3BTEE

The crystal structures of the complexes between bovine beta-trypsin and ten p1 variants of bpti.
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
221
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords TRYPSIN
publication title The crystal structures of the complexes between bovine beta-trypsin and ten P1 variants of BPTI.
pubmed doi rcsb
source organism Bos taurus
total genus 54
structure length 221
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3bteE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3bteE02
1MAXA 1O3KA 1P2NA 1W14U 2B0FA 4TPIZ 5C20A 2PKSC 5JB8S 1A5IA 1AO5A 1S5SA 4KELA 1NPMA 4NG9H 2P3FH 1O35A 5B6OA 4K2YA 2P95A 4WH6A 1DDJA 2Q6DA 4ZHAA 1ZYOA 1TB6H 4Y10E 1P2KA 1HAOH 4X8VH 5JDUB 3T25A 3ATLA 5F6MA 1DWDH 3DHKH 1C1OA 1V2VT 1A0HB 3H7TA 1PJPA 4ISIH 3VB7A 1YCPM 2BLQA 5E8EH 3QWCH 3BIUH 2XCFA 4J1YA 1YGCH 3URCA 1GHVH 1SBWA 1V2WT 3M5NA 3TNSA 1VR1H 1KXDA 3M5LA 2F83A 4I31A 1SC8U 1TMTH 2A1DB 1Z8RA 2J9NA 2IOTA 2FI5E 3SJOA 4LK4A 1FXYA 2QF3A 1AIXH 3SV8A 1A2CH 1ZSJA 3UOPA 4FU9A 2H5DA 1O3IA 1C2FA 2CHAB 3AASA 1NM6A 1ABJH 1C5TA 2NU4E 4FVDA 2R0LA 2PTNA 1NRQH 4DG4A 1NU9A 2BY6X 2FWWA 3BN9A 4J2YB 1SVPA 3P95A 3RXKA 1YP9A 1P2IA 3P6ZB 2SGDE 2WPHS 1SGEE 1C1UH 1V2TT 4BANB 2ZGHA 1LPKB 3T26A 5BPEA 3ZVAA 4FUHA 3U1JB 1QIXB 1W7XH 1SGYE 1QRXA 6LPRA 1C1PA 2HLCA 2VWOA 1AN1E 4CR5A 1ELBA 4YT6H 4CRFA 3IG6B 4O03A 2QAAA 1O3PB 1Q2WA 4K69A 2QXIA 1V2ST 3UQOA 3RMNH 2ZFPH 4U01A 1NU7B 1GBBA 1GMDG 5TJXA 2AEIH 1C1WH 3A85A 1QQUA 1ELEE 5CE1A 1O2OA 3UY9A 3RM0H 2O9QA 1QRWA 1J16A 1ELDE 1TGTA 2A4QA 2AGEX 2PFEA 3M3TA 1BB0B 1EZUC 1O3FA 1P2MA 2GMTC 1A3EH 1C2IA 4TWWA 4MNYA 1BTWA 4RKJB 2A5IA 4A1VA 2BX3A 3HKJB 1XMNB 1AB9B 1C1NA 3EGKH 3B8JA 1GBHA 1TQ0B 1G3BA 6CHAB 5I46H 3T2NA 1D3QB 1O5FH 1TNIA 2ZG0H 2BTCE 1GCTC 2D8WA 8GCHF 1IQHA 4ABJA 1C4V2 1GI1A 1RIWC 1TBZH 4XBBA 2PLXA 4JYVH 1B0EA 1KTTB 1THSH 1ELCA 1HFDA 4MDSA 1C5OH 3OX7U 4UD9H 4E7NA 3KQBA 3SUGA 2OP9A 3M7TA 1O5AB 1C1SA 1CU1A 2A7HA 3V13A 4DURA 3PMHB 5EQQA 1BBRK 3NXPA 1IQMA 1Y3XA 4NA8A 1O2XA 1BT7A 3SHCH 1MD8A 1PYTC 1RTLA 1C2LA 1JMOH 1WTHD 2ZCLP 3VEQB 3TGIE 1J9CH 2ALVA 2ALPA 1TABE 2C3SA 3UPEA 3SNCA 3BTGE 1ZPBA 1C2JA 1EAIA 3GY7A 4YLUA 5HYOA 3DT0H 4Q2KA 3E91A 1ACBE 4OS2A 2NU2E 3GDVA 4B74A 2JH0D 1SI5H 3LH1A 1MTVA 2QGRA 1A5GH 4B73A 2H1UA 2VWMA 5F03A 1PQ5A 4K1SA 2O8TA 3FFGA 2HRVA 3RXMA 1JXPA 1ANDA 1QJ6B 2J95A 2P16A 1KTSB 1S6FA 2Z9GA 4OS1A 5SGAE 1QA7A 4LXBH 2Y6TA 3Q00A 1WOFA 2O8UA 3E0PB 2EC9H 2EI6A 4CH8B 3HATH 2A2QH 2D26C 2EA3A 3QTOH 1C9PA 1IQEA 2F9VA 4HGCA 1P0SH 4GAWA 1AB9C 1N8OC 1LPZB 1BMLA 4AX9H 1O36A 1J14A 1U6QA 3ITIA 2GZ8A 2M5TA 3PLKA 1FMGA 3AVZA 1TBQH 4K1EA 3FP7E 3RXIA 1E38B 1S0QA 1RJXB 3ZVDA 1XKAC 1XXFA 5A2MH 1HIAB 1UTLM 1Z1JA 1NT1A 3BTME 2FPZA 2GTBA 4O9VA 1QA0A 5A09A 2FM2A 1CSOE 1GMHG 1JBUH 1VITG 2ZGBH 5FHTA 1Z8JB 3MMGA 4ABIA 1NRRH 4XBCA 3M37A 4FUDA 2VIPA 1O30A 2BYAX 3SNAA 1D3TB 1Q3XA 4NWKA 1P02A 1YPJH 3LKWA 1WQVH 3A86A 1FN8A 1P05A 1HPGA 5EXLA 1C1RA 1MMJN 1N1LA 3SU0A 1BMMH 1G36A 1HJAC 3SU1A 3O8DA 2SGPE 4CRCA 1PQ8A 3LONA 1GI4A 2AGIX 1HIAA 3MO9A 1ESAA 1NTPA 1O39A 1GI2A 3LGWA 2AIPA 4K3JA 3NWUA 1HAYB 3VGCB 2UUFB 4IC6A 3A8CA 1FY4A 2BD2A 2P59A 3KQDA 4FXGH 4WMEA 4NZLA 3UWIA 1F92A 1DLEA 2V3HH 1MU6B 2R3UA 1O3GA 1SLWB 2ESTE 3ATIA 3SJ8A 2BOHB 3F9HA 2FODA 3VPKA 2HWLB 4D8NA 3RMMH 3QX5H 4MTBA 3U69H 3OY5U 3RXLA 4K60A 1BZXE 1W11U 2WUBA 3PB1E 4JK6A 5FCKA 4A1XA 2AYWA 3PLBA 1Y3UA 1DSUA 2QYIA 3MU0A 4SGAE 1GBLA 1LHEH 1K1JA 3PMJA 5LPFA 5JYIA 3DUXH 2J38A 1KIGH 2ZKSA 1TMUH 1GBMA 2VH0A 3RXRA 4AN7A 1Z8GA 1YCPH 4INHA 1NFXA 2PUQH 2W3KA 2ZU4A 2VINA 4Q7YA 1VGCB 3K6ZA 1NC6A 4MPWA 3L3TA 1V2PT 3T29A 3BG4B 4NFFA 2A7CA 1ZGVA 1CHOG 3MTYA 1SGFG 4JZFH 5EXNA 1YPHC 4AYVB 1O2YA 4DT7B 1CA0C 1NFUA 1P06A 1BTUA 1NROH 4HZHA 1MD7A 3S7KB 3ZZ3A 1UTMA 2XXLA 1S82A 2NWNA 1FLEE 1SPJA 3RU4T 1W12U 3MHWU 1H9HE 4KTSA 1DFPA 1O31A 1HDTH 1C5QA 1V2UT 2A0QB 1AMHA 1AVGH 1LVOA 1PPFE 1T4VH 3VGCC 2STBE 1AE5A 3ZYDA 4AGKA 3RXHA 1YPEH 2A5AA 4WMDA 3MNBA 2BD9A 3M5OA 3RXDA 1GWAA 2Z9KA 1EX3A 1MUEB 4SGBE 1UTOA 1Y3VA 1GBFA 1CT0E 3K65B 5ETXA 1T4UH 2ANYA 1WAYB 1K28D 2VWNA 1XUKA 5JBAS 2ZQ1A 1T7CA 3M3SA 1F0UA 1GI6A 1QB9A 3PM3A 2C4FH 4GHQA 1FY1A 1L1NA 4INKA 2BY5X 3ESTA 3HK3B 5FX5A 3KN2A 1BMAA 1LHFH 2VNTA 2C90B 1DOJA 2VH6A 1ZJKA 2Z9JA 4AB9A 2SGEE 1KXEA 1C5LH 3ZVBA 2TGPZ 3MWIU 1SQOA 1VGCC 1XUGA 2RG3A 5HGGA 2EI7A 1GI0A 3SI4H 1QL8A 2BDGA 1UTQA 3E0NB 3BG4C 1XUJA 3EA9A 1B0FA 4NA9H 4YOGA 1JIMA 4WH8A 4DVAU 2O8LA 3GCNA 3SU2A 2O8WA 3V0XA 1AU8A 4JZIA 3RC6A 1OSSA 1O2LA 5FXLA 1PPGE 2DUCA 3M7QA 4NIVA 1K1OA 1ORFA 2RCEA 2J4IA 4BAOB 2BDYA 3N7OA 2FLBH 1TNLA 1G3DA 2FTMA 1UTKA 1SLXB 3GCHB 3AW1A 2PHBA 1DWBH 3UR6A 1OYTH 1P11E 5DG6A 4CBOA 1QURH 3IWMA 4Y8ZA 1TGCA 3GYLB 1GGDC 3QUMP 1O3JA 2BDBA 1JRTA 1VCQA 3GDSA 2XBWA 1ZPZA 1PPZA 1L1GA 1ARCA 1YPGH 2BDCA 1NFWA 3LC5A 2OBOA 3D62A 1AVXA 1TA2A 2QXJA 1QBOA 4UFFH 1QJ7B 4NIXA 4MNXA 2FX4A 2C8YB 2H6MA 4WWYA 5T3HA 3MH6A 2YNAA 3S0NA 1EJNA 1AFQB 4F49A 5A0AE 5DP3A 5AFZH 2H2ZA 2O8MA 4VGCB 1H9LB 2ZDNA 3LT3A 3MNSA 5JBBS 3SNEA 1BRCE 1P9SA 1EZXC 3R3GB 2ULLA 1C5UA 1P01A 2PGQB 3MU4A 3RLYH 1TIOA 1HJ9A 1P10A 4X1QU 4U32A 3A8AA 1P2QA 1RTFB 2ZDMA 2UUYA 3L6PA 1CGIE 1F5KU 1V2LT 2ODQA 3ZYEA 3JZ1B 2HGTH 3KL6A 3PO1B 1MQ5A 1DT2A 2VIWA 2RA3A 2TGAA 1LTOA 4IMQA 8ESTE 2SGAA 2FX6A 1PQAA 1D3PB 2NU3E 3A7XA 1V2KT 3Q3YA 3BTKE 3I29A 6ESTA 4B75A 3TJOA 1A4WH 2QXHA 4TWYA 1PFXC 5TCCA 1DSTA 2Q6FA 2F9BH 2BXUH 1C5VA 3ZZCA 3PLPA 1O5EH 3SN8A 1DICA 1MTNC 3LIWA 3ZZ5A 2ZP0H 1WV7H 2ZFSA 4UDWH 4ABHA 4CRDA 1LQDB 1LVBA 4ZHLU 1O3LA 3GYMA 1UK3A 2GD4B 3U9AH 2OBQA 4X8SH 3L33A 3GCHC 3TIUA 4GVUA 2FOCA 1O2RA 1BHXB 3TPIZ 2AS9A 1EOJA 5F8XA 3W94A 1O5GH 3HKIB 1VZQH 2BLOA 2FOHA 3SNBA 2A4OA 2BVSH 3RXUA 1FNIA 1GHAF 3GOVB 4WXIA 1O0DH 1C9TA 1SGRE 4VGCC 1H8IH 4NIWA 1LHCH 1JRSA 2B5TB 2FZZA 2QN5T 1SOZA 1V2QT 4Z6AH 2SFAA 1J15A 1DX5M 3NPSA 1IHTH 3STJA 1GPZA 1Q31A 3UIRA 1VJAU 5EGMA 3RP2A 5K0HA 1GHBF 2BY7X 2BHGA 1P04A 3SI3H 1HNEE 1C5RA 3SUFA 3BTWE 3EA8A 4K1TA 1TGNA 4FUCA 3E90B 5DPAA 5CHAB 1MKXH 2C8ZB 2BMGB 1KDQB 5AVDA 2IJOB 3ZZDA 1GJ4H 3P8NA 1N6XA 4Y7AA 4AFZA 3QO6A 3LGUA 3AW0A 4I8KA 2VJ1A 2FLRH 4DGJA 4O97A 3FVFB 4FU7A 1T32A 4DIIH 2A4RA 1PPHE 1TRNA 1BMNH 3VB5A 1F0RA 1ZMLA 1P09A 1GHWH 2BD7A 3MU5A 1MTUA 1FY8E 1VJ9U 2TGTA 1DANH 1P12E 5FAHA 4FU8A 3TU7H 1GDUA 1KDQA 2VU8E 1UMAH 3OYPA 1WTGH 4AZ2B 2GCHG 1K2I1 3K2UA 3P8GA 1DVAH 4A1TA 1O2QA 3M5MA 4ZXXH 5C2ZA 2XWAA 1C4U2 5DP6A 2OC8A 1KXFA 1Y8TA 1LVMA 1BJUA 1DUAA 1ZR0A 4X1PU 3S7HB 1HAGE 3LC3A 3BTTE 1SGCA 1OXGA 4KTCA 3SBKA 4A7IB 2J2UA 2WV5A 3Q77A 3A8DA 2AFQB 4D7FA 1SHYA 2CMYA 3QGJA 2HALA 5FBIA 3A88A 3SUEA 1YC0A 1TPSA 1KLJH 1UHBB 4ESTE 4UEHH 2CF8H 2DE8A 1Z8IB 2FS9A 5AF9H 1SFQB 4I8HA 1A7SA 2PW8H 1RGQA 1CVWH 1GG6B 2LPRA 2GT8A 3BEUA 1YLCA 2FS8A 1MQ6A 1D6RA 1P03A 1AD8H 3GISB 1YF4A 1PPEE 2PR3A 1BA8B 1LMWB 1SGQE 1TYNA 1ELTA 5L6NH 2B9LA 3RXPA 3DA9B 1DUEA 2P3UB 2G81E 3MU1A 4NSVA 2CHAC 4FUJA 1W0YH 1MZDA 1V2OT 1Z6EA 1P9UA 1ETSH 1UHBA 4H6SB 4E05H 1P2OA 2VGCB 2ZGJA 5A0CA 5DKMA 1TALA 1O3MA 1OWIA 1TOMH 4DOQA 3ZZ7A 1QL7A 3D23A 2Y5HA 3BIVH 3BTHE 4Z0KA 2ZWLH 5LPRA 1BDAA 3FZDA 1EJMA 4YO9A 2ODYB 1GJ7B 1GMCF 1TE0A 4ZKOU 1XX9A 2ZNKH 1O3NA 1TPPA 1UCYH 1O33A 4X0WU 4XBDA 3ZVGA 2AMPA 4X8TH 4CRAA 3RMOH 1IQLA 2HVXA 3ZZ9A 1O2WA 2D1JA 1LPGB 1MH0A 1XVMA 4IW4E 3NK8A 1BTXA 4U2WA 3RXEA 1M9UA 1BHXF 1ZHMA 3ELAH 3UTUH 4YOJA 3A87A 4XDEA 2BDHA 1C1QA 1HXFH 4KKDA 1W7GH 4I8JA 3G01A 4MPVA 4Y11E 2FOGA 3QZQA 5J4QA 4X6OA 4FVBA 1J8AA 2FESH 1ELGA 1LDTT 4GUXA 3TGKE 4OS7A 3FZZA 3V12A 1GDNA 1HLTH 5DK1A 2ANWA 1NFYA 5C1XA 1O5DH 6CHAC 3FP6E 1WCZA 4BAQB 3MOCA 1T31A 1TPOA 3GY4A 1A0JA 1ELVA 2FO9A 1MKWH 5HM9A 2FXRA 4BTIB 1G2LA 1S81A 3Q76A 2EEKA 3SUDA 6GCHG 1GJ8B 4GSOA 1H9IE 2F9NA 4WJG2 1W13U 4UFGH 5E2PA 2Y7ZA 5EQRA 1D3DB 1C1TA 3CS0A 2BZAA 2OC7A 3MU8A 3SNDA 1GVKB 1BITA 1K1NA 1GI3A 3P8FA 4INLA 4DJZB 5IYTA 4B71A 2VIVA 1GL1A 1G3CA 1C2GA 1TGSZ 2Z9LA 1OWEA 1GJDB 3RXFA 1GJ6A 2ZU3A 1SHHB 4DW2U 3TH3H 2BXTH 2SGQE 1YPHE 1UK4A 3BTDE 2TGDA 3M35A 2GKVE 1G2MA 4AGJA 2FYQA 2JH5D 3RC4A 1KSNA 1Y5UT 2VIOA 3C27B 4K8BA 3VXFH 1C2HA 1BQYA 3B23B 4CBNA 3A8BA 1FV9A 1IHSH 2I6QA 1GBCA 2ZHWH 1FDPA 1H1BA 5EOKA 4X2XA 2CN0H 4ABBA 1V6DA 1BRUP 3MFJA 1MBQA 4GCHF 1KYNA 3UNQA 1QY6A 1E34B 2VVCA 3DFJA 1DWCH 5DGJA 2ZFRH 1ZHPA 4NFEA 2BM2A 1W3CA 3A7VA 1B5GH 3F9FA 3K9XB 5ESTE 3RXSA 4NZQA 3RXGA 1MTWA 3E1XB 1IQJA 2BD3A 1FY3A 4I8GA 4HFPB 3PTNA 3LPRA 5DP5A 2UUJB 1ANBA 1Z1IA 5GIBA 1T8LA 4FUIA 3QLPH 1TLDA 1TGBA 1ZOMA 1ELFA 3LOXA 2ZFTA 3UUZA 1PYTD 4BXWA 2BQWB 2A32A 2G55A 2ZDLA 4LZ4B 5C67A 1GJBB 2ZDKA 4X2VA 3F1SB 4TYDA 3MYWA 1C4Y2 1EAUA 2QY0B 1KXAA 2AH4X 2XC4A 5GCHF 1LHGH 2A2XH 5E2OA 2FOEA 4ABDA 2XC0A 1PPBH 5GWZA 1F0TA 4MNWA 3A7TA 4WMFA 2ZC9H 1TQ7B 4Y79A 2GV7A 4FUGA 1RS0A 1LHDH 2R9PA 2PWXA 3IITA 3TK6A 3LJJA 1EQ9A 1GI7B 1IAUA 5FBEA 3RXAA 1JWTA 5EPYA 1GBTA 3OTJE 1K1IA 1P57B 1OWHA 5C5OA 2BOKA 3M36A 1C5XB 2GDEH 4Y71A 3RXTA 1RD3B 3BTEE 4GLYA 1AQ7A 1UTPA 2ANMH 3RLWH 1J17T 9ESTA 1XUIA 2ZDAH 3FANA 1TNGA 1GI8B 4E06H 3W95A 3KCGH 1QL9A 1YCPK 2UUKB 3CP7A 1HJ8A 1GBDA 1K21H 3SW2B 1TPAE 3MH5A 1C2KA 2Q1JA 3UNRA 1OWDA 3SQHE 3A7ZA 3SU6A 3JZ2B 1CHGA 2WUCA 1TMBH 1DXPA 1V2MT 1FUJA 3RDZA 1O3AA 2G52A 8GCHG 2FOBA 2A45B 1EAWA 4IBLH 1Y59T 4ISLA 4YESB 2WYGA 2VVUA 2GP9B 3TJVA 4AFUA 2F9PA 3FP8E 3B9FH 1S6HA 4O3UA 2Y5FA 1TX7A 5A0BA 1UVSH 4Y8YA 2BY8X 3O8CA 7GCHF 2Y5GA 2G8TA 3E3TA 3S9AA 3SO3A 1XXDA 2BDIA 1G32B 1O5CB 1QQ4A 2ZHDA 1UVOA 3MI4A 1INCA 2W26A 2BLWA 1AI8H 4MNVA 1OKXA 4IN2A 2XBXA 4IMZA 1TNKA 4KP0A 2J34A 3SJKA 1OP0A 3SGAE 2ZCHP 2JETB 1YM0A 4X8UH 2K1QA 4JMYA 1UVUH 1ESBA 2AGGX 1FN6A 1BCUH 1ANCA 1GBIA 5J4SA 3NCLA 1NRNH 1AUJA 1O34A 1HXEH 1AZ8A 1SGIB 4ZKRU 4Q7ZA 4WF8A 5EODA 2OQ5A 2RDLA 1GI9B 2P8OB 2FTLE 5EU8A 1THPB 1EB1H 1L0ZA 3LGVA 4HTCH 1KY9A 1YPMH 3SOSA 5EG4A 3K6YA 1LKAA 2TPIZ 5F8TA 3S9BA 2W5EA 1ZMNA 4Y0ZE 2OQUA 4BAKB 4Y76A 1ZTJA 4WVPE 1HAHH 1P8VC 1AFEH 4A92A 1O32A 4E7RG 4BNRA 5C3NA 2WINI 2FMJA 1TFXA 3R0FA 2XW9A 1S84A 1VITH 1EP5A 1F2SE 2NU0E 2BQ6B 3TLOA 1EJAA 3O8BA 1TA6A 5DP7A 1SLUB 1K1MA 2V6NA 3SV9A 2G4TA 2FDAA 1FJSA 3ATMA 3PMAB 4Q80A 1CQQA 4CREA 1O2UA 2W3IA 2ZTZA 4FUEA 5H4IB 1SGFA 3TJNA 1HAVB 2ZFQH 4WY3A 4ZH8A 4AG2A 1ABIH 4IS5A 2HPQH 5TCAA 1HBTH 2PSYA 1PQ7A 1QB1A 3HGPA 4MPUA 1SB1H 3MO3A 5A8ZA 4U30A 3F68H 5AFYH 1O2MA 3PROA 1FPHH 2PKSB 1NO9H 1HB0B 3DFLA 1KLIH 1E36B 3TITA 4I7YH 2JETC 5ESBA 1XUFA 1GVLA 1SQAA 2ASUB 1TWXB 1ZRBA 4YZUA 4H42U 4JZDH 3UQVA 1HGTH 3UOUA 2PKAB 1EOLA 1GHZA 1N6YA 1E0FD 1TNJA 2ZGXH 5PTPA 3O8RA 2STAE 2FP7B 5EXMA 3ODDA 4ZMAH 1T8NA 1Z7KA 3E6PH 1BTZA 3MNCA 1YYY1 2BVRH 2LNCA 1G37A 3SU5A 1EPTB 1DY9A 1XUHA 1D9IA 1Y5BT 3VB4A 1OWJA 1A5HA 2ZI2H 2FOAA 1AFQC 1MCTA 1SGNE 3GY8A 3S9CA 3SJIA 3CENA 1EB2A 2JKHA 3RXQA 4IN1A 3ZZAA 4BTTB 4BAMB 2ZU2A 1GMHF 2H9HA 3I77A 1WSSH 5DJ7A 1AUTC 2ZHFH 3E8LA 3M61U 2ZPRA 2PKAA 1C2DA 1O37A 1FONA 4AFSA 4AFQA 1BRAA 1CGJE 1IQNA 1W0ZU 1O2NA 2WV4A 3GICB 2Z3DA 1LCYA 4NWLA 2ZU1A 1AKSB 1DY8A 2ZPQA 4ZAEA 5DP8A 5GDSH 4CRBA 4BTUB 4NSYA 1FIWA 3PO1C 1NESE 1TOCB 1NZQH 2WPKS 3U98H 1JIRA 1VCWA 1F7ZA 1EPTA 3GCOA 1UO6A 1DE7H 2SNWA 2TIOA 3A81A 4JYUH 1KXCA 2HNTF 2PGBB 1BRBE 2CGAA 4WXVA 2CJIA 4XFQA 2SNVA 2QF0A 2GMTB 1Z6JH 2ILNA 1QRZA 4I33A 4AORA 3PMBB 4JCNA 1ZLRA 3TK5A 3NUMA 1FQ3A 3LH3A 1WBGB 3SHAH 1WQSA 3MO6A 1UVPA 1YLDA 2VIDA 1AKSA 1CGHA 1D4PB 2G51A 3PWCA 3M3VA 3ZVEA 2ZCKP 1O3CA 1ELAA 1QBVH 1GCTB 1EUFA 1BUIA 1K1PA 1L4DA 1QJ1B 2C93B 3UREA 4CH2B 3BEFB 1RIWB 1MCVA 4FUBA 2FIRH 2OINA 4YT7H 2XTTB 3TH2H 3DD2H 2OD3B 3GDUA 1UCYE 1SFIA 1AZZA 2FI3E 1EPTC 1O38A 3TNTA 1SSXA 2C8WB 2A5KA 1C5YB 1MKXK 4A5TS 1GVZA 3RM2H 1L4ZA 3OU0A 5AHGH 2ZU5A 2ZFFH 5E0GA 2ZEBA 4LOYH 4X2YA 2BD8A 4XOJA 7GCHG 4FUFA 1ZMJA 1KLTA 4UFDH 2PSXA 3VB6A 4Y7BA 3VFEA 5A8XA 2FYRA 3MH7A 1CHOF 2P93A 1B7XB 3URDA 1EKBB 1AWHB 1F0SA 4B2BA 2B7DH 5E0HA 1H4WA 1O2SA 3ATKA 2Y80A 2Y82A 1YKTA 5JBCS 4R0IA 1DXWA 5C5NA 2W7SA 4NA7A 1BTPA 4X6NA 4O3TA 2F9UA 1O3EA 2UWLA 1HAXB 5CHAC 2ZECA 4XSKU 1BBRH 4ZKSU 3SV6A 3HPTB 3BF6H 1C5NH 2G4UA 4MG3A 1T8MA 3LJOA 4I32A 3ZZ4A 1QGFA 2Z3CA 1AE8H 2AMDA 3VXEH 4YM9A 1GBJA 3F6UH 3SORA 1N8OB 3NKKA 1HAIH 5HMAA 4BAHB 4RKOB 2BD4A 4UFEH 4XE4A 1IQKA 1CA8B 1MBMA 2P94A 3SGBE 3KNXA 1GDQA 1HAPH 1ETRH 3LDXH 5EPNA 3ENSB 2F9OA 3LGYA 3PV4A 5EW1H 1SQTA 1LO6A 3PTBA 4ISOA 4QT8C 2RA0A 2GCTB 3ZV8A 3QGNB 3TK9A 3RXBA 8KME2 1DS2E 1UTJA 1X7AC 1C5PA 1W8BH 4H4FA 5DP4A 2OCVB 4GHTA 3T27A 2Q6GA 3T5FH 3EA7A 2UWOA 4ZHMU 3U8TH 4B76A 4X2WA 3V7TA 3BV9B 2XC5A 3UNSA 1HCGA 5K7RA 1GBKA 5HM2A 1IQGA 1AGJA 1LQEA 3FAOA 2V0BA 1GJ5H 1FY5A 8LPRA 2ZGCA 1SGPE 1SGTA 4NIYA 1OP2A 1HJAB 2BD5A 7KMEH 2CV3A 1UJ1A 5T6FA 1EXFA 2ZA5A 1K9OE 1GJAB 3RUOA 1OX1A 1XM1A 3WY8A 1EZSC 5C1YA 4KGAA 5HXFA 1C2MA 3D49H 5BRRE 4JZ1A 1CBWB 3A83A 2Z9IA 3ODFA 2GT7A 2GDDA 3A84A 4M7GA 3GCTF 1T8OA 1UK2A 2XBVA 1GG6C 3C1KA 2BY9X 1P3EA 4YOIA 1ZTKA 3TVJB 1P3CA 1S85A 4D9QA 1UCYK 1YPKH 1ZHRA 1ETTH 2WPLS 1HAZB 1SGDE 2QCYA 1AY6H 2B8OH 1TBRH 1D6WA 5L2YH 4ZXYH 1HRTH 2VIQA 3Q3XA 2QA9E 5FCRA 4RSPA 4YLQH 2YOLA 3D65E 2Y81A 1GHAG 2VGCC 2BB4A 1CT2E 2GCTC 2PTCE 1ZPCA 1JOUB 1TNHA 1C5SA 1ZZZA 3KHVA 4A6LA 2Z94A 3TH4H 4ISHH 1DWEH 3RU4E 1EASA 2A7JA 1A0LA 3RMLH 5FPYA 2ZHQH 1QR3E 2GZ9A 3OSYA 1QB6A 1CA0B 2GV6A 3QZRA 4Y6DA 1ZRKA 1MKWK 1GHBG 2OLGA 1BIOA 3ZZ6A 2SGFE 3A7WA 3CS7A 5LH8A 2ZPSA 4DY7B 5DO4H 1P2JA 1C2EA 1O2JA 1O2PA 3P8OA 3EAJA 4D9RA 4Q7XA 1C1MA 1KXBA 5C1UA 1SR5C 1IQFA 3HGNA 1W10U 3GY6A 5LGOA 1CT4E 1O3OA 3T62A 1FIZA 5F8ZA 4ABGA 1CE5A 4AG1A 3F9GA 1CBWC 1BOQA 5JPMH 1O2VA 1A1RA 5L30H 3H5CB 1A46H 2ZTYA 2WYJA 4ABFA 4AOQA 2ZHEH 2FEQH 1CO7E 3UFAA 3UR9A 1SL3A 3P70B 2ZDVH 5EQSA 2HOBA 3P92A 3KIDU 3QDZB 4DCDA 2XRCA 3PWBA 1UVTH 3T28A 2G5VA 1RXPA 2ZF0H 3UWJH 2ODPA 2H9TH 7LPRA 1C5MD 1V2JT 1XVOA 1WUNH 5GJ4B 2R2WU 4BOHA 2FOFA 3TGJE 3RXJA 2R3YA 4X1RU 2TBSA 3KQCA 1HYLA 1DLKB 1O3DA 4MQAA 2FOMB 4ISNA 5DP9A 2J92A 3ZVCA 4CHAB 4JZEH 2R0KA 4B1TA 1QNJA 2OTVA 1O2IA 3TJUA 3GY2A 3RXOA 1HV7A 1O2ZA 1FZZA 2AIQA 2FI4E 1NRSH 1ZSKA 3QN7A 2V35A 4AB8A 3KGPA 3KEEA 2THFB 1H8DH 4IC5A 3H7OA 2D2DA 3NZIA 3ATWA 3I78A 5FX6A 1BJVA 4MLFB 1Y3WA 3KF2A 1OPHB 3E16B 4MPXA 4R8TB 1O2GH 1DITH 4TPYA 3ZV9A 1FAKH 1GGDB 2PUXB 4GPGA 3LU9B 1TX6A 1Y5AT 1MAYA 1Y3YA 3SJ9A 5G4BA 2GX4A 2JH6D 3SZNA 1RTKA 2A31A 1E35B 4OS5A 3F9EA 2VVVA 2NU1E 3BEIB 1OWKA 1TONA 3RXCA 2W7UA 1QTFA 2GVFA 1ZJDA 2Y7XA 4IGDA 2BZ6H 1WU1A 5CMXH 1UTNA 2TRMA 1OYQA 2IPHA 4KTUA 4ABAA 2ZQ2A 2GCHF 1IQIA 1GHYH 2HNTE 2HPPH 1YPLH 3OY6U 1RFNA 4Y0YE 1C5ZB 2ZZUH 1G9IE 2XBYA 2BX4A 1TRMA 2H9EH 4LZ1H 1BTYA 1G30B 2ZO3H 1NS3A 4I8LA 2GZ7A 5T6DA 1GMCG 4YTAA 2F3CE 4AYYB 1DPOA 2AERH 1A61H 2XWBI 4X6MA 1GMDF 1GBEA 5IDKA 1C1VH 4B2CA 4BXSA 1ZSLA 1W2KH 3SU4A 3U1IB 7ESTE 1F5LA 1FPCH 4D7GA 4CHAC 4DIHH 2OC1A 4OGXA 2UWPA 1ID5H 1C5WB 2KAIB 2CF9H 2G5NA 2P3TB 3LGTA 2XYAA 5ABWA 1GHXH 1SOTA 4TY6A 1MTNB 2DE9A 5GPIB 1V2RT 3ZVFA 3MH4A 1ARBA 4PROA 2ANKH 3RXVA 3EE0B 1O2TA 1OOKB 2QXGA 2XCNA 3M7UA 1AVWA 1LKBA 3GCTG 3SGQE 4OS6A 1FI8A 3HK6B 1O2KA 3BG8A 1GJ9B 1ANEA 2QIQA 1SMFE 4HI3A 2Z3EA 3KQEA 5JB9S 4B2AA 3SV7A 1FAXA 3AAVA 2PV9B 1O3BA 2HNTC 3A82A 4ZUHA 5I25A 3RU4D 1DM4B 5JBTA 2KAIA 3RC5A 1GI5A 9LPRA 5FPSA 1QBNA 1THRH 3MNXA 1K22H 4OS4A 1GL0E 1SLVB 2BLVA 4D76A 1OS8A 2OXSA 3A80A 2H5CA 4X1NU 1AHTH 2Z6BD 2WPIS 4CR9A 4RN6A 2ZIQH 1WYKA 2VWLA 4NCYA 1V2NT 5L2ZH 2BQ7B 2WPJS 5T6GA 4JK5A 1IOEA 3LGIA 4MVNA 3U8RH 5EW2H 1LVYA 4UE7H 1VCPA 1RRKA 1MZAA 1ESTA 1NN6A 1OP8A 1TRYA 4ABEA 4OGYA 2F91A 2GGVB 2OC0A 1ZGIA 1F5RA 3QTVH 4Y8XA 1TAWA 4UONA 1E37B 4CRGA 2R2MB 1HAVA 2J94A 1SG8B 4GCHG 5A8YA 2VB0A 3Q3KA 2AMQA 3V3MA 1TX8A 2P8OC 1NRPH 1O2HA 3A89A 3SU3A 1AWFH 4X6PA 5GXPA 3ZZ8A 5LPEA 1GBAA 5E0JA 4H6TA 2C8XB 1MTSA 3QK1A 3EYDA 4JYTA 1ZTLA 2BVXH 1BTHH 1EP6A 1PPCE 1S0RA 3A7YA 3GY3A 2WPMS 4THNH 2EI8A 3P17H 3U8OH 1QCPA 4F4OC 2A4GA 6GCHF 3BSQA 2V3OH 1L2EA 3AAUA 2YNBA 1VITF 2CXVA 1EATA 4TY7A 3SV2H 2OUAA 4ASHA 1V3XA 1L1JA 1G3EA 1NY22 1O3HA 1QHRB 1YBWA 2ZTXA 3GY5A 3EQ0H 1K1LA 4K5ZA 5GCHG 1XKBC 3BTFE 4ZROA 3S69A 2IN2A 1GCDA 3ZZBA 4X1SU 2G00A 1MU8B 2XNIA 1A3BH 1Z71A 2I6SA 1O5BB 1S83A 2BDAA 3STIA 2Z7FE 3VB3A 1HUTH 2QC2A 5FPTA 2QV1A 3PYHA 4K8YA 3EDXB 1BBRE 1EAXA 1EZQA 4ZKNU 3SQEE 3BTQE 4NGAH 1QFKH 1GJCB
chains in the Genus database with same CATH superfamily
1MAXA 1O3KA 1P2NA 1W14U 2B0FA 4TPIZ 5C20A 4B6FA 2PKSC 4RI0A 5JB8S 2J97A 1A5IA 1AO5A 1S5SA 4KELA 1NPMA 4NG9H 2P3FH 1O35A 5B6OA 4K2YA 2P95A 4WH6A 1DDJA 2Q6DA 4ZHAA 1ZYOA 1TB6H 4Y10E 1P2KA 1HAOH 4X8VH 5JDUB 4YXWD 3T25A 3ATLA 5F6MA 1DWDH 3DHKH 1C1OA 1V2VT 1A0HB 3H7TA 1PJPA 4ISIH 3VB7A 1YCPM 2BLQA 5E8EH 3QWCH 1KMHB 3BIUH 2XCFA 4J1YA 1YGCH 3URCA 1GHVH 1SBWA 1V2WT 3M5NA 3TNSA 1VR1H 1KXDA 3M5LA 2F83A 4I31A 1SC8U 1WXRA 1TMTH 2A1DB 1Z8RA 2J9NA 2IOTA 2FI5E 3SJOA 4LK4A 4ASUD 1FXYA 2QF3A 1AIXH 3SV8A 1A2CH 1ZSJA 3UOPA 4FU9A 2H5DA 1O3IA 1C2FA 2CHAB 3AASA 1NM6A 1ABJH 1C5TA 2NU4E 4FVDA 2R0LA 2PTNA 1NRQH 4DG4A 1NU9A 2BY6X 2FWWA 3BN9A 4J2YB 1SVPA 3P95A 3RXKA 1YP9A 1P2IA 3P6ZB 2SGDE 2WPHS 1SGEE 1C1UH 1V2TT 4BANB 2ZGHA 1LPKB 3T26A 5BPEA 3ZVAA 4FUHA 3U1JB 1QIXB 1W7XH 2YMSC 3SYJA 1SGYE 1QRXA 6LPRA 1C1PA 2HLCA 3AK5A 2VWOA 1AN1E 4CR5A 1ELBA 4YT6H 5IK2D 4CRFA 3IG6B 4O03A 2QAAA 1O3PB 1Q2WA 4K69A 2QXIA 1V2ST 3UQOA 3RMNH 2ZFPH 4U01A 1NU7B 4TT3D 1GBBA 1GMDG 5TJXA 2AEIH 1C1WH 3A85A 1QQUA 1ELEE 5CE1A 1O2OA 3UY9A 3RM0H 2O9QA 1QRWA 1J16A 1ELDE 1TGTA 2A4QA 2AGEX 2PFEA 3M3TA 1BB0B 1EZUC 1O3FA 1P2MA 2GMTC 1A3EH 1C2IA 4TWWA 4MNYA 1BTWA 4RKJB 2A5IA 4A1VA 2BX3A 3HKJB 1XMNB 1AB9B 1C1NA 3EGKH 3B8JA 1GBHA 1TQ0B 1G3BA 5EJZA 6CHAB 5I46H 4F55A 3T2NA 1D3QB 1O5FH 1TNIA 2ZG0H 3CNRA 2BTCE 1GCTC 2D8WA 8GCHF 1IQHA 4ABJA 1C4V2 5C0UA 1GI1A 1RIWC 1TBZH 4XBBA 2PLXA 4JYVH 1B0EA 1KTTB 1THSH 1ELCA 1HFDA 4MDSA 1C5OH 3EE7A 3OX7U 4UD9H 4E7NA 3KQBA 3SUGA 2OP9A 3M7TA 1O5AB 1C1SA 1CU1A 2A7HA 3V13A 4DURA 3PMHB 5EQQA 1BBRK 3NXPA 1IQMA 1Y3XA 4NA8A 1O2XA 1BT7A 3SHCH 1MD8A 1PYTC 1RTLA 1C2LA 1JMOH 1WTHD 2IJD1 2ZCLP 3VEQB 3TGIE 1J9CH 2ALVA 2ALPA 1TABE 2C3SA 3UPEA 3SNCA 3BTGE 1ZPBA 1C2JA 1EAIA 3GY7A 4YLUA 5HYOA 3DT0H 4Q2KA 1E79D 1ACBE 3E91A 4OS2A 2NU2E 3GDVA 4B74A 2JH0D 1SI5H 3LH1A 1MTVA 2QGRA 1A5GH 4B73A 2H1UA 2VWMA 5F03A 1PQ5A 4K1SA 2O8TA 3FFGA 2HRVA 2JJ2D 3RXMA 1JXPA 1ANDA 1QJ6B 2J95A 2P16A 1KTSB 1S6FA 2Z9GA 4OS1A 5SGAE 1QA7A 4LXBH 2Y6TA 3Q00A 1WOFA 2O8UA 3E0PB 2EC9H 2EI6A 4CH8B 3HATH 2A2QH 2D26C 2EA3A 3QTOH 1C9PA 1IQEA 2F9VA 4HGCA 1P0SH 4GAWA 1AB9C 1N8OC 1LPZB 1BMLA 4AX9H 1O36A 1J14A 1U6QA 3ITIA 2GZ8A 2M5TA 3PLKA 1FMGA 3AVZA 1TBQH 4K1EA 3FP7E 3RXIA 1E38B 1S0QA 1RJXB 3ZVDA 1XKAC 1XXFA 5A2MH 1HIAB 1UTLM 1Z1JA 1NT1A 3BTME 2FPZA 2GTBA 4O9VA 1QA0A 5A09A 2FM2A 1CSOE 1GMHG 1JBUH 1VITG 1W0JD 2ZGBH 5FHTA 1Z8JB 3MMGA 4ABIA 1NRRH 4XBCA 3M37A 4FUDA 2VIPA 1O30A 3OEED 2BYAX 3SNAA 1D3TB 1Q3XA 2YMSD 4NWKA 1P02A 1YPJH 3LKWA 1WQVH 3A86A 1FN8A 1P05A 1HPGA 5EXLA 1C1RA 1MMJN 1N1LA 3SU0A 1BMMH 1G36A 1HJAC 3SU1A 3O8DA 2SGPE 4CRCA 1PQ8A 3LONA 1GI4A 2AGIX 1HIAA 3MO9A 1ESAA 1NTPA 1O39A 1GI2A 3LGWA 2AIPA 4K3JA 3NWUA 1HAYB 3VGCB 2UUFB 4IC6A 3A8CA 1FY4A 2BD2A 2P59A 5KGOA 3KQDA 3KYFA 4FXGH 2M2AA 4WMEA 4NZLA 3UWIA 1F92A 1DLEA 2V3HH 1MU6B 2R3UA 2L6OA 1O3GA 1SLWB 2ESTE 3ATIA 3SJ8A 2BOHB 3F9HA 2FODA 3VPKA 2HWLB 4D8NA 3RMMH 3QX5H 4MTBA 3U69H 3OY5U 3RXLA 4K60A 1BZXE 1W11U 2WUBA 1MABB 3PB1E 2J98B 4JK6A 5FCKA 4A1XA 1SQRA 2AYWA 3PLBA 1Y3UA 1DSUA 2QYIA 3MU0A 4SGAE 1GBLA 1LHEH 2JIZD 1K1JA 3PMJA 5LPFA 5JYIA 3DUXH 2J38A 1KIGH 2ZKSA 2J5UA 1TMUH 1GBMA 2VH0A 3RXRA 4AN7A 1Z8GA 1YCPH 4INHA 1NFXA 2PUQH 2W3KA 2ZU4A 2VINA 4Q7YA 1VGCB 3K6ZA 1NC6A 4MPWA 3L3TA 1V2PT 3T29A 3BG4B 4NFFA 2A7CA 1ZGVA 1CHOG 3MTYA 1SGFG 4JZFH 5EXNA 1YPHC 4AYVB 1O2YA 5B6LA 4DT7B 1CA0C 1NFUA 1P06A 2J98A 1BTUA 1NROH 4HZHA 1MD7A 3DSOA 4Q63A 3S7KB 3ZZ3A 1UTMA 2XXLA 1S82A 2NWNA 1FLEE 1SPJA 3RU4T 1W12U 3MHWU 1H9HE 4KTSA 1DFPA 1O31A 1HDTH 1C5QA 1V2UT 2A0QB 5GNDA 1AMHA 1AVGH 1LVOA 1PPFE 1T4VH 3VGCC 2STBE 1AE5A 3ZYDA 4AGKA 3RXHA 1YPEH 2A5AA 4WMDA 3MNBA 2BD9A 2K0QA 3M5OA 3RXDA 1GWAA 1K0HA 2RDEA 2Z9KA 1EX3A 1MUEB 4SGBE 1UTOA 1Y3VA 1GBFA 1CT0E 4B6EA 3K65B 5ETXA 5C0TA 1T4UH 2ANYA 1WAYB 1K28D 2VWNA 1XUKA 5JBAS 2ZQ1A 1T7CA 3M3SA 1F0UA 1GI6A 1QB9A 3OAAD 3PM3A 2C4FH 4GHQA 1FY1A 1L1NA 4INKA 3F2FA 2BY5X 3ESTA 3HK3B 5FX5A 3KN2A 1BMAA 1LHFH 2VNTA 2C90B 1DOJA 2VH6A 1ZJKA 2Z9JA 4AB9A 2SGEE 1KXEA 3WW7A 1C5LH 3ZVBA 2TGPZ 3MWIU 1SQOA 1VGCC 1XUGA 2RG3A 5HGGA 2EI7A 1GI0A 3SI4H 1QL8A 2BDGA 1UTQA 2V3MA 3E0NB 3BG4C 1XUJA 3EA9A 1B0FA 4NA9H 4YOGA 1JIMA 4WH8A 4DVAU 2O8LA 3FO8D 3GCNA 3SU2A 2O8WA 3V0XA 1AU8A 4JZIA 3RC6A 1OSSA 3F0OA 1O2LA 5FXLA 1PPGE 2DUCA 3M7QA 4NIVA 1K1OA 1ORFA 2RCEA 2J4IA 4BAOB 2BDYA 3N7OA 2FLBH 1TNLA 1G3DA 2FTMA 1UTKA 1BMFD 1SLXB 3GCHB 3AW1A 2PHBA 1DWBH 3UR6A 1OYTH 1P11E 1NBME 5DG6A 4CBOA 1QURH 3IWMA 3PV5A 4Y8ZA 1TGCA 3GYLB 1GGDC 3QUMP 1O3JA 2BDBA 1JRTA 1VCQA 3GDSA 2XBWA 1ZPZA 1PPZA 1L1GA 1ARCA 1YPGH 2BDCA 1NFWA 3LC5A 3F2GA 2OBOA 3D62A 1AVXA 1TA2A 2QXJA 1QBOA 4UFFH 1QJ7B 4NIXA 4MNXA 2FX4A 2C8YB 2H6MA 4WWYA 5T3HA 3MH6A 2YNAA 3S0NA 1EJNA 1AFQB 4F49A 5A0AE 5DP3A 2LELA 5AFZH 2H2ZA 2O8MA 4VGCB 1H9LB 2ZDNA 3LT3A 3MNSA 5JBBS 3SNEA 1BRCE 1P9SA 1EZXC 3R3GB 2ULLA 1C5UA 1P01A 2PGQB 3MU4A 3PRBA 3RLYH 1TIOA 1HJ9A 1P10A 4X1QU 4U32A 3A8AA 1P2QA 1RTFB 2ZDMA 2UUYA 3L6PA 1CGIE 1F5KU 1V2LT 2ODQA 3ZYEA 3JZ1B 2HGTH 3KL6A 3PO1B 1MQ5A 1DT2A 2VIWA 2RA3A 2TGAA 1LTOA 4IMQA 8ESTE 2SGAA 2FX6A 1PQAA 1D3PB 2NU3E 3A7XA 1V2KT 3Q3YA 3BTKE 3I29A 6ESTA 4B75A 3TJOA 1A4WH 2QXHA 4TWYA 1PFXC 5TCCA 1DSTA 2Q6FA 2F9BH 2BXUH 1C5VA 3ZZCA 3PLPA 1O5EH 1YWUA 3SN8A 1DICA 1MTNC 3LIWA 3ZZ5A 3OTPA 2ZP0H 1WV7H 2ZFSA 4UDWH 4ABHA 4CRDA 1LQDB 1LVBA 4ZHLU 1O3LA 3GYMA 1UK3A 2GD4B 3U9AH 2OBQA 4X8SH 3F2HA 3L33A 3GCHC 3TIUA 4GVUA 2FOCA 1O2RA 1BHXB 3TPIZ 2AS9A 1EOJA 5F8XA 5C17A 3W94A 1O5GH 3HKIB 1VZQH 2BLOA 2FOHA 3SNBA 2A4OA 2BVSH 3RXUA 1FNIA 1GHAF 3GOVB 4XRNA 4WXIA 3NRLA 1O0DH 1C9TA 1SGRE 4VGCC 1H8IH 4NIWA 1LHCH 1JRSA 2B5TB 2FZZA 2QN5T 1SOZA 1V2QT 1H8HD 4Z6AH 2SFAA 3KQ5A 1J15A 1DX5M 3NPSA 1IHTH 3STJA 1GPZA 1Q31A 3UIRA 1VJAU 5EGMA 3RP2A 5K0HA 1GHBF 2BY7X 2BHGA 1P04A 3SI3H 1HNEE 1C5RA 3SUFA 3BTWE 3EA8A 4K1TA 1TGNA 4FUCA 3E90B 5DPAA 5CHAB 1MKXH 2C8ZB 2BMGB 1KDQB 5AVDA 2IJOB 3ZZDA 1GJ4H 3P8NA 1N6XA 4Y7AA 4AFZA 3QO6A 2IPQX 3LGUA 3AW0A 4I8KA 2VJ1A 3W1EA 2FLRH 4DGJA 4O97A 3FVFB 4FU7A 1T32A 4DIIH 2A4RA 4Z1MD 1PPHE 1TRNA 1BMNH 3VB5A 1F0RA 1ZMLA 1P09A 1GHWH 2BD7A 3MU5A 1MTUA 1FY8E 1VJ9U 2TGTA 1DANH 1P12E 5FAHA 4FU8A 3TU7H 3PV2A 5C94A 1GDUA 1KDQA 2VU8E 1UMAH 3OYPA 1WTGH 4AZ2B 2GCHG 1K2I1 3K2UA 3P8GA 1DVAH 4A1TA 1O2QA 3M5MA 4ZXXH 5C2ZA 2GJGA 2XWAA 1C4U2 5DP6A 2OC8A 1KXFA 1Y8TA 1LVMA 3FOAA 1BJUA 1DUAA 1ZR0A 4X1PU 3S7HB 1HAGE 3LC3A 3BTTE 1SGCA 1OXGA 4KTCA 3SBKA 4A7IB 2J2UA 2WV5A 3Q77A 3A8DA 2AFQB 4D7FA 1SHYA 2CMYA 4I86A 3QGJA 2HALA 5FBIA 1NBMD 3A88A 3SUEA 1YC0A 5F53A 1TPSA 1KLJH 1UHBB 4ESTE 4UEHH 2CF8H 2DE8A 1Z8IB 2FS9A 2KCAA 5AF9H 1SFQB 4I8HA 1A7SA 2PW8H 1COWD 1RGQA 1CVWH 4HG6A 1GG6B 2LPRA 2WV9A 4FETA 2GT8A 3BEUA 1YLCA 2FS8A 1MQ6A 1D6RA 1P03A 1AD8H 3GISB 1YF4A 1PPEE 2PR3A 1BA8B 1LMWB 1SGQE 1TYNA 1ELTA 5L6NH 2B9LA 3RXPA 3DA9B 1DUEA 2P3UB 2G81E 3MU1A 4NSVA 2CHAC 4FUJA 1W0YH 1MZDA 1V2OT 1Z6EA 1P9UA 1ETSH 1UHBA 4H6SB 4E05H 1P2OA 2VGCB 2ZGJA 5A0CA 5DKMA 1TALA 1O3MA 1OWIA 1TOMH 4DOQA 3ZZ7A 1QL7A 3D23A 2Y5HA 3BIVH 3BTHE 4Z0KA 2ZWLH 5LPRA 1BDAA 3FZDA 1EJMA 4YO9A 2ODYB 1GJ7B 1GMCF 1TE0A 4ZKOU 1XX9A 2ZNKH 1O3NA 1TPPA 1UCYH 1O33A 4X0WU 4XBDA 3ZVGA 2AMPA 4X8TH 4CRAA 5FL7D 3RMOH 1IQLA 2HVXA 3ZZ9A 1O2WA 2D1JA 1LPGB 1MH0A 1XVMA 4IW4E 2WSSD 3NK8A 1BTXA 4U2WA 3FN8A 1M9UA 1BHXF 3RXEA 1ZHMA 3ELAH 3UTUH 4TSFD 4YOJA 3A87A 4XDEA 2BDHA 1C1QA 1HXFH 4KKDA 1W7GH 4AC9A 1YY3A 4I8JA 3G01A 4MPVA 4Y11E 2FOGA 3QZQA 5J4QA 4X6OA 4FVBA 1J8AA 2FESH 1ELGA 1LDTT 4GUXA 3TGKE 4OS7A 3FZZA 3V12A 1GDNA 1HLTH 5DK1A 2ANWA 1NFYA 5C1XA 1O5DH 6CHAC 3FP6E 1WCZA 4BAQB 3MOCA 1T31A 1TPOA 3GY4A 1A0JA 1ELVA 2FO9A 1MKWH 5HM9A 2FXRA 4BTIB 1G2LA 2WZQA 1S81A 3Q76A 2EEKA 3SUDA 6GCHG 1GJ8B 4GSOA 1H9IE 2F9NA 4WJG2 1W13U 4UFGH 5E2PA 3DSPA 2Y7ZA 5EQRA 1D3DB 1C1TA 3CS0A 2BZAA 2OC7A 3MU8A 3SNDA 4P02A 1GVKB 1BITA 1K1NA 1GI3A 3P8FA 4INLA 4DJZB 5IYTA 4B71A 2VIVA 1GL1A 2KCYA 1G3CA 1C2GA 1TGSZ 2Z9LA 1OWEA 1GJDB 3RXFA 1GJ6A 2ZU3A 1SHHB 4DW2U 3TH3H 2BXTH 2SGQE 1YPHE 1UK4A 3BTDE 2TGDA 3M35A 2GKVE 1G2MA 4AGJA 2FYQA 2JH5D 3RC4A 1KSNA 1Y5UT 2VIOA 3C27B 4K8BA 3VXFH 1C2HA 1BQYA 2WHXA 3B23B 4CBNA 3A8BA 1FV9A 1IHSH 2I6QA 1GBCA 2ZHWH 1FDPA 1H1BA 5EOKA 4X2XA 2CN0H 4ABBA 1V6DA 1BRUP 3MFJA 1MBQA 4GCHF 1KYNA 3UAIC 3UNQA 1QY6A 1E34B 2VVCA 3DFJA 1DWCH 5DGJA 2ZFRH 1ZHPA 4NFEA 2BM2A 1W3CA 2W6JD 3A7VA 1B5GH 3F9FA 3K9XB 5ESTE 3RXSA 4NZQA 3RXGA 1MTWA 3E1XB 1IQJA 2BD3A 1FY3A 4I8GA 4HFPB 3PTNA 3LPRA 5DP5A 2UUJB 4F48B 1ANBA 1Z1IA 5GIBA 1T8LA 4FUIA 3QLPH 1TLDA 1TGBA 1ZOMA 1ELFA 3LOXA 2ZFTA 3UUZA 1PYTD 4BXWA 2BQWB 2A32A 2G55A 2ZDLA 4LZ4B 5C67A 1GJBB 2ZDKA 4X2VA 3F1SB 4TYDA 3MYWA 1C4Y2 1EAUA 2QY0B 1KXAA 2AH4X 2XC4A 5GCHF 1LHGH 2A2XH 5KECA 5E2OA 2FOEA 4ABDA 2XC0A 1PPBH 5GWZA 1F0TA 4MNWA 3A7TA 4WMFA 2ZC9H 1TQ7B 4Y79A 2GV7A 4FUGA 1RS0A 1LHDH 1UW7A 2R9PA 2PWXA 2CK3D 3IITA 3TK6A 3LJJA 1EQ9A 1GI7B 1IAUA 5FBEA 3RXAA 1JWTA 2KR7A 5EPYA 1GBTA 3OTJE 1K1IA 5HIZA 1P57B 1OWHA 5C5OA 2BOKA 3M36A 1C5XB 2GDEH 4Y71A 3RXTA 1RD3B 3BTEE 4GLYA 1AQ7A 1UTPA 2ANMH 3RLWH 1J17T 9ESTA 1XUIA 2ZDAH 3FANA 2V7QD 1TNGA 1GI8B 4E06H 3W95A 3KCGH 1QL9A 1YCPK 2UUKB 3CP7A 1HJ8A 2KCPA 1GBDA 1K21H 3SW2B 1TPAE 3MH5A 1C2KA 2Q1JA 3UNRA 1OWDA 3SQHE 3A7ZA 3SU6A 3JZ2B 1CHGA 2WUCA 1TMBH 1DXPA 1V2MT 1FUJA 3RDZA 1O3AA 2G52A 8GCHG 2FOBA 2A45B 1EAWA 4IBLH 1Y59T 4ISLA 4RT1A 4YESB 2WYGA 2VVUA 2GP9B 3TJVA 4AFUA 2F9PA 3FP8E 3B9FH 1S6HA 4O3UA 2Y5FA 1TX7A 4OM9A 5A0BA 3F3BA 1UVSH 3WWFA 4Y8YA 3OFND 2BY8X 3O8CA 7GCHF 2Y5GA 2G8TA 3E3TA 3S9AA 3SO3A 1XXDA 2BDIA 1G32B 1O5CB 1QQ4A 2ZHDA 1UVOA 1W0KD 3MI4A 1INCA 2W6ID 2W26A 2BLWA 1AI8H 4MNVA 1OKXA 4IN2A 2XBXA 4IMZA 1TNKA 4KP0A 2J34A 3SJKA 3DCLA 1OP0A 3SGAE 2ZCHP 2EQNA 2JETB 1YM0A 4X8UH 2K1QA 4JMYA 1UVUH 1ESBA 2AGGX 1FN6A 1BCUH 1ANCA 1GBIA 5J4SA 3NCLA 1NRNH 1AUJA 1O34A 5T1VA 1HXEH 1AZ8A 1SGIB 4ZKRU 4Q7ZA 4WF8A 5EODA 2VBCA 2OQ5A 2RDLA 1GI9B 5DN6D 2P8OB 2FTLE 5EU8A 1THPB 1EB1H 1L0ZA 2KZ4A 3LGVA 4HTCH 1KY9A 1YPMH 3SOSA 5EG4A 3K6YA 1LKAA 2TPIZ 5F8TA 3S9BA 2W5EA 1ZMNA 4Y0ZE 2OQUA 4BAKB 4Y76A 1ZTJA 4WVPE 1HAHH 3GS9A 1P8VC 1AFEH 4A92A 1O32A 4E7RG 4BNRA 5C3NA 2WINI 2FMJA 2JDID 1TFXA 3R0FA 2XW9A 1S84A 1VITH 1EP5A 5CHBA 1F2SE 2NU0E 2BQ6B 3TLOA 1S6LA 1EJAA 3O8BA 1TA6A 5DP7A 1SLUB 1K1MA 2V6NA 3SV9A 2G4TA 2FDAA 1FJSA 3ATMA 3OEHD 3PMAB 4Q80A 1CQQA 4CREA 5CDFE 1O2UA 2W3IA 2ZTZA 4FUEA 5H4IB 1SGFA 3TJNA 1HAVB 2ZFQH 4WY3A 4ZH8A 1QZ8A 4AG2A 1ABIH 4IS5A 2HPQH 5TCAA 1HBTH 2PSYA 1PQ7A 1QB1A 3HGPA 4MPUA 1SB1H 3MO3A 5A8ZA 4U30A 3F68H 5AFYH 1O2MA 3PROA 1FPHH 2PKSB 1NO9H 1HB0B 3DFLA 1KLIH 1E36B 3TITA 2JJ1D 1H8ED 3FKSD 4I7YH 2JETC 5ESBA 1XUFA 1GVLA 1SQAA 2ASUB 1TWXB 1ZRBA 4P00A 4YZUA 4H42U 4JZDH 3UQVA 1HGTH 3SZEA 3UOUA 2PKAB 1EOLA 4XD7D 1GHZA 1N6YA 1E0FD 1FX0B 1TNJA 2ZGXH 5PTPA 3O8RA 2STAE 2FP7B 5EXMA 3ODDA 4ZMAH 1T8NA 1Z7KA 3E6PH 1BTZA 3MNCA 1YYY1 2BVRH 4FOUC 2LNCA 1G37A 3SU5A 1EPTB 1DY9A 1XUHA 1D9IA 1Y5BT 3VB4A 1OWJA 1A5HA 2ZI2H 2FOAA 1AFQC 1MCTA 1SGNE 3GY8A 3S9CA 3SJIA 3CENA 1EB2A 2JKHA 3RXQA 4IN1A 3ZZAA 4BTTB 4BAMB 2ZU2A 1GMHF 2H9HA 3I77A 1WSSH 5DJ7A 3WWBA 1AUTC 2ZHFH 3E8LA 3M61U 2ZPRA 2PKAA 1C2DA 1O37A 1FONA 1E1QD 4AFSA 4AFQA 1BRAA 2KX4A 1CGJE 1IQNA 1W0ZU 1O2NA 2YMSB 2WV4A 3GICB 2Z3DA 1LCYA 4NWLA 2ZU1A 1AKSB 1DY8A 2ZPQA 4ZAEA 5DP8A 5GDSH 4CRBA 4BTUB 4NSYA 1FIWA 3PO1C 1NESE 1TOCB 1NZQH 3F0PA 2WPKS 3U98H 1JIRA 1VCWA 1F7ZA 1EPTA 3GCOA 2F43B 1UO6A 1DE7H 2SNWA 2TIOA 3A81A 4JYUH 1KXCA 2HNTF 2PGBB 1BRBE 2CGAA 4WXVA 2CJIA 4XFQA 2SNVA 2QF0A 2GMTB 1Z6JH 2ILNA 1QRZA 4I33A 4AORA 3PMBB 4JCNA 1ZLRA 3TK5A 3MQKC 3NUMA 1FQ3A 3LH3A 1WBGB 3SHAH 1WQSA 3MO6A 1UVPA 1YLDA 2VIDA 1AKSA 1CGHA 1D4PB 2K8IA 2G51A 3PWCA 3M3VA 3ZVEA 2ZCKP 1O3CA 1ELAA 1QBVH 1GCTB 1EUFA 1BUIA 1K1PA 1L4DA 4ACBA 1QJ1B 2C93B 3UREA 4CH2B 3BEFB 1RIWB 1MCVA 4FUBA 2FIRH 2OINA 4YT7H 2XTTB 3TH2H 3DD2H 2KCOA 2OD3B 3GDUA 1UCYE 1SFIA 1AZZA 2FI3E 1EPTC 1O38A 3TNTA 1SSXA 2C8WB 2A5KA 1C5YB 1MKXK 4A5TS 1GVZA 3RM2H 1L4ZA 3OU0A 5AHGH 2ZU5A 2ZFFH 5E0GA 2ZEBA 4LOYH 4X2YA 2BD8A 4XOJA 7GCHG 4FUFA 1ZMJA 3N99A 1KLTA 4UFDH 2PSXA 3VB6A 4Y7BA 3VFEA 5A8XA 2FYRA 3MH7A 1CHOF 2P93A 1B7XB 3URDA 1EKBB 1AWHB 1F0SA 4B2BA 2B7DH 3U28C 5E0HA 1H4WA 1O2SA 3ATKA 2Y80A 2HLDD 2Y82A 1YKTA 5JBCS 4R0IA 1DXWA 5C5NA 2W7SA 4NA7A 1BTPA 4X6NA 4ACAA 4O3TA 2F9UA 1O3EA 2UWLA 1HAXB 5CHAC 2ZECA 4XSKU 1BBRH 4ZKSU 3SV6A 3HPTB 3BF6H 1C5NH 2G4UA 4MG3A 1T8MA 3LJOA 4I32A 3ZZ4A 1QGFA 2Z3CA 1AE8H 3N7DA 2AMDA 3VXEH 4YM9A 1GBJA 3F6UH 3SORA 1N8OB 3NKKA 1HAIH 5HMAA 4BAHB 4RKOB 5HIYA 2BD4A 4UFEH 4XE4A 1IQKA 1CA8B 1MBMA 2P94A 3SGBE 3KNXA 1GDQA 1HAPH 1ETRH 3LDXH 5EPNA 3ENSB 2F9OA 3LGYA 3PV4A 5EW1H 1SQTA 3OE7D 1LO6A 3PTBA 4ISOA 4QT8C 2RA0A 2GCTB 3ZV8A 3QGNB 3TK9A 3RXBA 4DT4A 8KME2 1DS2E 1UTJA 1X7AC 1C5PA 1W8BH 4H4FA 5DP4A 2OCVB 4GHTA 3T27A 2Q6GA 3T5FH 3EA7A 2UWOA 3N7EA 4ZHMU 3U8TH 4B76A 4X2WA 3V7TA 3BV9B 2XC5A 3UNSA 1HCGA 5K7RA 1GBKA 5HM2A 2QF5A 1IQGA 1AGJA 1LQEA 3FAOA 2V0BA 1GJ5H 1FY5A 8LPRA 2ZGCA 1SGPE 1SGTA 4NIYA 1OP2A 1HJAB 2BD5A 7KMEH 2CV3A 1UJ1A 5T6FA 1EXFA 2ZA5A 1K9OE 1GJAB 3RUOA 1OHHD 1OX1A 1XM1A 3WY8A 1EZSC 5C1YA 4KGAA 5HXFA 1C2MA 3D49H 5BRRE 4JZ1A 1CBWB 3A83A 2Z9IA 3ODFA 2GT7A 2GDDA 3A84A 4M7GA 3GCTF 1T8OA 1UK2A 2XBVA 1GG6C 1YLNA 3C1KA 2BY9X 4Q4LA 1P3EA 4YOIA 1ZTKA 3TVJB 1P3CA 1S85A 4D9QA 1UCYK 2KFWA 2L74A 1YPKH 1ZHRA 1ETTH 2WPLS 1HAZB 1SGDE 2QCYA 1AY6H 2B8OH 3DSGA 1TBRH 1D6WA 5L2YH 4ZXYH 1HRTH 2VIQA 3Q3XA 2QA9E 5FCRA 4RSPA 4YLQH 2YOLA 3D65E 2Y81A 1GHAG 2VGCC 1E1RD 2BB4A 1CT2E 2GCTC 2PTCE 1ZPCA 1JOUB 1TNHA 1C5SA 1ZZZA 3KHVA 4A6LA 2Z94A 3TH4H 4ISHH 1DWEH 3RU4E 1EASA 2A7JA 1A0LA 3RMLH 5FPYA 2ZHQH 1QR3E 2GZ9A 3OSYA 1QB6A 1CA0B 2GV6A 3QZRA 4Y6DA 1ZRKA 1MKWK 1GHBG 2OLGA 1BIOA 3ZZ6A 2SGFE 3A7WA 3CS7A 3PRDA 5LH8A 2ZPSA 4DY7B 5DO4H 1P2JA 1C2EA 1O2JA 1O2PA 3P8OA 3EAJA 3ZIAD 4Q7XA 4D9RA 1C1MA 1KXBA 5C1UA 1SR5C 1IQFA 3HGNA 1W10U 1SKYE 3GY6A 5LGOA 1CT4E 1O3OA 3T62A 1FIZA 5EJLA 5F8ZA 4ABGA 1CE5A 4AG1A 5EJ1A 3F9GA 2OK5A 1CBWC 1BOQA 5JPMH 1EFRD 1O2VA 1A1RA 4M9FA 3H5CB 5KEDA 5L30H 1A46H 2ZTYA 2WYJA 4ABFA 4AOQA 2ZHEH 2FEQH 1CO7E 3UFAA 3UR9A 1SL3A 3P70B 2ZDVH 5EQSA 2HOBA 3P92A 2F4LA 3KIDU 3QDZB 4DCDA 2XRCA 3PWBA 1UVTH 3T28A 2G5VA 1RXPA 2ZF0H 3UWJH 2ODPA 2H9TH 7LPRA 1C5MD 1V2JT 1XVOA 1WUNH 5GJ4B 2R2WU 4BOHA 2FOFA 3TGJE 3RXJA 2R3YA 4X1RU 2TBSA 3KQCA 1HYLA 1DLKB 1O3DA 4MQAA 2FOMB 4ISNA 5DP9A 2J92A 3KYGA 3ZVCA 4CHAB 4JZEH 2R0KA 4B1TA 1QNJA 2OTVA 1O2IA 3TJUA 2PP6A 3GY2A 3RXOA 2AHME 1HV7A 1O2ZA 1FZZA 2AIQA 2FI4E 1NRSH 1ZSKA 3QN7A 2V35A 4AB8A 3KGPA 3KEEA 2THFB 1H8DH 4IC5A 3H7OA 2D2DA 3NZIA 3ATWA 3I78A 5FX6A 1BJVA 4MLFB 1Y3WA 3KF2A 1OPHB 3E16B 4MPXA 4R8TB 1O2GH 1DITH 4TPYA 3ZV9A 1FAKH 1GGDB 2PUXB 4GPGA 3LU9B 1TX6A 1Y5AT 1MAYA 1Y3YA 3SJ9A 5G4BA 2GX4A 2JH6D 3SZNA 5DSFA 1RTKA 2A31A 1E35B 4OS5A 3F9EA 2VVVA 2NU1E 3BEIB 1OWKA 1TONA 3RXCA 2W7UA 1QTFA 2GVFA 2HVYB 1ZJDA 2Y7XA 4IGDA 2BZ6H 1WU1A 5CMXH 1UTNA 2TRMA 1OYQA 2IPHA 4KTUA 4ABAA 2ZQ2A 2GCHF 1IQIA 1GHYH 2HNTE 2HPPH 1YPLH 3OY6U 1RFNA 4Y0YE 1C5ZB 2ZZUH 1G9IE 2XBYA 2BX4A 1TRMA 2H9EH 4LZ1H 1BTYA 1G30B 2ZO3H 1NS3A 4I8LA 2GZ7A 5T6DA 1GMCG 4YTAA 2F3CE 4AYYB 1DPOA 2AERH 1A61H 2XWBI 4X6MA 2EY4C 1GMDF 1GBEA 5IDKA 1C1VH 4B2CA 4BXSA 1ZSLA 1W2KH 3SU4A 3U1IB 7ESTE 1F5LA 1FPCH 4D7GA 4CHAC 4DIHH 2OC1A 2XOKD 4OGXA 2UWPA 1ID5H 1C5WB 2KAIB 2CF9H 2G5NA 2P3TB 3LGTA 2XYAA 5ABWA 1GHXH 1SOTA 4TY6A 1MTNB 3UB0A 2DE9A 5GPIB 1V2RT 3ZVFA 3MH4A 1ARBA 4PROA 2ANKH 3RXVA 3EE0B 1O2TA 1OOKB 2KM0A 2QXGA 2XCNA 3M7UA 1VKYA 3H09A 1AVWA 1LKBA 3GCTG 3SGQE 4OS6A 1FI8A 3HK6B 1O2KA 3BG8A 1GJ9B 1ANEA 2QIQA 1SMFE 4HI3A 2Z3EA 3KQEA 5JB9S 4B2AA 3SV7A 1FAXA 3AAVA 2PV9B 1O3BA 2HNTC 3A82A 4ZUHA 5I25A 3RU4D 1DM4B 5JBTA 2KAIA 3RC5A 1GI5A 9LPRA 5FPSA 1QBNA 4RT0A 1THRH 3MNXA 1K22H 4OS4A 1GL0E 1SLVB 2BLVA 4D76A 1OS8A 2OXSA 2QF4A 3A80A 2H5CA 4X1NU 1WDIA 1AHTH 2Z6BD 2WPIS 3VG8A 4CR9A 4RN6A 2ZIQH 1WYKA 2VWLA 4NCYA 1V2NT 5L2ZH 2BQ7B 2WPJS 5T6GA 4JK5A 1IOEA 3LGIA 4MVNA 3U8RH 5EW2H 1LVYA 4UE7H 1VCPA 1RRKA 1MZAA 1ESTA 1NN6A 1OP8A 1TRYA 4ABEA 4ZCNA 4OGYA 2F91A 2GGVB 2OC0A 1ZGIA 1F5RA 3QTVH 4Y8XA 5HKKD 1TAWA 4UONA 1E37B 4CRGA 2R2MB 1HAVA 2J94A 1SG8B 4GCHG 2WPDD 5A8YA 2VB0A 3Q3KA 2AMQA 3V3MA 2XNDD 1TX8A 2P8OC 1NRPH 1O2HA 3A89A 3SU3A 1AWFH 4X6PA 5GXPA 3ZZ8A 5LPEA 1GBAA 5E0JA 4H6TA 2C8XB 1MTSA 3QK1A 3EYDA 4JYTA 1ZTLA 2BVXH 1BTHH 1EP6A 1PPCE 1S0RA 3A7YA 3GY3A 2WPMS 4THNH 2EI8A 3P17H 3U8OH 1QCPA 4F4OC 2A4GA 6GCHF 3BSQA 2RFKC 2V3OH 1L2EA 3AAUA 2YNBA 1VITF 2CXVA 1EATA 4TY7A 3SV2H 2OUAA 4ASHA 1V3XA 1L1JA 1G3EA 1NY22 1O3HA 1QHRB 1YBWA 2ZTXA 3GY5A 3EQ0H 1K1LA 4K5ZA 5GCHG 1XKBC 3BTFE 4ZROA 3S69A 2IN2A 1GCDA 3ZZBA 4X1SU 2G00A 1MU8B 2XNIA 1A3BH 1Z71A 2I6SA 1O5BB 1S83A 2BDAA 3STIA 2Z7FE 3VB3A 1HUTH 2QC2A 5FPTA 2QV1A 2LP6A 3PYHA 4K8YA 3EDXB 1BBRE 2QE7D 1EAXA 1EZQA 4ZKNU 3SQEE 3BTQE 4NGAH 5EIYA 1QFKH 1GJCB
chains in the Genus database with same CATH topology
1MAXA 1O3KA 1P2NA 1W14U 2B0FA 4TPIZ 5C20A 2PKSC 5JB8S 1A5IA 1AO5A 1S5SA 4KELA 1NPMA 4NG9H 2P3FH 1O35A 5B6OA 4K2YA 2P95A 4WH6A 1DDJA 2Q6DA 4ZHAA 1ZYOA 1TB6H 4Y10E 1P2KA 1HAOH 4X8VH 5JDUB 3T25A 3ATLA 5F6MA 1DWDH 3DHKH 1C1OA 1V2VT 1A0HB 3H7TA 1PJPA 4ISIH 3VB7A 1YCPM 2BLQA 5E8EH 3QWCH 3BIUH 2XCFA 4J1YA 1YGCH 3URCA 1GHVH 1SBWA 1V2WT 3M5NA 3TNSA 1VR1H 1KXDA 3M5LA 2F83A 4I31A 1SC8U 1TMTH 2A1DB 1Z8RA 2J9NA 2IOTA 2FI5E 3SJOA 4LK4A 1FXYA 2QF3A 1AIXH 3SV8A 1A2CH 1ZSJA 3UOPA 4FU9A 2H5DA 1O3IA 1C2FA 2CHAB 3AASA 1NM6A 1ABJH 1C5TA 2NU4E 4FVDA 2R0LA 2PTNA 1NRQH 4DG4A 1NU9A 2BY6X 2FWWA 3BN9A 4J2YB 1SVPA 3P95A 3RXKA 1YP9A 1P2IA 3P6ZB 2SGDE 2WPHS 1SGEE 1C1UH 1V2TT 4BANB 2ZGHA 1LPKB 3T26A 5BPEA 3ZVAA 4FUHA 3U1JB 1QIXB 1W7XH 1SGYE 1QRXA 6LPRA 1C1PA 2HLCA 2VWOA 1AN1E 4CR5A 1ELBA 4YT6H 4CRFA 3IG6B 4O03A 2QAAA 1O3PB 1Q2WA 4K69A 2QXIA 1V2ST 3UQOA 3RMNH 2ZFPH 4U01A 1NU7B 1GBBA 1GMDG 5TJXA 2AEIH 1C1WH 3A85A 1QQUA 1ELEE 5CE1A 1O2OA 3UY9A 3RM0H 2O9QA 1QRWA 1J16A 1ELDE 1TGTA 2A4QA 2AGEX 2PFEA 3M3TA 1BB0B 1EZUC 1O3FA 1P2MA 2GMTC 1A3EH 1C2IA 4TWWA 4MNYA 1BTWA 4RKJB 2A5IA 4A1VA 2BX3A 3HKJB 1XMNB 1AB9B 1C1NA 3EGKH 3B8JA 1GBHA 1TQ0B 1G3BA 6CHAB 5I46H 3T2NA 1D3QB 1O5FH 1TNIA 2ZG0H 2BTCE 1GCTC 2D8WA 8GCHF 1IQHA 4ABJA 1C4V2 1GI1A 1RIWC 1TBZH 4XBBA 2PLXA 4JYVH 1B0EA 1KTTB 1THSH 1ELCA 1HFDA 4MDSA 1C5OH 3OX7U 4UD9H 4E7NA 3KQBA 3SUGA 2OP9A 3M7TA 1O5AB 1C1SA 1CU1A 2A7HA 3V13A 4DURA 3PMHB 5EQQA 1BBRK 3NXPA 1IQMA 1Y3XA 4NA8A 1O2XA 1BT7A 3SHCH 1MD8A 1PYTC 1RTLA 1C2LA 1JMOH 1WTHD 2ZCLP 3VEQB 3TGIE 1J9CH 2ALVA 2ALPA 1TABE 2C3SA 3UPEA 3SNCA 3BTGE 1ZPBA 1C2JA 1EAIA 3GY7A 4YLUA 5HYOA 3DT0H 4Q2KA 3E91A 1ACBE 4OS2A 2NU2E 3GDVA 4B74A 2JH0D 1SI5H 3LH1A 1MTVA 2QGRA 1A5GH 4B73A 2H1UA 2VWMA 5F03A 1PQ5A 4K1SA 2O8TA 3FFGA 2HRVA 3RXMA 1JXPA 1ANDA 1QJ6B 2J95A 2P16A 1KTSB 1S6FA 2Z9GA 4OS1A 5SGAE 1QA7A 4LXBH 2Y6TA 3Q00A 1WOFA 2O8UA 3E0PB 2EC9H 2EI6A 4CH8B 3HATH 2A2QH 2D26C 2EA3A 3QTOH 1C9PA 1IQEA 2F9VA 4HGCA 1P0SH 4GAWA 1AB9C 1N8OC 1LPZB 1BMLA 4AX9H 1O36A 1J14A 1U6QA 3ITIA 2GZ8A 2M5TA 3PLKA 1FMGA 3AVZA 1TBQH 4K1EA 3FP7E 3RXIA 1E38B 1S0QA 1RJXB 3ZVDA 1XKAC 1XXFA 5A2MH 1HIAB 1UTLM 1Z1JA 1NT1A 3BTME 2FPZA 2GTBA 4O9VA 1QA0A 5A09A 2FM2A 1CSOE 1GMHG 1JBUH 1VITG 2ZGBH 5FHTA 1Z8JB 3MMGA 4ABIA 1NRRH 4XBCA 3M37A 4FUDA 2VIPA 1O30A 2BYAX 3SNAA 1D3TB 1Q3XA 4NWKA 1P02A 1YPJH 3LKWA 1WQVH 3A86A 1FN8A 1P05A 1HPGA 5EXLA 1C1RA 1MMJN 1N1LA 3SU0A 1BMMH 1G36A 1HJAC 3SU1A 3O8DA 2SGPE 4CRCA 1PQ8A 3LONA 1GI4A 2AGIX 1HIAA 3MO9A 1ESAA 1NTPA 1O39A 1GI2A 3LGWA 2AIPA 4K3JA 3NWUA 1HAYB 3VGCB 2UUFB 4IC6A 3A8CA 1FY4A 2BD2A 2P59A 3KQDA 4FXGH 4WMEA 4NZLA 3UWIA 1F92A 1DLEA 2V3HH 1MU6B 2R3UA 1O3GA 1SLWB 2ESTE 3ATIA 3SJ8A 2BOHB 3F9HA 2FODA 3VPKA 2HWLB 4D8NA 3RMMH 3QX5H 4MTBA 3U69H 3OY5U 3RXLA 4K60A 1BZXE 1W11U 2WUBA 3PB1E 4JK6A 5FCKA 4A1XA 2AYWA 3PLBA 1Y3UA 1DSUA 2QYIA 3MU0A 4SGAE 1GBLA 1LHEH 1K1JA 3PMJA 5LPFA 5JYIA 3DUXH 2J38A 1KIGH 2ZKSA 1TMUH 1GBMA 2VH0A 3RXRA 4AN7A 1Z8GA 1YCPH 4INHA 1NFXA 2PUQH 2W3KA 2ZU4A 2VINA 4Q7YA 1VGCB 3K6ZA 1NC6A 4MPWA 3L3TA 1V2PT 3T29A 3BG4B 4NFFA 2A7CA 1ZGVA 1CHOG 3MTYA 1SGFG 4JZFH 5EXNA 1YPHC 4AYVB 1O2YA 4DT7B 1CA0C 1NFUA 1P06A 1BTUA 1NROH 4HZHA 1MD7A 3S7KB 3ZZ3A 1UTMA 2XXLA 1S82A 2NWNA 1FLEE 1SPJA 3RU4T 1W12U 3MHWU 1H9HE 4KTSA 1DFPA 1O31A 1HDTH 1C5QA 1V2UT 2A0QB 1AMHA 1AVGH 1LVOA 1PPFE 1T4VH 3VGCC 2STBE 1AE5A 3ZYDA 4AGKA 3RXHA 1YPEH 2A5AA 4WMDA 3MNBA 2BD9A 3M5OA 3RXDA 1GWAA 2Z9KA 1EX3A 1MUEB 4SGBE 1UTOA 1Y3VA 1GBFA 1CT0E 3K65B 5ETXA 1T4UH 2ANYA 1WAYB 1K28D 2VWNA 1XUKA 5JBAS 2ZQ1A 1T7CA 3M3SA 1F0UA 1GI6A 1QB9A 3PM3A 2C4FH 4GHQA 1FY1A 1L1NA 4INKA 2BY5X 3ESTA 3HK3B 5FX5A 3KN2A 1BMAA 1LHFH 2VNTA 2C90B 1DOJA 2VH6A 1ZJKA 2Z9JA 4AB9A 2SGEE 1KXEA 1C5LH 3ZVBA 2TGPZ 3MWIU 1SQOA 1VGCC 1XUGA 2RG3A 5HGGA 2EI7A 1GI0A 3SI4H 1QL8A 2BDGA 1UTQA 3E0NB 3BG4C 1XUJA 3EA9A 1B0FA 4NA9H 4YOGA 1JIMA 4WH8A 4DVAU 2O8LA 3GCNA 3SU2A 2O8WA 3V0XA 1AU8A 4JZIA 3RC6A 1OSSA 1O2LA 5FXLA 1PPGE 2DUCA 3M7QA 4NIVA 1K1OA 1ORFA 2RCEA 2J4IA 4BAOB 2BDYA 3N7OA 2FLBH 1TNLA 1G3DA 2FTMA 1UTKA 1SLXB 3GCHB 3AW1A 2PHBA 1DWBH 3UR6A 1OYTH 1P11E 5DG6A 4CBOA 1QURH 3IWMA 4Y8ZA 1TGCA 3GYLB 1GGDC 3QUMP 1O3JA 2BDBA 1JRTA 1VCQA 3GDSA 2XBWA 1ZPZA 1PPZA 1L1GA 1ARCA 1YPGH 2BDCA 1NFWA 3LC5A 2OBOA 3D62A 1AVXA 1TA2A 2QXJA 1QBOA 4UFFH 1QJ7B 4NIXA 4MNXA 2FX4A 2C8YB 2H6MA 4WWYA 5T3HA 3MH6A 2YNAA 3S0NA 1EJNA 1AFQB 4F49A 5A0AE 5DP3A 5AFZH 2H2ZA 2O8MA 4VGCB 1H9LB 2ZDNA 3LT3A 3MNSA 5JBBS 3SNEA 1BRCE 1P9SA 1EZXC 3R3GB 2ULLA 1C5UA 1P01A 2PGQB 3MU4A 3RLYH 1TIOA 1HJ9A 1P10A 4X1QU 4U32A 3A8AA 1P2QA 1RTFB 2ZDMA 2UUYA 3L6PA 1CGIE 1F5KU 1V2LT 2ODQA 3ZYEA 3JZ1B 2HGTH 3KL6A 3PO1B 1MQ5A 1DT2A 2VIWA 2RA3A 2TGAA 1LTOA 4IMQA 8ESTE 2SGAA 2FX6A 1PQAA 1D3PB 2NU3E 3A7XA 1V2KT 3Q3YA 3BTKE 3I29A 6ESTA 4B75A 3TJOA 1A4WH 2QXHA 4TWYA 1PFXC 5TCCA 1DSTA 2Q6FA 2F9BH 2BXUH 1C5VA 3ZZCA 3PLPA 1O5EH 3SN8A 1DICA 1MTNC 3LIWA 3ZZ5A 2ZP0H 1WV7H 2ZFSA 4UDWH 4ABHA 4CRDA 1LQDB 1LVBA 4ZHLU 1O3LA 3GYMA 1UK3A 2GD4B 3U9AH 2OBQA 4X8SH 3L33A 3GCHC 3TIUA 4GVUA 2FOCA 1O2RA 1BHXB 3TPIZ 2AS9A 1EOJA 5F8XA 3W94A 1O5GH 3HKIB 1VZQH 2BLOA 2FOHA 3SNBA 2A4OA 2BVSH 3RXUA 1FNIA 1GHAF 3GOVB 4WXIA 1O0DH 1C9TA 1SGRE 4VGCC 1H8IH 4NIWA 1LHCH 1JRSA 2B5TB 2FZZA 2QN5T 1SOZA 1V2QT 4Z6AH 2SFAA 1J15A 1DX5M 3NPSA 1IHTH 3STJA 1GPZA 1Q31A 3UIRA 1VJAU 5EGMA 3RP2A 5K0HA 1GHBF 2BY7X 2BHGA 1P04A 3SI3H 1HNEE 1C5RA 3SUFA 3BTWE 3EA8A 4K1TA 1TGNA 4FUCA 3E90B 5DPAA 5CHAB 1MKXH 2C8ZB 2BMGB 1KDQB 5AVDA 2IJOB 3ZZDA 1GJ4H 3P8NA 1N6XA 4Y7AA 4AFZA 3QO6A 3LGUA 3AW0A 4I8KA 2VJ1A 2FLRH 4DGJA 4O97A 3FVFB 4FU7A 1T32A 4DIIH 2A4RA 1PPHE 1TRNA 1BMNH 3VB5A 1F0RA 1ZMLA 1P09A 1GHWH 2BD7A 3MU5A 1MTUA 1FY8E 1VJ9U 2TGTA 1DANH 1P12E 5FAHA 4FU8A 3TU7H 1GDUA 1KDQA 2VU8E 1UMAH 3OYPA 1WTGH 4AZ2B 2GCHG 1K2I1 3K2UA 3P8GA 1DVAH 4A1TA 1O2QA 3M5MA 4ZXXH 5C2ZA 2XWAA 1C4U2 5DP6A 2OC8A 1KXFA 1Y8TA 1LVMA 1BJUA 1DUAA 1ZR0A 4X1PU 3S7HB 1HAGE 3LC3A 3BTTE 1SGCA 1OXGA 4KTCA 3SBKA 4A7IB 2J2UA 2WV5A 3Q77A 3A8DA 2AFQB 4D7FA 1SHYA 2CMYA 3QGJA 2HALA 5FBIA 3A88A 3SUEA 1YC0A 1TPSA 1KLJH 1UHBB 4ESTE 4UEHH 2CF8H 2DE8A 1Z8IB 2FS9A 5AF9H 1SFQB 4I8HA 1A7SA 2PW8H 1RGQA 1CVWH 1GG6B 2LPRA 2GT8A 3BEUA 1YLCA 2FS8A 1MQ6A 1D6RA 1P03A 1AD8H 3GISB 1YF4A 1PPEE 2PR3A 1BA8B 1LMWB 1SGQE 1TYNA 1ELTA 5L6NH 2B9LA 3RXPA 3DA9B 1DUEA 2P3UB 2G81E 3MU1A 4NSVA 2CHAC 4FUJA 1W0YH 1MZDA 1V2OT 1Z6EA 1P9UA 1ETSH 1UHBA 4H6SB 4E05H 1P2OA 2VGCB 2ZGJA 5A0CA 5DKMA 1TALA 1O3MA 1OWIA 1TOMH 4DOQA 3ZZ7A 1QL7A 3D23A 2Y5HA 3BIVH 3BTHE 4Z0KA 2ZWLH 5LPRA 1BDAA 3FZDA 1EJMA 4YO9A 2ODYB 1GJ7B 1GMCF 1TE0A 4ZKOU 1XX9A 2ZNKH 1O3NA 1TPPA 1UCYH 1O33A 4X0WU 4XBDA 3ZVGA 2AMPA 4X8TH 4CRAA 3RMOH 1IQLA 2HVXA 3ZZ9A 1O2WA 2D1JA 1LPGB 1MH0A 1XVMA 4IW4E 3NK8A 1BTXA 4U2WA 3RXEA 1M9UA 1BHXF 1ZHMA 3ELAH 3UTUH 4YOJA 3A87A 4XDEA 2BDHA 1C1QA 1HXFH 4KKDA 1W7GH 4I8JA 3G01A 4MPVA 4Y11E 2FOGA 3QZQA 5J4QA 4X6OA 4FVBA 1J8AA 2FESH 1ELGA 1LDTT 4GUXA 3TGKE 4OS7A 3FZZA 3V12A 1GDNA 1HLTH 5DK1A 2ANWA 1NFYA 5C1XA 1O5DH 6CHAC 3FP6E 1WCZA 4BAQB 3MOCA 1T31A 1TPOA 3GY4A 1A0JA 1ELVA 2FO9A 1MKWH 5HM9A 2FXRA 4BTIB 1G2LA 1S81A 3Q76A 2EEKA 3SUDA 6GCHG 1GJ8B 4GSOA 1H9IE 2F9NA 4WJG2 1W13U 4UFGH 5E2PA 2Y7ZA 5EQRA 1D3DB 1C1TA 3CS0A 2BZAA 2OC7A 3MU8A 3SNDA 1GVKB 1BITA 1K1NA 1GI3A 3P8FA 4INLA 4DJZB 5IYTA 4B71A 2VIVA 1GL1A 1G3CA 1C2GA 1TGSZ 2Z9LA 1OWEA 1GJDB 3RXFA 1GJ6A 2ZU3A 1SHHB 4DW2U 3TH3H 2BXTH 2SGQE 1YPHE 1UK4A 3BTDE 2TGDA 3M35A 2GKVE 1G2MA 4AGJA 2FYQA 2JH5D 3RC4A 1KSNA 1Y5UT 2VIOA 3C27B 4K8BA 3VXFH 1C2HA 1BQYA 3B23B 4CBNA 3A8BA 1FV9A 1IHSH 2I6QA 1GBCA 2ZHWH 1FDPA 1H1BA 5EOKA 4X2XA 2CN0H 4ABBA 1V6DA 1BRUP 3MFJA 1MBQA 4GCHF 1KYNA 3UNQA 1QY6A 1E34B 2VVCA 3DFJA 1DWCH 5DGJA 2ZFRH 1ZHPA 4NFEA 2BM2A 1W3CA 3A7VA 1B5GH 3F9FA 3K9XB 5ESTE 3RXSA 4NZQA 3RXGA 1MTWA 3E1XB 1IQJA 2BD3A 1FY3A 4I8GA 4HFPB 3PTNA 3LPRA 5DP5A 2UUJB 1ANBA 1Z1IA 5GIBA 1T8LA 4FUIA 3QLPH 1TLDA 1TGBA 1ZOMA 1ELFA 3LOXA 2ZFTA 3UUZA 1PYTD 4BXWA