH 2RG3A 1P9SA 3RXJA 1D6WA 2FXRA 2OC8A 4CRBA 9ESTA 1GHAF 3H7OA 3JZ2B 4CRCA 2STBE 1IQGA 1LHFH 2TGPZ 3Q3YA 4X2WA 1EB2A 1TLDA 3TJNA 5HYOA 4AG1A 1MTNB 2BHGA 3CENA 3B23B 2OD3B 1KXDA 4ABFA 1C2DA 1KXBA 1MBQA 1E35B 1IAUA 1Y3WA 2BX3A 1O2PA 1E34B 1W8BH 4AFUA 4YT7H 1F0TA 2BZ6H 1C2JA 2KAIA 1BUIA 2BY7X 2H9HA 1A3BH 5DP3A 1SLUB 4Q7YA 2ANMH 3GCNA 5FCKA 1ORFA 3ATMA 1UCYE 1C5UA 1G3BA 1J9CH 2SGAA 1EJNA 1IQJA 2BVSH 3RXDA 2GDEH 4YT6H 2QA9E 1UTNA 4GLYA 4OGYA 2PLXA 5EW1H 1ANDA 5EQRA 5EOKA 2R3UA 4I8HA 1GI4A 1C1QA 3TK5A 5GCHF 3VB4A 2AMQA 3GCOA 4CRAA 3OX7U 1G32B 2VJ1A 5C5NA 3U1IB 3SUFA 1SGCA 1LO6A 2OTVA 5FCRA 5FPTA 2BD8A 2BMGB 3TJOA 4AFZA 5I46H 3PROA 1EZSC 3ZVGA 2G52A 3UR9A 1CGHA 1EZUC 1VITG 1SBWA 4NFEA 1GHAG 1L1JA 1GGDB 3PWCA 3SUDA 3SI3H 2BQ6B 2GV6A 4O9VA 3RXPA 1MKXH 4WY3A 2B8OH 2VWMA 3F9HA 3PTNA 2C90B 4U2WA 3LOXA 4FUJA 2AMDA 4RN6A 1TBZH 3KGPA 2J2UA 3O8CA 1QY6A 3D49H 1WQSA 1HJ8A 3DT0H 3M3VA 3RC5A 2LNCA 1RGQA 1O2VA 4AFQA 1ZPCA 2FM2A 5A8YA 4XBBA 3SI4H 1FPCH 2OQUA 2D8WA 1Y5UT 1OXGA 2Q6DA 1O3FA 3A7WA 2VVVA 3SU1A 2ZC9H 3KL6A 5EQQA 3TH3H 1EUFA 3LGWA 1HPGA 3MH4A 1O3JA 4MTBA 2Z9GA 2ZG0H 3S69A 1O30A 1O2IA 1ZTLA 2O8MA 3A8BA 1Z8IB 5HMAA 1VJAU 2XWAA 1Y3UA 3TU7H 1O2WA 3H5CB 1C1PA 1O2HA 1YPEH 2KAIB 2GMTC 2H6MA 2C8WB 3HK6B 3LGYA 5L2ZH 1GBDA 1F0SA 4MPWA 2F9NA 2FODA 4XBDA 1Y5BT 1HAVB 1HGTH 1L2EA 1XUIA 3VGCC 1O2NA 1WYKA 3UR6A 4FXGH 2W5EA 1O3PB 1AMHA 1GVZA 2QIQA 1BBRE 1Y3YA 1FNIA 2ZDMA 1GHYH 2CF8H 3SHAH 1V2PT 4CRFA 3A83A 2IOTA 4ABHA 3JZ1B 1S6HA 4A1XA 1QBNA 3VPKA 3BSQA 1YPHC 1ESTA 2A4QA 2A1DB 1CQQA 4INHA 2ULLA 3D65E 2VINA 4GAWA 3LH1A 1K22H 4AGJA 2H9TH 3LU9B 3ZVBA 1GBMA 4KGAA 1GCDA 1H9HE 1FN8A 3ZZ9A 2FI5E 2PHBA 1G30B 3T26A 1X7AC 4ZHAA 2FLRH 2VH6A 1TALA 2V6NA 4BTIB 2J95A 3M7UA 2FOMB 1Z71A 4UDWH 2BD2A 1P0SH 3RP2A 3T25A 1THSH 2Y82A 2AIPA 4A1VA 1OKXA 1LKAA 1W10U 4MQAA 1XVMA 4ESTE 1BRBE 4NWLA 2ZPRA 5DJ7A 1DWEH 2Y6TA 3RXAA 3ATKA 3ZZ6A 5C67A 5F8XA 1TRYA 2AYWA 3ODDA 3TGJE 1ZMNA 5ETXA 4O03A 4OS5A 5E2PA 1O3MA 2OCVB 4ISLA 3ZZDA 1G3DA 1EZXC 2O8LA 5AF9H 1ZR0A 2WV5A 1D3PB 1GBJA 3KN2A 3FZZA 1LHEH 2A5KA 2GMTB 1CGIE 1O5GH 3I77A 1CHOF 1HIAA 3VGCB 4H4FA 3GDSA 4JZ1A 2STAE 3O8RA 3A7YA 2A5AA 3RC4A 1LHCH 3SV9A 1ARBA 1NO9H 2FOEA 3T2NA 2DE8A 4ISIH 1DS2E 2JKHA 4MDSA 2A4OA 1A3EH 3T29A 1XUHA 1HAYB 2UWOA 4ZHLU 1TNIA 1JIMA 1OWDA 2FX4A 1ZLRA 1CSOE 3A80A 1HAPH 1JRTA 2BQWB 5TCAA 2ZO3H 2CN0H 2ZA5A 3SHCH 2HPQH 1HFDA 2H1UA 3RXSA 4Q2KA 4DCDA 2VIOA 1AB9B 2R0LA 1GHWH 1TGCA 3K6ZA 3PLPA 3E91A 1NRRH 4E7NA 4K1SA 1EJAA 1YPGH 2D1JA 3SU3A 2C3SA 1IQEA 1NROH 4OS7A 4WVPE 2FZZA 1SLXB 2A5IA 3RXMA 2CMYA 4AYVB 1EQ9A 3B8JA 5DG6A 2YNBA 1UTMA 1W12U 4B1TA 1FN6A 2PKAB 2Z6BD 1QHRB 3TLOA 1GWAA 1NPMA 1Z6EA 2VWOA 1CHOG 2R0KA 3FAOA 3TNTA 3SQEE 1BITA 4MVNA 4INLA 3SORA 1BZXE 2J92A 4TYDA 6CHAC 2BD9A 1UCYH 4BAMB 3ZVCA 5JPMH 1MAYA 1TPOA 4F4OC 3DD2H 1BHXF 2GT7A 1QBVH 1F0UA 1J8AA 1O2OA 3E90B 1KSNA 4UFGH 5EQSA 1TX6A 4GUXA 4B76A 1ETSH 2QV1A 1TFXA 1MZAA 4ZXXH 4WH6A 4DW2U 3RMLH 1RTFB 3MMGA 1NU9A 3EQ0H 4DJZB 1P2QA 3TK6A 3SOSA 2FYRA 5LH8A 2ZU3A 2FEQH 5C1XA 4NA8A 1IQIA 1O5FH 1QB6A 1C5RA 2PW8H 4X6NA 2W3IA 4XFQA 4DY7B 2VIVA 5IDKA 3DFLA 3AAVA 1MD7A 1KXEA 1AVXA 2H5DA 1TBQH 2Q1JA 1HIAB 2J4IA 1C5LH 2FS8A 3BTEE 1A5IA 1DX5M 3ELAH 1JBUH 1C2GA 1V2TT 4I8GA 4O3UA 2ZTXA 1V2MT 3KQEA 5JBTA 3RXVA 1TOMH 4CR5A 1P2KA 3P8OA 2EI6A 5K7RA 3P8FA 5GIBA 4DGJA 2ZU2A 2HOBA 1CHGA 1ANEA 3URCA 1BTPA 2A2QH 2ZU1A 3V3MA 2XCNA 1NN6A 5J4QA 1IQMA 3MO9A 1VGCC 2O8UA 1OYTH 3PLBA 1C2LA 3VFEA 4D7GA 4UD9H 2ZU4A 1GI6A 3TGIE 4I8JA 3UQVA 3NWUA 2H9EH 4JK6A 3TK9A 2PFEA 4CR9A 5HXFA 1S85A 4BAHB 3E1XB 2ODPA 4JMYA 4X2YA 1C5TA 1SLVB 3ZZ3A 1EASA 3SU4A 5F6MA 1BMLA 1VITH 2ZFSA 1EATA 2PTNA 3MOCA 4NSYA 5DP9A 1LDTT 3ZYDA 1W7GH 4BOHA 1QBOA 1HXEH 3F9FA 1O2KA 2Z3EA 3OSYA 1OWEA 1O5BB 1YP9A 5IYTA 1BQYA 1XUFA 2EI7A 4GHQA 1FLEE 1PPZA 3QK1A 3MNXA 1P2OA 1FY1A 1GJCB 3NZIA 3VEQB 3ZZ4A 3SNBA 2P3UB 1BBRH 1QQ4A 1XUGA 1P9UA 1SGQE 2QAAA 3GCHC 1DITH 2C8ZB 5CMXH 3STIA 1O3HA 1O35A 5A8XA 4WMEA 3VB7A 1A5HA 1FAKH 5A0CA 4INKA 1GJ8B 1SHYA 3RLYH 2QN5T 5T6DA 4IGDA 2SGEE 4AZ2B 4MG3A 1O36A 1YCPH 3KQBA 1T4UH 5EU8A 4R0IA 5K0HA 2BY6X 1T32A 4K69A 1V2KT 1QL7A 2F9VA 2BY5X 1V6DA 4A5TS 2PGBB 1ACBE 3PM3A 4RKJB 3SV7A 3SUEA 1GBFA 1YKTA 4WWYA 3TH4H 5LPEA 3BTHE 5HGGA 1L4DA 2A32A 1C5XB 2PUXB 3RC6A 1C2EA 4AORA 1INCA 3URDA 1BJUA 1QJ7B 4YOIA 3QUMP 2OC1A 1TOCB 3RXUA 1O5AB 1UTOA 3CS0A 4IS5A 1MBMA 1ZZZA 3UUZA 2HVXA 1C5ZB 4Y6DA 2NU2E 3GY7A 1KIGH 3FVFB 4MPXA 4YOJA 1EXFA 1AIXH 3SGBE 3SU5A 3Q77A 1ZPZA 4FU7A 1SSXA 2THFB 2V0BA 4NWKA 1H8IH 2QCYA 1J15A 1C5YB 2ZDNA 2VB0A 1ESAA 1V2VT 2BY8X 2OBQA 1GPZA 2ZQ1A 1Y59T 3DA9B 4FUBA 4I7YH 2ZFQH 4K5ZA 4CHAC 1P57B 3A86A 2CGAA 1TA6A 1ELVA 1EAXA 2A45B 4Y11E 2FI4E 2C8YB 1O2JA 1TQ7B 1SPJA 3T5FH 1C2MA 1ZTKA 5FAHA 3QGJA 4E7RG 1GG6C 1VJ9U 3PYHA 2JH0D 2ZQ2A 3IITA 1YLCA 1G3EA 1NU7B 5JB8S 2DE9A 5TCCA 1ETRH 2SNWA 1O2QA 1YBWA 2VWNA 1AQ7A 2R2MB 4NZLA 7GCHF 5EGMA 1C1RA 2BLQA 2NU1E 2NU4E 3UOPA 2Z9LA 1J14A 1MKWH 3RXHA 1FONA 1TRNA 5F8TA 2FTLE 3MNCA 1C2HA 3A7ZA 1TBRH 5FPYA 1Z8JB 2ZCKP 1EOJA 3S9CA 1AWHB 1SGEE 4MLFB 3BTFE 1GI9B 4U30A 1VITF 3CS7A 1O3LA 2HPPH 2FESH 2SFAA 2CF9H 2BD5A 4K60A 1XXDA 1ANBA 1FDPA 4JZFH 1PQ7A 5JBBS 2IPHA 1TAWA 2ZFRH 2YNAA 2C93B 4I33A 1ELBA 2PKSB 1TX8A 4GPGA 3HK3B 2ZNKH 2G4TA 5H4IB 1DY9A 1TGBA 2ZCLP 1HUTH 2AMPA 3ZVAA 2R9PA 1AFQC 1GJBB 2FIRH 1QA0A 3SJOA 1A0JA 1ELEE 2G4UA 4Y10E 2ZDAH 1SLWB 1TABE 3AW1A 4D9RA 1JOUB 1HAIH 2LPRA 2O8WA 1L4ZA 4Y8ZA 3L6PA 1HYLA 3N7OA 2OINA 4OS4A 3HGNA 3SU0A 4CHAB 2ZGJA 4X2XA 7GCHG 3MNBA 4JYTA 1O31A 3UNQA 1T7CA 1THPB 3O8BA 4Y76A 3SNAA 3DUXH 3PWBA 5A2MH 1EP5A 1NRSH 2UUKB 5FBEA 3A87A 3PV4A 3SGQE 2FWWA 4AX9H 1ZSJA 4Y0ZE 1G2MA 1A46H 3Q00A 3T28A 2BDAA 2FOHA 3VB5A 3BV9B 5LPFA 3RXEA 7LPRA 1C1OA 2FI3E 2WPIS 4OGXA 3BTTE 1WOFA 5A0BA 2ZF0H 3QDZB 1BTYA 1DSUA 1NZQH 3A84A 5AVDA 3MU4A 2OC0A 1GHZA 3U98H 2AGIX 4QT8C 5C1UA 1ZJKA 1W0YH 1KY9A 5HM9A 5FPSA 2R3YA 5DK1A 5SGAE 1FJSA 1G9IE 4E05H 2QXGA 1V2OT 4J1YA 1MQ6A 2JH5D 1ELFA 3ATWA 3RXBA 3HPTB 3F1SB 4ABEA 1YPLH 2ANWA 2F9PA 3MU0A 4X1NU 3Q76A 1TRMA 1F5RA 4GHTA 4UE7H 3RMOH 1T8LA 1KDQA 1FIWA 4AB8A 1AFQB 2BYAX 3FANA 3G01A 4YESB 2VNTA 4XDEA 1EKBB 1O5EH 3SJ9A 2GZ8A 1RS0A 1ABIH 1F0RA 4JYVH 4KKDA 4LK4A 2VIQA 3EGKH 4ZUHA 2EI8A 1IQFA 1J17T 3ZVFA 2HALA 3OTJE 3PMAB 1ZPBA 2F91A 2FP7B 1VR1H 1PPGE 4HTCH 5E8EH 3ESTA 1Q2WA 2PR3A 2BDHA 3LIWA 3F9EA 3KCGH 4VGCC 1AVWA 1BT7A 2TGAA 4IBLH 1C1UH 1LPGB 5BRRE