1V2RT

Trypsin inhibitor in complex with bovine trypsin variant x(ssri)bt.b4
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSRIITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Trypsin
publication title Understanding protein-ligand interactions: the price of protein flexibility
pubmed doi rcsb
source organism Bos taurus
total genus 50
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2rT01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2rT02
1C5ZB 2F9BH 1BRAA 2P93A 4A1TA 4CRFA 1WTGH 2CGAA 1CGHA 3LIWA 1O3NA 5A0CA 2AGIX 1NN6A 3FAOA 1ABIH 4I8JA 4MNXA 3S69A 1DSUA 1QNJA 1OX1A 1Z8RA 5ETXA 3T2NA 1BHXF 4D7GA 2BY5X 5H4IB 2VVCA 5ESTE 2D1JA 1P02A 2Z9JA 1AKSB 1C9PA 4H42U 2ZDLA 1QQUA 1Z8GA 1THSH 2DUCA 1GWAA 2O8MA 3ATMA 3UTUH 5DK1A 4ABJA 1GBFA 1MQ6A 1ZSKA 4ZAEA 1CHOF 2CF8H 4FU9A 3PROA 1A61H 3SOSA 1YCPM 1EQ9A 4Y8YA 2PUXB 5A2MH 3S7HB 2GZ7A 2GT8A 3TK9A 1GMCF 1OP8A 2OTVA 1O3HA 1U6QA 1D9IA 5EXLA 3FP8E 1XM1A 2W26A 2A31A 4NIYA 2NU4E 3UREA 4MPUA 1FUJA 1G37A 3GCNA 3SJIA 1HXEH 1HAPH 2H9TH 2OCVB 1XKBC 3STIA 1SPJA 4ISLA 1IQMA 3ZVGA 1UTLM 2BD2A 3UQOA 4BXWA 2QCYA 3ATLA 4VGCC 2PW8H 1AVWA 2A4QA 1QRWA 3SGAE 1S5SA 1C5MD 4ZHAA 4JZ1A 3W95A 2O8LA 5FCKA 5A8ZA 1O2RA 4GHQA 4YESB 3A8AA 1YLCA 3SV9A 3AAVA 3JZ1B 4XDEA 5JB9S 4JK6A 1GJCB 3MU5A 4X1QU 1F0SA 1O2IA 1OP0A 2ZPSA 1TBRH 1FONA 2M5TA 2ZTZA 1Y5AT 1P3EA 4U01A 4Y8XA 5GXPA 1D3TB 1P2NA 1MKXH 3UOUA 2XXLA 5E2OA 1XUIA 1GBMA 2FOAA 1HDTH 3B8JA 3K2UA 4CRDA 4ZMAH 3MO6A 2FTMA 4D8NA 4GUXA 1ZMLA 3HPTB 1ZGVA 3LH1A 2R0KA 2QAAA 7LPRA 1MZDA 1ZTLA 1G2LA 1W13U 1C5LH 2ZDKA 1GI1A 2ZWLH 1BB0B 3T5FH 1TOMH 1WAYB 1C5VA 5T6DA 3FVFB 1GI8B 2BQWB 1BTZA 4X8VH 1TIOA 3VGCB 1Y3XA 1QBNA 1XXFA 1RJXB 5DP5A 1C2HA 4NFFA 2AGEX 1D3QB 4K60A 1GMDG 3NK8A 3SJ8A 1RTKA 2CHAB 3EA7A 3BTKE 3ZZAA 1K1OA 3A84A 2BX4A 3BG4B 1PFXC 2O9QA 1UHBB 3RXGA 4NZLA 1C5OH 1QR3E 1YPJH 1QL7A 1ZPBA 2BDIA 2OP9A 1P2JA 2FP7B 4AYVB 2PR3A 3D65E 3BTGE 3H7TA 1ELEE 4O97A 3ZZ8A 4FVBA 1GCTC 2PLXA 3ZVAA 1BTYA 2FM2A 1E38B 3LGVA 4JZDH 1HCGA 5F8ZA 4NZQA 2PKAB 4X0WU 1ZRKA 2YNAA 3TJNA 1AB9C 1L0ZA 2FOBA 5E0HA 5EG4A 3S9BA 3NWUA 4NIVA 1P10A 1HIAB 4ABIA 5EPYA 1KIGH 4K69A 4OS4A 2ZGJA 3P70B 2HRVA 2OBQA 1O5AB 1TRMA 1KXCA 3QDZB 2XW9A 1MAXA 2FPZA 5F8TA 1XKAC 3P92A 1V2PT 1LHFH 5F6MA 2Z3EA 1DE7H 1AZ8A 3UNSA 3RXOA 2BVRH 1C2KA 1WOFA 2Q1JA 2TGPZ 1LDTT 1FY3A 2WPHS 4AG1A 3GCHB 3MOCA 4R8TB 3M7UA 4ZXXH 1TNHA 2GTBA 2ZFQH 1SLWB 4WJG2 3A8BA 3E8LA 3SJOA 1A5IA 1F2SE 3PB1E 5B6OA 2HVXA 3SHAH 2XCFA 1SBWA 1MD8A 1UVSH 1K1LA 2BVXH 1LHCH 4Q2KA 2GT7A 1Z1JA 3RXMA 2VIOA 1SGTA 1QB1A 1D6RA 1W0YH 4Y11E 3TITA 1C1OA 4YOJA 5DKMA 1MD7A 1FY4A 2QXJA 1KSNA 5EU8A 3RU4D 1ELCA 2VJ1A 1EAIA 1GMHG 3RXCA 5DO4H 3D23A 2Z7FE 4AFQA 1XUHA 1H4WA 2GDEH 2P59A 2H2ZA 1C5YB 4HFPB 1O2YA 4AG2A 2HLCA 1P2KA 2V35A 2GCTB 3E91A 1SGIB 1KY9A 1OP2A 3R0FA 2Z9GA 4WMEA 3E3TA 1GBDA 3P95A 4BOHA 1EZXC 1F0UA 2F9VA 1C2FA 4GVUA 3A88A 1BHXB 4CHAC 1TYNA 1EZQA 1TMUH 2OC7A 1FPHH 1NRQH 5C67A 1UTNA 4SGBE 2W3IA 3F9HA 1BBRE 1A0JA 1WBGB 3QUMP 4NWLA 1AD8H 2QV1A 3UUZA 3B9FH 3T25A 2JH5D 1BMMH 3SV6A 3MWIU 2R3UA 2ZO3H 2AMDA 4X1SU 2P3UB 4UDWH 3ZZ6A 3BTFE 1ORFA 3KQEA 1KXBA 1Z8JB 8LPRA 1SGEE 4X8UH 3UR6A 4RN6A 1ZPZA 2BD4A 2ZIQH 3TLOA 4AGJA 1C5RA 2Y6TA 3TVJB 5PTPA 1AWHB 2IN2A 1K21H 1VITG 4JK5A 1P09A 1FAXA 3PM3A 3TPIZ 3SGBE 1Y5BT 4MPWA 2BM2A 2XC4A 4MNYA 4B71A 4O3TA 1GGDC 2AIPA 1S83A 1IQEA 2BQ6B 1NRPH 1QIXB 1HBTH 1NO9H 4HGCA 1DY8A 1AE5A 1AI8H 1P0SH 5HGGA 2GCHG 1F0RA 4ZKNU 1NFYA 3GY6A 4FXGH 1C1RA 3SGQE 3BTTE 4ZHLU 2B9LA 4X1RU 4X6OA 3B23B 1HAYB 5LGOA 1HAHH 1CVWH 1EXFA 2Y5FA 3GY4A 1B0FA 1MKWK 2ODQA 3RXFA 2A5KA 5EXMA 3RUOA 4U30A 1E36B 4XBDA 1BRCE 3SBKA 5FX5A 1A2CH 1TE0A 1SB1H 3V12A 3QK1A 3ZVEA 1GBHA 6CHAB 1EATA 2ZZUH 6ESTA 1GHWH 3ZZ4A 4I7YH 2VB0A 4OS2A 3VXEH 1CGIE 1CQQA 1FXYA 1LHDH 1Y8TA 5EW1H 1A3EH 1DICA 2ZHWH 1ZSLA 3P8NA 2J95A 1CBWC 2PGQB 3SNDA 4B73A 3TJOA 1SQTA 1KDQA 1AFEH 1O3JA 3GY3A 2PKSB 3M36A 4FUIA 1GL1A 4IW4E 5DP7A 3M7TA 2V0BA 2ZQ2A 1FY8E 1HV7A 1O3AA 3RXJA 2P95A 4RSPA 2FZZA 4X2VA 5E0JA 1MH0A 3A7XA 3KQDA 1TPAE 1BCUH 1MZAA 3QN7A 3A7VA 2CXVA 1TAWA 2CMYA 1A1RA 4XFQA 3LH3A 5GWZA 1A5HA 2SGDE 1O2SA 3EDXB 3KQCA 5J4QA 3ZZDA 1HAGE 1FNIA 2ZDMA 1S0QA 4FU8A 1G36A 1W7XH 2H9EH 4Q7XA 4X2YA 1C5PA 4DY7B 4B2AA 1F5RA 3KF2A 2ZHFH 4OS7A 1RIWC 3GISB 3LGUA 3GCOA 3PO1C 5EQQA 2Z6BD 1SLUB 4U32A 3ELAH 3FZZA 1HRTH 1MU8B 1Z7KA 3TGIE 2BZ6H 1DUEA 3KQBA 4KELA 1VITF 4J2YB 2FLRH 3M3SA 5DPAA 3RU4T 2CV3A 3UFAA 2JKHA 1O3EA 1RRKA 4B74A 1BQYA 2FI3E 1ZR0A 2ZDNA 1SLVB 1SFIA 1K28D 1ZHPA 1LQDB 4IS5A 4LXBH 3H7OA 1DANH 2GCHF 1GHVH 1T4UH 1NC6A 2G52A 3AW0A 4X6MA 1P2OA 4VGCB 3SU0A 1J14A 1K9OE 4NGAH 1MKXK 2FYQA 3TGKE 3S7KB 4AN7A 1AY6H 2ZC9H 1BMLA 2VH6A 4K1SA 4FUCA 2A7HA 2GV7A 1E0FD 4A1XA 4I8KA 3QZQA 4OGXA 4NIXA 1O3IA 4ZROA 1UTKA 1WV7H 3ZZCA 4LZ4B 1CT2E 4XE4A 1XUGA 1LVBA 2JETC 1CA0C 1GHBG 2P3FH 1RTFB 2OC1A 1C2LA 2FYRA 1LHEH 2GKVE 2HNTF 3O8CA 1C2EA 4NIWA 1JMOH 1YGCH 1ZJKA 2Z3DA 3P8FA 2ZU3A 1T8MA 1UVPA 1JWTA 3PLPA 1C4Y2 1O5FH 1O3BA 2ANYA 1UTJA 2Q6GA 2WYJA 1DPOA 2QGRA 2ANWA 1QA7A 4SGAE 2ZG0H 1SGNE 2TGTA 1MTNC 4KTSA 1Z6EA 1LHGH 3O8DA 1EAUA 2BOKA 3DD2H 1GJ7B 1YM0A 4UEHH 1O2PA 3SU2A 3PYHA 1P06A 3MNSA 1A3BH 3V3MA 3BV9B 1Y3VA 2QA9E 1L4DA 1SSXA 1C4V2 1XUJA 1V2MT 3ZZ9A 6GCHG 2AH4X 2ZKSA 3RC6A 4NSVA 2BQ7B 4GHTA 1TNJA 2A0QB 2OXSA 1KXAA 3E1XB 1W0ZU 3PMAB 5C3NA 2PTNA 1SR5C 1AU8A 1W11U 1NU7B 4UFFH 5HMAA 1EPTA 1G30B 2PGBB 2ZHQH 4FUGA 1TRYA 4WVPE 3T29A 1QRZA 1C5QA 2WUBA 1S81A 1UHBA 1QCPA 4DGJA 2ESTE 4YOGA 3F9EA 1XVMA 1Y3YA 5AFZH 3UPEA 5GCHG 1DITH 1GHYH 3D62A 1F7ZA 1GVLA 1XVOA 1EZUC 1V2OT 1FV9A 1C1MA 1GCTB 2G00A 1O3LA 1TGTA 4GPGA 1MBQA 2VWLA 1TNKA 2C4FH 2PKAA 1P05A 1L2EA 1OWHA 3LPRA 1TABE 1LPKB 1YKTA 2STAE 5EODA 1E35B 4Q7ZA 2STBE 3LT3A 3UR9A 1AB9B 1V2ST 3FP6E 4YT7H 2GZ9A 1SGRE 1HIAA 2ZFPH 4KTUA 1GBKA 2GDDA 5TCCA 1FMGA 3GYMA 3NPSA 2J94A 2GX4A 2FEQH 3PMBB 2FOMB 2Z9KA 5GPIB 2A2XH 2VNTA 3RXAA 2W3KA 3AASA 1NFXA 3U98H 1KXDA 5FPYA 1PYTC 1CO7E 3A8CA 1P2QA 2C3SA 3EAJA 4IN2A 5T6GA 2ZP0H 1GVZA 1Y59T 4NG9H 4HI3A 4HZHA 1BTUA 1HJ8A 4A92A 3RXIA 1ZJDA 1ETRH 1P9UA 1HXFH 1W12U 3HK3B 5E2PA 5FPTA 4NWKA 2XRCA 1P11E 4BAKB 1PPFE 4O3UA 4LK4A 3PLKA 3UWJH 1W2KH 2VIPA 2W7SA 1GHBF 1O38A 3SUGA 2BY8X 3TNTA 2UUYA 4K8YA 3TJUA 1YPHE 1O32A 2H6MA 1H9LB 1A4WH 3BIUH 1CT0E 1EJMA 2FS8A 2G5VA 2R2MB 3LKWA 3A7ZA 2EEKA 3BTQE 3SU6A 1GJ4H 1TPPA 5AFYH 2BLQA 4DURA 1NS3A 5LPEA 2ZGXH 4D7FA 1RGQA 1CSOE 1O2NA 3G01A 1OOKB 4FUJA 5DP3A 5J4SA 1C5SA 4BTTB 2B7DH 2BY7X 2R0LA 5JBCS 2IJOB 1LQEA 1IQNA 1O31A 4MLFB 1OSSA 3GY8A 2FOFA 1F92A 3RMOH 4CHAB 2VWMA 1JOUB 2R2WU 3C1KA 1ZSJA 1V2UT 3MO9A 1SLXB 4IMZA 1S6FA 1O2WA 1PQ7A 1LKAA 1THPB 4K8BA 2XWAA 3A85A 1GBBA 5A8XA 1HJAC 3A80A 3E90B 3E0NB 4H4FA 4CR5A 1W7GH 3TJVA 2A7CA 4DCDA 1O3FA 1QRXA 1RFNA 3LU9B 1L1JA 2BVSH 1V2VT 2K1QA 4FUFA 1C5WB 1G3EA 5DG6A 1BZXE 4Z0KA 4JCNA 1TGSZ 1EJAA 1B0EA 1K1PA 1MU6B 4IN1A 1C5TA 4JYVH 3RP2A 1O2VA 2I6QA 4Y7BA 1P3CA 1XUKA 3CS0A 3QTVH 1SGYE 2WPMS 1UVTH 1O36A 1TX6A 1OWIA 2DE9A 2AMQA 3ZZ3A 2YNBA 2ANMH 3M61U 1S84A 5EQRA 2VIQA 2OD3B 1GGDB 1T32A 4CRCA 4DIIH 2WPIS 4I8GA 3U8TH 5LPRA 2BYAX 4MNWA 2XCNA 5HXFA 1K1MA 1P03A 1AHTH 1O2TA 3P8OA 3E16B 3I78A 1KYNA 3SV7A 1IQJA 1MTWA 2QXHA 3NZIA 1VJ9U 3V7TA 1GHAG 1YF4A 4TPYA 3TNSA 3CS7A 2XC0A 4A7IB 4OGYA 3F6UH 1TNLA 5DP6A 2BHGA 1S82A 5EXNA 3OY5U 1NRNH 1P9SA 3EGKH 2R3YA 1NPMA 3SUFA 1A7SA 3DA9B 3UNQA 2Y80A 4UFGH 1FDPA 1HAIH 1FJSA 4TWYA 4R0IA 3TGJE 1NT1A 3LGYA 3UIRA 1GI9B 3DT0H 4I33A 1BBRK 1H8DH 1BUIA 2BLOA 1RS0A 3URCA 4Y71A 1TBZH 4IC5A 2WV4A 1EOLA 4MVNA 3WY8A 2ZGHA 3RXEA 1GG6C 3MTYA 1TPOA 3ZZBA 3SHCH 3ZYEA 1CBWB 3ZVBA 1HUTH 5CMXH 3L33A 2B8OH 5EW2H 2VU8E 1WQSA 1P8VC 1EOJA 1NFUA 3HKJB 4D9QA 3VB6A 2P8OC 3HATH 4MTBA 4XBCA 4RKJB 1G3DA 1ANDA 1A0LA 4K1TA 3GY7A 1OXGA 2WYGA 4Y0YE 2VH0A 1THRH 3CP7A 1EAXA 3AVZA 1TFXA 3OY6U 2EI7A 2F91A 1LO6A 4TPIZ 1QURH 4YT6H 2Z9LA 1O3OA 2VWNA 2AIQA 2THFB 1F5LA 4X8SH 1UTOA 3LDXH 1Z8IB 4JMYA 1GL0E 2EI8A 1OWEA 2ZA5A 1O2KA 3QGNB 1C9TA 3PMHB 1TMTH 3EE0B 3MNXA 1ZPCA 1AE8H 1J8AA 4DOQA 3Q3YA 2BMGB 3ZVCA 2PSXA 1EJNA 1AO5A 1UTPA 2SGEE 1ETSH 1TRNA 3Q00A 2G55A 1ELFA 3K6YA 1GBLA 1RIWB 2VWOA 1LKBA 1TB6H 1O2ZA 1RD3B 1WYKA 3PO1B 5GDSH 1B5GH 1C1QA 5FBEA 1HAXB 3NKKA 1ELBA 3RXBA 4CBOA 2C8WB 1DT2A 1C4U2 1GI2A 3ZZ5A 4CRGA 5L6NH 1S6HA 3KCGH 2G51A 3MU1A 1PPEE 3PLBA 2DE8A 2ZU2A 2XC5A 5L30H 2AEIH 1OYQA 1RTLA 5C20A 1TQ0B 4TWWA 2HPQH 4I8LA 1GMDF 1O3PB 1QBOA 3O8BA 2VGCC 1T31A 2GD4B 2UUJB 3A7YA 4FVDA 3SORA 3S9CA 1GJ8B 4I32A 1H9HE 1PQ8A 5IDKA 1B7XB 1GHAF 3S0NA 1TA6A 2D2DA 4LOYH 2ZFTA 4ISIH 1AVGH 1V2TT 1EKBB 3SU5A 3HK6B 3RXRA 3GOVB 1HAOH 5DP4A 1OPHB 3V13A 2ZU5A 3LC5A 4UFEH 1HAZB 1BRBE 1DWEH 1E34B 1SGFA 2NU0E 2EC9H 2G5NA 4XBBA 2YOLA 3RC4A 2JETB 1CA0B 3MH4A 3RXSA 1VCWA 4ISHH 1PPHE 1L1GA 1D3PB 3KHVA 3TK5A 2ZDVH 1G32B 1YLDA 1FLEE 2BDHA 1LCYA 1GVKB 2OC8A 1MTNB 1TLDA 2XBVA 1J16A 2UWOA 1DS2E 2F3CE 3MYWA 5FHTA 1O5DH 4F4OC 4ZKOU 1V2KT 4MQAA 1DFPA 1EPTC 2J38A 5F8XA 2UUFB 3MNCA 1C1TA 1UVUH 1WUNH 2FIRH 2BD7A 3W94A 1UTMA 3BG8A 1Q2WA 1HGTH 2FX4A 2XBYA 5I25A 2HNTC 3U8RH 1K1JA 1AVXA 2BDCA 3BIVH 1C2DA 1GDNA 1MTUA 3SJKA 1LMWB 2CN0H 4JZEH 2Y82A 5E0GA 3H5CB 3L6PA 1GBEA 1NZQH 1XX9A 1MQ5A 1UTQA 1HYLA 1INCA 5LPFA 4XOJA 1SFQB 1SQAA 1O3DA 1PPZA 4X2WA 4K5ZA 3I77A 1GMHF 3A7TA 5K0HA 2ZHEH 1C5XB 5FBIA 1V6DA 1O3GA 2ZU1A 3RXPA 2XWBI 3SUDA 4KGAA 4GCHG 1GHXH 2KAIB 3UQVA 2ZGBH 7GCHG 1OWDA 1GI0A 3DFJA 1G3CA 2PTCE 4I8HA 3NXPA 3GICB 4Y7AA 3VB7A 3ZZ7A 3QZRA 5SGAE 1AKSA 4TYDA 1KXFA 1FY1A 1TNGA 2XBXA 1P57B 1QL9A 1M9UA 1MTSA 1V2JT 3M5OA 3GY5A 2RG3A 1QL8A 3PWCA 2G81E 3A8DA 4BAMB 1VZQH 1YCPH 2BDYA 1OWJA 4M7GA 2IOTA 2Y5HA 3LJJA 1DUAA 3SUEA 3URDA 3SI4H 3KEEA 3TH4H 1BTHH 3SZNA 4ZXYH 1H8IH 3M35A 2C8ZB 2HALA 2GP9B 3RXVA 1Y3UA 3RMMH 4ASHA 3TH3H 1BT7A 3U69H 1SGDE 1RXPA 2WUCA 3RXHA 5G4BA 4GAWA 1DM4B 2ZNKH 2ZQ1A 2AYWA 2ZFRH 4ESTE 4A5TS 4AX9H 2O8WA 2F9PA 1NY22 3I29A 1DDJA 4F49A 5C1UA 2G4UA 3HGNA 5AF9H 4MDSA 4IMQA 1NU9A 2P94A 4ABFA 2W7UA 3RLYH 1JBUH 1X7AC 1ZTKA 2BD9A 2LPRA 2TPIZ 5GIBA 3VPKA 1W3CA 3MU0A 4MG3A 4CH2B 1YPKH 4DW2U 2QYIA 4BAHB 1BTXA 5DGJA 3UWIA 5F03A 1N8OC 1W14U 3U8OH 1QTFA 2SGAA 3K65B 4KP0A 5CHAC 2J2UA 3EA9A 1GJ5H 1DXPA 1TX8A 2WPJS 3ODDA 1O2JA 4ABAA 4RKOB 1O2UA 4BAQB 1LVYA 3M7QA 5A0BA 1P2MA 1KTSB 1MCVA 3F9FA 3IITA 1VITH 4DT7B 4BAOB 1EB1H 2C8YB 4BNRA 4KTCA 1ACBE 3SJ9A 2OINA 1T8OA 5JYIA 3M3TA 4KKDA 3LGIA 4WY3A 1QB9A 4X2XA 3SNCA 1GDUA 5K7RA 1GPZA 1EASA 1TA2A 1UVOA 1QHRB 3SU3A 4NFEA 2SGQE 2GVFA 3FANA 1FPCH 1FIWA 2Y7XA 4NA7A 3ZV8A 1C2JA 2J9NA 2RCEA 1V2NT 1ANEA 2VIVA 2PV9B 2BY6X 3KN2A 4INKA 1OWKA 4INLA 3VB5A 2Q6DA 1TGCA 1Q3XA 3D49H 4Y79A 1EX3A 7GCHF 1Y5UT 4CRBA 4I31A 8GCHG 3A82A 4Q7YA 2XBWA 4A6LA 3T26A 1S0RA 1C2GA 1SGQE 1D4PB 5JPMH 1ZLRA 1BJUA 4WH6A 1TNIA 5DP8A 2TBSA 2Y7ZA 3EQ0H 5BRRE 3A89A 1WQVH 4ISOA 1EB2A 1MKWH 2C93B 2H5DA 2J4IA 1IQFA 3SQHE 4QT8C 1ZRBA 1S85A 1TMBH 3MH5A 1PPBH 4JYTA 1SL3A 1LPZB 3MHWU 2WINI 1KDQB 5A8YA 1Q31A 5TCAA 5FPSA 3BEIB 1BRUP 2QIQA 2FWWA 1WSSH 3ATKA 4NA9H 1ELGA 3SV2H 1ELVA 1HNEE 4THNH 1TGBA 3U1JB 3ATIA 3SO3A 5DJ7A 4A1VA 3SQEE 1ETTH 4E05H 1KLIH 5FCRA 5LH8A 1TBQH 3RLWH 5A09A 4DIHH 1AUTC 1GG6B 2AS9A 3PTBA 1WTHD 2FOEA 1GJAB 1FIZA 3DHKH 3RXTA 3T27A 2WV5A 1FQ3A 1FN8A 2FESH 2F9OA 4YLUA 1OS8A 1BITA 1VJAU 2QXGA 5IYTA 4K2YA 2P8OB 5C2ZA 1SVPA 1LTOA 2ZECA 2UWLA 3SNBA 5HM9A 1HJ9A 2A4GA 3Q77A 1VR1H 1DSTA 3M5NA 2ODPA 3O8RA 1IOEA 1MCTA 1O3MA 2ILNA 4WF8A 1G3BA 5HYOA 2PSYA 1AZZA 2ZFFH 1SGPE 4ZUHA 3BEFB 4D76A 8ESTE 2W5EA 3AAUA 1O34A 2ZEBA 4ZKSU 4DJZB 3RDZA 4B76A 3S9AA 1AWFH 1EUFA 2A5AA 2Y5GA 1DOJA 1LVOA 3A83A 2OUAA 2RA3A 3T62A 2RA0A 4X6PA 3BTEE 1IQIA 1T8LA 1UCYH 1DX5M 1AQ7A 2QF3A 4H6SB 3FFGA 3QX5H 5T3HA 2Z3CA 2ZHDA 5FXLA 2BTCE 1PPCE 1UJ1A 1Z6JH 2FODA 3MU4A 1LPGB 1HLTH 1N1LA 2QY0B 5T6FA 3JZ2B 3P17H 5DP9A 4X8TH 3EA8A 3E0PB 3VB4A 1QJ7B 6GCHF 4B1TA 2XNIA 1AGJA 4DG4A 1EP6A 1K2I1 2WPLS 2EA3A 3SN8A 1A5GH 2R9PA 3BF6H 1SGFG 3P8GA 2ZCHP 8GCHF 2VGCB 3C27B 3RMNH 2ALVA 1ZMNA 7ESTE 1K1IA 2BD8A 1GBTA 1H1BA 1VGCC 1SHHB 1AFQC 1ZZZA 2VVVA 1MUEB 1O2LA 2F9UA 5GCHF 3HKIB 5C1YA 4LZ1H 2V3OH 2H1UA 3RXDA 4INHA 1HAVB 1L4ZA 1TOCB 2BOHB 3ZV9A 2GMTC 2XYAA 3VXFH 2NWNA 1JRTA 2C8XB 2GZ8A 4CBNA 3Q3KA 2AMPA 4Q80A 3SNEA 3EYDA 3OX7U 2G4TA 5L2ZH 2FO9A 1GBCA 1O30A 3M3VA 3M5MA 2UWPA 2I6SA 1KXEA 3A87A 3E6PH 1TPSA 2BD5A 1NESE 1UK2A 1ZHRA 1O5EH 2ZDAH 4GLYA 1ABJH 1O5BB 1QJ1B 1VCQA 2SGFE 3QGJA 3ESTA 4J1YA 2LNCA 1EPTB 5JB8S 1NROH 5C1XA 2Z94A 2F83A 4WXIA 1CE5A 2P16A 5E8EH 1QB6A 1Z1IA 4MPVA 1SMFE 1C2MA 4OS1A 2A5IA 3K6ZA 4UFDH 1BMAA 1HFDA 2FXRA 1XMNB 4XSKU 2SNWA 3PMJA 1HB0B 1YYY1 1C1SA 4ABGA 1GBAA 2A4RA 4FUHA 1A46H 1P04A 1AUJA 1GI6A 1TQ7B 1D3DB 4AFUA 4E06H 1GI3A 3QWCH 1SOTA 3RM0H 1CHGA 4YM9A 2ODYB 2FLBH 3P6ZB 2PFEA 4CH8B 2D8WA 3U1IB 4OS6A 2BDAA 2FDAA 3IG6B 8KME2 3M37A 4CR9A 1IHSH 4UONA 1BIOA 5FAHA 1FN6A 4AFSA 3MO3A 3MU8A 1GI5A 1FZZA 1UO6A 1Z71A 3PTNA 4OS5A 4WXVA 5L2YH 3HGPA 1ESAA 1P01A 2TGAA 1YCPK 3DUXH 3SI3H 1ZOMA 4MNVA 2ANKH 2KAIA 2C90B 1MMJN 1BMNH 5EPNA 1C2IA 2VINA 1O2HA 6LPRA 3U9AH 1FAKH 2BZAA 2J34A 2NU3E 2D26C 4Y76A 4ABBA 3RXQA 3ZVFA 2V6NA 1YC0A 4O03A 1QQ4A 3VEQB 4BANB 4B2CA 2QN5T 5AHGH 3SV8A 5EQSA 4X6NA 5FX6A 1QA0A 4IGDA 1GJDB 3L3TA 4WWYA 3RXKA 1NTPA 3Q3XA 5JBTA 2A32A 3ENSB 4TY7A 2A7JA 1GI4A 3UNRA 1DWDH 3GCTG 1C5NH 1TALA 4WH8A 4YLQH 2TRMA 1C1WH 1JRSA 1GJ6A 5EOKA 3BTWE 2BLVA 1GI7B 1J15A 1O2QA 1SI5H 1K1NA 1O5GH 2VIWA 2PHBA 3MFJA 1VCPA 4IC6A 2SNVA 5GJ4B 4B75A 2AGGX 1DY9A 4UE7H 1O3CA 1NFWA 2AERH 4BXSA 1LVMA 1WCZA 4H6TA 1DWCH 2OBOA 2P3TB 2ZI2H 3F1SB 3KL6A 1EP5A 1IQHA 1BOQA 2B0FA 2FX6A 4K1EA 3KGPA 3F9GA 1UMAH 1H9IE 2QC2A 2ZPRA 2VIDA 5HM2A 4YZUA 1V2RT 5C5OA 4K3JA 4PROA 1DXWA 1ZTJA 2HPPH 4X1PU 1ZMJA 5JDUB 4BTIB 1N8OB 1IAUA 4YO9A 1BTPA 1G9IE 4AORA 1QGFA 3GDVA 4FUDA 1JIRA 1MTVA 5CHAB 5BPEA 1SQOA 4Y6DA 9ESTA 4YTAA 3BEUA 1AIXH 4FUEA 4DVAU 3R3GB 1O37A 1XXDA 1MBMA 3VGCC 3TH2H 2ASUB 3KIDU 4O9VA 3RXUA 4B2BA 2JH6D 3OU0A 3NCLA 2F9NA 1WU1A 2JH0D 3A81A 2O8UA 2ZFSA 3KNXA 3RM2H 2CHAC 1ANBA 1ZGIA 2TGDA 3LGWA 4NSYA 3SU4A 1O0DH 1PQAA 4WMDA 3V0XA 1SG8B 3BG4C 1O3KA 2BX3A 2BB4A 2FMJA 3QO6A 1ID5H 4AOQA 1ZYOA 2AFQB 2A45B 1GCDA 3N7OA 1ZHMA 1YPGH 3TIUA 1XUFA 3BTHE 3ITIA 4ISNA 1PPGE 2BD3A 1TX7A 3LONA 4X1NU 1ELTA 2SGPE 1C5UA 1IHTH 2OLGA 1ANCA 3DFLA 3QLPH 1N6YA 1F5KU 1JIMA 1D6WA 2ZCLP 2ZTXA 2WPKS 1QFKH 2BXUH 3ZYDA 4IBLH 3T28A 2CJIA 3A7WA 1ELAA 1O35A 3ZVDA 1SC8U 2HGTH 1ESTA 1E37B 1JXPA 2ZGCA 1PYTD 1GJBB 3OYPA 4ABDA 1C1PA 1SOZA 3GYLB 2G8TA 1SHYA 1T4VH 2QF0A 2FI5E 1NM6A 3GCTF 1K22H 2V3HH 2FI4E 2VVUA 3LOXA 1YPLH 4ZHMU 1DWBH 1BBRH 2H5CA 5ABWA 4E7NA 4MPXA 4AZ2B 1QY6A 2ZCKP 3GCHC 2IPHA 1CT4E 2B5TB 2GGVB 2GV6A 3BN9A 1O2MA 3K9XB 4U2WA 1OYTH 2A1DB 1QBVH 1YP9A 1UK4A 4ZKRU 3Q76A 3BTDE 2ZU4A 2OC0A 2OQUA 2EI6A 3SW2B 2TIOA 2QXIA 3ODFA 2UUKB 3F68H 1EAWA 4NA8A 1C1VH 1ELDE 1YPEH 3OTJE 1O39A 3GDSA 4AB9A 2CF9H 2Z9IA 1FY5A 2J92A 3IWMA 1KLJH 4JZFH 1AMHA 3MH6A 1UCYK 2HNTE 2FOCA 3QTOH 4UD9H 3PWBA 5A0AE 5TJXA 5AVDA 1A0HB 3TU7H 1ESBA 2PWXA 1UK3A 1F0TA 1MAYA 1CU1A 1O2OA 4AGKA 1IQLA 2A4OA 1BJVA 2GCTC 2BY9X 1J17T 2ULLA 3STJA 1ARBA 1DLEA 1QJ6B 5I46H 3TK6A 4E7RG 3GY2A 1T7CA 2XTTB 1O33A 3UOPA 5JBBS 4Y8ZA 1CHOG 4ABEA 3RMLH 2PUQH 4HTCH 2BLWA 4ABHA 1SGCA 1GMCG 1TONA 1L1NA 1O2XA 2NU2E 2A2QH 1V2LT 1T8NA 4FU7A 9LPRA 1CA8B 1N6XA 1V2WT 5CE1A 2Q6FA 1V2QT 2FOHA 2NU1E 2ALPA 4GSOA 1W8BH 2FOGA 5EGMA 3CENA 3VFEA 1KTTB 1P12E 1HJAB 3LGTA 1BDAA 1DVAH 4JYUH 1GHZA 2HWLB 3FZDA 4Z6AH 2OQ5A 1C1UH 1VGCB 1PJPA 2O8TA 1AFQB 3MI4A 3MMGA 4Y10E 4TY6A 1EZSC 1O5CB 3MH7A 2ZTYA 1YPMH 2H9HA 3LJOA 1V3XA 1YBWA 1Y3WA 4ZH8A 2Y81A 3UY9A 4CREA 1GDQA 1GBIA 1HAVA 3SU1A 3BTME 4AB8A 2RDLA 2GMTB 2ZPQA 4GCHF 1NRSH 3RXLA 1UCYE 4Y0ZE 4CRAA 1P2IA 1IQKA 1CGJE 1TWXB 1C1NA 2ZF0H 4JZIA 1TGNA 7KMEH 5JBAS 3BSQA 1GBJA 3AW1A 1BTWA 4AFZA 1GJ9B 2BDGA 1PQ5A 3NUMA 1IQGA 6CHAC 4NCYA 3PV4A 4BTUB 1KLTA 1W10U 2FTLE 3OSYA 1NRRH 1YPHC 3SNAA 2SFAA 1OKXA 1O2GH 1AN1E 2FS9A 2BXTH 2BDBA 3LC3A 4D9RA 1G2MA 2HOBA 3A86A 4WMFA 3VB3A 3MNBA 3RC5A 5C5NA 4FUBA 3FP7E 4AYYB 3RU4E 3ATWA 2PKSC 5ESBA 1DLKB 1FI8A 1HPGA 3GDUA 3M5LA 4YOIA 1J9CH 1BA8B 1ARCA
chains in the Genus database with same CATH superfamily
1C5ZB 2F9BH 1BRAA 2P93A 4A1TA 4CRFA 1WTGH 2CGAA 1CGHA 3LIWA 1O3NA 5A0CA 2WSSD 2AGIX 1NN6A 3FAOA 1ABIH 4I8JA 4MNXA 3S69A 1DSUA 1QNJA 1OX1A 1Z8RA 5ETXA 3T2NA 1BHXF 4D7GA 2BY5X 5H4IB 2VVCA 3PV5A 5ESTE 2D1JA 1P02A 2Z9JA 1AKSB 1C9PA 4H42U 2ZDLA 1QQUA 1Z8GA 1THSH 2DUCA 1GWAA 2O8MA 3ATMA 3UTUH 5DK1A 4YXWD 4ABJA 1GBFA 1MQ6A 1ZSKA 1EFRD 4ZAEA 1CHOF 2CF8H 4FU9A 3PROA 1A61H 3SOSA 1YCPM 1EQ9A 4Y8YA 2PUXB 5A2MH 3S7HB 2GZ7A 2GT8A 3TK9A 1GMCF 1OP8A 2OTVA 2KCYA 3F0OA 1O3HA 1U6QA 1D9IA 5EXLA 3FP8E 1XM1A 2W26A 2A31A 4NIYA 2NU4E 3UREA 4MPUA 1FUJA 1G37A 3GCNA 3SJIA 1HXEH 1HAPH 2H9TH 2OCVB 1XKBC 3STIA 1SPJA 4ISLA 1IQMA 3ZVGA 1UTLM 2BD2A 3UQOA 4BXWA 2QCYA 3ATLA 3N7DA 4VGCC 2PW8H 3EE7A 2EY4C 1AVWA 2A4QA 1QRWA 3SGAE 1S5SA 1C5MD 3PRDA 4ZHAA 4JZ1A 3W95A 2O8LA 2XOKD 5FCKA 5A8ZA 1O2RA 4GHQA 3WWFA 4YESB 3A8AA 1YLCA 3SV9A 3AAVA 3JZ1B 4XDEA 5JB9S 4JK6A 1GJCB 3MU5A 4X1QU 1F0SA 1O2IA 1OP0A 2ZPSA 1SQRA 1FONA 1TBRH 2M5TA 1Y5AT 2ZTZA 1P3EA 4U01A 4Y8XA 5GXPA 1D3TB 1P2NA 1MKXH 3UOUA 2XXLA 5E2OA 1XUIA 1GBMA 4M9FA 2FOAA 2KM0A 1HDTH 3B8JA 3K2UA 4CRDA 4ZMAH 3MO6A 2FTMA 4D8NA 4GUXA 1ZMLA 3HPTB 1ZGVA 3LH1A 2R0KA 2QAAA 7LPRA 1MZDA 1ZTLA 1G2LA 1W13U 1C5LH 2ZDKA 1GI1A 2ZWLH 1BB0B 3T5FH 1TOMH 1WAYB 1C5VA 5T6DA 3FVFB 1GI8B 2BQWB 1BTZA 4X8VH 1TIOA 3VGCB 1Y3XA 1QBNA 1XXFA 1RJXB 5DP5A 1C2HA 2KZ4A 4NFFA 2L6OA 2AGEX 1D3QB 4K60A 1GMDG 3NK8A 3SJ8A 1RTKA 2CHAB 3EA7A 3BTKE 3ZZAA 1K1OA 3A84A 2BX4A 3BG4B 1PFXC 1W0KD 2O9QA 4AC9A 3DSOA 1UHBB 3RXGA 4NZLA 1C5OH 1QR3E 1YPJH 1QL7A 1ZPBA 2BDIA 2OP9A 1P2JA 2FP7B 3DSGA 4AYVB 2PR3A 3D65E 3BTGE 3H7TA 3KQ5A 1ELEE 4O97A 3ZZ8A 4FVBA 1GCTC 2PLXA 3ZVAA 1BTYA 2FM2A 1E38B 3LGVA 4JZDH 1HCGA 5F8ZA 4NZQA 2PKAB 4X0WU 1ZRKA 2YNAA 3TJNA 1AB9C 1L0ZA 2KCPA 2FOBA 5E0HA 5EG4A 3S9BA 3NWUA 4NIVA 1P10A 1HIAB 4ABIA 5EPYA 1KIGH 4K69A 4OS4A 2ZGJA 3P70B 2HRVA 2OBQA 2LELA 1O5AB 1TRMA 1KXCA 3QDZB 2XW9A 1MAXA 2FPZA 5F8TA 1XKAC 3P92A 1V2PT 1LHFH 5F6MA 2Z3EA 1DE7H 1AZ8A 3UNSA 3RXOA 1K0HA 2BVRH 1C2KA 1WOFA 2Q1JA 1YY3A 2TGPZ 1LDTT 1FY3A 2WPHS 4AG1A 3GCHB 3MOCA 4R8TB 3M7UA 4ZXXH 1TNHA 2GTBA 2ZFQH 1SLWB 4WJG2 3A8BA 3E8LA 3SJOA 1A5IA 1F2SE 3PB1E 5B6OA 2HVXA 3SHAH 2XCFA 1SBWA 1MD8A 1UVSH 1K1LA 2BVXH 1LHCH 4Q2KA 2GT7A 1Z1JA 3RXMA 2VIOA 5C17A 1SGTA 1QB1A 2V3MA 1D6RA 1W0YH 4Y11E 3TITA 1C1OA 4YOJA 5DKMA 1MD7A 2IJD1 1FY4A 2QXJA 1KSNA 5EU8A 3RU4D 5CDFE 2J98A 1ELCA 2VJ1A 1EAIA 1GMHG 3RXCA 3GS9A 5DO4H 3D23A 2Z7FE 4AFQA 1XUHA 1H4WA 2GDEH 2P59A 2H2ZA 1C5YB 4HFPB 1O2YA 4AG2A 2HLCA 1P2KA 2V35A 2GCTB 3E91A 1SGIB 1KY9A 1OP2A 3R0FA 2Z9GA 4WMEA 3E3TA 1GBDA 3P95A 4BOHA 1EZXC 1F0UA 2F9VA 1C2FA 4GVUA 3A88A 1BHXB 4CHAC 1TYNA 1EZQA 1TMUH 2OC7A 1FPHH 1NRQH 5C67A 1UTNA 4SGBE 2W3IA 3F9HA 1BBRE 1A0JA 1WBGB 3QUMP 4NWLA 1AD8H 2QV1A 3UUZA 3B9FH 3T25A 2JH5D 1BMMH 3SV6A 3MWIU 2R3UA 2ZO3H 4TT3D 2AMDA 4X1SU 2P3UB 4UDWH 3ZZ6A 3BTFE 1ORFA 3KQEA 1KXBA 1Z8JB 8LPRA 2RFKC 1SGEE 4X8UH 3UR6A 4RN6A 1ZPZA 2BD4A 2ZIQH 3TLOA 4AGJA 1C5RA 2Y6TA 3TVJB 5PTPA 1AWHB 5EJLA 2IN2A 1K21H 1VITG 4JK5A 1P09A 4P00A 5C94A 1FAXA 3PM3A 3TPIZ 3SGBE 1Y5BT 4MPWA 2BM2A 2XC4A 4MNYA 4B71A 4O3TA 1GGDC 2AIPA 1S83A 1IQEA 2KFWA 2BQ6B 1NRPH 1QIXB 1HBTH 1NO9H 4HGCA 1DY8A 1AE5A 1AI8H 1P0SH 5HGGA 2GCHG 1F0RA 4ZKNU 1NFYA 3F3BA 3GY6A 4FXGH 1C1RA 3SGQE 3BTTE 4ZHLU 2B9LA 4X1RU 4X6OA 3B23B 5DN6D 1HAYB 5LGOA 1HAHH 1CVWH 1EXFA 2Y5FA 3GY4A 3OFND 1B0FA 1MKWK 1COWD 2ODQA 3RXFA 2A5KA 5EXMA 3RUOA 4U30A 1E36B 4XBDA 1SKYE 1BRCE 3SBKA 2VBCA 5FX5A 5CHBA 1A2CH 1TE0A 1SB1H 3V12A 2F4LA 3QK1A 3ZVEA 1GBHA 6CHAB 1EATA 2ZZUH 6ESTA 1GHWH 3ZZ4A 4I7YH 2VB0A 4OS2A 3VXEH 1CGIE 1CQQA 1FXYA 1LHDH 1Y8TA 5EW1H 1A3EH 1DICA 2ZHWH 1ZSLA 3P8NA 2J95A 1E1QD 1CBWC 4Q4LA 2PGQB 3SNDA 4B73A 3TJOA 1SQTA 1KDQA 1AFEH 1O3JA 3GY3A 2PKSB 3M36A 2K0QA 4FUIA 1GL1A 4IW4E 5DP7A 3M7TA 2V0BA 2ZQ2A 1FY8E 1HV7A 1O3AA 3RXJA 2P95A 4RSPA 2FZZA 4X2VA 5E0JA 1MH0A 3A7XA 3KQDA 1TPAE 1BCUH 1MZAA 3QN7A 3A7VA 2CXVA 1TAWA 2CMYA 1A1RA 4XFQA 3LH3A 5GWZA 1A5HA 4F48B 2SGDE 1O2SA 3EDXB 3KQCA 2QF5A 5J4QA 3ZZDA 1HAGE 1FNIA 2ZDMA 1S0QA 4FU8A 1G36A 1W7XH 2H9EH 4Q7XA 4X2YA 1C5PA 4DY7B 4B2AA 1F5RA 3KF2A 2ZHFH 4OS7A 1RIWC 3GISB 3LGUA 3GCOA 3OEED 3PO1C 5EQQA 2QF4A 1YLNA 2Z6BD 1SLUB 4U32A 3ELAH 3FZZA 1HRTH 1MU8B 1Z7KA 3TGIE 2BZ6H 1DUEA 3N7EA 3KQBA 4KELA 1VITF 4J2YB 2FLRH 3M3SA 5DPAA 3RU4T 2CV3A 3UFAA 2JKHA 1O3EA 1RRKA 4B74A 1BQYA 2FI3E 1ZR0A 2ZDNA 1SLVB 1SFIA 1K28D 1ZHPA 1LQDB 4IS5A 4LXBH 3H7OA 1DANH 2GCHF 1GHVH 1T4UH 1NC6A 2G52A 3AW0A 4X6MA 1P2OA 4VGCB 3SU0A 1J14A 1K9OE 4NGAH 1MKXK 2FYQA 3TGKE 3S7KB 4AN7A 1AY6H 2ZC9H 1BMLA 2VH6A 4K1SA 3W1EA 4FUCA 2A7HA 2GV7A 1E0FD 4A1XA 4I8KA 3QZQA 4OGXA 4NIXA 1O3IA 4ZROA 1UTKA 1WV7H 3ZZCA 4LZ4B 1CT2E 4XE4A 1XUGA 1LVBA 2JETC 1CA0C 1GHBG 2P3FH 1RTFB 2OC1A 1C2LA 2FYRA 1LHEH 2GKVE 2HNTF 3O8CA 1C2EA 4NIWA 1JMOH 1YGCH 1ZJKA 2Z3DA 3P8FA 2ZU3A 1T8MA 1UVPA 1JWTA 3PLPA 1C4Y2 1O5FH 1O3BA 2ANYA 1UTJA 2Q6GA 2WYJA 1DPOA 5EIYA 2QGRA 2ANWA 1QA7A 4SGAE 1E1RD 2ZG0H 1SGNE 2TGTA 1MTNC 4KTSA 1Z6EA 1LHGH 3O8DA 1EAUA 2BOKA 3DD2H 1GJ7B 2YMSC 1YM0A 4UEHH 1O2PA 3SU2A 3PYHA 1P06A 3MNSA 1A3BH 3V3MA 3BV9B 1Y3VA 2QA9E 5KEDA 1L4DA 1SSXA 1C4V2 1XUJA 1V2MT 3ZZ9A 6GCHG 2AH4X 2ZKSA 3RC6A 4NSVA 2BQ7B 4GHTA 1TNJA 2A0QB 2OXSA 1KXAA 3E1XB 1W0ZU 3PMAB 5C3NA 2PTNA 1SR5C 1AU8A 1W11U 1NU7B 4UFFH 5HMAA 1EPTA 1G30B 2PGBB 2ZHQH 4FUGA 3OTPA 1TRYA 4WVPE 3T29A 1QRZA 1C5QA 2WUBA 1S81A 1UHBA 1QCPA 4DGJA 1H8HD 2ESTE 4YOGA 3F9EA 1XVMA 1Y3YA 5AFZH 3UPEA 5GCHG 1DITH 1GHYH 3D62A 1F7ZA 1GVLA 1XVOA 1EZUC 1V2OT 1FV9A 2LP6A 1C1MA 1GCTB 2G00A 1O3LA 1TGTA 4GPGA 1MBQA 2VWLA 1TNKA 2C4FH 2PKAA 1P05A 1L2EA 1OWHA 3LPRA 1TABE 1LPKB 1YKTA 2STAE 5EODA 1E35B 4Q7ZA 2STBE 1W0JD 3LT3A 4Q63A 1AB9B 1V2ST 3UR9A 3FP6E 4YT7H 2GZ9A 1SGRE 1HIAA 2ZFPH 4KTUA 1GBKA 2GDDA 5TCCA 1FMGA 3GYMA 3NPSA 2J94A 2GX4A 2FEQH 3PMBB 2FOMB 2Z9KA 5GPIB 2A2XH 2VNTA 3RXAA 2W3KA 3AASA 1NFXA 3U98H 1KXDA 5FPYA 1PYTC 1CO7E 3A8CA 1P2QA 2C3SA 3EAJA 4IN2A 5T6GA 2ZP0H 1GVZA 1Y59T 3FOAA 4NG9H 4HI3A 4HZHA 1BTUA 1HJ8A 4A92A 3RXIA 1ZJDA 1ETRH 1P9UA 1HXFH 1W12U 3HK3B 5E2PA 5FPTA 4NWKA 2XRCA 1P11E 4BAKB 1PPFE 4O3UA 4LK4A 3PLKA 3UWJH 2K8IA 1W2KH 2VIPA 2W7SA 1GHBF 1O38A 3SUGA 2BY8X 3TNTA 2UUYA 4K8YA 3TJUA 1YPHE 2KR7A 1O32A 2H6MA 3F2FA 1H9LB 1A4WH 3BIUH 1CT0E 1EJMA 2FS8A 2G5VA 2R2MB 3LKWA 3A7ZA 3MQKC 2WHXA 2EEKA 3BTQE 3H09A 3SU6A 2J97A 1GJ4H 1TPPA 5AFYH 2BLQA 4DURA 1NS3A 5LPEA 2ZGXH 4D7FA 1RGQA 1CSOE 1O2NA 3UB0A 3G01A 1OOKB 4FUJA 5DP3A 5J4SA 1C5SA 4BTTB 2B7DH 2BY7X 2R0LA 5JBCS 2IJOB 1LQEA 1IQNA 1O31A 4MLFB 1OSSA 3GY8A 2FOFA 1F92A 3RMOH 4CHAB 2VWMA 1JOUB 5B6LA 2R2WU 3C1KA 1ZSJA 1V2UT 3MO9A 1SLXB 4IMZA 1S6FA 1O2WA 1PQ7A 1LKAA 1THPB 4K8BA 2XWAA 3A85A 1GBBA 5A8XA 1HJAC 3A80A 3E90B 3E0NB 4H4FA 4CR5A 1W7GH 3TJVA 2A7CA 4DCDA 1O3FA 1QRXA 1RFNA 2WV9A 1L1JA 2BVSH 3LU9B 1V2VT 2K1QA 4FUFA 1C5WB 1G3EA 5DG6A 1BZXE 4Z0KA 4JCNA 1TGSZ 1EJAA 1B0EA 1K1PA 1MU6B 4IN1A 1C5TA 4JYVH 3RP2A 1O2VA 2I6QA 4Y7BA 1P3CA 1XUKA 3CS0A 3QTVH 1SGYE 2WPMS 1UVTH 1O36A 1TX6A 1OWIA 2DE9A 3WW7A 2AMQA 3ZZ3A 2YNBA 4RT1A 2ANMH 3M61U 1S84A 5EQRA 2VIQA 2OD3B 1GGDB 1T32A 4CRCA 4DIIH 2WPIS 4I8GA 3U8TH 5LPRA 2BYAX 4MNWA 2XCNA 4HG6A 5HXFA 1K1MA 1P03A 3KYGA 1AHTH 1O2TA 3P8OA 3E16B 3I78A 1KYNA 3SV7A 1IQJA 1MTWA 2QXHA 3NZIA 1VJ9U 5HIYA 3V7TA 1GHAG 1YF4A 4TPYA 3TNSA 3CS7A 2XC0A 4A7IB 4OGYA 3F6UH 1TNLA 5DP6A 2BHGA 1S82A 5EXNA 3OY5U 1NRNH 1P9SA 3EGKH 5F53A 2R3YA 1NPMA 3SUFA 1A7SA 3DA9B 3UNQA 2Y80A 4UFGH 1FDPA 1HAIH 1FJSA 4I86A 4TWYA 4R0IA 3TGJE 1NT1A 3LGYA 3UIRA 1GI9B 3DT0H 4I33A 1BBRK 1H8DH 1BUIA 3CNRA 2BLOA 1RS0A 3URCA 4Y71A 1TBZH 4IC5A 2WV4A 1EOLA 4MVNA 3WY8A 2ZGHA 3RXEA 1GG6C 3MTYA 1TPOA 3ZZBA 3PRBA 3SHCH 3ZYEA 1CBWB 3ZVBA 1HUTH 5CMXH 3L33A 2B8OH 5EW2H 2VU8E 1WQSA 1P8VC 1EOJA 1NFUA 3HKJB 4D9QA 3VB6A 2P8OC 3HATH 4MTBA 4XBCA 4RKJB 1G3DA 1ANDA 1A0LA 4K1TA 3GY7A 1OXGA 2WYGA 4Y0YE 2VH0A 1THRH 3CP7A 1EAXA 3AVZA 1TFXA 3OY6U 2EI7A 2F91A 1LO6A 4TPIZ 1QURH 4YT6H 2Z9LA 1O3OA 2VWNA 2AIQA 2THFB 1F5LA 4X8SH 3AK5A 1UTOA 3LDXH 1Z8IB 4JMYA 1GL0E 2EI8A 2F43B 1OWEA 2ZA5A 1O2KA 3QGNB 1C9TA 3PMHB 1TMTH 3NRLA 3EE0B 3MNXA 1ZPCA 1AE8H 1J8AA 4DOQA 3Q3YA 2BMGB 3ZVCA 2PSXA 1EJNA 1AO5A 1UTPA 2SGEE 1ETSH 1TRNA 3Q00A 2G55A 1ELFA 3K6YA 1GBLA 1RIWB 2VWOA 1LKBA 1TB6H 1O2ZA 1RD3B 1WYKA 3PO1B 5GDSH 1B5GH 1C1QA 5FBEA 1HAXB 3NKKA 1ELBA 3RXBA 4CBOA 2C8WB 1DT2A 4F55A 1C4U2 1GI2A 3ZZ5A 4CRGA 5L6NH 1S6HA 3KCGH 2G51A 3MU1A 1PPEE 3F2GA 3PLBA 2DE8A 2ZU2A 2XC5A 5L30H 2AEIH 1OYQA 1RTLA 5C20A 1TQ0B 4TWWA 2HPQH 4I8LA 1GMDF 1O3PB 1QBOA 3O8BA 2VGCC 1T31A 2GD4B 2UUJB 3A7YA 4FVDA 3SORA 3S9CA 1S6LA 1GJ8B 4I32A 1H9HE 1PQ8A 5IDKA 1B7XB 1GHAF 3S0NA 1TA6A 2D2DA 4LOYH 2ZFTA 4ISIH 1AVGH 1V2TT 1EKBB 3SU5A 3HK6B 3RXRA 3GOVB 1HAOH 5DP4A 1OPHB 3V13A 2ZU5A 3LC5A 4UFEH 1HAZB 1BRBE 1DWEH 1E34B 1SGFA 2NU0E 2EC9H 2G5NA 4XBBA 2YOLA 3RC4A 2JETB 1CA0B 3OE7D 3MH4A 3RXSA 1VCWA 4ISHH 1PPHE 1L1GA 1D3PB 3KHVA 3TK5A 2ZDVH 1G32B 1YLDA 1FLEE 2BDHA 1LCYA 3WWBA 1GVKB 2OC8A 1MTNB 1TLDA 2XBVA 1J16A 2UWOA 1DS2E 2F3CE 3MYWA 5FHTA 1O5DH 4F4OC 4ZKOU 1V2KT 4MQAA 2YMSB 1DFPA 1EPTC 2J38A 5F8XA 2UUFB 3MNCA 1C1TA 1UVUH 1WUNH 2FIRH 2BD7A 3W94A 1UTMA 3BG8A 1OHHD 1Q2WA 1HGTH 2FX4A 2XBYA 5I25A 3DSPA 2HNTC 3U8RH 1K1JA 1AVXA 2BDCA 3BIVH 1C2DA 1GDNA 1MTUA 3SJKA 1LMWB 4FETA 2CN0H 4JZEH 2Y82A 5E0GA 3H5CB 3N99A 3L6PA 2JDID 1GBEA 1NZQH 1XX9A 2KCAA 5IK2D 3F2HA 1MQ5A 1UTQA 1HYLA 1INCA 5HIZA 5LPFA 4XOJA 1SFQB 4P02A 1SQAA 4B6EA 1O3DA 1PPZA 4X2WA 4K5ZA 3I77A 1GMHF 3A7TA 5K0HA 2GJGA 2ZHEH 5HKKD 1C5XB 5FBIA 1V6DA 1O3GA 2ZU1A 3RXPA 2XWBI 3SUDA 4KGAA 4GCHG 1GHXH 2HVYB 2KAIB 3UQVA 2ZGBH 7GCHG 1OWDA 1GI0A 3DFJA 1G3CA 2PTCE 4I8HA 3NXPA 3GICB 4Y7AA 3VB7A 3ZZ7A 3QZRA 5SGAE 1AKSA 4TYDA 1KXFA 1FY1A 1TNGA 2XBXA 1P57B 1QL9A 1M9UA 1MTSA 1V2JT 3M5OA 3GY5A 2RG3A 1QL8A 3PWCA 2G81E 3A8DA 4BAMB 1WXRA 1VZQH 1YCPH 2BDYA 1OWJA 3ZIAD 4M7GA 5C0TA 2IOTA 2Y5HA 3LJJA 1DUAA 3SUEA 3URDA 3SI4H 3KEEA 3TH4H 1BTHH 3SZNA 4ZXYH 1H8IH 3M35A 2C8ZB 2HALA 2GP9B 3RXVA 1H8ED 1Y3UA 3RMMH 4ASHA 3TH3H 1BT7A 3U69H 1SGDE 1RXPA 2WUCA 3RXHA 5G4BA 4GAWA 1DM4B 2ZNKH 2ZQ1A 2AYWA 2ZFRH 4ESTE 4A5TS 4AX9H 2O8WA 2F9PA 1NY22 3I29A 1DDJA 4F49A 5C1UA 2G4UA 3HGNA 2QE7D 5AF9H 4MDSA 3OAAD 4IMQA 1NU9A 2WPDD 2P94A 4ABFA 2W7UA 3RLYH 1JBUH 1X7AC 1ZTKA 2BD9A 2LPRA 2TPIZ 5GIBA 3VPKA 1W3CA 3MU0A 4MG3A 4CH2B 1YPKH 4DW2U 2QYIA 4BAHB 1BTXA 5DGJA 3UWIA 5F03A 1N8OC 1W14U 3U8OH 1QTFA 2SGAA 3K65B 4KP0A 5CHAC 2J2UA 3EA9A 1GJ5H 1DXPA 1TX8A 2WPJS 3ODDA 1O2JA 4ABAA 4RKOB 1O2UA 4BAQB 1LVYA 3M7QA 5A0BA 1P2MA 1KTSB 1MCVA 3F9FA 3IITA 1VITH 4DT7B 4BAOB 1EB1H 2C8YB 4BNRA 4KTCA 1ACBE 3SJ9A 2OINA 1T8OA 5JYIA 3M3TA 4FOUC 4KKDA 3LGIA 4WY3A 1QB9A 4X2XA 3SNCA 2M2AA 1GDUA 5K7RA 1GPZA 1EASA 1TA2A 1UVOA 1QHRB 3SU3A 4NFEA 2SGQE 2GVFA 3FANA 1FPCH 1FIWA 2Y7XA 4NA7A 3ZV8A 1C2JA 2J9NA 2RCEA 2XNDD 1V2NT 1ANEA 2VIVA 2PV9B 2BY6X 3KN2A 4INKA 1OWKA 4INLA 3VB5A 2Q6DA 1TGCA 1Q3XA 3D49H 4Y79A 1EX3A 7GCHF 1Y5UT 4CRBA 4I31A 8GCHG 3A82A 4Q7YA 2XBWA 4A6LA 3T26A 1S0RA 1C2GA 1SGQE 1D4PB 5JPMH 4RI0A 1ZLRA 1BJUA 4WH6A 1TNIA 5DP8A 2TBSA 2Y7ZA 3EQ0H 5BRRE 3A89A 1WQVH 4ISOA 1EB2A 1MKWH 2C93B 2H5DA 2J4IA 1IQFA 3SQHE 4QT8C 1ZRBA 2IPQX 1S85A 1TMBH 3MH5A 1PPBH 5T1VA 4JYTA 1SL3A 1KMHB 1LPZB 3KYFA 2WINI 1KDQB 3MHWU 5A8YA 1Q31A 2KCOA 5TCAA 5FPSA 3BEIB 1BRUP 2QIQA 2FWWA 1WSSH 3ATKA 4NA9H 1ELGA 4OM9A 1ELVA 3SV2H 1HNEE 4THNH 1TGBA 3U1JB 4Z1MD 3ATIA 3SO3A 5C0UA 5DJ7A 4A1VA 3SQEE 1ETTH 4E05H 1KLIH 5FCRA 5LH8A 1TBQH 3RLWH 5A09A 4DIHH 1AUTC 1GG6B 2AS9A 3PTBA 1WTHD 2FOEA 1GJAB 1FIZA 3DHKH 3RXTA 3T27A 2WV5A 1FQ3A 1FN8A 2FESH 2F9OA 4YLUA 1OS8A 1BITA 1VJAU 2QXGA 5IYTA 4K2YA 2P8OB 5C2ZA 1SVPA 1LTOA 2ZECA 2UWLA 3SNBA 5HM9A 1HJ9A 2A4GA 3Q77A 3U28C 3DCLA 1VR1H 1DSTA 3M5NA 2ODPA 3O8RA 1IOEA 1MCTA 1O3MA 2ILNA 4WF8A 1G3BA 5HYOA 2PSYA 1AZZA 2ZFFH 1SGPE 4ZUHA 3BEFB 4D76A 8ESTE 2W5EA 3AAUA 1O34A 2ZEBA 4XD7D 4ZKSU 4DJZB 3RDZA 4B76A 3S9AA 1AWFH 1EUFA 2A5AA 2Y5GA 1DOJA 1LVOA 3A83A 2OUAA 2RA3A 2L74A 3T62A 2RA0A 4X6PA 3BTEE 1IQIA 1T8LA 1UCYH 2JJ1D 1DX5M 1AQ7A 2QF3A 4H6SB 3FFGA 3QX5H 5T3HA 2Z3CA 2ZHDA 5FXLA 2BTCE 1PPCE 1UJ1A 1Z6JH 2FODA 3MU4A 3SZEA 1LPGB 1HLTH 1N1LA 2QY0B 5T6FA 3JZ2B 3P17H 5DP9A 4X8TH 3EA8A 3E0PB 2OK5A 1QJ7B 3VB4A 3VG8A 4B1TA 6GCHF 2XNIA 1AGJA 4DG4A 1EP6A 1K2I1 2WPLS 4RT0A 2EA3A 3SN8A 1A5GH 2R9PA 3BF6H 1SGFG 3P8GA 2ZCHP 8GCHF 2VGCB 3C27B 3RMNH 5KGOA 2ALVA 4B6FA 1ZMNA 7ESTE 1K1IA 2BD8A 1GBTA 1H1BA 1VGCC 1SHHB 4DT4A 1AFQC 1ZZZA 1MABB 2VVVA 1MUEB 1O2LA 3FN8A 2F9UA 5GCHF 3HKIB 5C1YA 4LZ1H 2V3OH 2H1UA 3RXDA 4INHA 1HAVB 1L4ZA 1TOCB 2BOHB 3ZV9A 2GMTC 2XYAA 3VXFH 2NWNA 3FO8D 1JRTA 2C8XB 2GZ8A 2W6JD 4CBNA 3Q3KA 2AMPA 4Q80A 3SNEA 3EYDA 3OX7U 2G4TA 5L2ZH 2FO9A 1GBCA 1O30A 3M3VA 3M5MA 2UWPA 2I6SA 1KXEA 3A87A 1YWUA 3E6PH 1TPSA 2BD5A 1NESE 1UK2A 1ZHRA 5EJZA 1O5EH 2ZDAH 2JIZD 1ABJH 1O5BB 1QJ1B 4GLYA 1VCQA 2SGFE 3QGJA 3ESTA 4J1YA 2LNCA 1EPTB 5JB8S 1NROH 5C1XA 2Z94A 2F83A 1UW7A 4WXIA 1CE5A 4ASUD 2V7QD 2P16A 5E8EH 1QB6A 2CK3D 1Z1IA 4MPVA 2PP6A 1SMFE 1C2MA 4OS1A 2A5IA 3K6ZA 4UFDH 1BMAA 1HFDA 2FXRA 1XMNB 4XSKU 2SNWA 3PMJA 1HB0B 1YYY1 1C1SA 4ABGA 1GBAA 2A4RA 4FUHA 2KX4A 1A46H 1P04A 1AUJA 1GI6A 1TQ7B 1D3DB 4AFUA 4E06H 1GI3A 3QWCH 1SOTA 3RM0H 1CHGA 4YM9A 2ODYB 2FLBH 3P6ZB 2PFEA 4CH8B 2D8WA 3U1IB 4OS6A 2BDAA 5GNDA 2FDAA 3IG6B 8KME2 4ACBA 3M37A 4CR9A 1IHSH 4UONA 1BIOA 3OEHD 5FAHA 1QZ8A 1FN6A 4AFSA 3MO3A 3MU8A 1GI5A 1FZZA 1UO6A 1Z71A 3PTNA 4OS5A 4WXVA 5L2YH 3HGPA 1ESAA 1P01A 2TGAA 1YCPK 3DUXH 3SI3H 1ZOMA 4MNVA 2ANKH 2KAIA 2C90B 1MMJN 1WDIA 1BMNH 5EPNA 1C2IA 2VINA 1O2HA 6LPRA 3U9AH 1FAKH 2BZAA 2J34A 2NU3E 2D26C 4Y76A 4ABBA 3RXQA 3ZVFA 2V6NA 1YC0A 4O03A 1QQ4A 3VEQB 4BANB 4B2CA 2QN5T 5AHGH 3SV8A 5EQSA 4X6NA 5FX6A 1QA0A 4IGDA 2RDEA 1GJDB 3L3TA 4WWYA 3RXKA 1NTPA 3Q3XA 5JBTA 2A32A 3ENSB 4TY7A 2A7JA 1GI4A 3UNRA 1DWDH 3GCTG 1C5NH 1TALA 4WH8A 2WZQA 4YLQH 2TRMA 1C1WH 1JRSA 1GJ6A 5EOKA 3BTWE 2BLVA 1GI7B 1J15A 1NBME 1O2QA 1SI5H 1K1NA 1O5GH 2VIWA 2PHBA 3MFJA 1VCPA 4IC6A 2SNVA 5GJ4B 4B75A 2AGGX 1DY9A 4UE7H 1O3CA 1NFWA 2AERH 4BXSA 1LVMA 1WCZA 4H6TA 1DWCH 2OBOA 2P3TB 2ZI2H 3F1SB 3KL6A 1EP5A 1IQHA 1BOQA 2B0FA 2FX6A 4K1EA 3KGPA 3F9GA 1UMAH 1H9IE 2QC2A 2ZPRA 2VIDA 5HM2A 4YZUA 1V2RT 2YMSD 5C5OA 4K3JA 4PROA 1DXWA 1ZTJA 2HPPH 4X1PU 1ZMJA 5JDUB 4BTIB 1N8OB 5EJ1A 1IAUA 4YO9A 1BTPA 1G9IE 4AORA 1QGFA 3GDVA 4FUDA 1JIRA 1MTVA 5CHAB 5BPEA 1SQOA 4Y6DA 9ESTA 4YTAA 3BEUA 1AIXH 4FUEA 4DVAU 3R3GB 1O37A 3F0PA 1XXDA 1MBMA 3VGCC 3TH2H 2ASUB 3KIDU 4O9VA 5DSFA 3RXUA 3SYJA 2JH6D 3OU0A 4B2BA 3NCLA 2F9NA 1WU1A 2JH0D 3A81A 2O8UA 2ZFSA 3KNXA 3RM2H 2CHAC 1ANBA 1ZGIA 2TGDA 3LGWA 4NSYA 3SU4A 1O0DH 1PQAA 4WMDA 1BMFD 3V0XA 4ACAA 1SG8B 3BG4C 2JJ2D 1O3KA 2BX3A 2BB4A 2FMJA 3QO6A 1ID5H 4AOQA 1ZYOA 2AFQB 2EQNA 2A45B 1GCDA 3N7OA 1ZHMA 1YPGH 3TIUA 1XUFA 3BTHE 3UAIC 3ITIA 4ISNA 1PPGE 2BD3A 1TX7A 3LONA 4X1NU 1ELTA 2SGPE 1C5UA 1IHTH 2OLGA 1ANCA 3DFLA 3QLPH 1N6YA 1F5KU 1JIMA 1D6WA 2ZCLP 2ZTXA 2WPKS 1FX0B 1QFKH 2BXUH 3ZYDA 4IBLH 3T28A 2CJIA 3A7WA 1ELAA 1O35A 3ZVDA 1SC8U 2HGTH 1ESTA 1E37B 1JXPA 2ZGCA 1PYTD 1GJBB 3OYPA 4ABDA 1C1PA 1SOZA 3GYLB 2G8TA 1SHYA 1T4VH 2QF0A 2FI5E 1NM6A 3GCTF 1K22H 2V3HH 2FI4E 2VVUA 3LOXA 1YPLH 4ZHMU 1DWBH 1BBRH 2H5CA 5ABWA 4E7NA 4MPXA 4AZ2B 1QY6A 2ZCKP 3GCHC 2IPHA 1CT4E 2B5TB 2GGVB 2GV6A 3BN9A 1O2MA 3K9XB 4U2WA 1OYTH 2A1DB 5FL7D 1QBVH 1YP9A 1UK4A 4ZKRU 3Q76A 3BTDE 2ZU4A 2OC0A 2OQUA 2EI6A 3SW2B 2TIOA 2QXIA 3ODFA 4TSFD 2UUKB 3PV2A 3F68H 1EAWA 4NA8A 1C1VH 1ELDE 1YPEH 3OTJE 1O39A 3GDSA 4AB9A 2CF9H 2Z9IA 1FY5A 2J92A 3IWMA 1KLJH 4JZFH 1AMHA 3MH6A 1UCYK 3FKSD 2HNTE 2FOCA 3QTOH 4UD9H 3PWBA 2J98B 5A0AE 5TJXA 5AVDA 1A0HB 3TU7H 1ESBA 2PWXA 1UK3A 1F0TA 1MAYA 2W6ID 1CU1A 1O2OA 4AGKA 1IQLA 2A4OA 1BJVA 2GCTC 2BY9X 1J17T 2ULLA 3STJA 1ARBA 1DLEA 1QJ6B 5I46H 3TK6A 4E7RG 4XRNA 3GY2A 1T7CA 1E79D 2XTTB 1O33A 3UOPA 5JBBS 4Y8ZA 1CHOG 4ABEA 3RMLH 2PUQH 1VKYA 4HTCH 2BLWA 4ABHA 1SGCA 1GMCG 1TONA 1L1NA 1O2XA 2NU2E 2A2QH 1V2LT 1T8NA 4FU7A 9LPRA 1CA8B 1N6XA 1V2WT 5CE1A 2Q6FA 1V2QT 2FOHA 2NU1E 2ALPA 4GSOA 1W8BH 2FOGA 5EGMA 3CENA 3VFEA 1KTTB 1P12E 1HJAB 2HLDD 3LGTA 1BDAA 1DVAH 4JYUH 1GHZA 2HWLB 3FZDA 4Z6AH 2OQ5A 1C1UH 1VGCB 1PJPA 2O8TA 1AFQB 3MI4A 3MMGA 4Y10E 4TY6A 1EZSC 1O5CB 3MH7A 2ZTYA 1YPMH 2H9HA 3LJOA 1V3XA 1YBWA 1Y3WA 4ZH8A 2Y81A 3UY9A 4CREA 1GDQA 1GBIA 1HAVA 3SU1A 3BTME 4AB8A 2RDLA 2GMTB 2ZPQA 4GCHF 1NRSH 3RXLA 1UCYE 4Y0ZE 4CRAA 1P2IA 1IQKA 1CGJE 1TWXB 1C1NA 2ZF0H 4JZIA 1TGNA 7KMEH 5JBAS 3BSQA 1GBJA 3AW1A 1BTWA 4AFZA 1GJ9B 1NBMD 2BDGA 1PQ5A 2AHME 3NUMA 1IQGA 6CHAC 4NCYA 3PV4A 4BTUB 1KLTA 1W10U 4ZCNA 2FTLE 3OSYA 1NRRH 1YPHC 3SNAA 2SFAA 1OKXA 1O2GH 1AN1E 2FS9A 2BXTH 2BDBA 3LC3A 4D9RA 5KECA 1G2MA 2HOBA 3A86A 4WMFA 3VB3A 3MNBA 3RC5A 5C5NA 4FUBA 3FP7E 4AYYB 3RU4E 3ATWA 2PKSC 5ESBA 2J5UA 1DLKB 1FI8A 1HPGA 3GDUA 3M5LA 4YOIA 1J9CH 1BA8B 1ARCA
chains in the Genus database with same CATH topology
1C5ZB 2F9BH 1BRAA 2P93A 4A1TA 4CRFA 1WTGH 2CGAA 1CGHA 3LIWA 1O3NA 5A0CA 2AGIX 1NN6A 3FAOA 1ABIH 4I8JA 4MNXA 3S69A 1DSUA 1QNJA 1OX1A 1Z8RA 5ETXA 3T2NA 1BHXF 4D7GA 2BY5X 5H4IB 2VVCA 5ESTE 2D1JA 1P02A 2Z9JA 1AKSB 1C9PA 4H42U 2ZDLA 1QQUA 1Z8GA 1THSH 2DUCA 1GWAA 2O8MA 3ATMA 3UTUH 5DK1A 4ABJA 1GBFA 1MQ6A 1ZSKA 4ZAEA 1CHOF 2CF8H 4FU9A 3PROA 1A61H 3SOSA 1YCPM 1EQ9A 4Y8YA 2PUXB 5A2MH 3S7HB 2GZ7A 2GT8A 3TK9A 1GMCF 1OP8A 2OTVA 1O3HA 1U6QA 1D9IA 5EXLA 3FP8E 1XM1A 2W26A 2A31A 4NIYA 2NU4E 3UREA 4MPUA 1FUJA 1G37A 3GCNA 3SJIA 1HXEH 1HAPH 2H9TH 2OCVB 1XKBC 3STIA 1SPJA 4ISLA 1IQMA 3ZVGA 1UTLM 2BD2A 3UQOA 4BXWA 2QCYA 3ATLA 4VGCC 2PW8H 1AVWA 2A4QA 1QRWA 3SGAE 1S5SA 1C5MD 4ZHAA 4JZ1A 3W95A 2O8LA 5FCKA 5A8ZA 1O2RA 4GHQA 4YESB 3A8AA 1YLCA 3SV9A 3AAVA 3JZ1B 4XDEA 5JB9S 4JK6A 1GJCB 3MU5A 4X1QU 1F0SA 1O2IA 1OP0A 2ZPSA 1TBRH 1FONA 2M5TA 2ZTZA 1Y5AT 1P3EA 4U01A 4Y8XA 5GXPA 1D3TB 1P2NA 1MKXH 3UOUA 2XXLA 5E2OA 1XUIA 1GBMA 2FOAA 1HDTH 3B8JA 3K2UA 4CRDA 4ZMAH 3MO6A 2FTMA 4D8NA 4GUXA 1ZMLA 3HPTB 1ZGVA 3LH1A 2R0KA 2QAAA 7LPRA 1MZDA 1ZTLA 1G2LA 1W13U 1C5LH 2ZDKA 1GI1A 2ZWLH 1BB0B 3T5FH 1TOMH 1WAYB 1C5VA 5T6DA 3FVFB 1GI8B 2BQWB 1BTZA 4X8VH 1TIOA 3VGCB 1Y3XA 1QBNA 1XXFA 1RJXB 5DP5A 1C2HA 4NFFA 2AGEX 1D3QB 4K60A 1GMDG 3NK8A 3SJ8A 1RTKA 2CHAB 3EA7A 3BTKE 3ZZAA 1K1OA 3A84A 2BX4A 3BG4B 1PFXC 2O9QA 1UHBB 3RXGA 4NZLA 1C5OH 1QR3E 1YPJH 1QL7A 1ZPBA 2BDIA 2OP9A 1P2JA 2FP7B 4AYVB 2PR3A 3D65E 3BTGE 3H7TA 1ELEE 4O97A 3ZZ8A 4FVBA 1GCTC 2PLXA 3ZVAA 1BTYA 2FM2A 1E38B 3LGVA 4JZDH 1HCGA 5F8ZA 4NZQA 2PKAB 4X0WU 1ZRKA 2YNAA 3TJNA 1AB9C 1L0ZA 2FOBA 5E0HA 5EG4A 3S9BA 3NWUA 4NIVA 1P10A 1HIAB 4ABIA 5EPYA 1KIGH 4K69A 4OS4A 2ZGJA 3P70B 2HRVA 2OBQA 1O5AB 1TRMA 1KXCA 3QDZB 2XW9A 1MAXA 2FPZA 5F8TA 1XKAC 3P92A 1V2PT 1LHFH 5F6MA 2Z3EA 1DE7H 1AZ8A 3UNSA 3RXOA 2BVRH 1C2KA 1WOFA 2Q1JA 2TGPZ 1LDTT 1FY3A 2WPHS 4AG1A 3GCHB 3MOCA 4R8TB 3M7UA 4ZXXH 1TNHA 2GTBA 2ZFQH 1SLWB 4WJG2 3A8BA 3E8LA 3SJOA 1A5IA 1F2SE 3PB1E 5B6OA 2HVXA 3SHAH 2XCFA 1SBWA 1MD8A 1UVSH 1K1LA 2BVXH 1LHCH 4Q2KA 2GT7A 1Z1JA 3RXMA 2VIOA 1SGTA 1QB1A 1D6RA 1W0YH 4Y11E 3TITA 1C1OA 4YOJA 5DKMA 1MD7A 1FY4A 2QXJA 1KSNA 5EU8A 3RU4D 1ELCA 2VJ1A 1EAIA 1GMHG 3RXCA 5DO4H 3D23A 2Z7FE 4AFQA 1XUHA 1H4WA 2GDEH 2P59A 2H2ZA 1C5YB 4HFPB 1O2YA 4AG2A 2HLCA 1P2KA 2V35A 2GCTB 3E91A 1SGIB 1KY9A 1OP2A 3R0FA 2Z9GA 4WMEA 3E3TA 1GBDA 3P95A 4BOHA 1EZXC 1F0UA 2F9VA 1C2FA 4GVUA 3A88A 1BHXB 4CHAC 1TYNA 1EZQA 1TMUH 2OC7A 1FPHH 1NRQH 5C67A 1UTNA 4SGBE 2W3IA 3F9HA 1BBRE 1A0JA 1WBGB 3QUMP 4NWLA 1AD8H 2QV1A 3UUZA 3B9FH 3T25A 2JH5D 1BMMH 3SV6A 3MWIU 2R3UA 2ZO3H 2AMDA 4X1SU 2P3UB 4UDWH 3ZZ6A 3BTFE 1ORFA 3KQEA 1KXBA 1Z8JB 8LPRA 1SGEE 4X8UH 3UR6A 4RN6A 1ZPZA 2BD4A 2ZIQH 3TLOA 4AGJA 1C5RA 2Y6TA 3TVJB 5PTPA 1AWHB 2IN2A 1K21H 1VITG 4JK5A 1P09A 1FAXA 3PM3A 3TPIZ 3SGBE 1Y5BT 4MPWA 2BM2A 2XC4A 4MNYA 4B71A 4O3TA 1GGDC 2AIPA 1S83A 1IQEA 2BQ6B 1NRPH 1QIXB 1HBTH 1NO9H 4HGCA 1DY8A 1AE5A 1AI8H 1P0SH 5HGGA 2GCHG 1F0RA 4ZKNU 1NFYA 3GY6A 4FXGH 1C1RA 3SGQE 3BTTE 4ZHLU 2B9LA 4X1RU 4X6OA 3B23B 1HAYB 5LGOA 1HAHH 1CVWH 1EXFA 2Y5FA 3GY4A 1B0FA 1MKWK 2ODQA 3RXFA 2A5KA 5EXMA 3RUOA 4U30A 1E36B 4XBDA 1BRCE 3SBKA 5FX5A 1A2CH 1TE0A 1SB1H 3V12A 3QK1A 3ZVEA 1GBHA 6CHAB 1EATA 2ZZUH 6ESTA 1GHWH 3ZZ4A 4I7YH 2VB0A 4OS2A 3VXEH 1CGIE 1CQQA 1FXYA 1LHDH 1Y8TA 5EW1H 1A3EH 1DICA 2ZHWH 1ZSLA 3P8NA 2J95A 1CBWC 2PGQB 3SNDA 4B73A 3TJOA 1SQTA 1KDQA 1AFEH 1O3JA 3GY3A 2PKSB 3M36A 4FUIA 1GL1A 4IW4E 5DP7A 3M7TA 2V0BA 2ZQ2A 1FY8E 1HV7A 1O3AA 3RXJA 2P95A 4RSPA 2FZZA 4X2VA 5E0JA 1MH0A 3A7XA 3KQDA 1TPAE 1BCUH 1MZAA 3QN7A 3A7VA 2CXVA 1TAWA 2CMYA 1A1RA 4XFQA 3LH3A 5GWZA 1A5HA 2SGDE 1O2SA 3EDXB 3KQCA 5J4QA 3ZZDA 1HAGE 1FNIA 2ZDMA 1S0QA 4FU8A 1G36A 1W7XH 2H9EH 4Q7XA 4X2YA 1C5PA 4DY7B 4B2AA 1F5RA 3KF2A 2ZHFH 4OS7A 1RIWC 3GISB 3LGUA 3GCOA 3PO1C 5EQQA 2Z6BD 1SLUB 4U32A 3ELAH 3FZZA 1HRTH 1MU8B 1Z7KA 3TGIE 2BZ6H 1DUEA 3KQBA 4KELA 1VITF 4J2YB 2FLRH 3M3SA 5DPAA 3RU4T 2CV3A 3UFAA 2JKHA 1O3EA 1RRKA 4B74A 1BQYA 2FI3E 1ZR0A 2ZDNA 1SLVB 1SFIA 1K28D 1ZHPA 1LQDB 4IS5A 4LXBH 3H7OA 1DANH 2GCHF 1GHVH 1T4UH 1NC6A 2G52A 3AW0A 4X6MA 1P2OA 4VGCB 3SU0A 1J14A 1K9OE 4NGAH 1MKXK 2FYQA 3TGKE 3S7KB 4AN7A 1AY6H 2ZC9H 1BMLA 2VH6A 4K1SA 4FUCA 2A7HA 2GV7A 1E0FD 4A1XA 4I8KA 3QZQA 4OGXA 4NIXA 1O3IA 4ZROA 1UTKA 1WV7H 3ZZCA 4LZ4B 1CT2E 4XE4A 1XUGA 1LVBA 2JETC 1CA0C 1GHBG 2P3FH 1RTFB 2OC1A 1C2LA 2FYRA 1LHEH 2GKVE 2HNTF 3O8CA 1C2EA 4NIWA 1JMOH 1YGCH 1ZJKA 2Z3DA 3P8FA 2ZU3A 1T8MA 1UVPA 1JWTA 3PLPA 1C4Y2 1O5FH 1O3BA 2ANYA 1UTJA 2Q6GA 2WYJA 1DPOA 2QGRA 2ANWA 1QA7A 4SGAE 2ZG0H 1SGNE 2TGTA 1MTNC 4KTSA 1Z6EA 1LHGH 3O8DA 1EAUA 2BOKA 3DD2H 1GJ7B 1YM0A 4UEHH 1O2PA 3SU2A 3PYHA 1P06A 3MNSA 1A3BH 3V3MA 3BV9B 1Y3VA 2QA9E 1L4DA 1SSXA 1C4V2 1XUJA 1V2MT 3ZZ9A 6GCHG 2AH4X 2ZKSA 3RC6A 4NSVA 2BQ7B 4GHTA 1TNJA 2A0QB 2OXSA 1KXAA 3E1XB 1W0ZU 3PMAB 5C3NA 2PTNA 1SR5C 1AU8A 1W11U 1NU7B 4UFFH 5HMAA 1EPTA 1G30B 2PGBB 2ZHQH 4FUGA 1TRYA 4WVPE 3T29A 1QRZA 1C5QA 2WUBA 1S81A 1UHBA 1QCPA 4DGJA 2ESTE 4YOGA 3F9EA 1XVMA 1Y3YA 5AFZH 3UPEA 5GCHG 1DITH 1GHYH 3D62A 1F7ZA 1GVLA 1XVOA 1EZUC 1V2OT 1FV9A 1C1MA 1GCTB 2G00A 1O3LA 1TGTA 4GPGA 1MBQA 2VWLA 1TNKA 2C4FH 2PKAA 1P05A 1L2EA 1OWHA 3LPRA 1TABE 1LPKB 1YKTA 2STAE 5EODA 1E35B 4Q7ZA 2STBE 3LT3A 3UR9A 1AB9B 1V2ST 3FP6E 4YT7H 2GZ9A 1SGRE 1HIAA 2ZFPH 4KTUA 1GBKA 2GDDA 5TCCA 1FMGA 3GYMA 3NPSA 2J94A 2GX4A 2FEQH 3PMBB 2FOMB 2Z9KA 5GPIB 2A2XH 2VNTA 3RXAA 2W3KA 3AASA 1NFXA 3U98H 1KXDA 5FPYA 1PYTC 1CO7E 3A8CA 1P2QA 2C3SA 3EAJA 4IN2A 5T6GA 2ZP0H 1GVZA 1Y59T 4NG9H 4HI3A 4HZHA 1BTUA 1HJ8A 4A92A 3RXIA 1ZJDA 1ETRH 1P9UA 1HXFH 1W12U 3HK3B 5E2PA 5FPTA 4NWKA 2XRCA 1P11E 4BAKB 1PPFE 4O3UA 4LK4A 3PLKA 3UWJH 1W2KH 2VIPA 2W7SA 1GHBF 1O38A 3SUGA 2BY8X 3TNTA 2UUYA 4K8YA 3TJUA 1YPHE 1O32A 2H6MA 1H9LB 1A4WH 3BIUH 1CT0E 1EJMA 2FS8A 2G5VA 2R2MB 3LKWA 3A7ZA 2EEKA 3BTQE 3SU6A 1GJ4H 1TPPA 5AFYH 2BLQA 4DURA 1NS3A 5LPEA 2ZGXH 4D7FA 1RGQA 1CSOE 1O2NA 3G01A 1OOKB 4FUJA 5DP3A 5J4SA 1C5SA 4BTTB 2B7DH 2BY7X 2R0LA 5JBCS 2IJOB 1LQEA 1IQNA 1O31A 4MLFB 1OSSA 3GY8A 2FOFA 1F92A 3RMOH 4CHAB 2VWMA 1JOUB 2R2WU 3C1KA 1ZSJA 1V2UT 3MO9A 1SLXB 4IMZA 1S6FA 1O2WA 1PQ7A 1LKAA 1THPB 4K8BA 2XWAA 3A85A 1GBBA 5A8XA 1HJAC 3A80A 3E90B 3E0NB 4H4FA 4CR5A 1W7GH 3TJVA 2A7CA 4DCDA 1O3FA 1QRXA 1RFNA 3LU9B 1L1JA 2BVSH 1V2VT 2K1QA 4FUFA 1C5WB 1G3EA 5DG6A 1BZXE 4Z0KA 4JCNA 1TGSZ 1EJAA 1B0EA 1K1PA 1MU6B 4IN1A 1C5TA 4JYVH 3RP2A 1O2VA 2I6QA 4Y7BA 1P3CA 1XUKA 3CS0A 3QTVH 1SGYE 2WPMS 1UVTH 1O36A 1TX6A 1OWIA 2DE9A 2AMQA 3ZZ3A 2YNBA 2ANMH 3M61U 1S84A 5EQRA 2VIQA 2OD3B 1GGDB 1T32A 4CRCA 4DIIH 2WPIS 4I8GA 3U8TH 5LPRA 2BYAX 4MNWA 2XCNA 5HXFA 1K1MA 1P03A 1AHTH 1O2TA 3P8OA 3E16B 3I78A 1KYNA 3SV7A 1IQJA 1MTWA 2QXHA 3NZIA 1VJ9U 3V7TA 1GHAG 1YF4A 4TPYA 3TNSA 3CS7A 2XC0A 4A7IB 4OGYA 3F6UH 1TNLA 5DP6A 2BHGA 1S82A 5EXNA 3OY5U 1NRNH 1P9SA 3EGKH 2R3YA 1NPMA 3SUFA 1A7SA 3DA9B 3UNQA 2Y80A 4UFGH 1FDPA 1HAIH 1FJSA 4TWYA 4R0IA 3TGJE 1NT1A 3LGYA 3UIRA 1GI9B 3DT0H 4I33A 1BBRK 1H8DH 1BUIA 2BLOA 1RS0A 3URCA 4Y71A 1TBZH 4IC5A 2WV4A 1EOLA 4MVNA 3WY8A 2ZGHA 3RXEA 1GG6C 3MTYA 1TPOA 3ZZBA 3SHCH 3ZYEA 1CBWB 3ZVBA 1HUTH 5CMXH 3L33A 2B8OH 5EW2H 2VU8E 1WQSA 1P8VC 1EOJA 1NFUA 3HKJB 4D9QA 3VB6A 2P8OC 3HATH 4MTBA 4XBCA 4RKJB 1G3DA 1ANDA 1A0LA 4K1TA 3GY7A 1OXGA 2WYGA 4Y0YE 2VH0A 1THRH 3CP7A 1EAXA 3AVZA 1TFXA 3OY6U 2EI7A 2F91A 1LO6A 4TPIZ 1QURH 4YT6H 2Z9LA 1O3OA 2VWNA 2AIQA 2THFB 1F5LA 4X8SH 1UTOA 3LDXH 1Z8IB 4JMYA 1GL0E 2EI8A 1OWEA 2ZA5A 1O2KA 3QGNB 1C9TA 3PMHB 1TMTH 3EE0B 3MNXA 1ZPCA 1AE8H 1J8AA 4DOQA 3Q3YA 2BMGB 3ZVCA 2PSXA 1EJNA 1AO5A 1UTPA 2SGEE 1ETSH 1TRNA 3Q00A 2G55A 1ELFA 3K6YA 1GBLA 1RIWB 2VWOA 1LKBA 1TB6H 1O2ZA 1RD3B 1WYKA 3PO1B 5GDSH 1B5GH 1C1QA 5FBEA 1HAXB 3NKKA 1ELBA 3RXBA 4CBOA 2C8WB 1DT2A 1C4U2 1GI2A 3ZZ5A 4CRGA 5L6NH 1S6HA 3KCGH 2G51A 3MU1A 1PPEE 3PLBA 2DE8A 2ZU2A 2XC5A 5L30H 2AEIH 1OYQA 1RTLA 5C20A 1TQ0B 4TWWA 2HPQH 4I8LA 1GMDF 1O3PB 1QBOA 3O8BA 2VGCC 1T31A 2GD4B 2UUJB 3A7YA