1YC0A

Short form hgfa with first kunitz domain from hai-1
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
Knots found
sequence length
254
structure length
247
Chain Sequence
ACGRRHKKIIGGSSSLPGSHPWLAAIYIGDSFCAGSLVHTCWVVSAAHCFSHSPPRDSVSVVLGQHFFNRTTDVTQTFGIEKYIPYTLYSVFNPSDHDLVLIRLKKKGDRCATRSQFVQPICLPEPGSTFPAGHKCQIAGWGHLDENVSGYSSSLREALVPLVADHKCSSPEVYGADISPNMLCAGYFDCKSDACQGDSGGPLACEKNGVAYLYGIISWGDGCGRLHKPGVYTRVANYVDWINDRIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hepatocyte growth factor activator
publication title Conformational lability in serine protease active sites: structures of hepatocyte growth factor activator (HGFA) alone and with the inhibitory domain from HGFA inhibitor-1B.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/inhibitor
total genus 63
structure length 247
sequence length 254
other databases KnotProt 2.0: Artifct K -52 -31
ec nomenclature ec 3.4.21.-:
pdb deposition date 2004-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1yc0A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1yc0A01
1SMFE 1UMAH 2CF9H 3T2NA 3QX5H 4FUFA 3DFLA 1ZPBA 3A7XA 2HPQH 4NIWA 1IOEA 1C5TA 2C3SA 2ZI2H 4NWKA 4A7IB 4ZH8A 1TONA 2CMYA 3P17H 1DM4B 4ABDA 3I29A 1IQHA 2HLCA 3BTWE 3TU7H 1TPSA 2ODPA 1TX8A 4A1VA 2H6MA 8KME2 2GV6A 4TY6A 1LO6A 3Q3XA 1EZSC 1JIRA 2DE9A 2QIQA 2PSXA 1AFEH 2VIPA 3A87A 1HAHH 3TNSA 4I7YH 3Q77A 3QN7A 3SV6A 3DFJA 3LGIA 3TJUA 1MTUA 1CGIE 2JH0D 2GMTC 1UTLM 1NM6A 2BD7A 2F9BH 1TAWA 1C5NH 2NU2E 1YYY1 2TGPZ 1MUEB 5BRRE 1NFYA 1W11U 4I8LA 5JPMH 3MOCA 4BAOB 1D3DB 1Q3XA 4BOHA 2J95A 2BD4A 3PB1E 5FHTA 2AYWA 2BQWB 1KY9A 5I25A 1G30B 3F6UH 3IWMA 3FFGA 2ZDKA 1YCPM 2WUBA 2ZPQA 1YPHC 4OS2A 1P57B 3RXTA 3RXMA 4SGBE 5DPAA 2H9HA 2BY7X 3UR9A 1ZHMA 5IDKA 5E8EH 4I31A 3RXAA 1EB2A 4X8UH 1ETSH 3BG4B 5LH8A 1QL9A 1KSNA 2CN0H 5DGJA 1BMMH 3BTHE 2A5AA 3PTNA 2CV3A 1KXAA 1QQUA 1HAVB 5CMXH 1GGDC 1V2OT 3SUFA 1YLCA 1EXFA 3P6ZB 4ISHH 2BY9X 1A2CH 3C27B 2J2UA 1G3BA 2SGAA 1XXDA 4YO9A 4ABIA 1AGJA 2AGEX 1H9IE 1B7XB 2O8TA 4NGAH 2C90B 1OOKB 3PM3A 2R2WU 1O35A 3A7YA 4NZQA 2ZCHP 2G8TA 2QXGA 1CSOE 2FMJA 2GVFA 2OQUA 3VB4A 1Q31A 3LOXA 1C5WB 2BD9A 4OS6A 1C1OA 1G3CA 4F49A 4IN1A 1K28D 2OC1A 3TH2H 3KF2A 5A8YA 1GJBB 4GUXA 4X0WU 3TGKE 3R0FA 1HIAA 1C5UA 1O5FH 2P8OB 1VITH 2STAE 3LONA 3O8DA 1A0JA 6CHAB 3NWUA 5FPYA 1S85A 4A92A 2GZ8A 1UTKA 3SJ9A 4E06H 3RXPA 1V2ST 2OBQA 1FMGA 1WSSH 5F8TA 4AFSA 2BDHA 1SGRE 2FOMB 4B73A 2BVRH 1A3BH 1D3PB 2GZ7A 4LOYH 2UUKB 2XBVA 1HAVA 1RS0A 4MVNA 4B74A 2YNBA 2BX4A 1Y3YA 4AB8A 5JBAS 1O39A 1K1OA 1QL8A 1YPMH 3A88A 1Y3WA 5EODA 3TH3H 1BDAA 4AB9A 3V13A 2WPMS 4E7RG 2EEKA 1CA0B 4YOIA 3PMAB 2M5TA 2CHAB 2OC7A 3GCOA 4OGXA 1O30A 5T6GA 1YGCH 2ZCKP 1EB1H 2H9EH 2P3UB 1XXFA 1GJ6A 2QF0A 1OWDA 3UY9A 1ZGIA 4IBLH 1WYKA 3RXRA 3ZZ7A 1UTOA 1LQDB 1FI8A 2DE8A 1JMOH 1Y3XA 2Z3DA 2A4GA 2AIPA 2PFEA 3PLPA 1UVUH 3FP6E 2FOFA 1TPPA 1XUFA 3S9CA 1Y5BT 2Z9LA 3ATLA 1C4U2 1TNIA 3SJ8A 1QRWA 1HAYB 1EX3A 1Z8JB 1GI6A 3E0NB 4JK6A 2ANMH 3RXOA 1XUGA 1ESTA 2B5TB 3HGNA 1AFQC 4MNYA 4YT6H 2XWBI 2ZHWH 3RXVA 3MFJA 1DVAH 1E38B 1KXCA 4U30A 1DICA 4X8SH 3M5MA 3VB3A 4CRBA 1BT7A 1ELTA 3M5NA 3S69A 5GIBA 1O3EA 2BD2A 1BTZA 2R2MB 1BMAA 4NZLA 3UNSA 1RTKA 3H7OA 2VB0A 1VITF 2G55A 5CHAC 1H9LB 3SUDA 2ZFQH 1DWCH 2ZO3H 1CVWH 1AZZA 1UJ1A 5FCKA 1Z71A 4MLFB 4BAMB 4K5ZA 4A1XA 4TPYA 1BZXE 1GI4A 3ATIA 4ABGA 3IG6B 1TMTH 4MPVA 1N8OB 1S6HA 1XX9A 2ZDVH 3D65E 5FX5A 1V2TT 1DFPA 4TY7A 3UR6A 3B8JA 1Z8IB 3ELAH 1VITG 1BMLA 1AMHA 3RXQA 1VCQA 1P0SH 3RUOA 3R3GB 2A2QH 1QJ7B 1A46H 3VXEH 5AHGH 1THPB 4QT8C 1EP5A 2FDAA 4Q7XA 1GMDF 3ATWA 1O32A 2QA9E 1ABJH 3MO6A 1HB0B 4MDSA 1J15A 2ZFRH 1ELEE 4YOJA 2PKSC 2TRMA 1KIGH 3MWIU 2G5NA 4LK4A 4DVAU 3S9BA 4PROA 4CRDA 2ZTYA 4UDWH 1UVTH 1GMDG 2PGQB 3F1SB 1SQTA 4FUJA 1GMCF 5GJ4B 3MH7A 2BZ6H 1C5MD 1FLEE 4Q2KA 1GI9B 1JBUH 1NY22 2A45B 1SOTA 1SQAA 5EOKA 5DP6A 3BIUH 2GCTC 4NIXA 1OX1A 1C5VA 3OY5U 4INKA 1K1PA 2ZF0H 2FOHA 4HGCA 2I6QA 4E7NA 2SNWA 2Y81A 4GCHF 1G3DA 3T5FH 2RCEA 1ESBA 1QRXA 1XVOA 3PROA 1Z1IA 1DE7H 2VGCC 1LHGH 3T62A 1FAXA 1RFNA 5DJ7A 3LJJA 1OYQA 1T8LA 1TE0A 4JYUH 1NFXA 1FY3A 2EI7A 2XTTB 5AFYH 1HV7A 4X6MA 2QXHA 3HK6B 3CENA 1TA2A 2ULLA 2ZDMA 1GBHA 1V2UT 2VWLA 3TLOA 3URCA 1P12E 1JRSA 5JYIA 1K2I1 1SR5C 2LPRA 1Y59T 1FAKH 1OYTH 3FVFB 2JETB 3E8LA 1TA6A 2CGAA 4CREA 3OYPA 1XUKA 3OY6U 4GHTA 2A5KA 1QCPA 2ZWLH 1QIXB 2K1QA 1X7AC 1SC8U 3KQCA 4UFEH 3RM2H 1O3LA 5ESTE 1NU9A 3FANA 1YPLH 2G4TA 5L2ZH 1O38A 3DUXH 3SNDA 3RXLA 3ZVEA 5E2PA 4IMZA 1F5LA 1Y8TA 4NCYA 1ZSJA 3SU0A 1P03A 2AEIH 3PO1B 1MZAA 3KGPA 1DSTA 1OWHA 3E16B 3SU3A 1C5PA 3GYMA 1D9IA 1QQ4A 1Y5UT 5EPNA 1IQNA 1LCYA 4D7GA 1FIZA 1BTXA 1MKXH 2ZC9H 2PTNA 1N6YA 1SGEE 2PKAA 2WV4A 3ZYDA 2HVXA 1YPJH 4ZROA 1O37A 1V2LT 2DUCA 3MNXA 1CBWC 1HCGA 2BY8X 2VU8E 3KNXA 1DPOA 2FX6A 3GDVA 3F68H 4FUIA 1YPKH 2FPZA 1GVLA 4GLYA 3A7TA 1VR1H 1F0TA 4IN2A 2FP7B 8GCHF 4CR5A 4RSPA 2I6SA 4ZUHA 3SI3H 5LPRA 1GJDB 1PPZA 4O97A 2F83A 2A7JA 1O5GH 1GBMA 1O3BA 2A2XH 4O03A 3UFAA 1JRTA 2P59A 1EZQA 4WMEA 8GCHG 4HTCH 4YM9A 2PW8H 5E0JA 2ZU4A 3MU4A 3ZV9A 3T29A 1TB6H 1SHYA 4WWYA 4JYTA 4H6SB 3M7TA 1Z6EA 1GVZA 1K21H 2V0BA 2Z9IA 1FY8E 1C5RA 2VH6A 5J4SA 1AB9B 1P9UA 1GJ8B 1PYTD 2FOCA 3DD2H 3TITA 1G3EA 2VVCA 4KTCA 1QBVH 2OP9A 1O5DH 4B1TA 1G32B 2HWLB 2A0QB 2NU1E 2QC2A 1TBZH 4BTTB 3M7QA 1UCYH 3GDSA 5TCAA 2ZHFH 3SORA 3BSQA 2BVSH 1YBWA 3GISB 1V2QT 4NSYA 3GDUA 3RMNH 1FY5A 1JXPA 1NRRH 1S83A 2VNTA 1TMUH 3SNEA 3BG4C 4B2AA 3ZZ8A 2W26A 1SGIB 1O3IA 3A86A 2XBWA 1V2JT 1GDQA 2V3HH 2ODQA 3U69H 4WMFA 3U8TH 4A1TA 1BTYA 3U9AH 5GCHF 1QRZA 1IQFA 1DSUA 1GI5A 5GXPA 5EXLA 1AQ7A 1TMBH 1NRQH 3PTBA 4X1RU 1AY6H 1SQOA 2V6NA 1LPGB 1TOMH 2ZA5A 3RU4T 1O34A 1MD8A 1TRYA 4D76A 1MTNB 1P06A 5A2MH 2HGTH 1GBCA 3SUGA 2OINA 3T27A 4J2YB 3UUZA 1JWTA 5DG6A 2G00A 5GCHG 1C5OH 1GCDA 2J9NA 4Y0YE 1TALA 1P2NA 3QZRA 1NC6A 3ZZ3A 5E0HA 2ZHDA 1UVPA 1A4WH 1TLDA 5L6NH 2VIOA 1BTWA 2BVXH 3RC4A 3O8RA 1GPZA 6CHAC 1AVGH 1FV9A 1O3JA 2H1UA 2NWNA 1IAUA 2VH0A 1O2KA 1RD3B 1W7GH 4JZDH 2QGRA 3SN8A 2OC8A 2O8LA 3A7ZA 1N1LA 1IHTH 2ZGBH 4JK5A 1DOJA 1RXPA 1C1UH 4YESB 1V2KT 4MPXA 1DXPA 4A5TS 1C1VH 2O8MA 2ZU2A 1GI0A 3SI4H 1BTPA 1HXFH 3GYLB 5C3NA 3LDXH 2C93B 3MU1A 5LPEA 1CA0C 1ESAA 2CHAC 5T6FA 1D6RA 1GHVH 2ANWA 1EPTB 3Q00A 1SGCA 4K1EA 2OUAA 2Z7FE 4TPIZ 1WTGH 3RXIA 4GHQA 1QNJA 2PR3A 2JH5D 1FN8A 2VWOA 2QY0B 4RN6A 2XW9A 3GCTF 1C1PA 4U32A 3P70B 3A7VA 4JZEH 1GCTC 2ZKSA 1KTTB 4ABJA 1FPHH 2OLGA 2BD5A 2BZAA 1LHCH 3SNCA 4D7FA 4NWLA 1AU8A 3U8OH 3P95A 1BRAA 1K1LA 3GCTG 1NESE 2FTLE 2J38A 2TGDA 1UHBA 3M3TA 4YLUA 1H9HE 2YNAA 4X2XA 5JBCS 3V7TA 3UWJH 1KXFA 1ZRBA 3RMLH 1NS3A 4BXSA 1GL0E 1O2TA 4WVPE 2Z94A 2STBE 2GCHF 1SOZA 5C20A 1SGPE 1YCPK 1P2OA 1AKSA 4DJZB 1TIOA 5C67A 5HMAA 3SBKA 1AUJA 2BDGA 5B6OA 7ESTE 1EJAA 5GWZA 4ZKOU 3ZVCA 3W94A 3GY6A 4Y6DA 2HNTF 1L4ZA 1MKWH 1QB6A 3BIVH 4DY7B 1QR3E 2GCHG 3ZZ6A 4K1TA 1P2KA 1O2YA 3SJOA 3E6PH 1XKBC 2GZ9A 1G2LA 1GJAB 4O3TA 1C2JA 5C5OA 2ZU5A 4JMYA 2BLQA 1SGTA 3TJNA 1QGFA 1IQEA 1TNJA 4ISOA 5C1XA 1TGSZ 1QJ1B 3L3TA 1S84A 1N8OC 1TX7A 4B71A 2BHGA 1SB1H 2ZPSA 3SV9A 2B8OH 1LHEH 4WH8A 2QV1A 5DO4H 1W13U 2WUCA 4X1NU 1Z7KA 3EE0B 1OP2A 1C5ZB 4D9RA 1H8IH 1P2IA 1V2WT 3PMBB 3K65B 4UFFH 1TX6A 5A8XA 2BLWA 1GJ7B 5EXNA 3VPKA 1O5CB 1TRNA 2ZIQH 3DA9B 4ASHA 1UK4A 1AHTH 1AE8H 2SGFE 1NTPA 3FZZA 1TBRH 2QXJA 3A82A 7LPRA 1O33A 1AD8H 1D6WA 3ZZDA 4JZ1A 4UE7H 3RC5A 5DP3A 1K22H 4F4OC 1SLVB 4FUGA 4X1QU 2FS9A 3QTOH 4CHAB 1EP6A 1FJSA 3C1KA 1T4VH 3ATKA 2Q1JA 1AWFH 1H8DH 4NG9H 3P8NA 4DOQA 1UCYE 1E37B 4R0IA 1SL3A 3RDZA 2VIVA 1FDPA 4U2WA 4X6PA 3UPEA 1L1JA 3M3VA 5DK1A 1PQAA 4IC6A 5GDSH 3LU9B 1T32A 3RXBA 1S0QA 3SV7A 1C2HA 4ZXXH 2THFB 5C5NA 1YLDA 2HALA 1Q2WA 1C5XB 5BPEA 3SU1A 3UNQA 1NO9H 1W8BH 2HRVA 4U01A 2VIQA 4NA7A 4X8VH 1LPKB 1D4PB 1O2GH 5F8XA 3GY5A 4ZHLU 4BXWA 1C4Y2 3HPTB 1S6FA 4XE4A 4Y76A 4X1PU 4YLQH 2QCYA 1DWBH 1FN6A 2AGIX 1DS2E 3ZVAA 1TQ0B 2FI3E 2PGBB 1ZRKA 1FUJA 3E3TA 1ELVA 4FUCA 3SO3A 1O2OA 1GHYH 3GOVB 2HNTE 4K69A 1F0SA 4K2YA 1EZUC 3NCLA 1J17T 1O2MA 1TABE 1EASA 2ASUB 1CA8B 1BRBE 2JETC 2UUJB 3SU5A 4AGJA 4XOJA 1ZMJA 2OXSA 1ZSLA 2PLXA 1P01A 1W12U 5EXMA 2W5EA 3LH1A 1W0YH 3M5OA 1IQKA 1MU8B 3N7OA 4JZIA 1YPEH 1TBQH 2ZQ1A 1PQ5A 3CS7A 1O3CA 1O3NA 1P9SA 2BX3A 4MG3A 1ETTH 2ZZUH 1EAUA 2GP9B 3UREA 5EQSA 2FYRA 2A31A 1WOFA 1GVKB 4VGCC 4ABAA 2FS8A 1AE5A 4B2CA 1KYNA 2FZZA 2GMTB 3AW0A 2UWLA 3K6YA 1ETRH 4XDEA 1AUTC 1SHHB 1HAIH 1ACBE 1C1QA 1ZSKA 3TPIZ 3KCGH 1B0FA 7KMEH 2FWWA 2ZFPH 3MO3A 2V35A 3OSYA 3ZZ9A 3PO1C 1CGHA 1AI8H 1KXDA 4LZ4B 2FM2A 1HGTH 5EPYA 5F6MA 1BOQA 3GY7A 4CRGA 1LMWB 2FI4E 1GJ5H 1MBMA 1BA8B 1DWEH 1NFUA 5LPFA 2FOAA 3BEIB 2ZDAH 1O2PA 5EG4A 3T26A 3L6PA 1P2JA 3RLYH 1NROH 4NA9H 1YM0A 5HGGA 1OP0A 1MU6B 1AVWA 4OS5A 2AFQB 2ZU1A 2IN2A 1BBRH 1TFXA 2Z3CA 1GGDB 4Y8XA 3S0NA 3QGJA 3UTUH 3VEQB 1PQ7A 2GV7A 3KEEA 3MU8A 1AWHB 4NFFA 2PV9B 4ABFA 4MQAA 4DIHH 1EJNA 2SFAA 3EGKH 3ODDA 1TNHA 2ZPRA 2XBXA 2PWXA 1O2UA 4DW2U 3ZZCA 1V6DA 2ANKH 5A8ZA 5EGMA 3BTME 3RXUA 3VGCB 1Z8GA 2BDAA 1OP8A 3MH6A 2HOBA 3U8RH 1C1WH 1K9OE 4A6LA 2GTBA 2CXVA 3CS0A 1O2LA 1RJXB 5J4QA 3OX7U 3RXGA 1LDTT 3K9XB 3M3SA 1HXEH 3PYHA 4JYVH 1NRSH 1O3HA 2J94A 1JIMA 4DCDA 1ZJKA 1HAPH 1O31A 2VVUA 3ATMA 2A4QA 2FOBA 3RLWH 5C1UA 2BMGB 3AVZA 3BF6H 3SJKA 3EYDA 5AFZH 5JBBS 5I46H 4B2BA 2XXLA 2Q6GA 2VVVA 1ZZZA 2GGVB 4I33A 4I8GA 1P3EA 4UFDH 4OS4A 3S7KB 1TYNA 2BXUH 1U6QA 1T8OA 3T25A 1WBGB 4GPGA 1DY9A 3E90B 1FPCH 3ESTA 2ESTE 1GBJA 2TPIZ 3MH5A 1ELAA 5EQQA 1MTNC 1UTNA 1WUNH 2G52A 4K8BA 7GCHF 3SV2H 3VB7A 1LVOA 1EQ9A 1SFQB 1ELFA 2VWNA 3GY8A 4XFQA 1PYTC 3ZVFA 3FP7E 4YOGA 4RKJB 4FUHA 4ZKSU 1L4DA 2BM2A 1FONA 1HUTH 3QLPH 3LPRA 2TGAA 2FLBH 3QZQA 1YPHE 2XCFA 3SHCH 2BD8A 7GCHG 1XUIA 2QF3A 2ZFTA 1TGNA 2WPKS 3GCHB 3KQBA 3QK1A 5FPSA 1C9TA 1BHXB 3SNAA 4IW4E 2ZP0H 2AIQA 3FZDA 3MNCA 3TK5A 3RU4E 1GDNA 4B75A 3V12A 4DT7B 3ZVGA 1ZTJA 1IQIA 3RMMH 1G9IE 1RTLA 2SGDE 1KXEA 1BJVA 1TQ7B 2VJ1A 2NU0E 1A5HA 1C5LH 1O2VA 3QUMP 4INLA 3P8FA 4H42U 4HI3A 1OWKA 1C2IA 1RGQA 4DG4A 1BHXF 1ZPCA 1DITH 1F92A 1F5RA 1ELCA 3KQEA 4FVBA 2UWOA 4Q80A 5CHAB 2BXTH 2PHBA 1SVPA 1YPGH 1DANH 1TNGA 4AFQA 3T28A 1GHBF 4OGYA 3AAVA 4OS1A 4BAKB 1J8AA 2F9PA 1KXBA 2F91A 2QXIA 5JDUB 4BANB 5FPTA 4IGDA 1L1NA 5LGOA 1KTSB 3IITA 1DUAA 1L0ZA 1LKBA 3KHVA 1Y5AT 3PMHB 4UFGH 1O3KA 2AERH 3MHWU 3A83A 3A80A 1E35B 1LQEA 3A8AA 3HATH 1EATA 2UWPA 2BTCE 4O3UA 4WMDA 4XBBA 1BTHH 1GHBG 1WCZA 2H9TH 1C5SA 1ZMLA 1YP9A 3ITIA 4ABHA 2W3IA 1PPFE 5H4IB 4ABBA 2BY6X 1VGCB 4AN7A 2A1DB 1MKXK 4Y7AA 3MNSA 1DXWA 1K1MA 2BYAX 2ZTZA 4D9QA 4AG2A 3LH3A 1LKAA 4XBCA 2D26C 3UQOA 4Q7ZA 3RC6A 1F7ZA 2G51A 2LNCA 3SU4A 9ESTA 2Z9GA 1C2DA 2GT8A 3VB6A 4Y11E 1K1NA 4WXVA 2R9PA 1S82A 1Z1JA 1ZOMA 2GCTB 3UIRA 1NFWA 1T8NA 3TIUA 4ZHMU 2BDIA 2C8WB 4M7GA 3U1IB 3SW2B 1MTWA 5DP8A 3MU0A 1ELDE 1SGNE 1TGBA 2V3OH 2GKVE 1SLWB 4YTAA 1KLJH 3RXKA 3UNRA 3KIDU 3LT3A 1MQ5A 1C1NA 1F2SE 2BD3A 1LVYA 2H5DA 3TJOA 8ESTE 2O8UA 2VINA 2OCVB 4YZUA 1BCUH 1V3XA 2VGCB 3SQHE 3GY2A 1GJCB 1UTJA 2WPIS 1S5SA 4K8YA 1ZJDA 1ZTLA 5PTPA 1SGFG 3SU6A 1TNLA 2ZFSA 3ZZBA 1UVOA 3RMOH 1UTQA 1TPOA 2A32A 4Y7BA 2AMDA 1FXYA 1GBAA 4X2WA 2VWMA 2BDCA 1BJUA 1UTMA 1RRKA 4MPUA 3ODFA 3Q3YA 1GBDA 3QGNB 2FI5E 1NPMA 5T6DA 3ZVDA 4GSOA 4AYVB 4WXIA 1O3OA 1O3PB 1DWDH 1UCYK 1GG6B 1J14A 2FO9A 4GVUA 2P8OC 4X2YA 1EAIA 1XUHA 1S0RA 2FESH 1VJ9U 4CHAC 1UTPA 4FU8A 1O2RA 3MMGA 1V2MT 4CRCA 3ZVBA 2SGEE 2KAIB 4MPWA 1QY6A 3P8GA 3A7WA 1T31A 3M37A 4ZAEA 5L30H 5DP7A 3TVJB 2EI6A 1AO5A 1CT0E 3ZV8A 1O3FA 4LXBH 5K7RA 1QURH 1A5GH 1C1TA 5E2OA 5EW1H 3E91A 1XUJA 1GHAF 1PQ8A 1W7XH 2BOKA 1HYLA 1T7CA 1HRTH 5A0CA 1IQMA 4R8TB 1HAXB 4BTIB 3EA8A 3UOPA 1M9UA 5A09A 1GHXH 1CT2E 2JH6D 5FXLA 1HNEE 2A7CA 4KKDA 2C8ZB 4NIYA 4D8NA 4ISIH 4IS5A 3BV9B 1SGYE 1GHAG 1BIOA 1SFIA 5FBEA 3WY8A 1TGTA 3UWIA 1ZLRA 2P95A 2ZGHA 1BTUA 4Y0ZE 3SHAH 3PWBA 1LTOA 1KLTA 2XC5A 3KN2A 2WYGA 5FBIA 1UVSH 3URDA 1XM1A 2VIWA 1P10A 2IPHA 2Y5GA 1ZHRA 1ARCA 4X2VA 4BTUB 1LHFH 4FUEA 2KAIA 1V2NT 3F9FA 4CBOA 4JCNA 2J34A 2EI8A 1DLKB 1J16A 2FOGA 6GCHF 2P94A 1K1IA 1GBLA 3RXCA 1FIWA 2ODYB 1MCVA 3TJVA 3V0XA 2WV5A 2XCNA 3RXJA 2D1JA 1MMJN 2ZGJA 1EOLA 1EUFA 1OWIA 2BDYA 4X6NA 1H1BA 1QA0A 1O3MA 1O2JA 2Y7XA 1W0ZU 3B23B 6GCHG 3U98H 3HK3B 1ELGA 5ABWA 1EPTA 1PPEE 2B0FA 3TK6A 3W95A 5C1YA 1AVXA 3NK8A 4OS7A 1E36B 1B0EA 5JBTA 3ZYEA 3K2UA 2WPLS 1GBIA 5HXFA 2F9NA 1QL7A 3DT0H 3HKJB 1C5QA 1BRUP 1ARBA 2VIDA 2Y82A 4CBNA 1GMHF 1HIAB 1RIWB 1TOCB 3AAUA 2TGTA 4Y10E 4AORA 4IC5A 1C9PA 4H6TA 1L2EA 5AF9H 4UONA 1ANCA 2Y5FA 3GY3A 4MNVA 4B76A 3BEFB 5T3HA 5JB9S 2Z9JA 1MAYA 1QBOA 3QO6A 4KTUA 1GMHG 2GT7A 3ZZAA 9LPRA 1C5YB 3HGPA 1W14U 1FY1A 1HLTH 3A84A 2NU3E 1W3CA 1GHWH 1O2WA 1O5EH 1E0FD 2FIRH 2RA3A 4ZHAA 3H5CB 2B7DH 1BMNH 2GDEH 3I78A 3D49H 4AG1A 4UEHH 1O2HA 2BOHB 2ZEBA 3SNBA 2TIOA 2XC4A 4I8HA 2A7HA 1MKWK 4FVDA 3BTQE 1O2XA 1THSH 3CP7A 1G37A 2ZHQH 1CGJE 3P92A 1GI3A 3EQ0H 3F9HA 4I8KA 1HJAB 1SG8B 2R3UA 1SGDE 4NIVA 2Y6TA 3M61U 1LVMA 1NZQH 2OD3B 3BEUA 1XVMA 3LGUA 3TH4H 1EJMA 3VGCC 1CE5A 1HJ8A 1OXGA 2Q6DA 3ZZ4A 1NU7B 1D3QB 1GI1A 1OWJA 2OQ5A 3BTTE 1NN6A 2SGPE 3BG8A 2AMPA 3STIA 3A81A 1F0RA 3F9GA 2Q6FA 1XMNB 1GJ9B 2ZCLP 1VCPA 2WPHS 3LGTA 1ABIH 4Y8YA 3STJA 3SZNA 4Y8ZA 1BITA 1HAZB 3MYWA 3TGIE 3LKWA 2W7SA 2GD4B 4E05H 4WY3A 5K0HA 3BTGE 2AGGX 4DURA 1DLEA 1BQYA 3RU4D 1B5GH 2P16A 1MCTA 4CRAA 2P93A 5ESBA 3PLKA 3ENSB 2FOEA 1PPCE 1OSSA 1QB1A 1LVBA 1EZXC 3EA7A 1BB0B 4CR9A 3E0PB 1T8MA 3SV8A 3NUMA 1GCTB 2WPJS 1P8VC 3KQDA 3A8BA 4AOQA 1C1MA 4Y79A 5F8ZA 4FXGH 3MH4A 1TGCA 1DX5M 4GAWA 1G2MA 1Z8RA 2ZECA 1W2KH 2FTMA 1Y3VA 1PPBH 3LGWA 1ZTKA 4KP0A 2BQ6B 1GBKA 1IQLA 3A85A 1DDJA 2SGQE 6LPRA 3V3MA 4WJG2 1DT2A 5GPIB 1SGQE 3GCHC 1ANDA 1NRNH 1DUEA 1O2ZA 1MBQA 1RTFB 4FU7A 2D2DA 3MI4A 3UOUA 3RXFA 5EQRA 4H4FA 5HM9A 2PTCE 3JZ2B 2OBOA 4AZ2B 2AS9A 4X8TH 2WINI 4K3JA 3S7HB 3MU5A 3BTDE 1A3EH 1P2QA 1HDTH 3EAJA 1QTFA 4CH2B 1F5KU 3BTFE 1CU1A 3BTEE 1MQ6A 1IQJA 1SI5H 2NU4E 3LC3A 3M7UA 3VXFH 1MD7A 3RP2A 3NXPA 1ZGVA 3RXSA 2Y5HA 3OTJE 1O2QA 2XRCA 2ILNA 5HM2A 4AFUA 3PV4A 1IHSH 1FQ3A 2FYQA 1LHDH 4FUDA 5TJXA 1HBTH 1C4V2 1EAWA 1GHZA 3KL6A 4Q7YA 1WQSA 5A0BA 2W3KA 2ZTXA 4BAQB 4MNWA 1O2IA 1GJ4H 3LIWA 1V2VT 3UQVA 1G36A 1SSXA 1A0LA 1GBFA 3A8DA 2FEQH 2GX4A 4ZMAH 1YKTA 3ZZ5A 2QAAA 1TRMA 2QYIA 3QWCH 1GBBA 4LZ1H 5TCCA 1D3TB 1WV7H 1AB9C 3D62A 2UUFB 1VGCC 3SU2A 3QDZB 4I8JA 4NFEA 3M5LA 1GDUA 1W10U 4CRFA 1C2GA 1OS8A 3Q76A 3RXHA 3GCNA 4TWYA 3GICB 3MO9A 1ZMNA 2B9LA 1BBRK 3NZIA 5FAHA 4YT7H 2XC0A 4CH8B 1OPHB 2HPPH 1P02A 1ZHPA 1QA7A 1TWXB 1PPGE 1OKXA 3RXDA 2BY5X 1L1GA 1ZYOA 5CE1A 3LJOA 2CJIA 4Y71A 1GMCG 4KGAA 2ZG0H 2RA0A 1SPJA 1ID5H 1V2RT 4HFPB 1Y3UA 4NA8A 1H4WA 1V2PT 5IYTA 3L33A 2PUQH 1NT1A 2XYAA 3S9AA 3SUEA 1AN1E 1MTSA 1IQGA 2P3TB 1ORFA 1C2EA 1GL1A 3PMJA 5FX6A 1C2FA 3SJIA 4GCHG 1FY4A 2R0KA 3E1XB 3P8OA 3PWCA 1O2SA 2R3YA 1O5AB 1HPGA 4FUBA 4Z0KA 3SOSA 6ESTA 2PKAB 3GY4A 2A4RA 2ZDLA 1N6XA 3SGBE 4FU9A 1GG6C 3NKKA 2FODA 2G5VA 4Z6AH 2Z9KA 3D23A 2BDBA 1AFQB 3RM0H 2OTVA 2YOLA 5JB8S 5L2YH 4O9VA 1FNIA 1P05A 3FP8E 4INHA 1UO6A 2P3FH 1ZR0A 1TNKA 3MNBA 1CO7E 3U1JB 1P2MA 1WAYB 2D8WA 4MTBA 4VGCB 5SGAE 2Z6BD 1GWAA 3HKIB 1XKAC 1HFDA 1WTHD 1J9CH 2XBYA 3RXEA 2R0LA 3O8BA 1MAXA 1KLIH 3TGJE 3LGYA 1MH0A 1GBEA 2IJOB 4RKOB 1OWEA 3DHKH 1QFKH 1O0DH 2ZGCA 3K6ZA 4X1SU 1YC0A 1MZDA 2IOTA 2A4OA 2ANYA 2O9QA 2O8WA 1O2NA 1O3AA 4BNRA 1EAXA 3A8CA 1P11E 1EPTC 1O36A 3Q3KA 1THRH 2F9UA 1HJ9A 1Z6JH 2C8YB 4X6OA 1C2MA 2AH4X 2F3CE 2RDLA 1ANEA 3VFEA 2BLVA 4DIIH 1MTVA 1CQQA 2ALVA 4WF8A 2ZNKH 2EC9H 1F0UA 2ALPA 2PSYA 3G01A 1BUIA 1TPAE 1EOJA 1GI2A 1CT4E 3SGQE 5F03A 1O3GA 2AMQA 5DKMA 2GDDA 2ZDNA 1ZPZA 4K1SA 4DGJA 2HNTC 2UUYA 3SQEE 5C2ZA 5DP5A 3O8CA 1P09A 2PKSB 2BB4A 4IMQA 5EU8A 4ABEA 4ISLA 1GBTA 5AVDA 2SNVA 3MTYA 4XSKU 1O3DA 4AX9H 1C1SA 2G4UA 2WYJA 4ZKRU 2ZQ2A 1UK2A 1WU1A 3LC5A 1GI8B 1EKBB 3EDXB 5EW2H 1SLXB 4MNXA 1C2LA 1SLUB 1QB9A 2PUXB 1BRCE 2H5CA 4NSVA 1DY8A 3AW1A 1INCA 1PPHE 1A0HB 1A7SA 1P04A 4AFZA 1ANBA 2BLOA 1BBRE 2J92A 2ZFFH 1NRPH 1AIXH 1QBNA 2Y7ZA 1RIWC 1SBWA 3M36A 1GI7B 1PFXC 4ESTE 2C4FH 1KDQB 1QHRB 4XBDA 1S81A 2F9VA 3I77A 1FZZA 4KTSA 4J1YA 2ZU3A 3LGVA 5E0GA 8LPRA 4KELA 4ZXYH 3QTVH 2FXRA 3PLBA 1CHOF 2C8XB 3SGAE 1SGFA 1VCWA 4WH6A 1CHGA 5HYOA 3OU0A 2ZHEH 5ETXA 4K60A 3VB5A 5G4BA 1P3CA 1VJAU 4JZFH 1A1RA 2ZGXH 4ZKNU 4AGKA 1C2KA 2Z3EA 2JKHA 4BAHB 2FLRH 1CHOG 2FX4A 3TK9A 2F9OA 1A61H 1WQVH 3FAOA 4I32A 3TNTA 2Y80A 3F9EA 2TBSA 4THNH 1C1RA 4TWWA 1YF4A 4UD9H 1UK3A 3M35A 3NPSA 1HJAC 3JZ1B 1HAGE 2H2ZA 4ISNA 4SGAE 1LPZB 1AZ8A 2XWAA 1A5IA 1KDQA 3AASA 1JOUB 1HAOH 3A89A 3BTKE 2G81E 2EA3A 4TYDA 3BN9A 1ELBA 2BQ7B 3EA9A 1T4UH 2W7UA 5DP9A 3B9FH 5FCRA 2CF8H 2J4IA 5DP4A 1UHBB 5A0AE 1QJ6B 2A5IA 2OC0A 4AYYB 1K1JA 1VZQH 1PJPA 4HZHA 1E34B 3H7TA 1CBWB 1O5BB 2RG3A 2XNIA 1YCPH 2QN5T 1AKSB
chains in the Genus database with same CATH superfamily
1SMFE 1UMAH 2CF9H 3T2NA 3QX5H 4FUFA 3DFLA 1ZPBA 3A7XA 2HPQH 4NIWA 1IOEA 1C5TA 1S6LA 2C3SA 2ZI2H 4NWKA 4A7IB 4ZH8A 1TONA 2CMYA 3P17H 1DM4B 4ABDA 3I29A 1IQHA 2HLCA 3BTWE 3PV2A 3TU7H 1TPSA 2ODPA 1TX8A 4A1VA 2H6MA 8KME2 2GV6A 4TY6A 3OFND 3OEHD 1LO6A 3Q3XA 1EZSC 5HKKD 1JIRA 2DE9A 2QIQA 2PSXA 1AFEH 2VIPA 2L6OA 3A87A 1HAHH 3TNSA 4I7YH 3Q77A 3QN7A 3SV6A 3DFJA 1WDIA 3LGIA 3TJUA 1MTUA 1CGIE 2JH0D 2GMTC 1UTLM 1NM6A 2BD7A 2F9BH 1TAWA 1C5NH 2NU2E 1YYY1 2TGPZ 1MUEB 5BRRE 1NFYA 1W11U 4I8LA 5JPMH 3MOCA 4BAOB 1D3DB 1Q3XA 4BOHA 2J95A 2BD4A 3PB1E 5FHTA 2AYWA 2BQWB 1KY9A 5I25A 1G30B 3F6UH 3IWMA 3FFGA 2ZDKA 3F2GA 1YCPM 2WUBA 2ZPQA 1YPHC 4OS2A 1P57B 3RXTA 3RXMA 4SGBE 5DPAA 2H9HA 2BY7X 1EFRD 3UR9A 1ZHMA 5IDKA 5E8EH 4I31A 3RXAA 1EB2A 4X8UH 1ETSH 3BG4B 5LH8A 1QL9A 1KSNA 2CN0H 5DGJA 1BMMH 3H09A 3BTHE 2A5AA 3PTNA 2CV3A 1KXAA 1QQUA 1HAVB 5GNDA 5CMXH 1GGDC 1V2OT 3SUFA 1W0KD 1YLCA 1EXFA 3P6ZB 4ISHH 2BY9X 1A2CH 5IK2D 3C27B 2J2UA 1G3BA 2SGAA 1XXDA 4YO9A 3DSGA 1AGJA 4ABIA 2AGEX 1H9IE 1B7XB 2O8TA 4NGAH 2C90B 1OOKB 3PM3A 2R2WU 1O35A 3A7YA 4NZQA 2ZCHP 2G8TA 2QXGA 1CSOE 2FMJA 2GVFA 2OQUA 3VB4A 1Q31A 3LOXA 1C5WB 2BD9A 4OS6A 1C1OA 1G3CA 4F49A 4IN1A 1K28D 2OC1A 3TH2H 3KF2A 5A8YA 1GJBB 4GUXA 4X0WU 3TGKE 3R0FA 1HIAA 1C5UA 1O5FH 2P8OB 1VITH 2STAE 3LONA 3O8DA 1A0JA 6CHAB 3NWUA 5FPYA 1S85A 4A92A 2GZ8A 1UTKA 3SJ9A 4E06H 3RXPA 1V2ST 2OBQA 1FMGA 1WSSH 5F8TA 4AFSA 2BDHA 1SGRE 2FOMB 4B73A 2BVRH 1A3BH 1D3PB 2GZ7A 2WHXA 4LOYH 2UUKB 2XBVA 1HAVA 1RS0A 4MVNA 4B74A 2YNBA 2BX4A 1Y3YA 4AB8A 5JBAS 1O39A 1K1OA 1QL8A 1QZ8A 1YPMH 3A88A 1Y3WA 5EODA 3TH3H 1BDAA 4AB9A 3V13A 2WPMS 4P02A 4E7RG 2EEKA 1CA0B 4YOIA 1OHHD 2VBCA 3PMAB 2M5TA 2CHAB 2OC7A 3GCOA 2L74A 4OGXA 1O30A 5T6GA 1YGCH 2ZCKP 1EB1H 2H9EH 2P3UB 1XXFA 1K0HA 1GJ6A 2QF0A 1OWDA 2JIZD 3UY9A 1ZGIA 4IBLH 1WYKA 3RXRA 3ZZ7A 1UTOA 1LQDB 1FI8A 2DE8A 1JMOH 1Y3XA 2Z3DA 2A4GA 2WZQA 2AIPA 2PFEA 3PLPA 1UVUH 2KZ4A 3FP6E 2FOFA 1TPPA 1XUFA 3S9CA 1Y5BT 2Z9LA 3ATLA 1C4U2 1TNIA 3SJ8A 1QRWA 1HAYB 1EX3A 1Z8JB 1GI6A 3E0NB 4JK6A 3U28C 2ANMH 3RXOA 1XUGA 1ESTA 2B5TB 3HGNA 1AFQC 4MNYA 4YT6H 2XWBI 2ZHWH 3RXVA 3MFJA 1DVAH 1E38B 1KXCA 4U30A 1DICA 2GJGA 4X8SH 3M5MA 3VB3A 4CRBA 1BT7A 1ELTA 3M5NA 3S69A 5GIBA 1O3EA 2BD2A 1BTZA 2R2MB 1BMAA 4NZLA 3UNSA 1RTKA 3H7OA 2VB0A 1VITF 2G55A 5CHAC 1H9LB 3SUDA 2ZFQH 2W6JD 1DWCH 2ZO3H 1CVWH 1AZZA 1UJ1A 3OAAD 1Z71A 4MLFB 5FCKA 4BAMB 4K5ZA 4A1XA 4TPYA 1BZXE 1GI4A 3ATIA 4ABGA 3IG6B 1TMTH 4MPVA 1N8OB 1S6HA 1XX9A 2ZDVH 3D65E 5FX5A 1V2TT 1DFPA 4TY7A 3UR6A 3B8JA 1Z8IB 3ELAH 1VITG 1BMLA 1AMHA 3RXQA 1VCQA 1P0SH 3RUOA 3R3GB 2A2QH 1QJ7B 1A46H 3VXEH 5AHGH 1SQRA 1THPB 4QT8C 1EP5A 2FDAA 4Q7XA 1GMDF 3ATWA 1O32A 2QA9E 1ABJH 3MO6A 1HB0B 4MDSA 1J15A 2ZFRH 1ELEE 4YOJA 2PKSC 2TRMA 1KIGH 3MWIU 2G5NA 4LK4A 4DVAU 3S9BA 4PROA 4CRDA 2ZTYA 4UDWH 1UVTH 1GMDG 2PGQB 3F1SB 1SQTA 4FUJA 1GMCF 5GJ4B 3MH7A 2BZ6H 1C5MD 1FLEE 4Q2KA 1GI9B 1JBUH 1NY22 2A45B 1SOTA 1SQAA 5EOKA 5DP6A 3BIUH 2GCTC 4NIXA 1OX1A 1C5VA 3OY5U 4INKA 1K1PA 2ZF0H 2FOHA 4HGCA 2I6QA 4E7NA 2SNWA 5CDFE 2Y81A 4GCHF 1G3DA 3T5FH 2RCEA 1ESBA 1QRXA 1XVOA 3PROA 1Z1IA 1DE7H 2VGCC 2F4LA 1LHGH 3T62A 1FAXA 1RFNA 5DJ7A 3LJJA 1OYQA 1T8LA 1TE0A 4JYUH 1NFXA 1FY3A 2EI7A 2XTTB 5AFYH 1HV7A 4X6MA 2QXHA 3HK6B 3CENA 1TA2A 2ULLA 2ZDMA 1GBHA 1V2UT 2VWLA 3TLOA 3URCA 1P12E 1JRSA 5JYIA 1K2I1 1SR5C 2LPRA 1Y59T 3F3BA 1FAKH 1OYTH 3FVFB 2JETB 3E8LA 1TA6A 2CGAA 4CREA 3OYPA 1XUKA 3ZIAD 3OY6U 4GHTA 2A5KA 1QCPA 2ZWLH 1QIXB 2K1QA 1X7AC 1SC8U 3KQCA 4UFEH 3RM2H 1O3LA 4Q63A 4DT4A 5ESTE 1NU9A 3FANA 1YPLH 2G4TA 5L2ZH 1O38A 3DUXH 3SNDA 3RXLA 3ZVEA 5E2PA 4IMZA 1F5LA 1Y8TA 4NCYA 1ZSJA 3SU0A 1P03A 2AEIH 3PO1B 1MZAA 3KGPA 1DSTA 1OWHA 3E16B 3SU3A 1C5PA 3GYMA 1D9IA 1QQ4A 1Y5UT 5EPNA 1IQNA 1LCYA 4D7GA 1FIZA 1BTXA 1MKXH 2ZC9H 2PTNA 1N6YA 1SGEE 2PKAA 2WV4A 3ZYDA 2HVXA 1YPJH 4ZROA 1O37A 1V2LT 2DUCA 3MNXA 1CBWC 1HCGA 2BY8X 2VU8E 3KNXA 1DPOA 2FX6A 3GDVA 3F68H 4FUIA 1YPKH 2FPZA 1GVLA 4GLYA 3A7TA 1VR1H 1F0TA 4IN2A 2FP7B 8GCHF 4CR5A 4RSPA 2I6SA 5T1VA 4ZUHA 3SI3H 5LPRA 2QF4A 1GJDB 1PPZA 4O97A 2F83A 2A7JA 1O5GH 2M2AA 1GBMA 1O3BA 2A2XH 4O03A 3UFAA 3PV5A 1JRTA 2P59A 1EZQA 4WMEA 8GCHG 5C0UA 4HTCH 4YM9A 2PW8H 5EJLA 5E0JA 2ZU4A 3MU4A 3ZV9A 3T29A 1TB6H 1SHYA 4WWYA 4JYTA 4H6SB 3M7TA 1Z6EA 1GVZA 1K21H 2V0BA 2Z9IA 1FY8E 1C5RA 2VH6A 5J4SA 1AB9B 1P9UA 1GJ8B 1PYTD 2FOCA 3DD2H 3TITA 1G3EA 2VVCA 4KTCA 1QBVH 2OP9A 1O5DH 4B1TA 1G32B 2HWLB 2A0QB 2NU1E 2QC2A 1TBZH 4BTTB 5CHBA 3M7QA 1UCYH 3GDSA 5TCAA 2ZHFH 3SORA 3BSQA 2BVSH 1YBWA 3GISB 1V2QT 4NSYA 3GDUA 3RMNH 1FY5A 1JXPA 1NRRH 1S83A 2VNTA 1TMUH 3SNEA 3BG4C 4B2AA 3ZZ8A 2W26A 1SGIB 1O3IA 3A86A 2XBWA 1V2JT 1GDQA 2V3HH 2ODQA 3U69H 4WMFA 3U8TH 4A1TA 1BTYA 3U9AH 5GCHF 1QRZA 1IQFA 1DSUA 1GI5A 5GXPA 5EXLA 1AQ7A 1TMBH 1NRQH 3PTBA 4X1RU 1YLNA 1AY6H 1SQOA 2V6NA 1LPGB 1TOMH 2ZA5A 3RU4T 1O34A 2WV9A 1MD8A 1TRYA 4D76A 1MTNB 1P06A 5A2MH 2HGTH 1GBCA 3SUGA 2OINA 3T27A 4J2YB 3UUZA 1JWTA 5DG6A 2G00A 5GCHG 1C5OH 1GCDA 2J9NA 4Y0YE 1TALA 1P2NA 3QZRA 1NC6A 3ZZ3A 5E0HA 2ZHDA 1COWD 1UVPA 1A4WH 1TLDA 5L6NH 2VIOA 1BTWA 2BVXH 3RC4A 3O8RA 1GPZA 2KX4A 6CHAC 1AVGH 1FV9A 1O3JA 4AC9A 2H1UA 2NWNA 1IAUA 2VH0A 1O2KA 1RD3B 1W7GH 4JZDH 2QGRA 3SN8A 2OC8A 2O8LA 3A7ZA 1N1LA 1IHTH 2ZGBH 4JK5A 1DOJA 1RXPA 1C1UH 4YESB 1V2KT 3VG8A 4MPXA 2KR7A 1DXPA 4A5TS 1C1VH 2O8MA 2ZU2A 1GI0A 3SI4H 1BTPA 1HXFH 3GYLB 5C3NA 3LDXH 2C93B 3MU1A 5LPEA 1CA0C 1ESAA 2CHAC 5T6FA 1D6RA 1GHVH 2ANWA 1E1QD 1EPTB 3Q00A 1SGCA 4ZCNA 4K1EA 2OUAA 2Z7FE 4TPIZ 1WTGH 3RXIA 4GHQA 1QNJA 2PR3A 2JH5D 1FN8A 2VWOA 2QY0B 4RN6A 5DSFA 2XW9A 3GCTF 1C1PA 4U32A 4XD7D 3P70B 4F48B 1UW7A 3A7VA 4JZEH 1GCTC 2ZKSA 1KTTB 4ABJA 1FPHH 2KCYA 4P00A 2OLGA 2BD5A 3F0PA 2BZAA 1LHCH 3SNCA 4D7FA 4NWLA 1AU8A 3U8OH 3P95A 1BRAA 1K1LA 3GCTG 1NESE 2FTLE 2J38A 2TGDA 5EIYA 2PP6A 1UHBA 2IJD1 3M3TA 4YLUA 1H9HE 2YNAA 4X2XA 5JBCS 3V7TA 3KQ5A 3UWJH 1KXFA 1ZRBA 3RMLH 1NS3A 4BXSA 1GL0E 1O2TA 4WVPE 2Z94A 2STBE 3MQKC 2GCHF 1SOZA 5C20A 1SGPE 1YCPK 1P2OA 1AKSA 4DJZB 1TIOA 5C67A 5HMAA 3SBKA 1AUJA 2BDGA 5B6OA 7ESTE 1EJAA 5GWZA 4ZKOU 3ZVCA 3W94A 3GY6A 4Y6DA 2XOKD 2HNTF 1L4ZA 1MKWH 1QB6A 3BIVH 4DY7B 1QR3E 2GCHG 3ZZ6A 4K1TA 1P2KA 1O2YA 3SJOA 3E6PH 1XKBC 2GZ9A 1G2LA 1GJAB 4O3TA 1C2JA 5C5OA 2ZU5A 4JMYA 2BLQA 1SGTA 3TJNA 1QGFA 1IQEA 1TNJA 3FKSD 4ISOA 5C1XA 1TGSZ 1QJ1B 3L3TA 1S84A 1N8OC 1TX7A 4B71A 2BHGA 1SB1H 2ZPSA 4ACBA 3SV9A 2B8OH 1LHEH 4WH8A 2QV1A 3W1EA 5DO4H 1W13U 2WUCA 4X1NU 1Z7KA 3EE0B 1OP2A 1C5ZB 4D9RA 1H8IH 1P2IA 1V2WT 3PMBB 1YY3A 3K65B 4UFFH 1TX6A 5A8XA 2BLWA 1GJ7B 5EXNA 3VPKA 1O5CB 1TRNA 2ZIQH 3DA9B 4ASHA 1UK4A 1AHTH 1AE8H 2SGFE 1NTPA 3FZZA 1TBRH 2QXJA 3A82A 7LPRA 1O33A 5HIYA 1AD8H 1D6WA 3ZZDA 3UB0A 5EJ1A 3GS9A 4JZ1A 4UE7H 3RC5A 5DP3A 1K22H 4F4OC 1SLVB 4FUGA 4X1QU 2FS9A 3QTOH 4CHAB 1EP6A 1FJSA 3C1KA 1T4VH 3ATKA 2Q1JA 1AWFH 1H8DH 4NG9H 3P8NA 4DOQA 1UCYE 1E37B 4R0IA 1SL3A 3RDZA 2VIVA 1FDPA 4U2WA 2W6ID 4X6PA 3UPEA 4B6FA 1L1JA 3M3VA 5DK1A 1PQAA 4IC6A 5GDSH 3LU9B 1T32A 3RXBA 1S0QA 3SV7A 1C2HA 4ZXXH 2THFB 5C5NA 1YLDA 2HALA 1Q2WA 1C5XB 5BPEA 3SU1A 3UNQA 1NO9H 1W8BH 2HRVA 4U01A 2VIQA 4NA7A 4X8VH 1LPKB 1D4PB 1O2GH 5F8XA 3GY5A 4ZHLU 4BXWA 1C4Y2 3HPTB 1S6FA 4XE4A 4Y76A 4X1PU 4YLQH 2QCYA 1DWBH 1FN6A 2AGIX 1DS2E 3ZVAA 1TQ0B 2FI3E 2PGBB 1ZRKA 1FUJA 4FOUC 3E3TA 5C0TA 1ELVA 4FUCA 3SO3A 1O2OA 1GHYH 3GOVB 2HNTE 4K69A 1F0SA 2WPDD 4K2YA 1EZUC 3NCLA 1J17T 1O2MA 1TABE 1EASA 2ASUB 1CA8B 2KCOA 1BRBE 5B6LA 2JETC 2UUJB 3SU5A 4AGJA 4XOJA 1ZMJA 2OXSA 1ZSLA 2PLXA 1P01A 1W12U 5EXMA 2W5EA 3LH1A 1W0YH 3M5OA 1IQKA 1MU8B 3N7OA 4JZIA 1YPEH 1TBQH 2ZQ1A 1PQ5A 3CS7A 1O3CA 1O3NA 1P9SA 2BX3A 4MG3A 1ETTH 2ZZUH 1EAUA 2GP9B 3UREA 5EQSA 2FYRA 2A31A 2J97A 1WOFA 1GVKB 4VGCC 4ABAA 2FS8A 1AE5A 4B2CA 1KYNA 2FZZA 2GMTB 3AW0A 2UWLA 3K6YA 1ETRH 4XDEA 1AUTC 1SHHB 1HAIH 1ACBE 1C1QA 1ZSKA 3TPIZ 4YXWD 3KCGH 1B0FA 7KMEH 2FWWA 2ZFPH 3MO3A 2V35A 3OSYA 3ZZ9A 3PO1C 1CGHA 1AI8H 1KXDA 4LZ4B 2FM2A 1HGTH 5EPYA 5F6MA 1BOQA 3GY7A 4CRGA 1LMWB 3WWBA 2FI4E 1GJ5H 1MBMA 1BA8B 1DWEH 1NFUA 5LPFA 2FOAA 3BEIB 2ZDAH 1O2PA 5EG4A 3T26A 3L6PA 1P2JA 3RLYH 1NROH 4NA9H 1YM0A 3NRLA 5HGGA 1OP0A 1MU6B 1AVWA 4OS5A 2AFQB 2ZU1A 2IN2A 2J98B 1BBRH 1TFXA 2Z3CA 1GGDB 4Y8XA 3S0NA 3QGJA 3UTUH 1NBME 3VEQB 1PQ7A 1E79D 2GV7A 3KEEA 3MU8A 1AWHB 4NFFA 2YMSD 2PV9B 4M9FA 4ABFA 4MQAA 3FN8A 4DIHH 1EJNA 3KYGA 2SFAA 3EGKH 3ODDA 1TNHA 2ZPRA 2XBXA 2PWXA 1O2UA 4DW2U 3ZZCA 5FL7D 1V6DA 2ANKH 5A8ZA 5EGMA 3BTME 3RXUA 3VGCB 1Z8GA 2BDAA 1OP8A 3MH6A 2HOBA 3U8RH 1C1WH 2XNDD 1K9OE 4A6LA 1H8ED 2GTBA 2V3MA 2CXVA 3CS0A 1O2LA 1RJXB 5J4QA 3WW7A 3OX7U 3RXGA 1LDTT 3K9XB 3M3SA 1HXEH 2J98A 3PYHA 4JYVH 1NRSH 1O3HA 3F2HA 2J94A 4OM9A 1JIMA 4DCDA 1ZJKA 1HAPH 1O31A 2VVUA 3ATMA 2A4QA 2FOBA 3RLWH 5C1UA 2BMGB 3AVZA 3BF6H 3SJKA 3EYDA 5AFZH 5JBBS 5I46H 3N7EA 2WSSD 4B2BA 2XXLA 3DSPA 2Q6GA 2VVVA 2AHME 5C94A 1ZZZA 2GGVB 4I33A 4I8GA 1P3EA 4UFDH 4OS4A 3S7KB 1TYNA 2BXUH 1U6QA 2YMSB 1T8OA 3T25A 1WBGB 4GPGA 1DY9A 3E90B 1FPCH 3ESTA 2ESTE 1GBJA 2TPIZ 3MH5A 1ELAA 5EQQA 1MTNC 1UTNA 1WUNH 2G52A 4K8BA 7GCHF 3SV2H 3VB7A 1LVOA 1EQ9A 1SFQB 1ELFA 2VWNA 3GY8A 4XFQA 1PYTC 3ZVFA 3FP7E 4YOGA 4RKJB 4FUHA 4ZKSU 1L4DA 2BM2A 1FONA 1HUTH 3QLPH 3LPRA 2TGAA 2FLBH 3QZQA 1YPHE 2XCFA 3SHCH 2BD8A 7GCHG 1XUIA 2QF3A 2ZFTA 1TGNA 3SYJA 2WPKS 3GCHB 3KQBA 3QK1A 5FPSA 1C9TA 1BHXB 3AK5A 3SNAA 4IW4E 2ZP0H 2AIQA 3FZDA 3MNCA 3TK5A 3RU4E 1GDNA 4B75A 3V12A 4DT7B 3ZVGA 1ZTJA 1IQIA 3RMMH 1G9IE 1RTLA 2SGDE 1KXEA 1BJVA 1TQ7B 4RT1A 2VJ1A 2NU0E 1A5HA 1C5LH 1O2VA 3QUMP 4INLA 3P8FA 2HVYB 4H42U 2J5UA 4HI3A 1OWKA 1C2IA 1RGQA 1VKYA 4DG4A 1BHXF 1ZPCA 1DITH 1F92A 1F5RA 1ELCA 2KM0A 3KQEA 2UWOA 4FVBA 4Q80A 5CHAB 1WXRA 2BXTH 2PHBA 1SVPA 1YPGH 1DANH 1TNGA 4AFQA 3T28A 2QE7D 1GHBF 4OGYA 3AAVA 4OS1A 4BAKB 1J8AA 2F9PA 1KXBA 4RI0A 2F91A 2QXIA 5JDUB 4BANB 5FPTA 4IGDA 1L1NA 5LGOA 1KTSB 3IITA 1DUAA 1L0ZA 1LKBA 2K0QA 3KHVA 1Y5AT 3PMHB 4F55A 4UFGH 1O3KA 2AERH 3MHWU 3A83A 3A80A 1E35B 1LQEA 3A8AA 3HATH 1EATA 2UWPA 2BTCE 4O3UA 4WMDA 4XBBA 1BTHH 1GHBG 3FO8D 1WCZA 2H9TH 4ACAA 1C5SA 1ZMLA 1YP9A 3ITIA 4ABHA 2W3IA 1PPFE 2OK5A 5H4IB 4ABBA 2BY6X 1VGCB 4AN7A 1KMHB 2A1DB 1MKXK 4Y7AA 3MNSA 1DXWA 1K1MA 2BYAX 2ZTZA 4D9QA 4AG2A 3LH3A 1LKAA 4XBCA 2D26C 3UQOA 4Q7ZA 3RC6A 1F7ZA 2G51A 2LNCA 3SU4A 9ESTA 3OEED 2Z9GA 1C2DA 2GT8A 3VB6A 4Y11E 1K1NA 4WXVA 2R9PA 1S82A 1Z1JA 1ZOMA 2GCTB 3UIRA 1NFWA 1T8NA 3TIUA 4ZHMU 2BDIA 2C8WB 4M7GA 3U1IB 1MABB 3SW2B 1MTWA 5DP8A 3MU0A 1ELDE 1SGNE 1TGBA 2V3OH 2GKVE 1SLWB 4YTAA 1KLJH 3RXKA 3UNRA 3KIDU 3LT3A 1MQ5A 1C1NA 1F2SE 2BD3A 1LVYA 2H5DA 3TJOA 8ESTE 2O8UA 2VINA 2OCVB 4YZUA 1BCUH 1V3XA 2VGCB 3SQHE 3GY2A 1GJCB 1UTJA 2WPIS 1S5SA 4K8YA 1ZJDA 1ZTLA 2EY4C 5PTPA 1SGFG 3SU6A 1TNLA 2ZFSA 3ZZBA 5KGOA 1UVOA 3RMOH 1UTQA 1TPOA 2A32A 4Y7BA 2AMDA 1FXYA 1GBAA 4X2WA 2VWMA 2BDCA 1BJUA 1UTMA 1RRKA 4MPUA 3ODFA 3Q3YA 1GBDA 3QGNB 2FI5E 1NPMA 5T6DA 3ZVDA 4GSOA 4AYVB 4WXIA 1O3OA 1O3PB 1DWDH 1UCYK 1GG6B 1J14A 2FO9A 4GVUA 2P8OC 4X2YA 1EAIA 2IPQX 1XUHA 1S0RA 2FESH 1VJ9U 4CHAC 1UTPA 4FU8A 1O2RA 3MMGA 1V2MT 4CRCA 3ZVBA 2SGEE 2KAIB 4MPWA 1QY6A 3P8GA 3A7WA 1T31A 3M37A 4ZAEA 5L30H 5DP7A 3TVJB 2EI6A 1AO5A 1CT0E 3ZV8A 1O3FA 4LXBH 5K7RA 1QURH 1A5GH 1C1TA 5E2OA 5EW1H 3E91A 1XUJA 1GHAF 1PQ8A 1W7XH 2BOKA 1HYLA 1T7CA 1HRTH 5A0CA 1IQMA 4R8TB 1HAXB 4BTIB 3EA8A 3UOPA 1M9UA 5A09A 1GHXH 1CT2E 2JH6D 5FXLA 1HNEE 2A7CA 5HIZA 4KKDA 2C8ZB 4NIYA 4D8NA 4ISIH 4IS5A 4Z1MD 3BV9B 1SGYE 1GHAG 1BIOA 1SFIA 5FBEA 3WY8A 1TGTA 3UWIA 1ZLRA 2P95A 2ZGHA 1BTUA 4Y0ZE 3SHAH 3PWBA 1LTOA 1KLTA 2XC5A 3KN2A 2WYGA 5FBIA 1UVSH 3URDA 1XM1A 2VIWA 1P10A 2IPHA 2Y5GA 1ZHRA 1ARCA 4X2VA 4BTUB 1LHFH 4FUEA 2KAIA 1V2NT 3F9FA 4CBOA 4JCNA 2J34A 2EI8A 1DLKB 1J16A 2FOGA 6GCHF 2P94A 1K1IA 1GBLA 3RXCA 1FIWA 2ODYB 1MCVA 3TJVA 3V0XA 2WV5A 2XCNA 3RXJA 2D1JA 1MMJN 2ZGJA 1EOLA 1EUFA 1OWIA 2BDYA 4X6NA 2LELA 1H1BA 1QA0A 1O3MA 1O2JA 2Y7XA 1W0ZU 3B23B 6GCHG 3U98H 3HK3B 1ELGA 5ABWA 1EPTA 1NBMD 1PPEE 2B0FA 3TK6A 3W95A 5C1YA 1AVXA 3NK8A 4OS7A 1E36B 1B0EA 5JBTA 3ZYEA 5KECA 3K2UA 2WPLS 1GBIA 5HXFA 2F9NA 1QL7A 3DT0H 3HKJB 1C5QA 1BRUP 1ARBA 2VIDA 2Y82A 4CBNA 1GMHF 1HIAB 1RIWB 1TOCB 3AAUA 2TGTA 4Y10E 1W0JD 4AORA 4IC5A 1C9PA 4H6TA 1L2EA 5AF9H 4UONA 1ANCA 2Y5FA 3GY3A 4MNVA 4B76A 3BEFB 5T3HA 5JB9S 1E1RD 2Z9JA 1MAYA 1QBOA 3QO6A 4KTUA 1GMHG 2GT7A 3ZZAA 9LPRA 1C5YB 3HGPA 1W14U 1FY1A 1HLTH 3A84A 2NU3E 1W3CA 1GHWH 1O2WA 1O5EH 1E0FD 4XRNA 3N7DA 2FIRH 2RA3A 4ZHAA 3H5CB 2B7DH 1BMNH 2GDEH 3I78A 3D49H 3EE7A 4AG1A 4UEHH 1O2HA 2BOHB 2JJ2D 2ZEBA 3SNBA 2TIOA 2XC4A 4I8HA 2A7HA 1MKWK 4FVDA 3BTQE 1O2XA 1THSH 3CP7A 1G37A 2ZHQH 1CGJE 3P92A 1GI3A 3EQ0H 3F9HA 4Q4LA 4I8KA 1HJAB 1SG8B 2R3UA 1SGDE 4NIVA 2Y6TA 3M61U 3F0OA 1LVMA 1NZQH 3DSOA 2OD3B 3BEUA 1XVMA 3LGUA 3TH4H 1EJMA 3VGCC 1CE5A 1HJ8A 1OXGA 2Q6DA 3ZZ4A 1NU7B 1D3QB 1GI1A 1OWJA 2OQ5A 3BTTE 1NN6A 2SGPE 3BG8A 2AMPA 3STIA 3A81A 1F0RA 3F9GA 2Q6FA 1XMNB 1GJ9B 2ZCLP 1VCPA 2WPHS 3LGTA 1ABIH 4HG6A 4Y8YA 3STJA 3SZNA 4Y8ZA 1BITA 1HAZB 3WWFA 3MYWA 3TGIE 3LKWA 2W7SA 2GD4B 4TSFD 4RT0A 4E05H 4WY3A 5K0HA 3BTGE 2AGGX 4DURA 1DLEA 1BQYA 3RU4D 1B5GH 2P16A 1MCTA 2YMSC 2P93A 4CRAA 5ESBA 3PLKA 3ENSB 2FOEA 1PPCE 1OSSA 1QB1A 1LVBA 1EZXC 3EA7A 1BB0B 4CR9A 3E0PB 1T8MA 3SV8A 3NUMA 3OE7D 1GCTB 2WPJS 1P8VC 3FOAA 3KQDA 2KFWA 3A8BA 4AOQA 1C1MA 4Y79A 5F8ZA 4FXGH 3MH4A 1TGCA 2KCAA 1DX5M 4GAWA 1G2MA 1Z8RA 2ZECA 2F43B 1W2KH 2FTMA 1Y3VA 1PPBH 5DN6D 3LGWA 1ZTKA 4KP0A 2BQ6B 1GBKA 1IQLA 3A85A 1DDJA 2SGQE 6LPRA 3V3MA 4WJG2 1DT2A 4ASUD 5GPIB 1SGQE 3GCHC 1ANDA 1NRNH 1DUEA 1O2ZA 1MBQA 1RTFB 4FU7A 2D2DA 3MI4A 3UOUA 3RXFA 5EQRA 4H4FA 5HM9A 2PTCE 3JZ2B 2OBOA 4AZ2B 2AS9A 4X8TH 2WINI 4K3JA 3S7HB 3MU5A 3BTDE 1A3EH 1P2QA 5C17A 1HDTH 3EAJA 1QTFA 4CH2B 1F5KU 3BTFE 1CU1A 3BTEE 1MQ6A 1IQJA 1SI5H 2NU4E 3LC3A 3M7UA 3VXFH 1MD7A 3RP2A 4B6EA 3NXPA 1ZGVA 3RXSA 2Y5HA 3OTJE 1O2QA 2XRCA 2ILNA 5HM2A 4AFUA 3PV4A 1IHSH 1FQ3A 2FYQA 1LHDH 4FUDA 5TJXA 1HBTH 1C4V2 1EAWA 1GHZA 3KL6A 4Q7YA 1WQSA 5A0BA 2W3KA 2ZTXA 4BAQB 3SZEA 4MNWA 1O2IA 1GJ4H 3LIWA 1V2VT 3UQVA 1G36A 1SSXA 1A0LA 1GBFA 3A8DA 2FEQH 2GX4A 4ZMAH 1YKTA 3ZZ5A 2QAAA 1TRMA 1FX0B 2QYIA 5F53A 3QWCH 1GBBA 4LZ1H 5TCCA 1D3TB 1WV7H 1AB9C 3D62A 2UUFB 1VGCC 3SU2A 3QDZB 4I8JA 4NFEA 3M5LA 1GDUA 1W10U 4CRFA 1C2GA 1OS8A 3Q76A 2JDID 3RXHA 3GCNA 4TWYA 3GICB 3MO9A 1YWUA 1ZMNA 2B9LA 1BBRK 3NZIA 5FAHA 4YT7H 2XC0A 4CH8B 1OPHB 2HPPH 2EQNA 1P02A 1ZHPA 1QA7A 1TWXB 1PPGE 1OKXA 3RXDA 2BY5X 1L1GA 1ZYOA 5CE1A 3LJOA 2CJIA 4Y71A 1GMCG 4KGAA 2ZG0H 2RA0A 1SPJA 1ID5H 1V2RT 4HFPB 1Y3UA 4NA8A 1H4WA 1V2PT 5IYTA 3L33A 2V7QD 2PUQH 1NT1A 2XYAA 3S9AA 3SUEA 1AN1E 1MTSA 1IQGA 2P3TB 1ORFA 1C2EA 1GL1A 3PMJA 5FX6A 1C2FA 3SJIA 4GCHG 1FY4A 2R0KA 3E1XB 3P8OA 3PWCA 1O2SA 2R3YA 1O5AB 1HPGA 4FUBA 4Z0KA 3SOSA 6ESTA 2PKAB 3GY4A 2A4RA 2ZDLA 1N6XA 3SGBE 4FU9A 1GG6C 3NKKA 2FODA 2G5VA 4Z6AH 2Z9KA 3D23A 2BDBA 1AFQB 1BMFD 2OTVA 2YOLA 3RM0H 5JB8S 5L2YH 4O9VA 1FNIA 1P05A 3FP8E 4INHA 1UO6A 2P3FH 1ZR0A 1TNKA 3MNBA 2K8IA 1CO7E 3U1JB 1P2MA 1WAYB 2D8WA 4MTBA 4VGCB 5SGAE 2Z6BD 1GWAA 3HKIB 3N99A 5EJZA 1XKAC 1HFDA 1WTHD 1J9CH 2XBYA 3RXEA 2R0LA 2HLDD 3O8BA 1MAXA 1KLIH 3TGJE 3LGYA 1MH0A 1GBEA 2IJOB 4RKOB 1OWEA 3DHKH 1QFKH 1O0DH 2ZGCA 3K6ZA 4X1SU 1YC0A 1MZDA 2IOTA 2A4OA 2ANYA 2O9QA 2O8WA 1O2NA 1O3AA 4BNRA 1EAXA 3A8CA 1P11E 1EPTC 1O36A 3Q3KA 1THRH 2F9UA 1HJ9A 1Z6JH 2C8YB 4X6OA 1C2MA 2AH4X 2F3CE 2RDLA 1ANEA 3VFEA 2BLVA 4DIIH 1MTVA 1CQQA 2ALVA 3PRDA 4WF8A 2ZNKH 2EC9H 1F0UA 2ALPA 2PSYA 3G01A 1BUIA 1TPAE 2JJ1D 1EOJA 1GI2A 1CT4E 3SGQE 5F03A 1O3GA 2AMQA 3CNRA 3PRBA 5DKMA 2GDDA 2ZDNA 1ZPZA 4K1SA 3KYFA 4DGJA 2HNTC 3UAIC 2UUYA 3SQEE 5C2ZA 3DCLA 5DP5A 3O8CA 1P09A 2PKSB 2BB4A 4IMQA 2KCPA 5EU8A 4ABEA 4ISLA 1GBTA 5AVDA 2SNVA 3MTYA 4I86A 4XSKU 1O3DA 4AX9H 1C1SA 2G4UA 2WYJA 4ZKRU 2ZQ2A 1UK2A 1WU1A 3LC5A 1GI8B 1EKBB 1H8HD 3EDXB 5EW2H 1SLXB 4MNXA 1C2LA 5KEDA 1SLUB 1QB9A 2PUXB 1BRCE 2H5CA 4NSVA 1DY8A 3AW1A 1INCA 1PPHE 1A0HB 1A7SA 1P04A 4AFZA 1ANBA 4TT3D 2BLOA 1BBRE 2J92A 2ZFFH 1NRPH 1AIXH 1QBNA 2Y7ZA 1RIWC 1SBWA 3M36A 1GI7B 1PFXC 4ESTE 2C4FH 1KDQB 1QHRB 4XBDA 1S81A 2F9VA 3I77A 1FZZA 4KTSA 4J1YA 2CK3D 2ZU3A 3LGVA 5E0GA 8LPRA 4KELA 4ZXYH 3QTVH 2FXRA 3PLBA 1CHOF 2C8XB 3SGAE 1SGFA 1VCWA 4WH6A 1CHGA 5HYOA 3OU0A 2ZHEH 5ETXA 4K60A 3VB5A 5G4BA 4FETA 1P3CA 1VJAU 4JZFH 1A1RA 2ZGXH 2RFKC 4ZKNU 4AGKA 3OTPA 1C2KA 2Z3EA 2QF5A 2JKHA 4BAHB 2FLRH 1CHOG 2FX4A 3TK9A 2F9OA 1A61H 1WQVH 3FAOA 4I32A 3TNTA 2RDEA 2Y80A 3F9EA 2TBSA 4THNH 1C1RA 4TWWA 1YF4A 4UD9H 1UK3A 3M35A 3NPSA 1HJAC 3JZ1B 1HAGE 2H2ZA 4ISNA 4SGAE 1LPZB 1AZ8A 2XWAA 1A5IA 1KDQA 3AASA 1JOUB 1HAOH 3A89A 3BTKE 2G81E 2EA3A 4TYDA 3BN9A 1ELBA 2BQ7B 3EA9A 1T4UH 2W7UA 5DP9A 3B9FH 5FCRA 2CF8H 2J4IA 5DP4A 3F2FA 1UHBB 5A0AE 1QJ6B 2A5IA 2OC0A 4AYYB 1SKYE 1K1JA 1VZQH 1PJPA 4HZHA 1E34B 3H7TA 1CBWB 1O5BB 2RG3A 2XNIA 1YCPH 2QN5T 2LP6A 1AKSB
chains in the Genus database with same CATH topology
1SMFE 1UMAH 2CF9H 3T2NA 3QX5H 4FUFA 3DFLA 1ZPBA 3A7XA 2HPQH 4NIWA 1IOEA 1C5TA 2C3SA 2ZI2H 4NWKA 4A7IB 4ZH8A 1TONA 2CMYA 3P17H 1DM4B 4ABDA 3I29A 1IQHA 2HLCA 3BTWE 3TU7H 1TPSA 2ODPA 1TX8A 4A1VA 2H6MA 8KME2 2GV6A 4TY6A 1LO6A 3Q3XA 1EZSC 1JIRA 2DE9A 2QIQA 2PSXA 1AFEH 2VIPA 3A87A 1HAHH 3TNSA 4I7YH 3Q77A 3QN7A 3SV6A 3DFJA 3LGIA 3TJUA 1MTUA 1CGIE 2JH0D 2GMTC 1UTLM 1NM6A 2BD7A 2F9BH 1TAWA 1C5NH 2NU2E 1YYY1 2TGPZ 1MUEB 5BRRE 1NFYA 1W11U 4I8LA 5JPMH 3MOCA 4BAOB 1D3DB 1Q3XA 4BOHA 2J95A 2BD4A 3PB1E 5FHTA 2AYWA 2BQWB 1KY9A 5I25A 1G30B 3F6UH 3IWMA 3FFGA 2ZDKA 1YCPM 2WUBA 2ZPQA 1YPHC 4OS2A 1P57B 3RXTA 3RXMA 4SGBE 5DPAA 2H9HA 2BY7X 3UR9A 1ZHMA 5IDKA 5E8EH 4I31A 3RXAA 1EB2A 4X8UH 1ETSH 3BG4B 5LH8A 1QL9A 1KSNA 2CN0H 5DGJA 1BMMH 3BTHE 2A5AA 3PTNA 2CV3A 1KXAA 1QQUA 1HAVB 5CMXH 1GGDC 1V2OT 3SUFA 1YLCA 1EXFA 3P6ZB 4ISHH 2BY9X 1A2CH 3C27B 2J2UA 1G3BA 2SGAA 1XXDA 4YO9A 4ABIA 1AGJA 2AGEX 1H9IE 1B7XB 2O8TA 4NGAH 2C90B 1OOKB 3PM3A 2R2WU 1O35A 3A7YA 4NZQA 2ZCHP 2G8TA 2QXGA 1CSOE 2FMJA 2GVFA 2OQUA 3VB4A 1Q31A 3LOXA 1C5WB 2BD9A 4OS6A 1C1OA 1G3CA 4F49A 4IN1A 1K28D 2OC1A 3TH2H 3KF2A 5A8YA 1GJBB 4GUXA 4X0WU 3TGKE 3R0FA 1HIAA 1C5UA 1O5FH 2P8OB 1VITH 2STAE 3LONA 3O8DA 1A0JA 6CHAB 3NWUA 5FPYA 1S85A 4A92A 2GZ8A 1UTKA 3SJ9A 4E06H 3RXPA 1V2ST 2OBQA 1FMGA 1WSSH 5F8TA 4AFSA 2BDHA 1SGRE 2FOMB 4B73A 2BVRH 1A3BH 1D3PB 2GZ7A 4LOYH 2UUKB 2XBVA 1HAVA 1RS0A 4MVNA 4B74A 2YNBA 2BX4A 1Y3YA 4AB8A 5JBAS 1O39A 1K1OA 1QL8A 1YPMH 3A88A 1Y3WA 5EODA 3TH3H 1BDAA 4AB9A 3V13A 2WPMS 4E7RG 2EEKA 1CA0B 4YOIA 3PMAB 2M5TA 2CHAB 2OC7A 3GCOA 4OGXA 1O30A 5T6GA 1YGCH 2ZCKP 1EB1H 2H9EH 2P3UB 1XXFA 1GJ6A 2QF0A 1OWDA 3UY9A 1ZGIA 4IBLH 1WYKA 3RXRA 3ZZ7A 1UTOA 1LQDB 1FI8A 2DE8A 1JMOH 1Y3XA 2Z3DA 2A4GA 2AIPA 2PFEA 3PLPA 1UVUH 3FP6E 2FOFA 1TPPA 1XUFA 3S9CA 1Y5BT 2Z9LA 3ATLA 1C4U2 1TNIA 3SJ8A 1QRWA 1HAYB 1EX3A 1Z8JB 1GI6A 3E0NB 4JK6A 2ANMH 3RXOA 1XUGA 1ESTA 2B5TB 3HGNA 1AFQC 4MNYA 4YT6H 2XWBI 2ZHWH 3RXVA 3MFJA 1DVAH 1E38B 1KXCA 4U30A 1DICA 4X8SH 3M5MA 3VB3A 4CRBA 1BT7A 1ELTA 3M5NA 3S69A 5GIBA 1O3EA 2BD2A 1BTZA 2R2MB 1BMAA 4NZLA 3UNSA 1RTKA 3H7OA 2VB0A 1VITF 2G55A 5CHAC 1H9LB 3SUDA 2ZFQH 1DWCH 2ZO3H 1CVWH 1AZZA 1UJ1A 5FCKA 1Z71A 4MLFB 4BAMB 4K5ZA 4A1XA 4TPYA 1BZXE 1GI4A 3ATIA 4ABGA 3IG6B 1TMTH 4MPVA 1N8OB 1S6HA 1XX9A 2ZDVH 3D65E 5FX5A 1V2TT 1DFPA 4TY7A 3UR6A 3B8JA 1Z8IB 3ELAH 1VITG 1BMLA 1AMHA 3RXQA 1VCQA 1P0SH 3RUOA 3R3GB 2A2QH 1QJ7B 1A46H 3VXEH 5AHGH 1THPB 4QT8C 1EP5A 2FDAA 4Q7XA 1GMDF 3ATWA 1O32A 2QA9E 1ABJH 3MO6A 1HB0B 4MDSA 1J15A 2ZFRH 1ELEE 4YOJA 2PKSC 2TRMA 1KIGH 3MWIU 2G5NA 4LK4A 4DVAU 3S9BA 4PROA 4CRDA 2ZTYA 4UDWH 1UVTH 1GMDG 2PGQB 3F1SB 1SQTA 4FUJA 1GMCF 5GJ4B 3MH7A 2BZ6H 1C5MD 1FLEE 4Q2KA 1GI9B 1JBUH 1NY22 2A45B 1SOTA 1SQAA 5EOKA 5DP6A 3BIUH 2GCTC 4NIXA 1OX1A 1C5VA 3OY5U 4INKA 1K1PA 2ZF0H 2FOHA 4HGCA 2I6QA 4E7NA 2SNWA 2Y81A 4GCHF 1G3DA 3T5FH 2RCEA 1ESBA 1QRXA 1XVOA 3PROA 1Z1IA 1DE7H 2VGCC 1LHGH 3T62A 1FAXA 1RFNA 5DJ7A 3LJJA 1OYQA 1T8LA 1TE0A 4JYUH 1NFXA 1FY3A 2EI7A 2XTTB 5AFYH 1HV7A 4X6MA 2QXHA 3HK6B 3CENA 1TA2A 2ULLA 2ZDMA 1GBHA 1V2UT 2VWLA 3TLOA 3URCA 1P12E 1JRSA 5JYIA 1K2I1 1SR5C 2LPRA 1Y59T 1FAKH 1OYTH 3FVFB 2JETB 3E8LA 1TA6A 2CGAA 4CREA 3OYPA 1XUKA 3OY6U 4GHTA 2A5KA 1QCPA 2ZWLH 1QIXB 2K1QA 1X7AC 1SC8U 3KQCA 4UFEH 3RM2H 1O3LA 5ESTE 1NU9A 3FANA 1YPLH 2G4TA 5L2ZH 1O38A 3DUXH 3SNDA 3RXLA 3ZVEA 5E2PA 4IMZA 1F5LA 1Y8TA 4NCYA 1ZSJA 3SU0A 1P03A 2AEIH 3PO1B 1MZAA 3KGPA 1DSTA 1OWHA 3E16B 3SU3A 1C5PA 3GYMA 1D9IA 1QQ4A 1Y5UT 5EPNA 1IQNA 1LCYA 4D7GA 1FIZA 1BTXA 1MKXH 2ZC9H 2PTNA 1N6YA 1SGEE 2PKAA 2WV4A 3ZYDA 2HVXA 1YPJH 4ZROA 1O37A 1V2LT 2DUCA 3MNXA 1CBWC 1HCGA 2BY8X 2VU8E 3KNXA 1DPOA 2FX6A 3GDVA 3F68H 4FUIA 1YPKH 2FPZA 1GVLA 4GLYA 3A7TA 1VR1H 1F0TA 4IN2A 2FP7B 8GCHF 4CR5A 4RSPA 2I6SA 4ZUHA 3SI3H 5LPRA 1GJDB 1PPZA 4O97A 2F83A 2A7JA 1O5GH 1GBMA 1O3BA 2A2XH 4O03A 3UFAA 1JRTA 2P59A 1EZQA 4WMEA 8GCHG 4HTCH 4YM9A 2PW8H 5E0JA 2ZU4A 3MU4A 3ZV9A 3T29A 1TB6H 1SHYA 4WWYA 4JYTA 4H6SB 3M7TA 1Z6EA 1GVZA 1K21H 2V0BA 2Z9IA 1FY8E 1C5RA 2VH6A 5J4SA 1AB9B 1P9UA 1GJ8B 1PYTD 2FOCA 3DD2H 3TITA 1G3EA 2VVCA 4KTCA 1QBVH 2OP9A 1O5DH 4B1TA 1G32B 2HWLB 2A0QB 2NU1E 2QC2A 1TBZH 4BTTB 3M7QA 1UCYH 3GDSA 5TCAA 2ZHFH 3SORA 3BSQA 2BVSH 1YBWA 3GISB 1V2QT 4NSYA 3GDUA 3RMNH 1FY5A 1JXPA 1NRRH 1S83A 2VNTA 1TMUH 3SNEA 3BG4C 4B2AA 3ZZ8A 2W26A 1SGIB 1O3IA 3A86A 2XBWA 1V2JT 1GDQA 2V3HH 2ODQA 3U69H 4WMFA 3U8TH 4A1TA 1BTYA 3U9AH 5GCHF 1QRZA 1IQFA 1DSUA 1GI5A 5GXPA 5EXLA 1AQ7A 1TMBH 1NRQH 3PTBA 4X1RU 1AY6H 1SQOA 2V6NA 1LPGB 1TOMH 2ZA5A 3RU4T 1O34A 1MD8A 1TRYA 4D76A 1MTNB 1P06A 5A2MH 2HGTH 1GBCA 3SUGA 2OINA 3T27A 4J2YB 3UUZA 1JWTA 5DG6A 2G00A 5GCHG 1C5OH 1GCDA 2J9NA 4Y0YE 1TALA 1P2NA 3QZRA 1NC6A 3ZZ3A 5E0HA 2ZHDA 1UVPA 1A4WH 1TLDA 5L6NH 2VIOA 1BTWA 2BVXH 3RC4A 3O8RA 1GPZA 6CHAC 1AVGH 1FV9A 1O3JA 2H1UA 2NWNA 1IAUA 2VH0A 1O2KA 1RD3B 1W7GH 4JZDH 2QGRA 3SN8A 2OC8A 2O8LA 3A7ZA 1N1LA 1IHTH 2ZGBH 4JK5A 1DOJA 1RXPA 1C1UH 4YESB 1V2KT 4MPXA 1DXPA 4A5TS 1C1VH 2O8MA 2ZU2A 1GI0A 3SI4H 1BTPA 1HXFH 3GYLB 5C3NA 3LDXH 2C93B 3MU1A 5LPEA 1CA0C 1ESAA 2CHAC 5T6FA 1D6RA 1GHVH 2ANWA 1EPTB 3Q00A 1SGCA 4K1EA 2OUAA 2Z7FE 4TPIZ 1WTGH 3RXIA 4GHQA 1QNJA 2PR3A 2JH5D 1FN8A 2VWOA 2QY0B 4RN6A 2XW9A 3GCTF 1C1PA 4U32A 3P70B 3A7VA 4JZEH 1GCTC 2ZKSA 1KTTB 4ABJA 1FPHH 2OLGA 2BD5A 2BZAA 1LHCH 3SNCA 4D7FA 4NWLA 1AU8A 3U8OH 3P95A 1BRAA 1K1LA 3GCTG 1NESE 2FTLE 2J38A 2TGDA 1UHBA 3M3TA 4YLUA 1H9HE 2YNAA 4X2XA 5JBCS 3V7TA 3UWJH 1KXFA 1ZRBA 3RMLH 1NS3A 4BXSA 1GL0E 1O2TA 4WVPE 2Z94A 2STBE 2GCHF 1SOZA 5C20A 1SGPE 1YCPK 1P2OA 1AKSA 4DJZB 1TIOA 5C67A 5HMAA 3SBKA 1AUJA 2BDGA 5B6OA 7ESTE 1EJAA 5GWZA 4ZKOU 3ZVCA 3W94A 3GY6A 4Y6DA 2HNTF 1L4ZA 1MKWH 1QB6A 3BIVH 4DY7B 1QR3E 2GCHG 3ZZ6A 4K1TA 1P2KA 1O2YA 3SJOA 3E6PH 1XKBC 2GZ9A 1G2LA 1GJAB 4O3TA 1C2JA 5C5OA 2ZU5A 4JMYA 2BLQA 1SGTA 3TJNA 1QGFA 1IQEA 1TNJA 4ISOA 5C1XA 1TGSZ 1QJ1B 3L3TA 1S84A 1N8OC 1TX7A 4B71A 2BHGA 1SB1H 2ZPSA 3SV9A 2B8OH 1LHEH 4WH8A 2QV1A 5DO4H 1W13U 2WUCA 4X1NU 1Z7KA 3EE0B 1OP2A 1C5ZB 4D9RA 1H8IH 1P2IA 1V2WT 3PMBB 3K65B 4UFFH 1TX6A 5A8XA 2BLWA 1GJ7B 5EXNA 3VPKA 1O5CB 1TRNA 2ZIQH 3DA9B 4ASHA 1UK4A 1AHTH 1AE8H 2SGFE 1NTPA 3FZZA 1TBRH 2QXJA 3A82A 7LPRA 1O33A 1AD8H 1D6WA 3ZZDA 4JZ1A 4UE7H 3RC5A 5DP3A 1K22H 4F4OC 1SLVB 4FUGA 4X1QU 2FS9A 3QTOH 4CHAB 1EP6A 1FJSA 3C1KA 1T4VH 3ATKA 2Q1JA 1AWFH 1H8DH 4NG9H 3P8NA 4DOQA 1UCYE 1E37B 4R0IA 1SL3A 3RDZA 2VIVA 1FDPA 4U2WA 4X6PA 3UPEA 1L1JA 3M3VA 5DK1A 1PQAA 4IC6A 5GDSH 3LU9B 1T32A 3RXBA 1S0QA 3SV7A 1C2HA 4ZXXH 2THFB 5C5NA 1YLDA 2HALA 1Q2WA 1C5XB 5BPEA 3SU1A 3UNQA 1NO9H 1W8BH 2HRVA 4U01A 2VIQA 4NA7A 4X8VH 1LPKB 1D4PB 1O2GH 5F8XA 3GY5A 4ZHLU 4BXWA 1C4Y2 3HPTB 1S6FA 4XE4A 4Y76A 4X1PU 4YLQH 2QCYA 1DWBH 1FN6A 2AGIX 1DS2E 3ZVAA 1TQ0B 2FI3E 2PGBB 1ZRKA 1FUJA 3E3TA 1ELVA 4FUCA 3SO3A 1O2OA 1GHYH 3GOVB 2HNTE 4K69A 1F0SA 4K2YA 1EZUC 3NCLA 1J17T 1O2MA 1TABE 1EASA 2ASUB 1CA8B 1BRBE 2JETC 2UUJB 3SU5A 4AGJA 4XOJA 1ZMJA 2OXSA 1ZSLA 2PLXA 1P01A 1W12U 5EXMA 2W5EA 3LH1A 1W0YH 3M5OA 1IQKA 1MU8B 3N7OA 4JZIA 1YPEH 1TBQH 2ZQ1A 1PQ5A 3CS7A 1O3CA 1O3NA 1P9SA 2BX3A 4MG3A 1ETTH 2ZZUH 1EAUA 2GP9B 3UREA 5EQSA 2FYRA 2A31A 1WOFA 1GVKB 4VGCC 4ABAA 2FS8A 1AE5A 4B2CA 1KYNA 2FZZA 2GMTB 3AW0A 2UWLA 3K6YA 1ETRH 4XDEA 1AUTC 1SHHB 1HAIH 1ACBE 1C1QA 1ZSKA 3TPIZ 3KCGH 1B0FA 7KMEH 2FWWA 2ZFPH 3MO3A 2V35A 3OSYA 3ZZ9A 3PO1C 1CGHA 1AI8H 1KXDA 4LZ4B 2FM2A 1HGTH 5EPYA 5F6MA 1BOQA 3GY7A 4CRGA 1LMWB 2FI4E 1GJ5H 1MBMA 1BA8B 1DWEH 1NFUA 5LPFA 2FOAA 3BEIB 2ZDAH 1O2PA 5EG4A 3T26A 3L6PA 1P2JA 3RLYH 1NROH 4NA9H 1YM0A 5HGGA 1OP0A 1MU6B 1AVWA 4OS5A 2AFQB 2ZU1A 2IN2A 1BBRH 1TFXA 2Z3CA 1GGDB 4Y8XA 3S0NA 3QGJA 3UTUH 3VEQB 1PQ7A 2GV7A 3KEEA 3MU8A 1AWHB 4NFFA 2PV9B 4ABFA 4MQAA 4DIHH 1EJNA 2SFAA 3EGKH 3ODDA 1TNHA 2ZPRA 2XBXA 2PWXA 1O2UA 4DW2U 3ZZCA 1V6DA 2ANKH 5A8ZA 5EGMA 3BTME 3RXUA 3VGCB 1Z8GA 2BDAA 1OP8A 3MH6A 2HOBA 3U8RH 1C1WH 1K9OE 4A6LA 2GTBA 2CXVA 3CS0A 1O2LA 1RJXB 5J4QA 3OX7U 3RXGA 1LDTT 3K9XB 3M3SA 1HXEH