1YC0A

Short form hgfa with first kunitz domain from hai-1
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
Knots found
sequence length
254
structure length
247
Chain Sequence
ACGRRHKKIIGGSSSLPGSHPWLAAIYIGDSFCAGSLVHTCWVVSAAHCFSHSPPRDSVSVVLGQHFFNRTTDVTQTFGIEKYIPYTLYSVFNPSDHDLVLIRLKKKGDRCATRSQFVQPICLPEPGSTFPAGHKCQIAGWGHLDENVSGYSSSLREALVPLVADHKCSSPEVYGADISPNMLCAGYFDCKSDACQGDSGGPLACEKNGVAYLYGIISWGDGCGRLHKPGVYTRVANYVDWINDRIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/inhibitor
molecule keywords Hepatocyte growth factor activator
publication title Conformational lability in serine protease active sites: structures of hepatocyte growth factor activator (HGFA) alone and with the inhibitory domain from HGFA inhibitor-1B.
pubmed doi rcsb
source organism Homo sapiens
total genus 63
structure length 247
sequence length 254
other databases KnotProt 2.0: Artifct K -52 -31
ec nomenclature ec 3.4.21.-:
pdb deposition date 2004-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1yc0A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1yc0A01
1FV9A 3ZVEA 1EZUC 1TNIA 2GP9B 2ASUB 3PV4A 1TBZH 2B8OH 3GDUA 1IAUA 1HAGE 1RTFB 3MFJA 5DP8A 1P09A 3QGNB 4AYVB 2Z94A 3ZV9A 4E05H 3BTKE 2O8TA 1RFNA 2BLQA 2ZU1A 3EDXB 4ZHAA 1BQYA 1MTSA 1C5MD 1Y3UA 2SNVA 3M5MA 4Q7ZA 4YO9A 4MVNA 4NWKA 3VB7A 2VIOA 3SHCH 1QTFA 1P02A 1DY8A 3M61U 4NA7A 5EOKA 3V0XA 1A5HA 4HI3A 3W95A 2ZDMA 1PYTD 3ATWA 1BTWA 4I8GA 1DICA 2VWLA 3G01A 2BY6X 1F0UA 3A7YA 2F91A 3LC3A 3LKWA 1NRNH 1SL3A 1HAPH 1C1QA 1Z71A 1XUJA 1AKSB 1C5YB 1T8MA 5A0BA 2SGQE 2ZFPH 5SGAE 2AGEX 1J17T 4NSVA 4X2VA 3SUGA 5GJ4B 5EQRA 1BTXA 1C5UA 1A2CH 5T6FA 2PFEA 1WOFA 1HCGA 1C5NH 1DS2E 1AHTH 3K65B 3HGPA 2BD3A 5GXPA 1W7GH 4AFQA 2ANKH 3KIDU 1CHOG 2FESH 4FUHA 1OPHB 1SGYE 1MTUA 2ZECA 2ZQ1A 5EODA 3TPIZ 1O34A 1FDPA 2QIQA 4K69A 1PPZA 1FAXA 1LHGH 3ATMA 1O3AA 3GDSA 1AZZA 3RU4E 1Z8GA 1GHBG 1OWJA 3AW1A 2F9VA 1W3CA 3RXIA 1DWCH 1GGDB 1IQNA 2LPRA 1MQ6A 1CT2E 1GL1A 2HNTF 3A7VA 4WMFA 4AYYB 4FUGA 4BOHA 1NM6A 2OUAA 4YM9A 2NU4E 4X8SH 2ZA5A 4ZMAH 4Y8XA 1Y5AT 3UPEA 1G36A 1P0SH 3FP7E 2NU2E 1LPZB 3FANA 1GBMA 1GJCB 1XUKA 4GHQA 3P8FA 5C1UA 1EAIA 2CXVA 1ANDA 1IQFA 2G55A 1SQTA 4ISNA 1OWDA 1LHEH 3QX5H 1QBNA 3EA9A 1FN8A 1GMDG 1T8NA 2VIQA 1S85A 3SGBE 4XDEA 4J1YA 2ALPA 3IWMA 4MNWA 3ZVAA 8KME2 1YPEH 2OQ5A 4E7NA 3PM3A 3JZ1B 1O3FA 1SLWB 2Q1JA 3SUFA 3BEIB 1OKXA 5GWZA 1KY9A 4I31A 3LU9B 5BPEA 3RXMA 1S0RA 2AEIH 3Q00A 1A0LA 1P03A 4MTBA 3RUOA 1GBBA 2CF8H 1GI4A 1V2JT 5E8EH 5K7RA 2ANYA 1QA0A 5C67A 1XUHA 3MI4A 4UFGH 2LNCA 1AVGH 2H2ZA 1O35A 1HAVA 1HJ8A 1EJMA 2ODQA 4NA9H 4AB9A 3SJIA 4AGJA 2QV1A 3DFJA 3A8CA 1TQ0B 1ABIH 5C5OA 3GCNA 1CQQA 3KQDA 1ZJKA 1EOLA 4ZXXH 3O8RA 2BVSH 4WF8A 5AF9H 1NU7B 3KQCA 4GHTA 3U98H 4GVUA 2Y82A 2XCFA 4IC5A 3TLOA 3TH4H 2A1DB 4X6NA 4X2XA 1BT7A 1T7CA 1EPTA 1O3LA 4K1TA 7KMEH 4FUFA 1C2MA 2BY8X 3CS0A 5GPIB 3U1JB 3AAVA 1JIRA 1K9OE 4U2WA 4A5TS 1SR5C 2XCNA 3GCHC 1NFYA 1YM0A 2QF0A 2AGIX 4JYVH 2UWOA 4K8BA 1J14A 2PHBA 3A84A 3RXGA 9LPRA 3MMGA 4ZUHA 4JZDH 1O5AB 5EXMA 4I33A 2PGBB 4MPUA 3VB3A 1VITG 1KSNA 5L2YH 3PLPA 2RA0A 2GV6A 2FODA 5GCHG 3ITIA 3TGJE 1TX7A 5F8ZA 1FY4A 4OS1A 2OC1A 2JETB 3D65E 3TU7H 1C2KA 1GI1A 3ELAH 2XBWA 2Y5HA 4B71A 3MO3A 3TJVA 5EQQA 3LONA 3PTBA 2J95A 3SU5A 3QO6A 4BTIB 4X2WA 1XXDA 3I29A 1N8OB 2BY7X 3GDVA 1O3GA 3SV8A 2CN0H 1RS0A 2H5DA 2D2DA 2D8WA 1O2TA 1O2WA 3CS7A 2V6NA 1CA0C 1UO6A 2C93B 2ZGHA 1MCVA 1BBRH 2ZNKH 1O2IA 4FVBA 1PPFE 1G2MA 1KLTA 1VGCC 2XC0A 4CBOA 3OX7U 5JB9S 3SORA 3RM0H 5I25A 1FONA 4K1EA 1YPJH 1HJAB 3EGKH 1DOJA 1BZXE 2M5TA 1F92A 2FDAA 4DW2U 1QY6A 1MBMA 3UFAA 4X0WU 3ZZ5A 3RC6A 2W26A 1F0RA 2FS9A 2FXRA 5F8XA 1QJ1B 1AO5A 4K1SA 1DY9A 1RJXB 4OGXA 1DX5M 1O5CB 1VZQH 2BB4A 2ZO3H 2OTVA 2AIPA 2SGDE 2ZHEH 1FUJA 1AVXA 3NK8A 1MMJN 4KP0A 2ZGXH 1K1NA 1LTOA 2Z9GA 1AKSA 4SGBE 2QC2A 4WMEA 2VB0A 5JBCS 2VH0A 4I8JA 3BG8A 1ELVA 1ANCA 1BJUA 1GDQA 1SGNE 2GTBA 1ZPBA 1ELCA 4Z6AH 1KTTB 1QFKH 3A8DA 4OS7A 4JZ1A 4ZAEA 1T8LA 4HZHA 2AS9A 2Z9LA 1ANEA 1HDTH 2FEQH 3LGYA 4YT6H 1YC0A 2RDLA 1NRRH 4I7YH 3ZZ9A 3F9GA 2Y80A 1Z1JA 1LVBA 3SN8A 3A8AA 3PMBB 4X8VH 1O3OA 2BQ7B 1OSSA 2UUKB 5FHTA 2Y6TA 1H8DH 4CREA 4A7IB 2A7HA 1Y59T 1P3CA 4H42U 1D3TB 5L30H 1TA6A 2PKAB 1V2PT 1O30A 2HNTC 3NUMA 3KGPA 4A92A 1Q31A 2A4RA 2O8LA 2CHAC 1EB1H 5C1XA 3HGNA 1AMHA 2R3UA 4YZUA 5T6DA 3R0FA 1TPOA 2FPZA 1EX3A 1GI2A 1SGCA 1MKXH 2GDEH 3BTEE 3AAUA 1MZDA 2BD8A 2RG3A 5E0GA 5DP4A 3RLYH 1YCPH 3H5CB 1MKWH 5HGGA 1TBRH 3ZZ3A 4BTTB 1THPB 2WV5A 3A89A 1D6RA 3F6UH 1ELFA 1HAIH 1W11U 2XTTB 2HRVA 4KTUA 3DD2H 1P2KA 2SFAA 1RD3B 4D7GA 4IGDA 4WXVA 1P57B 5DK1A 2V3OH 4I8LA 5JBBS 1P8VC 1PYTC 3BTTE 1YLDA 3GOVB 1EZXC 1THSH 2Z3EA 2AH4X 1H9HE 1L0ZA 2XBVA 4ISOA 1ZSJA 4TPYA 4Y76A 1ETSH 1AY6H 3UIRA 4IC6A 3SJKA 4AB8A 4D76A 1O3NA 3LC5A 1G2LA 1P9UA 2R2MB 4GAWA 3F9HA 5C2ZA 2VWOA 5EQSA 1S83A 2ODPA 4MPVA 1T4UH 3Q77A 1TONA 1ZHRA 3GYMA 4RKJB 4XFQA 3M3TA 1AWFH 1QNJA 3M36A 1S6HA 2UUFB 1MD7A 4AN7A 2FIRH 3SI4H 2R9PA 1ZLRA 1XUGA 3PMHB 5DP6A 3MH7A 4BAOB 2PKSB 1BA8B 1OWIA 1UTLM 1GJ9B 1HNEE 1UVUH 1NC6A 1QIXB 3TK5A 2BY5X 1S84A 4FU9A 2RA3A 2P8OC 3PO1C 1QHRB 5K0HA 3SO3A 2ZEBA 5GDSH 3U9AH 5A09A 2WPMS 3OSYA 1QL7A 1V2WT 3M5OA 4XBBA 1UTJA 1UTNA 2DE9A 1PQ8A 4NSYA 2QY0B 1O2GH 1QURH 1Y8TA 1GBDA 1EASA 2ZHFH 2BDCA 1BTZA 4O3TA 2AFQB 4FUCA 4Y6DA 4CRCA 4ABHA 1K1LA 1UK2A 1LKBA 1GBJA 1FY8E 2A4GA 2CMYA 3A86A 5EPYA 3ZVDA 3HK6B 3DUXH 5C5NA 1Z6EA 2FYRA 1FNIA 1GI3A 2F83A 4XBCA 1GMHF 3A87A 2A5AA 2JH0D 3F68H 2OP9A 3NKKA 1OWEA 5FPYA 1T8OA 3QK1A 4JYUH 1ZMNA 3E8LA 4ABIA 1NS3A 4K3JA 1IQKA 1ZJDA 4ABFA 1EP5A 2TGAA 4YTAA 4IMZA 1WBGB 2ZDAH 1U6QA 1VCQA 1AFQC 2BDAA 4INLA 3PMJA 1ELBA 2ZF0H 1Z8IB 2OC7A 4NGAH 1O5GH 1CVWH 3VXFH 4JZFH 5IYTA 1DPOA 2J34A 2WV4A 3V13A 1H9LB 4UD9H 4IS5A 1ELDE 2G8TA 1EKBB 1C5ZB 1C4U2 2GD4B 3BTME 3ODFA 4KELA 4DY7B 1P2IA 4KKDA 4FUIA 2BHGA 1DE7H 2BD4A 1E34B 1TLDA 3EA7A 2GV7A 1UK3A 1O3HA 2A7CA 2PLXA 3GY2A 4I32A 5HM2A 2XRCA 3GYLB 2G52A 4LOYH 1H9IE 4DT7B 4WXIA 4X1PU 3TK6A 5JBAS 4ABAA 2P8OB 3PO1B 1O39A 1G32B 3SU3A 5J4QA 1OYTH 1L1GA 1ZPZA 2VIPA 4D9RA 2WUBA 3QWCH 1C5XB 4YT7H 1OP2A 1C2HA 1BTPA 1THRH 1UVTH 1K1JA 1O3MA 3SHAH 1PQAA 1C1TA 5F6MA 1C1OA 2BYAX 1QBOA 1CGHA 1EXFA 3T25A 1NFWA 1BRCE 3ZZDA 3KQBA 1TBQH 4Z0KA 2NU1E 3A80A 3ZVCA 3GICB 1NRPH 2ZU2A 3F1SB 1JOUB 1O31A 2WPLS 4AFZA 3RC5A 4YOGA 2BLVA 1P06A 1GI6A 1SGDE 3V7TA 1ZSLA 1UTOA 3VB6A 3ZZBA 1P2MA 2FOBA 2H9EH 2VIWA 2Z6BD 1H1BA 4GSOA 4DVAU 1O2OA 4Y7AA 4Y0YE 1WTHD 3TH2H 1KYNA 1V3XA 2CV3A 3UUZA 1T32A 1C2FA 1G3BA 1HPGA 4X1RU 2XYAA 1AFQB 3ESTA 3DA9B 4R0IA 3Q3YA 3SV6A 1ZRKA 1MU8B 3MHWU 4ZKNU 3TJOA 1HRTH 1S6FA 1EJAA 3RXBA 5BRRE 2FX4A 4AFUA 1TOMH 3SW2B 1SHHB 2ZC9H 2WYJA 3GISB 3MO9A 1GHAG 2A5IA 3O8BA 4K2YA 2FOAA 2G81E 3ZZCA 1E35B 2A4OA 4MLFB 1BTHH 1XX9A 5F03A 1QB1A 2BQ6B 3UR6A 6GCHG 2ZFTA 3MH6A 1DLEA 3RU4T 2BD5A 5AVDA 1A0JA 1EATA 1F5RA 2GZ7A 1IQGA 3GY8A 4J2YB 4DGJA 1QL9A 2GCHF 2ZU3A 3AW0A 1VITH 1D9IA 1NPMA 1C1RA 3M5LA 1E38B 1GVZA 3KQEA 1KXAA 1QGFA 4AG1A 1AFEH 3U8RH 1FIWA 1XUFA 3GCTF 2CJIA 5C1YA 2YOLA 4B2CA 1DVAH 1KDQA 1CU1A 3PROA 1N1LA 1VJ9U 5LPEA 2ZFSA 3RXDA 3DT0H 1P11E 4WJG2 4JZIA 1DXWA 3K2UA 4MQAA 1SQOA 4ABGA 1B5GH 1VJAU 4LZ4B 2OD3B 3ZZ4A 1O2SA 3P6ZB 1W0ZU 1LO6A 2GGVB 1GDUA 4Y11E 1BMLA 1O2JA 1YKTA 3M3VA 4IW4E 1RIWC 1HXEH 3A7ZA 1DITH 2JKHA 4GCHF 4JK6A 1C5PA 5FX5A 1FPHH 1L2EA 4UFEH 1UHBB 2Y5GA 1V2LT 1UVPA 2ZKSA 4X1NU 3RXKA 1AI8H 3A7XA 3MWIU 7GCHG 3VFEA 2ODYB 4XSKU 5JPMH 4ZKRU 4OS6A 6ESTA 2PR3A 1NY22 1DT2A 3FP8E 3UOUA 3L6PA 1GWAA 1TFXA 1IQHA 2C8ZB 3STIA 4NIVA 1GVLA 3RXRA 3SV2H 2VNTA 3RU4D 2VIDA 2JETC 2UUJB 3DFLA 5T6GA 1CHGA 3RXEA 1IQMA 2BXTH 1O3IA 4DG4A 1UTMA 1ESBA 1LHDH 1MTWA 4WH8A 5E2OA 1N8OC 4CRGA 3IG6B 1G3EA 6LPRA 2ZP0H 1T4VH 3U69H 1Y5BT 4WH6A 1QQ4A 2B7DH 1DLKB 3BTGE 1GMCF 1TNJA 3UWIA 1RTKA 1O5EH 1C5SA 3STJA 2GDDA 2ZDVH 1SI5H 3U8TH 3VEQB 3UWJH 1GI8B 4U30A 1HJAC 1HBTH 5E0JA 1RGQA 1P2NA 4XBDA 4Y0ZE 1MCTA 3RXPA 5DP3A 1HGTH 1OWHA 1UK4A 4OS4A 1V2NT 1BBRE 3QLPH 1E0FD 1O38A 1WV7H 4ISHH 1W8BH 3SOSA 1GBCA 2Q6FA 3M5NA 1BHXB 3OYPA 2GVFA 4VGCB 2FO9A 1LVOA 3I78A 3RXVA 1BIOA 3PLKA 1YPGH 3CP7A 2TRMA 1IOEA 2P94A 2VH6A 3FZZA 3A7TA 1Q2WA 2ZCHP 2CGAA 2UUYA 3VGCC 3NWUA 1TAWA 1TIOA 1GBTA 1LKAA 1UJ1A 1IHSH 4E06H 1ZMLA 3EA8A 2BVXH 4IBLH 1O2KA 4NFEA 4D7FA 1ZYOA 4UDWH 2F9UA 1L4ZA 4ZKSU 3T28A 3UNSA 1RIWB 1O3KA 2EI8A 3LGVA 3QN7A 1F0TA 3I77A 5LGOA 8ESTE 3S7KB 3E6PH 1Z7KA 1Y3YA 2A0QB 4HTCH 1TRNA 1QJ7B 3T62A 4A6LA 2A2XH 2IJOB 3GY6A 3E1XB 1WCZA 1WUNH 4FUEA 2G5NA 3T26A 3UTUH 2PSXA 3TVJB 4Y10E 1SGQE 1K28D 2AMQA 1SBWA 3RXTA 3M7UA 1NFUA 4IN2A 1O2VA 3B23B 3LOXA 4WVPE 2FOEA 2ZHQH 5E0HA 4BAHB 3EYDA 4WWYA 1UCYE 1LQEA 4XE4A 5CMXH 3P8GA 3SV7A 4B2AA 2BD9A 1FI8A 1CGJE 1F2SE 2ZTZA 4U32A 2ZI2H 1YF4A 2K1QA 1GL0E 2HOBA 1J16A 4AG2A 3D49H 3A88A 3KNXA 2SNWA 1O3JA 1YGCH 1EZQA 4TWWA 1LQDB 5B6OA 1O2ZA 2G51A 3EE0B 3RP2A 5FPTA 1GCDA 1O5BB 1X7AC 1BTYA 3MH4A 1GHXH 3P95A 3LH1A 1HAYB 1OWKA 3HK3B 3RXLA 3D23A 1C4Y2 2HGTH 3KCGH 1D3PB 1WQVH 5CHAB 3SJOA 1ELGA 2FOHA 2QF3A 4A1XA 2G4UA 3UNQA 2GZ9A 2FOFA 1A4WH 1ARCA 3QTOH 4Q2KA 3OU0A 3VGCB 2GT8A 2CF9H 1CSOE 3SGAE 1OXGA 1F5LA 3HPTB 3QTVH 2BMGB 5PTPA 2BOHB 1B0EA 2V0BA 3UQVA 8GCHF 4YOJA 4CBNA 1D6WA 3LIWA 4ISIH 1PPHE 2XXLA 5CE1A 2YNAA 1BRBE 3MU5A 2GMTC 1F7ZA 1W10U 1WSSH 1J15A 2ZQ2A 3LGIA 2PKSC 2ZFFH 2P59A 1PJPA 3URCA 2ILNA 2Z3CA 5TCAA 3MU1A 2NU3E 3OY5U 4FU8A 5JYIA 4AZ2B 3RMOH 1MTNB 3D62A 1C2EA 1UCYH 1GJ7B 2QN5T 1MAYA 4UONA 3A7WA 5EXNA 4HGCA 3ZYDA 1XMNB 1NRSH 1O33A 2SGAA 4X8UH 1ESTA 5DP5A 4DIIH 1GI5A 1EZSC 1HAXB 2VVVA 1EOJA 1P2OA 1A3EH 3GY4A 2HVXA 1ZTLA 4E7RG 1AB9B 1GJ8B 1GHZA 3BG4B 1LPGB 1JXPA 1WQSA 5DP9A 4D9QA 5A8XA 1PQ5A 3BSQA 5F8TA 1YYY1 1GCTC 6CHAB 1TGTA 3UREA 1TPSA 3PMAB 2STBE 1DFPA 1GDNA 2FYQA 3NXPA 4BNRA 2G4TA 2Z7FE 3B9FH 1GJDB 4F49A 3TGIE 5EG4A 3KF2A 1BTUA 1BMAA 1ID5H 3HKJB 4O03A 3MU0A 2GZ8A 1AUTC 5EXLA 1ETRH 2ZHDA 3ZYEA 1K21H 3HKIB 3P17H 1NRQH 2BQWB 4GPGA 1IHTH 2QAAA 3RM2H 2XW9A 1SGFA 2KAIB 2BX4A 3GCOA 7ESTE 1Y3XA 2FOMB 1EAXA 3C27B 3S9AA 4XOJA 1D3QB 2VWNA 3VB4A 1LVYA 1YPKH 2BLWA 1DWBH 1SFIA 2XBXA 1N6YA 1BHXF 2FLRH 2TIOA 5JB8S 2F9BH 5C3NA 1ELAA 2ZIQH 5HM9A 1O37A 3QDZB 3AVZA 3LGUA 5AHGH 2QXJA 4A1TA 1ACBE 1HFDA 1DANH 5A8ZA 4AGKA 3UY9A 1BRAA 1HAHH 2GMTB 2FS8A 3LGTA 4RSPA 2J38A 2I6SA 4X1QU 2UWLA 3UR9A 1FN6A 1TGCA 2I6QA 1P9SA 4JZEH 4CRAA 1S82A 2BD2A 4DOQA 2G00A 1YPMH 4LZ1H 1PPBH 1SFQB 2BM2A 1GI9B 3LJJA 1WTGH 2W3KA 4INHA 1OYQA 1AU8A 3NCLA 3RXCA 3W94A 3SNCA 1Z1IA 1KIGH 1J9CH 4ZHLU 4DJZB 3ZV8A 1TNLA 2ZWLH 2A45B 4IN1A 2VWMA 1TB6H 2THFB 1S81A 2B9LA 1W14U 2BDGA 4NA8A 3RXHA 4X6PA 1ORFA 2PUXB 3SU2A 5DKMA 1A46H 1A61H 4K5ZA 1GCTB 4YOIA 1GHYH 2OCVB 1C2JA 2PTCE 4SGAE 2TGTA 4YESB 4MG3A 1TX6A 2BOKA 1KXFA 1TQ7B 4WY3A 5DJ7A 1V2OT 2J94A 2O8UA 2ZCLP 2XNIA 1G3CA 1W7XH 1ESAA 1SMFE 1TMBH 2GT7A 1NZQH 2BDYA 4K8YA 3RMLH 3AASA 1UVOA 3CENA 1GJ5H 2AMPA 1C1NA 4Y7BA 2Y81A 1SLUB 2A7JA 4BAMB 5L2ZH 1RXPA 2XC4A 2FZZA 2J4IA 1V2QT 1SOZA 2A4QA 1OP0A 1Z6JH 1Y3WA 2J92A 4BXWA 1AD8H 1OOKB 1YPHC 4CH8B 1QRXA 2FOCA 3H7OA 3M7TA 1BMNH 1KXCA 2VJ1A 2DUCA 1GJBB 1YLCA 4JCNA 3L3TA 1W13U 2QXHA 1MBQA 2ULLA 3QZRA 1G3DA 2ZDNA 1SGFG 4M7GA 1C5RA 1LHFH 3JZ2B 3MNSA 1BDAA 4U01A 1OS8A 1AN1E 1EQ9A 1TMTH 2W5EA 2A32A 1KLIH 2H5CA 1H8IH 2EA3A 3PYHA 2SGPE 4BAQB 1HUTH 1SG8B 1CHOF 3GY5A 4ABEA 1TGNA 3RMMH 2FTLE 1SQAA 4LXBH 4CRFA 3MO6A 4HFPB 3LDXH 3KN2A 1DWEH 1C1MA 1AIXH 1C2DA 3A83A 3SI3H 2A31A 1GHBF 2J2UA 2ZTXA 3BEUA 2JH5D 2HNTE 4KTCA 3LT3A 1GPZA 2PV9B 4DIHH 4AOQA 1AVWA 1EPTB 2PKAA 3B8JA 1MU6B 2J9NA 3ATKA 4H6TA 5C20A 2P3FH 2TGDA 2OLGA 4BAKB 1CE5A 1HJ9A 1P10A 3TJUA 2OBQA 4JMYA 1ANBA 2ZGCA 2ZGJA 4A1VA 1BITA 1DUAA 1V2ST 3NZIA 1FIZA 1C5WB 4ISLA 1GMDF 1PPCE 3VPKA 1QB9A 2C8YB 1GBAA 1YPLH 1ZSKA 1QRZA 3SNEA 5HXFA 4RN6A 3BEFB 1LCYA 3MTYA 1IQLA 1O2QA 1P2QA 3RXOA 3UNRA 2ZPRA 1TMUH 2PUQH 1Z8RA 2BDBA 3T29A 4THNH 4CRBA 1GHWH 2BTCE 2PGQB 3TIUA 3M7QA 5HMAA 1GMHG 1A3BH 3TJNA 1GBHA 3L33A 1UVSH 1FXYA 2JH6D 2Q6GA 1SOTA 5EW1H 3FAOA 1J8AA 1SC8U 3ATLA 5DP7A 1EP6A 2AMDA 4CHAC 1D4PB 2KAIA 2D1JA 1CBWC 3P8NA 2IN2A 3SZNA 1B7XB 4AORA 1EJNA 2BXUH 2TPIZ 4K60A 1BCUH 2Y7ZA 5FX6A 3P92A 4ASHA 4VGCC 3RXUA 1C5OH 1G9IE 2W7SA 4TYDA 2IPHA 2Z9KA 1FJSA 1LDTT 1DSTA 4MNYA 2HPQH 1Z8JB 3KL6A 2QXGA 4H6SB 2SGFE 3F9EA 5A8YA 2F3CE 5ETXA 3SNDA 4ABDA 1SSXA 2BDHA 2ESTE 1JBUH 3MNCA 9ESTA 4IMQA 3TNTA 2BZAA 1PPEE 1KXEA 2QGRA 8LPRA 2ZFRH 3OTJE 3SNAA 1RRKA 1HIAB 2VINA 2ZZUH 1ZGVA 2STAE 2Z9JA 5EGMA 5EU8A 4Q7YA 3A8BA 4Y8ZA 4I8HA 3U1IB 1UTPA 1MAXA 3GY7A 4X2YA 3RXAA 1BUIA 1VITF 5H4IB 4O9VA 1ZZZA 2PW8H 5GCHF 4R8TB 1QL8A 1YBWA 4BXSA 1DDJA 1BJVA 2WUCA 3QZQA 1KXBA 3ZZ7A 3RXQA 2VIVA 2ZDLA 3BTWE 3PWBA 1ZTKA 4AFSA 3IITA 1ZMJA 2ZPSA 3A81A 4UE7H 1GG6B 1TE0A 1TOCB 1AUJA 3P70B 2FP7B 3EQ0H 1TALA 5DO4H 2BD7A 2V3HH 1P01A 4MNXA 3QGJA 1C1PA 3BIUH 4O3UA 3K6YA 5ABWA 2A5KA 1TA2A 3BTQE 1MTVA 2H9TH 1BMMH 2R0LA 3RXJA 5GIBA 4CR9A 4I8KA 1GBLA 2W3IA 5E2PA 2Z9IA 1AWHB 2ZG0H 4CHAB 1AE5A 4O97A 2HPPH 5FXLA 4D8NA 1YPHE 1GBFA 1CBWB 2DE8A 2ZCKP 1P05A 1KLJH 4NZLA 2FM2A 3ODDA 2AIQA 1XVMA 4BTUB 2O9QA 2P3TB 1ABJH 1V6DA 1ETTH 2HLCA 3ZZAA 5CHAC 1GI7B 1PFXC 2G5VA 1TABE 1C2IA 1EAWA 1FQ3A 4NIWA 1O2HA 3O8CA 1CT4E 4Y71A 1O5DH 2F9PA 3E0NB 1DUEA 2EI6A 4MPWA 1K1MA 1TRYA 1P3EA 1M9UA 1JIMA 1W0YH 2P3UB 2EI7A 2GCHG 2P93A 4UFDH 1TX8A 1YP9A 1NROH 1IQIA 2W7UA 2BZ6H 1HAOH 5JBTA 5FPSA 1ZR0A 3ZVGA 3OY6U 4MNVA 1FPCH 2ZFQH 5ESBA 1FY3A 1FY1A 3GCTG 1XM1A 3RXSA 1TPAE 3C1KA 3SU1A 1L1JA 2QCYA 2WPJS 2QXIA 1GJ6A 1MTNC 1QRWA 3MYWA 1CA8B 1O2PA 4WMDA 1SGTA 1WU1A 5HYOA 2AYWA 1V2MT 3NPSA 1P04A 2WYGA 3SV9A 1C5QA 4GCHG 4DCDA 5AFYH 1JWTA 1XKBC 2P16A 3Q76A 3E90B 3RC4A 1TWXB 7LPRA 2FTMA 3BF6H 4ABBA 1HAZB 1O2MA 3K9XB 1SPJA 2OXSA 3E16B 1AB9C 3BG4C 4OGYA 1ZRBA 5FBIA 4AX9H 1FZZA 5A2MH 1TGSZ 1QA7A 1SHYA 2ANMH 2FWWA 4GLYA 4OS5A 4Y8YA 6CHAC 2WPIS 1MUEB 2BY9X 4FUBA 2O8WA 4F4OC 1INCA 2GKVE 4ABJA 4MDSA 1O3PB 3TGKE 3QUMP 4YLQH 2HWLB 1O2LA 1SGRE 1T31A 1JRTA 3RDZA 1GMCG 1ZOMA 2C3SA 3MNXA 1ZHPA 4NG9H 3SUDA 4UFFH 5T3HA 2FI3E 3SBKA 2FI5E 1C2LA 4FUDA 2P95A 3PB1E 3BTFE 1CT0E 1ZPCA 2SGEE 4X6OA 3FP6E 3R3GB 2WPKS 1TNKA 3BTDE 5FAHA 1G30B 1P12E 4FXGH 1LMWB 3VB5A 1A7SA 1V2TT 2EC9H 2GCTC 2WINI 5J4SA 2EEKA 1NO9H 3BIVH 4INKA 1AE8H 4GUXA 1UTQA 3SQHE 4B1TA 1VCPA 2ZTYA 1XVOA 2PWXA 1O3EA 3HATH 4QT8C 1W12U 1C9TA 2R2WU 1GBKA 1O2RA 3U8OH 1C5VA 1O2NA 3MOCA 1SLVB 1AGJA 1VR1H 2OC8A 1BOQA 1ELTA 4KTSA 1HIAA 4CH2B 2FOGA 3SU4A 3S69A 1DSUA 2BX3A 1Y5UT 4TWYA 1UHBA 2B5TB 4PROA 5DGJA 5A0CA 5G4BA 1FY5A 1JMOH 1K2I1 5TCCA 1SGIB 1HXFH 1E37B 3GCHB 3GY3A 3ZVFA 5EW2H 1IQJA 4ZHMU 1KXDA 3E3TA 1BBRK 2OC0A 4TY6A 1O5FH 1YCPM 2YNBA 4NWLA 1V2UT 2FX6A 4FVDA 2RCEA 3A85A 3KHVA 4FUJA 3T27A 1CO7E 2XWAA 3S7HB 1V2RT 2H1UA 1HYLA 2R0KA 1GBIA 2FLBH 5JDUB 1XUIA 1SGEE 2ANWA 2HALA 2XC5A 3URDA 2ZU4A 1K22H 1W2KH 5L6NH 3SU0A 3F9FA 1C5LH 4B76A 1G37A 2NU0E 1O3BA 4X1SU 1LHCH 3UQOA 3SNBA 3MU4A 1KTSB 1GI0A 2O8MA 1NN6A 1CA0B 1IQEA 1LVMA 1ZGIA 2C4FH 3H7TA 3M35A 1GBEA 2ZU5A 4ZROA 1VGCB 1XKAC 2BDIA 4BANB 4B75A 1NU9A 3T2NA 4CR5A 1AQ7A 3S9CA 4NCYA 3LJOA 1VCWA 3M3SA 1C1UH 2F9OA 3SUEA 3ZZ8A 1N6XA 3RMNH 1F0SA 3M37A 1QCPA 1SB1H 3BN9A 1EAUA 3TNSA 4Y79A 3PLBA 4JK5A 2OINA 1C1SA 1SGPE 2GCTB 1GJ4H 1DWDH 5A0AE 1LPKB 1HB0B 2PTNA 3RLWH 1GJAB 2AERH 1K1PA 2C8WB 1L4DA 1DXPA 1UCYK 3S9BA 3Q3KA 2Y7XA 1C1VH 1O0DH 3LH3A 3FZDA 2ZHWH 3TK9A 3V12A 1A0HB 1FAKH 4NIXA 3E91A 3ATIA 3EAJA 1AZ8A 3S0NA 3K6ZA 2ALVA 4NZQA 3VXEH 1KDQB 8GCHG 1BB0B 4FU7A 1MH0A 1OX1A 4JYTA 5FBEA 3T5FH 1NT1A 3RXFA 1MKXK 4LK4A 3O8DA 4NIYA 1BRUP 3E0PB 1SVPA 1DM4B 1TPPA 2V35A 1MZAA 2PSYA 2ZPQA 3FFGA 1O2YA 1YCPK 1EPTC 2H9HA 1MKWK 3BTHE 3P8OA 3N7OA 1P2JA 2B0FA 1TNGA 1XXFA 1B0FA 1F5KU 1WYKA 4ZXYH 1HLTH 2C90B 5ESTE 2Q6DA 2QA9E 2CHAB 1S5SA 1TRMA 1QR3E 4B73A 4MPXA 1A5GH 1QBVH 1EB2A 1O2UA 1V2KT 4Q80A 3SQEE 3PTNA 2VGCC 2ZGBH 4X8TH 5EPNA 4X6MA 3LPRA 1JRSA 2VVUA 5TJXA 4B2BA 1SLXB 3BV9B 5DPAA 5LH8A 1PPGE 1QQUA 1Y3VA 4CRDA 2GX4A 2F9NA 3KEEA 5IDKA 3FVFB 1C9PA 1O32A 3LGWA 2UWPA 1GHVH 3ZVBA 2BLOA 4B74A 4ESTE 1EUFA 1GHAF 2IOTA 1K1OA 1D3DB 2D26C 5FCRA 2BVRH 2XBYA 4H4FA 1TYNA 3Q3XA 6GCHF 3MNBA 1ARBA 3ZZ6A 1UMAH 3V3MA 2H6MA 1Q3XA 2WPHS 1O2XA 3SGQE 4DURA 1QB6A 3DHKH 1PQ7A 1NFXA 5AFZH 4TPIZ 4NFFA 2OBOA 2VVCA 3TITA 2NWNA 2XWBI 1A5IA 1C1WH 1HAVB 1OP8A 1NESE 1L1NA 1QJ6B 1TNHA 2Z3DA 4UEHH 1H4WA 1ZTJA 3PWCA 1O36A 2Y5FA 2C8XB 4TY7A 1TGBA 2VU8E 3SU6A 1E36B 2A2QH 3WY8A 3SJ9A 2ZDKA 1MD8A 1FMGA 2R3YA 3MH5A 2FMJA 1ELEE 4ZH8A 5FCKA 1CGIE 4RKOB 3UOPA 2OQUA 7GCHF 4OS2A 1WAYB 3ENSB 5LPRA 2TGPZ 2AGGX 3A82A 2TBSA 4KGAA 1A1RA 5LPFA 1K1IA 1C4V2 1ZHMA 4Q7XA 1NTPA 1S0QA 4YLUA 4ZKOU 1GGDC 1O3CA 2QYIA 2FI4E 1HV7A 3SJ8A 1MQ5A 5DG6A 1UTKA 1GVKB 2VGCB 3TH3H 1C2GA 1FLEE 1O3DA 5I46H 1RTLA 1V2VT 3MU8A 1GG6C 1C5TA
chains in the Genus database with same CATH superfamily
1FV9A 3ZVEA 1EZUC 1TNIA 2GP9B 3UB0A 2ASUB 3PV4A 1TBZH 2B8OH 3GDUA 1IAUA 1HAGE 1RTFB 3MFJA 5DP8A 1P09A 3QGNB 4AYVB 1NBMD 2Z94A 3ZV9A 4E05H 3BTKE 2O8TA 1RFNA 2BLQA 2ZU1A 3KYFA 3EDXB 4ZHAA 1BQYA 1MTSA 1C5MD 1Y3UA 2SNVA 3M5MA 4Q7ZA 4YO9A 4MVNA 4NWKA 3VB7A 2VIOA 3SHCH 1QTFA 1P02A 1DY8A 3M61U 4NA7A 5EOKA 3V0XA 1A5HA 4HI3A 3W95A 2ZDMA 1PYTD 3ATWA 1BTWA 4I8GA 1DICA 2VWLA 3G01A 2BY6X 1F0UA 3A7YA 2F91A 3LC3A 3LKWA 1NRNH 1SL3A 1HAPH 1C1QA 1Z71A 1XUJA 1AKSB 1C5YB 1T8MA 5A0BA 2SGQE 2ZFPH 5SGAE 2AGEX 1J17T 4NSVA 4X2VA 3SUGA 5GJ4B 5EQRA 1BTXA 1C5UA 1A2CH 5T6FA 2PFEA 1WOFA 1HCGA 1C5NH 1DS2E 1AHTH 3K65B 3HGPA 2BD3A 5GXPA 1W7GH 4AFQA 2ANKH 3KIDU 1CHOG 2FESH 4FUHA 1OPHB 1SGYE 1MTUA 2ZECA 2ZQ1A 5EODA 2J5UA 3TPIZ 1O34A 1FDPA 2QIQA 4K69A 3OE7D 1PPZA 1FAXA 1LHGH 3ATMA 1O3AA 3GDSA 1AZZA 3RU4E 1Z8GA 1GHBG 1OWJA 3AW1A 2F9VA 1W3CA 3RXIA 1DWCH 1GGDB 1IQNA 2LPRA 1MQ6A 1CT2E 1GL1A 2HNTF 3A7VA 4WMFA 4AYYB 5KGOA 4FUGA 4BOHA 1NM6A 2OUAA 4YM9A 2NU4E 4X8SH 2ZA5A 4ZMAH 4Y8XA 1Y5AT 3UPEA 1G36A 1P0SH 3FP7E 2NU2E 1LPZB 3FANA 1GBMA 1GJCB 1XUKA 4GHQA 3P8FA 5C1UA 1EAIA 2CXVA 1ANDA 1IQFA 2G55A 2IPQX 1SQTA 4ISNA 1OWDA 1LHEH 3QX5H 1QBNA 3EA9A 1FN8A 1GMDG 1T8NA 2VIQA 1S85A 3SGBE 4XDEA 4J1YA 2ALPA 3IWMA 4MNWA 3ZVAA 8KME2 1YPEH 2OQ5A 4E7NA 3PM3A 3JZ1B 1O3FA 1SLWB 2Q1JA 3SUFA 3BEIB 1OKXA 5GWZA 1KY9A 4I31A 3LU9B 5BPEA 3RXMA 1S0RA 2AEIH 3Q00A 1A0LA 1P03A 4MTBA 3RUOA 1GBBA 2CF8H 1GI4A 1V2JT 5E8EH 5K7RA 2ANYA 1QA0A 5C67A 1XUHA 3MI4A 4UFGH 2LNCA 2YMSD 1AVGH 2H2ZA 1O35A 1HAVA 1HJ8A 1EJMA 2ODQA 4NA9H 4AB9A 3SJIA 4AGJA 2QV1A 3DFJA 3A8CA 1TQ0B 1ABIH 5C5OA 3GCNA 1CQQA 3KQDA 1ZJKA 1EOLA 4ZXXH 3O8RA 1FX0B 2BVSH 4WF8A 5AF9H 1NU7B 3KQCA 4GHTA 3U98H 4GVUA 2Y82A 2XCFA 1YY3A 4IC5A 3TLOA 3TH4H 2A1DB 4X6NA 4X2XA 2VBCA 1BT7A 1T7CA 1EPTA 1O3LA 4K1TA 7KMEH 4FUFA 1C2MA 2BY8X 3CS0A 5GPIB 3U1JB 3AAVA 1JIRA 1K9OE 4U2WA 4A5TS 1SR5C 2XCNA 3GCHC 1NFYA 1S6LA 1YM0A 2QF0A 2AGIX 4JYVH 2UWOA 4K8BA 1J14A 2PHBA 3A84A 3RXGA 9LPRA 3MMGA 4ZUHA 4JZDH 5EJ1A 1O5AB 5EXMA 4I33A 2PGBB 4MPUA 3VB3A 1VITG 1KSNA 3AK5A 5L2YH 3PLPA 2RA0A 2GV6A 2FODA 5GCHG 3ITIA 3TGJE 1TX7A 5F8ZA 1FY4A 4OS1A 2OC1A 2JETB 3D65E 3TU7H 1C2KA 1GI1A 3DSPA 3ELAH 2XBWA 2Y5HA 4B71A 3MO3A 3TJVA 5EQQA 3LONA 3PTBA 2J95A 3SU5A 3QO6A 4BTIB 4X2WA 1XXDA 3I29A 1N8OB 2BY7X 3GDVA 4FOUC 1O3GA 3SV8A 2CN0H 1RS0A 2H5DA 2D2DA 2D8WA 1O2TA 1O2WA 3CS7A 2V6NA 1CA0C 2WPDD 1UO6A 2C93B 2ZGHA 1MCVA 1BBRH 2ZNKH 1O2IA 4FVBA 1PPFE 1G2MA 1KLTA 1VGCC 1OHHD 2XC0A 4CBOA 3OX7U 5JB9S 3SORA 3RM0H 5I25A 1FONA 4K1EA 1YPJH 1HJAB 3EGKH 1DOJA 1BZXE 2FDAA 1F92A 2M5TA 4DW2U 1QY6A 1MBMA 3UFAA 4X0WU 3ZZ5A 3RC6A 2W26A 1F0RA 2FS9A 2FXRA 5F8XA 1QJ1B 5FL7D 1AO5A 4K1SA 1DY9A 1RJXB 4OGXA 2PP6A 1DX5M 1O5CB 2AHME 1VZQH 2BB4A 2ZO3H 2OTVA 2AIPA 2SGDE 2ZHEH 1FUJA 1AVXA 3NK8A 1MMJN 4KP0A 2ZGXH 1K1NA 1LTOA 2Z9GA 1AKSA 3PV2A 4SGBE 2QC2A 4WMEA 2VB0A 5JBCS 2VH0A 2J98B 4I8JA 3BG8A 1ELVA 1ANCA 1BJUA 1GDQA 1SGNE 2GTBA 1ZPBA 1ELCA 4Z6AH 1KTTB 1QFKH 3A8DA 4OS7A 2F4LA 4JZ1A 4ZAEA 1T8LA 4HZHA 2AS9A 2Z9LA 1ANEA 1HDTH 2FEQH 3LGYA 4YT6H 1YC0A 2RDLA 1NRRH 4I7YH 3ZZ9A 3F9GA 2Y80A 1Z1JA 1LVBA 3SN8A 1KMHB 3F0PA 3A8AA 3PMBB 4X8VH 1O3OA 3KYGA 2BQ7B 1OSSA 2UUKB 5FHTA 4F48B 2Y6TA 1H8DH 4CREA 4A7IB 2A7HA 1Y59T 1P3CA 4H42U 1D3TB 5L30H 1TA6A 2PKAB 1V2PT 1O30A 2HNTC 3NUMA 3KGPA 4A92A 1Q31A 2A4RA 2O8LA 2CHAC 1EB1H 5C1XA 3HGNA 1AMHA 2R3UA 4YZUA 5T6DA 3R0FA 1TPOA 2FPZA 1EX3A 1GI2A 1SGCA 1MKXH 2GDEH 3BTEE 5DSFA 3AAUA 1MZDA 2BD8A 2RG3A 5E0GA 5DP4A 3RLYH 1YCPH 3H5CB 3F3BA 1MKWH 5HGGA 1TBRH 3ZZ3A 4BTTB 1THPB 2WV5A 3A89A 1D6RA 3F6UH 1ELFA 1HAIH 1W11U 2XTTB 2HRVA 4KTUA 2RDEA 3DD2H 1P2KA 2SFAA 1RD3B 4D7GA 4IGDA 4WXVA 1P57B 5DK1A 2V3OH 4I8LA 5JBBS 1YWUA 1P8VC 1PYTC 3BTTE 1YLDA 3GOVB 1EZXC 1THSH 2Z3EA 2AH4X 1H9HE 1L0ZA 2XBVA 4ISOA 1ZSJA 4TPYA 4Y76A 1ETSH 1AY6H 3UIRA 4IC6A 3SJKA 4AB8A 4D76A 1O3NA 3LC5A 1G2LA 1P9UA 2R2MB 4GAWA 3F9HA 5C2ZA 2VWOA 5EQSA 1QZ8A 1S83A 2ODPA 1T4UH 3Q77A 4MPVA 1TONA 1ZHRA 3GYMA 4RKJB 4XFQA 4B6FA 3M3TA 1AWFH 5B6LA 1QNJA 3M36A 1S6HA 2UUFB 1MD7A 4AN7A 2FIRH 3SI4H 2R9PA 1ZLRA 1XUGA 3PMHB 5DP6A 3MH7A 4BAOB 2PKSB 1BA8B 1OWIA 1UTLM 1GJ9B 1HNEE 1UVUH 1NC6A 1QIXB 3TK5A 2BY5X 1S84A 4FU9A 2RA3A 2P8OC 3PO1C 1QHRB 5K0HA 3SO3A 2ZEBA 5GDSH 3U9AH 5A09A 2WPMS 3OSYA 1QL7A 1V2WT 3M5OA 4XBBA 1UTJA 1UTNA 2DE9A 1PQ8A 4NSYA 2QY0B 1O2GH 4M9FA 1QURH 1Y8TA 1GBDA 1EASA 2W6ID 2ZHFH 2BDCA 1BTZA 4O3TA 2AFQB 4FUCA 4Y6DA 4CRCA 4ABHA 1K1LA 1UK2A 1LKBA 1GBJA 1FY8E 2A4GA 2CMYA 3A86A 5EPYA 3ZVDA 3HK6B 3DUXH 5C5NA 1Z6EA 1W0JD 2FYRA 1FNIA 1GI3A 2F83A 4XBCA 1GMHF 3A87A 2A5AA 2JH0D 3F68H 2OP9A 3NKKA 1OWEA 5FPYA 2LELA 1T8OA 3QK1A 4JYUH 1ZMNA 3E8LA 4ABIA 1NS3A 4K3JA 1IQKA 1ZJDA 4ABFA 1EP5A 2TGAA 4YTAA 4IMZA 1WBGB 2ZDAH 1U6QA 1VCQA 3N99A 1AFQC 2BDAA 4INLA 3PMJA 1ELBA 2ZF0H 1Z8IB 2OC7A 4NGAH 1O5GH 2KCAA 1CVWH 2WZQA 2YMSC 3VXFH 4JZFH 5IYTA 1VKYA 1DPOA 2J34A 2WV4A 3V13A 1H9LB 4UD9H 4IS5A 1ELDE 2G8TA 5GNDA 1EKBB 1C5ZB 1C4U2 2GD4B 3BTME 3ODFA 4KELA 4DY7B 1P2IA 4KKDA 4FUIA 2BHGA 1DE7H 2BD4A 1E34B 3KQ5A 1TLDA 3EA7A 2GV7A 1UK3A 1O3HA 2A7CA 2PLXA 3GY2A 4I32A 5HM2A 2XRCA 3GYLB 2G52A 4LOYH 1H9IE 4DT7B 4WXIA 4X1PU 3TK6A 5JBAS 4ABAA 2P8OB 3PO1B 1O39A 1G32B 3WW7A 3SU3A 5J4QA 1OYTH 1L1GA 1ZPZA 2VIPA 2KX4A 4D9RA 2WUBA 3QWCH 1C5XB 4ACAA 1OP2A 4YT7H 5EJZA 1C2HA 1BTPA 1THRH 1UVTH 1K1JA 1O3MA 3SHAH 1PQAA 1C1TA 5F6MA 1C1OA 2BYAX 1QBOA 1CGHA 1EXFA 3T25A 1NFWA 1BRCE 3ZZDA 3KQBA 1TBQH 4Z0KA 2NU1E 3A80A 3ZVCA 3GICB 1NRPH 2ZU2A 3F1SB 1JOUB 1O31A 2WPLS 4AFZA 3RC5A 5C0TA 4YOGA 2BLVA 1P06A 1GI6A 1SGDE 3V7TA 1ZSLA 1NBME 1UTOA 5HKKD 3VB6A 3ZZBA 1P2MA 2FOBA 2H9EH 2VIWA 2Z6BD 1H1BA 4GSOA 4DVAU 1O2OA 4Y7AA 4Y0YE 1WTHD 3TH2H 1KYNA 1V3XA 2CV3A 3UUZA 1T32A 1C2FA 1W0KD 1G3BA 1HPGA 4X1RU 2XYAA 1AFQB 3ESTA 3DA9B 4R0IA 3Q3YA 3SV6A 1ZRKA 1MU8B 3MHWU 4ZKNU 3U28C 3TJOA 4I86A 1HRTH 1S6FA 1EJAA 3RXBA 5BRRE 2FX4A 4AFUA 1E79D 1TOMH 3SW2B 2YMSB 1SHHB 2ZC9H 2WYJA 3GISB 3MO9A 4P00A 1GHAG 2A5IA 3O8BA 4K2YA 2FOAA 2G81E 3ZZCA 1E35B 2A4OA 4MLFB 1BTHH 1XX9A 5F03A 1QB1A 2BQ6B 3UR6A 6GCHG 2ZFTA 3MH6A 1DLEA 3RU4T 2BD5A 5AVDA 1A0JA 1EATA 1F5RA 2GZ7A 1IQGA 3GY8A 4J2YB 4DGJA 1QL9A 2GCHF 2ZU3A 3AW0A 1VITH 1D9IA 1NPMA 1C1RA 3M5LA 1E38B 1GVZA 3KQEA 1KXAA 1QGFA 4AG1A 1AFEH 3U8RH 1FIWA 1XUFA 3GCTF 2CJIA 5C1YA 2YOLA 4B2CA 1DVAH 1KDQA 1CU1A 3PROA 1N1LA 1VJ9U 5LPEA 2ZFSA 3RXDA 3DT0H 1P11E 4WJG2 4JZIA 1DXWA 3K2UA 4MQAA 1SQOA 4ABGA 1B5GH 1VJAU 1SKYE 2OD3B 3ZZ4A 4LZ4B 1O2SA 3P6ZB 1W0ZU 1LO6A 2GGVB 1GDUA 4Y11E 1BMLA 1O2JA 1YKTA 3M3VA 4IW4E 1RIWC 1HXEH 3A7ZA 1DITH 2JKHA 4GCHF 4JK6A 1C5PA 5FX5A 1FPHH 1L2EA 4UFEH 1UHBB 2Y5GA 1V2LT 1UVPA 2ZKSA 4X1NU 3RXKA 1AI8H 4OM9A 3A7XA 3MWIU 7GCHG 3VFEA 2ODYB 4XSKU 5JPMH 4ZKRU 4OS6A 6ESTA 2PR3A 1NY22 1DT2A 3FP8E 3UOUA 3L6PA 1GWAA 1TFXA 1IQHA 2C8ZB 3STIA 4NIVA 1GVLA 3RXRA 3SV2H 2KCYA 2VNTA 3RU4D 2VIDA 2JETC 2UUJB 3DFLA 5T6GA 1CHGA 3RXEA 1IQMA 2BXTH 1O3IA 4DG4A 1UTMA 1ESBA 1LHDH 2KM0A 1MTWA 2WHXA 4WH8A 5E2OA 1N8OC 4CRGA 3IG6B 1G3EA 6LPRA 2ZP0H 1T4VH 3U69H 1Y5BT 4WH6A 1QQ4A 2B7DH 1DLKB 3BTGE 1GMCF 1TNJA 3UWIA 1RTKA 1O5EH 1C5SA 3STJA 2WSSD 2GDDA 2ZDVH 1SI5H 3U8TH 3VEQB 3UWJH 1GI8B 4U30A 4YXWD 1HJAC 1HBTH 4B6EA 5E0JA 1RGQA 1P2NA 4XBDA 4Y0ZE 1MCTA 3RXPA 5DP3A 1HGTH 1OWHA 1UK4A 4OS4A 1V2NT 1BBRE 3QLPH 1E0FD 1O38A 1WV7H 4ISHH 1W8BH 3SOSA 1GBCA 2Q6FA 3M5NA 1BHXB 3OYPA 2GVFA 4VGCB 2FO9A 1LVOA 3I78A 3RXVA 1BIOA 3PLKA 1YPGH 4TSFD 3CP7A 2TRMA 3UAIC 1IOEA 2P94A 2VH6A 3FZZA 4RT0A 3A7TA 1Q2WA 2ZCHP 2CGAA 2UUYA 3FKSD 3VGCC 3NWUA 3OEHD 1TAWA 1TIOA 1GBTA 1LKAA 1UJ1A 1IHSH 4E06H 1ZMLA 3EA8A 1WDIA 2BVXH 5DN6D 4IBLH 1O2KA 4NFEA 4D7FA 1ZYOA 4UDWH 2F9UA 1L4ZA 4ZKSU 3T28A 3UNSA 1RIWB 1O3KA 5HIZA 2EI8A 3LGVA 3QN7A 1F0TA 3I77A 5LGOA 8ESTE 3S7KB 3E6PH 1Z7KA 1Y3YA 2A0QB 4HTCH 1TRNA 1QJ7B 3T62A 4A6LA 2A2XH 2IJOB 3GY6A 3E1XB 1WCZA 1WUNH 4FUEA 2G5NA 3T26A 3UTUH 2PSXA 3TVJB 4Y10E 1SGQE 1K28D 2AMQA 1SBWA 3RXTA 3M7UA 1NFUA 4IN2A 1O2VA 3B23B 3LOXA 4WVPE 2FOEA 2ZHQH 5E0HA 4BAHB 3EYDA 4WWYA 1UCYE 1LQEA 4XE4A 2L74A 5CMXH 3P8GA 3SV7A 4B2AA 2BD9A 1FI8A 1CGJE 1F2SE 2ZTZA 4U32A 2ZI2H 1YF4A 2K1QA 3PV5A 1GL0E 2HOBA 1J16A 4AG2A 3D49H 3A88A 3KNXA 2SNWA 1O3JA 1YGCH 1EZQA 4TWWA 1LQDB 5B6OA 1O2ZA 2G51A 3EE0B 3RP2A 5FPTA 1GCDA 1O5BB 1X7AC 1BTYA 3MH4A 1GHXH 3P95A 3LH1A 1HAYB 1OWKA 3HK3B 3RXLA 3D23A 1C4Y2 2HGTH 3KCGH 1D3PB 1WQVH 3DSOA 5CHAB 3SJOA 1ELGA 2FOHA 2QF3A 2JIZD 4A1XA 2G4UA 3UNQA 2GZ9A 4ZCNA 2FOFA 1A4WH 1ARCA 3QTOH 4Q2KA 3OU0A 3VGCB 2GT8A 2CF9H 1CSOE 3SGAE 1OXGA 1F5LA 3HPTB 3QTVH 2BMGB 5PTPA 2BOHB 1B0EA 2V0BA 3UQVA 8GCHF 4YOJA 4CBNA 1D6WA 3LIWA 4ISIH 1PPHE 2XXLA 5CE1A 2YNAA 1BRBE 3MU5A 2GMTC 1F7ZA 1W10U 1WSSH 1J15A 2ZQ2A 3LGIA 2PKSC 2ZFFH 2P59A 1PJPA 5F53A 3URCA 2ILNA 3F2FA 2Z3CA 4RT1A 5TCAA 3MU1A 4Z1MD 2NU3E 3OY5U 4FU8A 5JYIA 4AZ2B 3RMOH 1MTNB 3D62A 1C2EA 1UCYH 1GJ7B 2QN5T 1MAYA 4UONA 3A7WA 3N7EA 5EXNA 4HGCA 3ZYDA 2LP6A 1XMNB 1NRSH 1O33A 2SGAA 4X8UH 1ESTA 5DP5A 4DIIH 1GI5A 4Q4LA 1EZSC 1HAXB 5HIYA 2VVVA 1EOJA 1P2OA 1A3EH 3GY4A 2HVXA 1YLNA 1ZTLA 4E7RG 1AB9B 1GJ8B 1GHZA 3BG4B 1LPGB 1JXPA 1WQSA 5DP9A 4D9QA 5A8XA 1PQ5A 3BSQA 5F8TA 1YYY1 1GCTC 6CHAB 1TGTA 3UREA 1TPSA 3PMAB 2STBE 1DFPA 1GDNA 2FYQA 3NXPA 4BNRA 2G4TA 2Z7FE 3B9FH 1GJDB 4F49A 3TGIE 5EG4A 3KF2A 1BTUA 1BMAA 1ID5H 3HKJB 4O03A 3MU0A 2GZ8A 1AUTC 5EXLA 1ETRH 2ZHDA 3ZYEA 1K21H 3HKIB 1H8HD 3P17H 1NRQH 2BQWB 4GPGA 1IHTH 2QAAA 3RM2H 2XW9A 1SGFA 2KAIB 2BX4A 3GCOA 7ESTE 1Y3XA 2FOMB 1EAXA 3C27B 3S9AA 4XOJA 1D3QB 2VWNA 3VB4A 1LVYA 1YPKH 2BLWA 1DWBH 1SFIA 2XBXA 1N6YA 1BHXF 2FLRH 2TIOA 5JB8S 2F9BH 5C3NA 1ELAA 2ZIQH 5HM9A 1O37A 3QDZB 3AVZA 3LGUA 5AHGH 2QXJA 4A1TA 1ACBE 1HFDA 1DANH 5A8ZA 4AGKA 3UY9A 1BRAA 1HAHH 2GMTB 2FS8A 3LGTA 4RSPA 2J38A 2I6SA 4X1QU 2UWLA 3UR9A 1FN6A 1TGCA 2I6QA 1P9SA 4JZEH 4CRAA 1S82A 2BD2A 4DOQA 2G00A 1YPMH 4LZ1H 1PPBH 1SFQB 4RI0A 2BM2A 1GI9B 3LJJA 5C0UA 1WTGH 2W3KA 4INHA 1OYQA 1AU8A 3NCLA 3RXCA 3W94A 3SNCA 2M2AA 1Z1IA 1KIGH 1J9CH 4ZHLU 4DJZB 3ZV8A 1TNLA 2ZWLH 2A45B 4IN1A 2VWMA 1TB6H 2THFB 1S81A 2B9LA 1W14U 2BDGA 4NA8A 3RXHA 4X6PA 1ORFA 2PUXB 3SU2A 5DKMA 1A46H 1A61H 4K5ZA 1GCTB 4YOIA 1GHYH 2OCVB 1C2JA 2PTCE 4SGAE 2TGTA 3MQKC 4YESB 2K8IA 4MG3A 1TX6A 2BOKA 1KXFA 1TQ7B 4WY3A 5DJ7A 5CHBA 1V2OT 2J94A 2O8UA 2ZCLP 2XNIA 1G3CA 1W7XH 1ESAA 1SMFE 1TMBH 2GT7A 1NZQH 2BDYA 4K8YA 3RMLH 3AASA 1UVOA 3CENA 1GJ5H 2KR7A 2AMPA 1C1NA 4Y7BA 2Y81A 1SLUB 2A7JA 4BAMB 5L2ZH 1RXPA 2XC4A 2FZZA 2J4IA 1V2QT 1SOZA 2A4QA 1OP0A 1Z6JH 1Y3WA 2J92A 4BXWA 1K0HA 1AD8H 1OOKB 1YPHC 3OAAD 4CH8B 1QRXA 2FOCA 3H7OA 3M7TA 1BMNH 1KXCA 2VJ1A 2DUCA 1GJBB 1YLCA 4JCNA 3L3TA 1W13U 2QXHA 1MBQA 2ULLA 3QZRA 1G3DA 2ZDNA 1SGFG 4M7GA 1C5RA 1LHFH 3JZ2B 3MNSA 1BDAA 2J98A 4U01A 1OS8A 1AN1E 1EQ9A 1TMTH 2W5EA 2A32A 1KLIH 2H5CA 1H8IH 2EA3A 3PYHA 2SGPE 4BAQB 1HUTH 1SG8B 1CHOF 3GY5A 4ABEA 1TGNA 3DSGA 3RMMH 2FTLE 1SQAA 4LXBH 4CRFA 3MO6A 4HFPB 3LDXH 3KN2A 1DWEH 1C1MA 1AIXH 1C2DA 3A83A 3SI3H 2A31A 1GHBF 2J2UA 2ZTXA 3BEUA 2JH5D 2HNTE 4KTCA 3LT3A 1GPZA 2PV9B 4DIHH 4AOQA 1AVWA 1EPTB 2PKAA 3B8JA 1MU6B 2J9NA 3ATKA 4H6TA 5C20A 2P3FH 2TGDA 2OLGA 4BAKB 1CE5A 1HJ9A 1P10A 3TJUA 2OBQA 2V3MA 4JMYA 1ANBA 2ZGCA 2ZGJA 4A1VA 1BITA 2V7QD 1DUAA 1V2ST 3NZIA 1FIZA 1C5WB 4ISLA 1GMDF 1PPCE 3VPKA 1QB9A 2C8YB 4FETA 1GBAA 1YPLH 2JJ2D 2QF4A 1ZSKA 1QRZA 3SNEA 5HXFA 4RN6A 3BEFB 1LCYA 3MTYA 1IQLA 1O2QA 1P2QA 3RXOA 3UNRA 3GS9A 2ZPRA 1TMUH 2PUQH 1Z8RA 2BDBA 3T29A 4THNH 4CRBA 1GHWH 2BTCE 2PGQB 3TIUA 3M7QA 5HMAA 1GMHG 1A3BH 3TJNA 1GBHA 3L33A 1UVSH 1FXYA 2JH6D 2Q6GA 1SOTA 3OTPA 4ACBA 2RFKC 5EW1H 3FAOA 1J8AA 1SC8U 3ATLA 5DP7A 1EP6A 2AMDA 4CHAC 1D4PB 2KAIA 2D1JA 1CBWC 3P8NA 2IN2A 3SZNA 1B7XB 4AORA 1EJNA 2BXUH 2TPIZ 4K60A 1BCUH 2Y7ZA 5FX6A 3P92A 4ASHA 4VGCC 3RXUA 1C5OH 1G9IE 2W7SA 4TYDA 2IPHA 2HLDD 2Z9KA 1FJSA 1LDTT 1DSTA 4MNYA 2HPQH 1Z8JB 3KL6A 2QXGA 4H6SB 2SGFE 3F9EA 5KECA 5C17A 5A8YA 2F3CE 5ETXA 3SNDA 4ABDA 1SSXA 2BDHA 3FO8D 2ESTE 1JBUH 3MNCA 9ESTA 4IMQA 3TNTA 2BZAA 1PPEE 1KXEA 2QGRA 8LPRA 2ZFRH 3OTJE 3SNAA 1RRKA 1HIAB 3N7DA 2VINA 4XD7D 2ZZUH 1ZGVA 2STAE 2Z9JA 5EGMA 5EU8A 4Q7YA 3A8BA 4Y8ZA 2EQNA 4I8HA 3U1IB 1UTPA 1MAXA 3GY7A 4X2YA 3RXAA 1BUIA 1VITF 5H4IB 4O9VA 1ZZZA 2PW8H 5GCHF 4R8TB 1QL8A 1YBWA 4BXSA 1DDJA 1BJVA 2WUCA 3QZQA 1KXBA 3ZZ7A 3RXQA 2VIVA 2ZDLA 3BTWE 3PWBA 1ZTKA 4AFSA 3IITA 1ZMJA 2ZPSA 3A81A 4UE7H 1GG6B 1TE0A 1TOCB 1AUJA 3P70B 2FP7B 3EQ0H 1TALA 5DO4H 2BD7A 2V3HH 1P01A 4MNXA 3QGJA 1C1PA 2GJGA 3BIUH 3VG8A 4O3UA 3K6YA 5ABWA 2A5KA 1TA2A 3BTQE 1MTVA 2H9TH 1BMMH 2R0LA 3RXJA 5GIBA 4CR9A 4I8KA 1GBLA 2W3IA 5E2PA 2Z9IA 1AWHB 2ZG0H 4CHAB 1AE5A 4O97A 2HPPH 5FXLA 4D8NA 1YPHE 1GBFA 1CBWB 2DE8A 2ZCKP 1P05A 1KLJH 4NZLA 4DT4A 2FM2A 3ODDA 2AIQA 1XVMA 4BTUB 2O9QA 2P3TB 1ABJH 1V6DA 1ETTH 2HLCA 3ZZAA 5CHAC 1GI7B 1PFXC 2G5VA 1TABE 1C2IA 1EAWA 1FQ3A 4NIWA 1O2HA 3O8CA 1CT4E 4Y71A 1O5DH 2F9PA 3E0NB 2QE7D 1DUEA 2EI6A 4MPWA 1K1MA 1TRYA 1P3EA 2EY4C 2L6OA 1M9UA 1JIMA 1W0YH 2P3UB 2EI7A 2GCHG 2P93A 4UFDH 1TX8A 1YP9A 1NROH 1IQIA 2W7UA 2BZ6H 1HAOH 5JBTA 5FPSA 1ZR0A 3ZVGA 3OY6U 4MNVA 1FPCH 3W1EA 2ZFQH 5ESBA 1FY3A 1FY1A 3SZEA 3GCTG 4ASUD 1XM1A 3RXSA 1TPAE 3C1KA 3SU1A 1L1JA 2QCYA 2WPJS 2QXIA 3OEED 1GJ6A 1MTNC 1QRWA 3MYWA 1CA8B 1H8ED 1O2PA 4WMDA 1SGTA 1WU1A 5HYOA 2AYWA 1V2MT 3NPSA 1P04A 2WYGA 1E1RD 3SV9A 1C5QA 4GCHG 4DCDA 5AFYH 1JWTA 1XKBC 2P16A 3Q76A 3E90B 3RC4A 1TWXB 7LPRA 2FTMA 3BF6H 4ABBA 1HAZB 1O2MA 3K9XB 1SPJA 2OXSA 3E16B 1AB9C 3BG4C 2OK5A 3WWBA 4F55A 4OGYA 1ZRBA 5FBIA 4AX9H 1FZZA 5A2MH 1TGSZ 1QA7A 1SHYA 2ANMH 2FWWA 4GLYA 4OS5A 4Y8YA 6CHAC 2WPIS 1MUEB 2BY9X 4FUBA 2O8WA 4F4OC 3EE7A 1INCA 2GKVE 4ABJA 4MDSA 1BMFD 1O3PB 3TGKE 3FN8A 3QUMP 4YLQH 2HWLB 1O2LA 1SGRE 1T31A 1JRTA 3RDZA 1GMCG 1ZOMA 2C3SA 3MNXA 1ZHPA 3PRDA 4NG9H 3SUDA 4UFFH 5T3HA 2FI3E 3SBKA 2FI5E 1C2LA 4FUDA 2P95A 3OFND 3PB1E 3BTFE 1CT0E 1ZPCA 2KCOA 2SGEE 4X6OA 1COWD 3FP6E 3R3GB 2WPKS 1TNKA 3BTDE 5FAHA 1G30B 3DCLA 1WXRA 1P12E 5IK2D 2JDID 4FXGH 1LMWB 3VB5A 1A7SA 1V2TT 2EC9H 2GCTC 2WINI 3F2GA 5J4SA 2EEKA 1NO9H 3BIVH 4INKA 1AE8H 4GUXA 1UTQA 3SQHE 4B1TA 1VCPA 2ZTYA 1XVOA 2PWXA 1O3EA 3HATH 4QT8C 1W12U 1C9TA 2R2WU 3FOAA 1EFRD 1GBKA 1O2RA 3U8OH 1C5VA 1O2NA 3MOCA 2W6JD 1SLVB 1AGJA 1VR1H 2OC8A 4HG6A 1BOQA 1ELTA 4KTSA 1HIAA 4CH2B 2WV9A 3F2HA 2FOGA 3SU4A 3S69A 1DSUA 2BX3A 1Y5UT 4TWYA 1UHBA 2B5TB 4PROA 5DGJA 5A0CA 5G4BA 1FY5A 1JMOH 1K2I1 2XOKD 5TCCA 1SGIB 1HXFH 1E37B 3GCHB 3GY3A 3ZVFA 5EW2H 1IQJA 4ZHMU 1KXDA 3E3TA 1BBRK 2OC0A 4TY6A 1O5FH 1YCPM 2YNBA 4NWLA 1V2UT 2FX6A 4FVDA 2RCEA 3A85A 2HVYB 3KHVA 4FUJA 3T27A 1CO7E 2XWAA 3S7HB 1V2RT 2H1UA 1HYLA 2R0KA 1GBIA 2FLBH 5JDUB 1XUIA 1SGEE 2ANWA 2HALA 2XC5A 3URDA 2ZU4A 2KZ4A 1K22H 1W2KH 5L6NH 3SU0A 3F9FA 1C5LH 4B76A 1G37A 2NU0E 1O3BA 4X1SU 1LHCH 3UQOA 3SNBA 3MU4A 1KTSB 1GI0A 3NRLA 2O8MA 1NN6A 1CA0B 2CK3D 1IQEA 1LVMA 1ZGIA 2C4FH 3H7TA 3M35A 1GBEA 2ZU5A 4ZROA 1VGCB 1XKAC 2BDIA 4BANB 4B75A 1NU9A 3T2NA 4CR5A 1AQ7A 1UW7A 3S9CA 4NCYA 3LJOA 1VCWA 3M3SA 1C1UH 2F9OA 3SUEA 3ZZ8A 1N6XA 3RMNH 1F0SA 2JJ1D 1QCPA 3M37A 5EIYA 1SB1H 3BN9A 1EAUA 3TNSA 4Y79A 3PLBA 4JK5A 2OINA 1C1SA 1SGPE 2GCTB 1GJ4H 4TT3D 1DWDH 5A0AE 1LPKB 1HB0B 2PTNA 4XRNA 1GJAB 2AERH 3RLWH 1K1PA 2C8WB 4AC9A 1L4DA 1DXPA 1UCYK 3S9BA 3Q3KA 2Y7XA 5T1VA 1C1VH 1O0DH 3LH3A 3FZDA 2ZHWH 3TK9A 3V12A 1A0HB 1FAKH 4NIXA 3E91A 3ATIA 3EAJA 2IJD1 1AZ8A 3S0NA 3K6ZA 2ALVA 2F43B 4NZQA 3VXEH 1KDQB 8GCHG 1BB0B 4FU7A 5CDFE 1MH0A 1OX1A 4JYTA 2KFWA 4Q63A 5FBEA 3T5FH 1NT1A 3RXFA 1MKXK 4LK4A 3O8DA 4NIYA 1BRUP 3E0PB 1SVPA 1DM4B 1TPPA 2V35A 1MZAA 3PRBA 2PSYA 2ZPQA 3FFGA 1O2YA 1YCPK 1EPTC 2H9HA 1MKWK 3BTHE 3P8OA 3N7OA 1P2JA 2B0FA 1TNGA 1XXFA 1B0FA 1F5KU 1WYKA 4ZXYH 1HLTH 2C90B 5ESTE 2Q6DA 2QA9E 2CHAB 1S5SA 3WWFA 1TRMA 1QR3E 4B73A 4MPXA 1A5GH 1QBVH 1EB2A 1O2UA 1V2KT 4Q80A 3SQEE 3PTNA 2VGCC 2ZGBH 4X8TH 5EPNA 5C94A 4X6MA 3LPRA 1JRSA 2VVUA 5TJXA 4B2BA 1SLXB 3BV9B 1SQRA 5DPAA 5LH8A 5EJLA 1PPGE 1QQUA 1Y3VA 4CRDA 2GX4A 2F9NA 3KEEA 5IDKA 3FVFB 1C9PA 1O32A 3LGWA 2UWPA 1GHVH 3ZIAD 2BLOA 3ZVBA 4B74A 4ESTE 1EUFA 1GHAF 2IOTA 1K1OA 1MABB 1D3DB 2D26C 5FCRA 2BVRH 2XBYA 4H4FA 1TYNA 2KCPA 3Q3XA 6GCHF 3MNBA 1ARBA 3ZZ6A 3F0OA 1E1QD 1UMAH 2K0QA 2H6MA 3V3MA 1Q3XA 2WPHS 3CNRA 1O2XA 3SGQE 4DURA 1QB6A 5KEDA 3DHKH 1PQ7A 1NFXA 5AFZH 4TPIZ 4NFFA 2OBOA 2VVCA 3TITA 2NWNA 2XWBI 2XNDD 1A5IA 1C1WH 1HAVB 1OP8A 1NESE 1L1NA 1QJ6B 1TNHA 2Z3DA 4UEHH 2QF5A 1H4WA 1ZTJA 3PWCA 1O36A 2Y5FA 2C8XB 4TY7A 1TGBA 2VU8E 3SU6A 1E36B 2A2QH 3WY8A 3SJ9A 2ZDKA 1MD8A 3SYJA 1FMGA 2R3YA 3MH5A 2FMJA 1ELEE 4ZH8A 5FCKA 1CGIE 4RKOB 3UOPA 2OQUA 7GCHF 4OS2A 1WAYB 3ENSB 5LPRA 2TGPZ 2AGGX 3A82A 2TBSA 4KGAA 1A1RA 5LPFA 1K1IA 1C4V2 1ZHMA 4Q7XA 1NTPA 1S0QA 4YLUA 4ZKOU 1GGDC 4P02A 1O3CA 2QYIA 2FI4E 1HV7A 3SJ8A 1MQ5A 5DG6A 1UTKA 1GVKB 2VGCB 3TH3H 1C2GA 2J97A 1FLEE 1O3DA 3H09A 1RTLA 5I46H 1V2VT 3MU8A 1GG6C 1C5TA
chains in the Genus database with same CATH topology
1FV9A 3ZVEA 1EZUC 1TNIA 2GP9B 2ASUB 3PV4A 1TBZH 2B8OH 3GDUA 1IAUA 1HAGE 1RTFB 3MFJA 5DP8A 1P09A 3QGNB 4AYVB 2Z94A 3ZV9A 4E05H 3BTKE 2O8TA 1RFNA 2BLQA 2ZU1A 3EDXB 4ZHAA 1BQYA 1MTSA 1C5MD 1Y3UA 2SNVA 3M5MA 4Q7ZA 4YO9A 4MVNA 4NWKA 3VB7A 2VIOA 3SHCH 1QTFA 1P02A 1DY8A 3M61U 4NA7A 5EOKA 3V0XA 1A5HA 4HI3A 3W95A 2ZDMA 1PYTD 3ATWA 1BTWA 4I8GA 1DICA 2VWLA 3G01A 2BY6X 1F0UA 3A7YA 2F91A 3LC3A 3LKWA 1NRNH 1SL3A 1HAPH 1C1QA 1Z71A 1XUJA 1AKSB 1C5YB 1T8MA 5A0BA 2SGQE 2ZFPH 5SGAE 2AGEX 1J17T 4NSVA 4X2VA 3SUGA 5GJ4B 5EQRA 1BTXA 1C5UA 1A2CH 5T6FA 2PFEA 1WOFA 1HCGA 1C5NH 1DS2E 1AHTH 3K65B 3HGPA 2BD3A 5GXPA 1W7GH 4AFQA 2ANKH 3KIDU 1CHOG 2FESH 4FUHA 1OPHB 1SGYE 1MTUA 2ZECA 2ZQ1A 5EODA 3TPIZ 1O34A 1FDPA 2QIQA 4K69A 1PPZA 1FAXA 1LHGH 3ATMA 1O3AA 3GDSA 1AZZA 3RU4E 1Z8GA 1GHBG 1OWJA 3AW1A 2F9VA 1W3CA 3RXIA 1DWCH 1GGDB 1IQNA 2LPRA 1MQ6A 1CT2E 1GL1A 2HNTF 3A7VA 4WMFA 4AYYB 4FUGA 4BOHA 1NM6A 2OUAA 4YM9A 2NU4E 4X8SH 2ZA5A 4ZMAH 4Y8XA 1Y5AT 3UPEA 1G36A 1P0SH 3FP7E 2NU2E 1LPZB 3FANA 1GBMA 1GJCB 1XUKA 4GHQA 3P8FA 5C1UA 1EAIA 2CXVA 1ANDA 1IQFA 2G55A 1SQTA 4ISNA 1OWDA 1LHEH 3QX5H 1QBNA 3EA9A 1FN8A 1GMDG 1T8NA 2VIQA 1S85A 3SGBE 4XDEA 4J1YA 2ALPA 3IWMA 4MNWA 3ZVAA 8KME2 1YPEH 2OQ5A 4E7NA 3PM3A 3JZ1B 1O3FA 1SLWB 2Q1JA 3SUFA 3BEIB 1OKXA 5GWZA 1KY9A 4I31A 3LU9B 5BPEA 3RXMA 1S0RA 2AEIH 3Q00A 1A0LA 1P03A 4MTBA 3RUOA 1GBBA 2CF8H 1GI4A 1V2JT 5E8EH 5K7RA 2ANYA 1QA0A 5C67A 1XUHA 3MI4A 4UFGH 2LNCA 1AVGH 2H2ZA 1O35A 1HAVA 1HJ8A 1EJMA 2ODQA 4NA9H 4AB9A 3SJIA 4AGJA 2QV1A 3DFJA 3A8CA 1TQ0B 1ABIH 5C5OA 3GCNA 1CQQA 3KQDA 1ZJKA 1EOLA 4ZXXH 3O8RA 2BVSH 4WF8A 5AF9H 1NU7B 3KQCA 4GHTA 3U98H 4GVUA 2Y82A 2XCFA 4IC5A 3TLOA 3TH4H 2A1DB 4X6NA 4X2XA 1BT7A 1T7CA 1EPTA 1O3LA 4K1TA 7KMEH 4FUFA 1C2MA 2BY8X 3CS0A 5GPIB 3U1JB 3AAVA 1JIRA 1K9OE 4U2WA 4A5TS 1SR5C 2XCNA 3GCHC 1NFYA 1YM0A 2QF0A 2AGIX 4JYVH 2UWOA 4K8BA 1J14A 2PHBA 3A84A 3RXGA 9LPRA 3MMGA 4ZUHA 4JZDH 1O5AB 5EXMA 4I33A 2PGBB 4MPUA 3VB3A 1VITG 1KSNA 5L2YH 3PLPA 2RA0A 2GV6A 2FODA 5GCHG 3ITIA 3TGJE 1TX7A 5F8ZA 1FY4A 4OS1A 2OC1A 2JETB 3D65E 3TU7H 1C2KA 1GI1A 3ELAH 2XBWA 2Y5HA 4B71A 3MO3A 3TJVA 5EQQA 3LONA 3PTBA 2J95A 3SU5A 3QO6A 4BTIB 4X2WA 1XXDA 3I29A 1N8OB 2BY7X 3GDVA 1O3GA 3SV8A 2CN0H 1RS0A 2H5DA 2D2DA 2D8WA 1O2TA 1O2WA 3CS7A 2V6NA 1CA0C 1UO6A 2C93B 2ZGHA 1MCVA 1BBRH 2ZNKH 1O2IA 4FVBA 1PPFE 1G2MA 1KLTA 1VGCC 2XC0A 4CBOA 3OX7U 5JB9S 3SORA 3RM0H 5I25A 1FONA 4K1EA 1YPJH 1HJAB 3EGKH 1DOJA 1BZXE 2M5TA 1F92A 2FDAA 4DW2U 1QY6A 1MBMA 3UFAA 4X0WU 3ZZ5A 3RC6A 2W26A 1F0RA 2FS9A 2FXRA 5F8XA 1QJ1B 1AO5A 4K1SA 1DY9A 1RJXB 4OGXA 1DX5M 1O5CB 1VZQH 2BB4A 2ZO3H 2OTVA 2AIPA 2SGDE 2ZHEH 1FUJA 1AVXA 3NK8A 1MMJN 4KP0A 2ZGXH 1K1NA 1LTOA 2Z9GA 1AKSA 4SGBE 2QC2A 4WMEA 2VB0A 5JBCS 2VH0A 4I8JA 3BG8A 1ELVA 1ANCA 1BJUA 1GDQA 1SGNE 2GTBA 1ZPBA 1ELCA 4Z6AH 1KTTB 1QFKH 3A8DA 4OS7A 4JZ1A 4ZAEA 1T8LA 4HZHA 2AS9A 2Z9LA 1ANEA 1HDTH 2FEQH 3LGYA 4YT6H 1YC0A 2RDLA 1NRRH 4I7YH 3ZZ9A 3F9GA 2Y80A 1Z1JA 1LVBA 3SN8A 3A8AA 3PMBB 4X8VH 1O3OA 2BQ7B 1OSSA 2UUKB 5FHTA 2Y6TA 1H8DH 4CREA 4A7IB 2A7HA 1Y59T 1P3CA 4H42U 1D3TB 5L30H 1TA6A 2PKAB 1V2PT 1O30A 2HNTC 3NUMA 3KGPA 4A92A 1Q31A 2A4RA 2O8LA 2CHAC 1EB1H 5C1XA 3HGNA 1AMHA 2R3UA 4YZUA 5T6DA 3R0FA 1TPOA 2FPZA 1EX3A 1GI2A 1SGCA 1MKXH 2GDEH 3BTEE 3AAUA 1MZDA 2BD8A 2RG3A 5E0GA 5DP4A 3RLYH 1YCPH 3H5CB 1MKWH 5HGGA 1TBRH 3ZZ3A 4BTTB 1THPB 2WV5A 3A89A 1D6RA 3F6UH 1ELFA 1HAIH 1W11U 2XTTB 2HRVA 4KTUA 3DD2H 1P2KA 2SFAA 1RD3B 4D7GA 4IGDA 4WXVA 1P57B 5DK1A 2V3OH 4I8LA 5JBBS 1P8VC 1PYTC 3BTTE 1YLDA 3GOVB 1EZXC 1THSH 2Z3EA 2AH4X 1H9HE 1L0ZA 2XBVA 4ISOA 1ZSJA 4TPYA 4Y76A 1ETSH 1AY6H 3UIRA 4IC6A 3SJKA 4AB8A 4D76A 1O3NA 3LC5A 1G2LA 1P9UA 2R2MB 4GAWA 3F9HA 5C2ZA 2VWOA 5EQSA 1S83A 2ODPA 4MPVA 1T4UH 3Q77A 1TONA 1ZHRA 3GYMA 4RKJB 4XFQA 3M3TA 1AWFH 1QNJA 3M36A 1S6HA 2UUFB 1MD7A 4AN7A 2FIRH 3SI4H 2R9PA 1ZLRA 1XUGA 3PMHB 5DP6A 3MH7A 4BAOB 2PKSB 1BA8B 1OWIA 1UTLM 1GJ9B 1HNEE 1UVUH 1NC6A 1QIXB 3TK5A 2BY5X 1S84A 4FU9A 2RA3A 2P8OC 3PO1C 1QHRB 5K0HA 3SO3A 2ZEBA 5GDSH 3U9AH 5A09A 2WPMS 3OSYA 1QL7A 1V2WT 3M5OA 4XBBA 1UTJA 1UTNA 2DE9A 1PQ8A 4NSYA 2QY0B 1O2GH 1QURH 1Y8TA 1GBDA 1EASA 2ZHFH 2BDCA 1BTZA 4O3TA 2AFQB 4FUCA 4Y6DA 4CRCA 4ABHA 1K1LA 1UK2A 1LKBA 1GBJA 1FY8E 2A4GA 2CMYA 3A86A 5EPYA 3ZVDA 3HK6B 3DUXH 5C5NA 1Z6EA 2FYRA 1FNIA 1GI3A 2F83A 4XBCA 1GMHF 3A87A 2A5AA 2JH0D 3F68H 2OP9A 3NKKA 1OWEA 5FPYA 1T8OA 3QK1A 4JYUH 1ZMNA 3E8LA 4ABIA 1NS3A 4K3JA 1IQKA 1ZJDA 4ABFA 1EP5A 2TGAA 4YTAA 4IMZA 1WBGB 2ZDAH 1U6QA 1VCQA 1AFQC 2BDAA 4INLA 3PMJA 1ELBA 2ZF0H 1Z8IB 2OC7A 4NGAH 1O5GH 1CVWH 3VXFH 4JZFH 5IYTA 1DPOA 2J34A 2WV4A 3V13A 1H9LB 4UD9H 4IS5A 1ELDE 2G8TA 1EKBB 1C5ZB 1C4U2 2GD4B 3BTME 3ODFA 4KELA 4DY7B 1P2IA 4KKDA 4FUIA 2BHGA 1DE7H 2BD4A 1E34B 1TLDA 3EA7A 2GV7A 1UK3A 1O3HA 2A7CA 2PLXA 3GY2A 4I32A 5HM2A 2XRCA 3GYLB 2G52A 4LOYH 1H9IE 4DT7B 4WXIA 4X1PU 3TK6A 5JBAS 4ABAA 2P8OB 3PO1B 1O39A 1G32B 3SU3A 5J4QA 1OYTH 1L1GA 1ZPZA 2VIPA 4D9RA 2WUBA 3QWCH 1C5XB 4YT7H 1OP2A 1C2HA 1BTPA 1THRH 1UVTH 1K1JA 1O3MA 3SHAH 1PQAA 1C1TA 5F6MA 1C1OA 2BYAX 1QBOA 1CGHA 1EXFA 3T25A 1NFWA 1BRCE 3ZZDA 3KQBA 1TBQH 4Z0KA 2NU1E 3A80A 3ZVCA 3GICB 1NRPH 2ZU2A 3F1SB 1JOUB 1O31A 2WPLS 4AFZA 3RC5A 4YOGA 2BLVA 1P06A 1GI6A 1SGDE 3V7TA 1ZSLA 1UTOA 3VB6A 3ZZBA 1P2MA 2FOBA 2H9EH 2VIWA 2Z6BD 1H1BA 4GSOA 4DVAU 1O2OA 4Y7AA 4Y0YE 1WTHD 3TH2H 1KYNA 1V3XA 2CV3A 3UUZA 1T32A 1C2FA 1G3BA 1HPGA 4X1RU 2XYAA 1AFQB 3ESTA 3DA9B 4R0IA 3Q3YA 3SV6A 1ZRKA 1MU8B 3MHWU 4ZKNU 3TJOA 1HRTH 1S6FA 1EJAA 3RXBA 5BRRE 2FX4A 4AFUA 1TOMH 3SW2B 1SHHB 2ZC9H 2WYJA 3GISB 3MO9A 1GHAG 2A5IA 3O8BA 4K2YA 2FOAA 2G81E 3ZZCA 1E35B 2A4OA 4MLFB 1BTHH 1XX9A 5F03A 1QB1A 2BQ6B 3UR6A 6GCHG 2ZFTA 3MH6A 1DLEA 3RU4T 2BD5A 5AVDA 1A0JA 1EATA 1F5RA 2GZ7A 1IQGA 3GY8A 4J2YB 4DGJA 1QL9A 2GCHF 2ZU3A 3AW0A 1VITH 1D9IA 1NPMA 1C1RA 3M5LA 1E38B 1GVZA 3KQEA 1KXAA 1QGFA 4AG1A 1AFEH 3U8RH 1FIWA 1XUFA 3GCTF 2CJIA 5C1YA 2YOLA 4B2CA 1DVAH 1KDQA 1CU1A 3PROA 1N1LA 1VJ9U 5LPEA 2ZFSA 3RXDA 3DT0H 1P11E 4WJG2 4JZIA 1DXWA 3K2UA 4MQAA 1SQOA 4ABGA 1B5GH 1VJAU 4LZ4B 2OD3B 3ZZ4A 1O2SA 3P6ZB 1W0ZU 1LO6A 2GGVB 1GDUA 4Y11E 1BMLA 1O2JA 1YKTA 3M3VA 4IW4E 1RIWC 1HXEH 3A7ZA 1DITH 2JKHA 4GCHF 4JK6A 1C5PA 5FX5A 1FPHH 1L2EA 4UFEH 1UHBB 2Y5GA 1V2LT 1UVPA 2ZKSA 4X1NU 3RXKA 1AI8H 3A7XA 3MWIU 7GCHG 3VFEA 2ODYB 4XSKU 5JPMH 4ZKRU 4OS6A 6ESTA 2PR3A 1NY22 1DT2A 3FP8E 3UOUA 3L6PA 1GWAA 1TFXA 1IQHA 2C8ZB 3STIA 4NIVA 1GVLA 3RXRA 3SV2H 2VNTA 3RU4D 2VIDA 2JETC 2UUJB 3DFLA 5T6GA 1CHGA 3RXEA 1IQMA 2BXTH 1O3IA 4DG4A 1UTMA 1ESBA 1LHDH 1MTWA 4WH8A 5E2OA 1N8OC 4CRGA 3IG6B 1G3EA 6LPRA 2ZP0H 1T4VH 3U69H 1Y5BT 4WH6A 1QQ4A 2B7DH 1DLKB 3BTGE 1GMCF 1TNJA 3UWIA 1RTKA 1O5EH 1C5SA 3STJA 2GDDA 2ZDVH 1SI5H 3U8TH 3VEQB 3UWJH 1GI8B 4U30A 1HJAC 1HBTH 5E0JA 1RGQA 1P2NA 4XBDA 4Y0ZE 1MCTA 3RXPA 5DP3A 1HGTH 1OWHA 1UK4A 4OS4A 1V2NT 1BBRE 3QLPH 1E0FD 1O38A 1WV7H 4ISHH 1W8BH 3SOSA 1GBCA 2Q6FA 3M5NA 1BHXB 3OYPA 2GVFA 4VGCB 2FO9A 1LVOA 3I78A 3RXVA 1BIOA 3PLKA 1YPGH 3CP7A 2TRMA 1IOEA 2P94A 2VH6A 3FZZA 3A7TA 1Q2WA 2ZCHP 2CGAA 2UUYA 3VGCC 3NWUA 1TAWA 1TIOA 1GBTA 1LKAA 1UJ1A 1IHSH 4E06H 1ZMLA 3EA8A 2BVXH 4IBLH 1O2KA 4NFEA 4D7FA 1ZYOA 4UDWH 2F9UA 1L4ZA 4ZKSU 3T28A 3UNSA 1RIWB 1O3KA 2EI8A 3LGVA 3QN7A 1F0TA 3I77A 5LGOA 8ESTE 3S7KB 3E6PH 1Z7KA 1Y3YA 2A0QB 4HTCH 1TRNA 1QJ7B 3T62A 4A6LA 2A2XH 2IJOB 3GY6A 3E1XB 1WCZA 1WUNH 4FUEA 2G5NA 3T26A 3UTUH 2PSXA 3TVJB 4Y10E 1SGQE 1K28D 2AMQA 1SBWA 3RXTA 3M7UA 1NFUA 4IN2A 1O2VA 3B23B 3LOXA 4WVPE 2FOEA 2ZHQH 5E0HA 4BAHB 3EYDA 4WWYA 1UCYE 1LQEA 4XE4A 5CMXH 3P8GA 3SV7A 4B2AA 2BD9A 1FI8A 1CGJE 1F2SE 2ZTZA 4U32A 2ZI2H 1YF4A 2K1QA 1GL0E 2HOBA 1J16A 4AG2A 3D49H 3A88A 3KNXA 2SNWA 1O3JA 1YGCH 1EZQA 4TWWA 1LQDB 5B6OA 1O2ZA 2G51A 3EE0B 3RP2A 5FPTA 1GCDA 1O5BB 1X7AC 1BTYA 3MH4A 1GHXH 3P95A 3LH1A 1HAYB 1OWKA 3HK3B 3RXLA 3D23A 1C4Y2 2HGTH 3KCGH 1D3PB 1WQVH 5CHAB 3SJOA 1ELGA 2FOHA 2QF3A 4A1XA 2G4UA 3UNQA 2GZ9A 2FOFA 1A4WH 1ARCA 3QTOH 4Q2KA 3OU0A 3VGCB 2GT8A 2CF9H 1CSOE 3SGAE 1OXGA