3BTEE

The crystal structures of the complexes between bovine beta-trypsin and ten p1 variants of bpti.
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
221
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title The crystal structures of the complexes between bovine beta-trypsin and ten P1 variants of BPTI.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 54
structure length 221
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3bteE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3bteE02
1PQ5A 1UVSH 2V35A 3LGYA 1OXGA 1SGPE 2ZPQA 5HM2A 5L6NH 3EGKH 1VCWA 1S6FA 5I46H 5J4SA 1IQJA 1JMOH 1EJAA 4PROA 3RXLA 4X2XA 1YP9A 4CH8B 1IQGA 1XUHA 2FO9A 1GVLA 2W7SA 3Q00A 7LPRA 1GI9B 4J1YA 1MCVA 1DY9A 2A2XH 3ATMA 4ZXYH 3UY9A 1GJ6A 1V2UT 3AASA 2D8WA 2YNAA 3MU5A 3U8TH 3BSQA 1GI1A 3UOPA 2VWNA 2ZGBH 4NWLA 1T32A 3RXJA 1ZHMA 1BTHH 2YNBA 1L1JA 3LU9B 3VEQB 2BY5X 4XBCA 4YT7H 2FEQH 2CJIA 1YPHC 1AB9C 2V3OH 2QA9E 1NFYA 2ZU2A 4ABJA 1RTFB 3RXCA 3UTUH 2Y81A 1OP0A 3F9EA 1ZPBA 1QA0A 4AB9A 5JBAS 2BQ7B 3PLBA 1C5RA 1L1NA 4X2WA 4Y10E 1IQHA 3F1SB 1S6HA 1CBWB 2GP9B 2BX4A 1K2I1 1TBZH 5C1YA 3FP7E 1SGNE 2BYAX 2WV4A 1FUJA 4ISIH 1TRYA 3BG4B 1KDQA 3RP2A 1K1OA 1RIWC 4CH2B 1CA0B 3SNDA 5EQSA 1W0ZU 1V2MT 2VWOA 5FCKA 2B0FA 2TGTA 4UFFH 2PGBB 1HAGE 2OC8A 3MMGA 2OQ5A 4THNH 2EI6A 2JH6D 1SI5H 5F8XA 1V2JT 1ZSJA 4OGYA 4K8BA 4K8YA 4Y8YA 1ELVA 1BTPA 3BEFB 4BTTB 3VGCC 1K1JA 4Y7AA 1AZ8A 5EW2H 1JIMA 3MU1A 1P12E 1TFXA 4ZHMU 4Y11E 4NZLA 2V6NA 2AGIX 1S0RA 2HWLB 1HIAB 2XXLA 2IN2A 2QY0B 1Y3VA 5DP9A 1AB9B 4R8TB 3E16B 2HPQH 3P17H 3DT0H 1ARBA 1IQEA 2PUXB 3ZVCA 5J4QA 4ZUHA 4DCDA 1ZTLA 2HLCA 1IHSH 4TPYA 3JZ1B 4FUFA 3PM3A 1BRAA 1ZRKA 1K1IA 1F2SE 3MHWU 3FP8E 1LHGH 1YBWA 5HXFA 1H8IH 1O3MA 2Z6BD 1MAXA 1MAYA 2OBOA 3S7HB 1GJBB 2A4OA 3A8BA 3RC5A 4OS4A 3SV9A 3MFJA 1K1MA 5FAHA 1IOEA 1SSXA 3ZYEA 2G51A 1O2XA 2THFB 1RIWB 1P04A 1KXCA 1S84A 4FVBA 1O5GH 5EGMA 3U9AH 3RM0H 4MNXA 4AG1A 1IQLA 2GV6A 5FBEA 2BX3A 1BMAA 3ZZ5A 2AFQB 3LKWA 1FLEE 1IQNA 1JRSA 4X8UH 2O8WA 1NROH 4B1TA 1C2HA 3PWBA 4E7NA 2FOCA 2P8OC 3A7WA 2BY8X 3TU7H 4OS7A 3GY2A 5K7RA 2ZQ1A 1QY6A 3VB4A 3EAJA 3UR6A 4D8NA 4H6TA 2Y5GA 1BDAA 1G30B 3CENA 1RTLA 1CT0E 1M9UA 3TGKE 1HIAA 1D6RA 5JBTA 1BMLA 3RXHA 3RLYH 3LGVA 4GCHG 4ABGA 3GCNA 1G3EA 2C93B 3I78A 8GCHG 2AMQA 2C8YB 3A86A 3D62A 1HAHH 4OS1A 1GJ8B 1ZMNA 2GT7A 4CR9A 1IQMA 5AFYH 2ZDNA 4BTIB 1V2ST 1AVGH 2FP7B 3LT3A 2NU0E 1GI0A 3NWUA 1P2JA 1WQVH 4X2VA 1BMNH 1WSSH 1O35A 2BDBA 1TGBA 3O8RA 1EB2A 1FNIA 4MPWA 1Y5AT 1GJ4H 1O36A 3TH2H 1CGIE 1BRUP 3TJNA 1J15A 1GCDA 1NFUA 2Q6DA 3A7YA 1GPZA 3SI4H 5HMAA 3T2NA 3K6ZA 3URCA 1Z1JA 1D9IA 4QT8C 4AX9H 5DP8A 1YM0A 3RXIA 1WBGB 2VNTA 4VGCC 1HAYB 3VXFH 1QJ1B 1O2RA 2RCEA 2VVUA 3AAUA 1CT4E 1O2LA 1O5BB 3K6YA 1W13U 3RXFA 2ZFRH 1A46H 3E90B 1KYNA 1LCYA 1SHYA 1O2WA 2ZFTA 1LVOA 1AGJA 4DY7B 1IQIA 2BDYA 4CHAC 1SGIB 1H9LB 2UWPA 4K1SA 4XFQA 4NIWA 1UO6A 1ZSLA 1HYLA 3QN7A 1BIOA 1C1QA 4WF8A 4FUGA 1BTZA 4GHTA 3M36A 1C1NA 1GBDA 5AVDA 3BEUA 4I31A 5DK1A 2W5EA 1HV7A 4AFSA 1O2KA 2VWLA 4KKDA 3M5MA 1LO6A 3BTME 3TK9A 3HATH 4JMYA 3ZVDA 1SL3A 1F5RA 5TCAA 2H5DA 4CBNA 4BAQB 1UMAH 3PMAB 3ZVFA 3P92A 5HYOA 1L1GA 1VCQA 1GHBG 1DWCH 3FZDA 5JB9S 5JBCS 1C5VA 2PGQB 1E37B 1AMHA 1O3JA 5JYIA 2OUAA 2IPHA 6GCHG 2ZIQH 4A7IB 1SQOA 2BZAA 1NESE 1UTPA 4WH6A 3A82A 2HNTF 4BAOB 3A7ZA 1HAXB 4JK6A 2Q6FA 1ELEE 1VZQH 1H9IE 2QXGA 1NRSH 3SGQE 2G5VA 1SC8U 1W3CA 4BXWA 1QB6A 1TBQH 2A7CA 2D26C 4CHAB 1JIRA 2P59A 2PTNA 1GBTA 5F8ZA 3SV6A 3T26A 2BDHA 2PSYA 2KAIB 1C5MD 2BLQA 2PR3A 1HXEH 3SJ8A 2BQ6B 3RXKA 1CQQA 1PJPA 1TRMA 2ZCKP 1DLEA 3SUFA 1AIXH 1O2TA 2XWBI 3UR9A 1MBMA 2Z9KA 5L30H 1DSUA 1SBWA 1QJ6B 1C5SA 2J9NA 2FESH 3KF2A 1Y3WA 1G32B 1P10A 2BD3A 2HNTC 2J95A 4ABEA 1GJAB 2QXIA 6ESTA 1Y3YA 1YCPM 2RA3A 1OX1A 2GVFA 1C2MA 4RKJB 2BD9A 3GCTG 2I6QA 3QK1A 1C1WH 4ABFA 5IYTA 1GGDB 4Q80A 2GX4A 1ZYOA 1DFPA 1F5KU 4A6LA 2PV9B 3M5OA 1C5NH 2ANYA 1TNKA 1PPEE 7ESTE 1QB9A 1A5IA 3T25A 2ZFPH 1XX9A 4GUXA 1K9OE 1O3KA 2QXHA 3LOXA 1DSTA 5A09A 2P94A 2I6SA 3GY6A 1CE5A 1W2KH 2JH0D 1P9UA 1B7XB 4FUCA 4BTUB 2OBQA 3MYWA 2R3YA 3IWMA 3V3MA 3B23B 4DGJA 3FP6E 4JZ1A 2OLGA 2J92A 2DE8A 4TY6A 3PV4A 1ESTA 1XKBC 3PMHB 4U2WA 5GDSH 2UWOA 4KTSA 1DVAH 4AGKA 2ZA5A 3MNBA 2KAIA 3OY5U 5CE1A 2ZTYA 1T8OA 2WPMS 1P3CA 1ARCA 2HALA 3GY3A 1RD3B 2B5TB 2BVXH 2CF8H 2BVSH 2XW9A 2FXRA 1ZR0A 5K0HA 4MPUA 1C2EA 2AYWA 3ZZCA 3SJ9A 3C1KA 4Y8ZA 5DGJA 1BJUA 2WYJA 5C5NA 1HRTH 1C9TA 1LHCH 3E0PB 3SORA 2Z9JA 1NRQH 1MBQA 1THSH 2TPIZ 2ZFSA 1C5LH 1E34B 1RFNA 1T31A 2A4RA 4Z0KA 4UFDH 1O3NA 2VGCB 2PTCE 3A88A 4MLFB 4MPVA 3ZV9A 1Y3UA 1T8MA 1V2PT 2SNWA 4YOIA 4E06H 2GD4B 2ZHWH 4WJG2 3SU1A 2H5CA 4B71A 1C5UA 2R3UA 1UTMA 4D9QA 1LPKB 2D2DA 5DJ7A 1MKXH 2SGAA 1O2ZA 2LNCA 2W3KA 1ZJKA 5CMXH 1K22H 1O2YA 3I77A 4GLYA 4LXBH 4AGJA 4CR5A 1YPKH 2PKSB 4ABBA 3R0FA 1TOCB 3BTKE 1C5YB 3DUXH 4JZIA 3VB5A 3UPEA 1FIWA 3HKJB 4Y71A 5EXMA 2GZ7A 5IDKA 2BDIA 5DP6A 1EOJA 1Y3XA 3SHCH 2BVRH 1T8NA 1T7CA 1MU8B 2GV7A 1TNIA 1ZPCA 2FLRH 5LPEA 3QLPH 1BRBE 3DFLA 3AAVA 1SG8B 3QWCH 3L6PA 4O97A 1GMDF 4Z6AH 1C5ZB 4BAHB 1EATA 4WWYA 1ZJDA 5EPNA 4NSYA 3BTTE 2OXSA 3CS7A 1TNHA 3ZZ9A 1A7SA 3SN8A 2ZCHP 3DHKH 2A45B 3RXBA 1SLWB 1W0YH 1KXFA 3ZZAA 5GWZA 1C1UH 1O2JA 1OP2A 1S82A 1P9SA 3BV9B 1GI4A 4R0IA 1C2LA 4GAWA 1BTXA 3SU3A 4FUJA 1PPZA 2Q1JA 3G01A 2FOEA 5EW1H 4CRFA 3GY8A 2RDLA 4Y79A 5GPIB 1LKAA 2FI4E 3RXQA 1SGQE 1GBEA 1BTUA 1HPGA 1O2VA 4HGCA 1EPTC 4O03A 3SUEA 1FY8E 3PTBA 4IN2A 3KGPA 4GCHF 2C3SA 3UQVA 4NFEA 4YT6H 8GCHF 2G4UA 3SU2A 1BTWA 4GVUA 4BAKB 2ALVA 2EA3A 1C1VH 1DICA 2TIOA 2ZG0H 1HUTH 3Q3YA 4Y0ZE 2ESTE 4E7RG 1A0HB 2ZFFH 5C2ZA 1MTNC 3KCGH 5BRRE 3VXEH 1O3FA 2ZTZA 1TYNA 3SNBA 1BQYA 1HGTH 3O8DA 1ANDA 2Y6TA 4WVPE 1TAWA 4IN1A 2FPZA 5C1UA 3IITA 1VCPA 2BLOA 2A4GA 1QR3E 2CF9H 4IS5A 1E0FD 2BHGA 4XOJA 5HGGA 1D3QB 3A85A 2VJ1A 4FUDA 4I32A 3M5LA 1HB0B 3MH6A 3HGNA 2Z9LA 1ZSKA 3T29A 1NO9H 1GCTB 1FDPA 3ZYDA 2P3UB 5CHAC 2C8XB 1EZXC 1K1LA 4CRDA 1VGCB 1DITH 2J38A 2VIVA 3ODDA 3M5NA 2AS9A 2G81E 1P06A 1EPTB 4WMDA 3U8OH 1L4ZA 1GBMA 3TGIE 1GBHA 2SGFE 1Y8TA 2FODA 3FZZA 2F9VA 1GMHF 2BM2A 1VITG 2Z94A 2ZNKH 3PLKA 1PFXC 2NU1E 3D23A 4TYDA 3NKKA 1RS0A 1SPJA 1XUFA 1TMBH 2B7DH 3KHVA 1F92A 3TJUA 2BB4A 1Z8IB 1LPGB 1PQAA 1FZZA 3E91A 2Y5FA 5T6GA 2R2MB 3RXMA 1D3DB 1ZGVA 1ZHRA 3ZV8A 1O3PB 1TB6H 3ZZBA 1ETRH 1CSOE 3SNCA 1O5EH 1UCYK 4ZKRU 5TCCA 1N1LA 1TGTA 5EODA 4UE7H 1JRTA 1O3EA 2O8TA 4DT7B 2BD4A 4RSPA 5JPMH 3S69A 1O31A 3E8LA 3A89A 1GHBF 2FOAA 2ZCLP 2F3CE 3STJA 3V7TA 1ABJH 3A7VA 4LK4A 1E36B 1F7ZA 2H9TH 1X7AC 3I29A 8LPRA 2HOBA 2J94A 2XWAA 3M3SA 4B74A 4CRGA 3E1XB 1GBBA 3QZRA 1FIZA 2F83A 1L4DA 1HNEE 3LH3A 3O8BA 1G3BA 4XBDA 5FXLA 1O2MA 1UHBB 3LC5A 1XMNB 1QIXB 5E8EH 7GCHG 4ABHA 3AW1A 1EPTA 3QX5H 1FPCH 2VIWA 1GL1A 3GY7A 1TGNA 3SOSA 5C67A 2WPKS 2OD3B 1OSSA 2GZ8A 1QB1A 2BLWA 2Q6GA 3IG6B 2AMPA 1UTQA 4WXIA 2FOFA 2QC2A 2SGQE 2A32A 4U30A 1ELCA 2Y80A 1QRXA 3SQEE 3BTEE 3Q3KA 1H4WA 2IOTA 3GCTF 1P2QA 2FS9A 4MDSA 1P01A 1KXAA 2WINI 1A0LA 1MMJN 4X6PA 1KLJH 1UVOA 2BD7A 1BITA 3SJOA 3RXOA 2QIQA 1O5DH 4Y76A 1DX5M 1TPAE 1WAYB 2CXVA 4GHQA 4ESTE 5ESTE 2ZI2H 5FPSA 2BD5A 4JZEH 1MQ6A 1MKWH 2PLXA 1BRCE 2XTTB 3MO6A 1BA8B 3LDXH 3UREA 4NZQA 1RXPA 2ZHEH 2HRVA 3A8CA 3GCOA 4NG9H 1CHOG 1F0RA 3VGCB 5GJ4B 4KGAA 1GHZA 2F9BH 3FFGA 3K2UA 4NWKA 4X1NU 4YOGA 2CHAC 4CRBA 1C5QA 2EEKA 4TWYA 3BG8A 1C1SA 1TNLA 3RUOA 3M3TA 2FI3E 2QF3A 3GOVB 1XVOA 5L2ZH 2H9HA 1KXBA 4MQAA 1A61H 5F6MA 2ANKH 4AZ2B 4WH8A 2AH4X 1CA8B 2YOLA 4I8KA 2PFEA 1C5OH 1UHBA 2VWMA 3L3TA 3MU4A 3BTDE 2FOGA 3RXDA 4AYVB 2NU3E 1JOUB 1ORFA 4OS6A 2A7HA 1TA6A 3AVZA 3P6ZB 1ELAA 5GCHF 1C5PA 5T6FA 1V2TT 4D9RA 1QL9A 3A84A 4AFZA 1TE0A 3M37A 1BBRK 5T3HA 1MUEB 1O5AB 1DUEA 4Y7BA 2XBWA 1EJMA 1MD8A 1O2SA 1OWJA 3BIVH 2FOMB 4K5ZA 4WXVA 1ESAA 3UWIA 1CO7E 1TALA 2ZQ2A 4YM9A 2SGDE 4K60A 4FU8A 3GDVA 3MH4A 5DP5A 1AE5A 1LHFH 2UUYA 3RU4D 3TPIZ 3LJOA 2ZTXA 4DOQA 1C1PA 3DD2H 1THRH 3CP7A 1G3DA 2P3FH 3RC4A 1EP6A 2BXUH 1XUJA 2P8OB 4DW2U 2GCHG 4MNYA 1LTOA 3F9GA 3P8GA 4IMZA 1O30A 1TX6A 1PPCE 1RRKA 1UK3A 2R9PA 4X6NA 1LVBA 1FY3A 3SU0A 1FY1A 2G00A 2WYGA 2GT8A 5A8YA 4K1TA 1GI7B 1W12U 1O3LA 1NFXA 2GCTC 1AFQC 1XUKA 3TJOA 2HPPH 5AHGH 4D7FA 4ZHLU 1EAWA 2ZZUH 1XKAC 3SU6A 1GHYH 1HXFH 1A5HA 4NCYA 4ZMAH 1NN6A 3UFAA 2ODYB 4ZKOU 2WPIS 4YOJA 1IHTH 4KTUA 4NFFA 5DG6A 3MU8A 5H4IB 2BQWB 1PPGE 4X1SU 1XXDA 4XBBA 1SB1H 2P3TB 1W7GH 5AFZH 3A81A 5DP4A 3E0NB 1O3IA 1TPPA 2AERH 5AF9H 1C4Y2 1NFWA 3A87A 1J9CH 1AUTC 2A5AA 1ZMLA 1P2NA 2NU4E 4I7YH 1U6QA 1ZGIA 4FUBA 1TGCA 4FUEA 1V2RT 1O2QA 3UNRA 3ZZ4A 4VGCB 4JZFH 1Y59T 2QCYA 1DANH 2BDCA 1C1TA 1NRRH 1GI8B 1ZTKA 1UVPA 3PMBB 3PMJA 4AFQA 1ACBE 1C5WB 1PQ7A 1C2KA 2JETC 3Q76A 1A0JA 3TIUA 2W3IA 2TBSA 3RU4T 1YLDA 1ZLRA 1AFQB 1EOLA 1YGCH 4X8TH 5TJXA 1GHAG 1P57B 2ZGJA 1AD8H 4B75A 1MZAA 4AYYB 2Z3CA 1SQAA 3S9BA 3MO9A 1TNJA 1G36A 1YPGH 3ESTA 3PB1E 2K1QA 2A5IA 3RMOH 4NA7A 1EP5A 3HK6B 1G37A 2AMDA 1DWDH 1OYTH 1SGRE 2OINA 2TGAA 2W26A 2VIQA 2ZFQH 4INLA 2PUQH 2BD2A 5LPFA 1BOQA 4BNRA 1EX3A 1K1NA 1YYY1 2ZDKA 1NT1A 3KQBA 1O2HA 1GBCA 4FU7A 2GZ9A 4D76A 4HZHA 1Z6EA 3H7OA 5EXLA 1GHXH 1N8OC 2G52A 2C8ZB 5GIBA 1SLXB 2BY6X 1AN1E 5DPAA 3LJJA 1VITF 1VITH 3GY5A 2FZZA 1ZOMA 2FWWA 2FM2A 1HFDA 5EU8A 1DWEH 2ZU3A 2JETB 2P16A 4A92A 2M5TA 2GGVB 2ZU4A 5EQRA 3SHAH 2XCFA 1ESBA 3TH3H 1BCUH 1DLKB 1O33A 1V2NT 1V2OT 4DVAU 2ZGHA 1BHXB 2ZKSA 1HAIH 2FLBH 3OY6U 3MH5A 1TNGA 2VU8E 2EC9H 2ZP0H 4MVNA 3HK3B 1GVZA 3M7UA 1Z1IA 4A1TA 5ETXA 1S81A 1WV7H 1RGQA 2NU2E 3DFJA 4ISLA 3GISB 2R0KA 2JH5D 2STBE 4XSKU 4ZH8A 4WMFA 1UTKA 4BXSA 2A31A 3F6UH 1DM4B 5A8ZA 4IMQA 2OC7A 3P8FA 3ATWA 3MOCA 1OWHA 1Z71A 1T4UH 4JK5A 3QTOH 2VH0A 1QRZA 5JDUB 1KTTB 4AFUA 3WY8A 3BTQE 4MNWA 3T27A 2A0QB 1AWFH 3RXEA 4HFPB 2Y7XA 2Y5HA 3ZVAA 1SVPA 1Y5BT 4JYUH 5E0GA 3SNAA 1QJ7B 3OSYA 3UNQA 2BXTH 5JB8S 1BB0B 2VINA 4UD9H 5E2PA 1UCYE 3U8RH 1J16A 1ANBA 1D4PB 4AN7A 3SGAE 3TK6A 4Y8XA 1F0TA 1IQFA 1GJ5H 2BTCE 2P93A 3MI4A 3U69H 5A0AE 3A8AA 1SGEE 1H8DH 2ODPA 5A0BA 1NRNH 1W8BH 1S83A 1C9PA 3SW2B 2TGDA 4FUHA 3RXVA 5GXPA 1HJAC 3H7TA 4I8JA 1JBUH 3EDXB 2Y7ZA 1J8AA 1C5XB 3KQCA 4YLUA 4B76A 2WUBA 4K3JA 5E0HA 2CN0H 4CBOA 1SLUB 2V0BA 1FPHH 1CHOF 1DXWA 3SUDA 1HLTH 1TOMH 1MZDA 2ANWA 2SGEE 3RMNH 2WPLS 1YF4A 2ZDLA 1UK2A 1P2IA 4SGBE 3W94A 2FOHA 3ZVGA 1Z8GA 1B5GH 1PPHE 1G2LA 1L2EA 3S9AA 1WTHD 3E3TA 3H5CB 1O39A 8KME2 3GCHC 3QDZB 4NIXA 3U1IB 4BANB 1FV9A 5HM9A 1GDUA 2ANMH 2Z3DA 3ATIA 1C1RA 2ZC9H 1GMCG 4OS2A 3M35A 1O2OA 2PSXA 3Q3XA 4NA8A 1LPZB 1F0UA 1WTGH 4TPIZ 3FVFB 1VJAU 3ZZ3A 1QBVH 5E0JA 1H9HE 3KIDU 1LHEH 3ZZ7A 4HI3A 5F8TA 1C5TA 4BOHA 5FHTA 1O2GH 3P8OA 1OWDA 2BD8A 3TK5A 2Z7FE 1BT7A 2J2UA 1ZHPA 2AIQA 1EUFA 1O5CB 5A0CA 2A7JA 1XUGA 4X0WU 4LZ4B 1P2OA 1XXFA 1SMFE 2ZEBA 4ABDA 3LGWA 4O9VA 3FANA 2VIPA 2WV5A 4I8LA 1Q3XA 2DUCA 1UJ1A 1OWKA 1HJ8A 3SI3H 2UUFB 4B2CA 3V0XA 3M7QA 1O3OA 3LGUA 5C1XA 1FN6A 2ZO3H 1C2JA 1PYTC 1CU1A 2TGPZ 1WQSA 2JKHA 1MTWA 1GBKA 2GCHF 4GPGA 1KY9A 2ZPRA 3EQ0H 1GDNA 4KP0A 3GCHB 2QAAA 4Y0YE 4KELA 1UTNA 2OC0A 3RXPA 1O2IA 3LGTA 2SFAA 2F9UA 3VB6A 3QZQA 1KTSB 1O3CA 1CBWC 3A7XA 2ZF0H 1RJXB 1KSNA 3U1JB 1BBRE 2H6MA 3BG4C 2FYQA 3T28A 1CA0C 2XC5A 3NK8A 3GICB 1JWTA 1C2GA 1O34A 4E05H 3KNXA 4UONA 1HAOH 3GYLB 1FJSA 3ATKA 3SJIA 1A5GH 1GVKB 2XBYA 4Q2KA 1CHGA 4I8HA 4NGAH 4UDWH 3VFEA 2FIRH 3LIWA 1MTNB 3RC6A 1SFIA 2F9NA 3P95A 4U32A 3BTWE 1O37A 1QURH 2ZPSA 3F9HA 1QNJA 4ZAEA 1VJ9U 1NM6A 2UWLA 1HAZB 3QGNB 4ABIA 1DUAA 4U01A 5C3NA 1SGYE 2OP9A 3RXAA 3TITA 1EZSC 1SOZA 1XVMA 1WU1A 1SQTA 2V3HH 6GCHF 1QBNA 1J14A 1EXFA 1FMGA 1FXYA 1H1BA 1SLVB 4MG3A 1ID5H 4KTCA 5CHAB 1VR1H 3F68H 3UIRA 5A2MH 3M61U 2OQUA 2Z9GA 4F4OC 4X6MA 1HJ9A 1A2CH 2BOHB 1OWEA 1GBIA 4Y6DA 1EAUA 2PHBA 3CS0A 4RN6A 1DE7H 3MNXA 5EQQA 1NC6A 4LZ1H 3QO6A 1GHAF 2GTBA 3SV8A 3STIA 4ISNA 2WPJS 4IW4E 4ZKSU 2Z3EA 3BN9A 1W14U 2STAE 5EG4A 5BPEA 2Y82A 1EAXA 1G3CA 1OYQA 1P09A 1S0QA 1EB1H 3MWIU 5PTPA 2RA0A 5B6OA 1QQ4A 1TX7A 2VVVA 1QA7A 2CGAA 1Z6JH 2F9OA 1ETTH 1J17T 1TONA 2O8LA 1A3EH 6CHAC 1TQ7B 1W10U 1ZMJA 2P95A 5SGAE 1AU8A 1TWXB 3PTNA 4IC6A 4YLQH 8ESTE 9LPRA 1E38B 4AORA 1YPLH 2GMTC 1C2DA 1UTOA 1TBRH 1O3AA 1Y5UT 1ELDE 4DIHH 3P70B 4GSOA 5DO4H 5EOKA 1Q31A 4DJZB 3A8DA 1MTVA 1QL8A 4AG2A 3M3VA 1P02A 1QHRB 1TA2A 1C2IA 2AGGX 2ODQA 3OTJE 1A3BH 1AE8H 1C4V2 4JCNA 1MTUA 1YCPK 1Q2WA 1DS2E 1BTYA 5ESBA 4JYVH 5FPYA 1DT2A 1GMDG 3OX7U 2O9QA 1A1RA 1NS3A 1WOFA 4ZKNU 1HBTH 2ZGCA 4NIYA 3K65B 1P2KA 1QTFA 4NSVA 1T4VH 1GG6C 2FMJA 5DP7A 1LVYA 2EI7A 1D3TB 3W95A 5A8XA 1DXPA 1K28D 1WCZA 2G55A 2QGRA 1V2LT 1QRWA 2ZDAH 4NA9H 3RXUA 3B8JA 1DWBH 1SR5C 3GDSA 1BJVA 2EI8A 2ZGXH 3QUMP 4H42U 1LQDB 4D7GA 1UVTH 3EA7A 2ZECA 3D49H 4INKA 3HKIB 3SU5A 6CHAB 1SGDE 3BF6H 1ZZZA 3QTVH 4MTBA 1V3XA 1E35B 1O32A 2GMTB 1EKBB 3P8NA 5FBIA 1SHHB 1Z8RA 1INCA 1CT2E 4IGDA 2C4FH 3GY4A 1GI5A 1LQEA 3RXGA 2XNIA 4ZHAA 1A4WH 1HDTH 3KEEA 4FUIA 1P3EA 1ETSH 1UK4A 2ZHFH 2QXJA 2ZDVH 1C2FA 3BEIB 4Q7ZA 2CHAB 3BTFE 1SGCA 3KQDA 4NIVA 1PQ8A 2IJOB 1TQ0B 1WYKA 3PWCA 3PROA 1IQKA 2G5NA 5L2YH 1UTJA 3KN2A 1T8LA 1DDJA 1SGTA 3SO3A 2DE9A 1YC0A 1YPHE 4DURA 1AHTH 1UCYH 3JZ2B 1GG6B 3VPKA 3S0NA 3OYPA 2SNVA 2ZWLH 5JBBS 3T62A 1LDTT 2H9EH 2ZDMA 1P11E 1BUIA 4ASHA 2HVXA 2VB0A 2WUCA 3ENSB 1GJCB 2PKAB 1F0SA 2BMGB 3FAOA 3RMMH 2CMYA 2XC4A 3URDA 2XYAA 2BZ6H 3TVJB 3ZZ6A 1AZZA 3ODFA 1B0FA 1P03A 1NPMA 4OS5A 3C27B 3GDUA 5E2OA 2UUJB 1GMHG 2FTMA 1V2WT 3SNEA 1CVWH 3A7TA 2ULLA 1EQ9A 5EPYA 2BLVA 1C1OA 1V2QT 1EAIA 2TRMA 1GBLA 3PO1C 2ZU1A 4INHA 2PWXA 2CV3A 3TNTA 2B8OH 2BY7X 4WY3A 1DOJA 3BTHE 4MNVA 1TLDA 1CGJE 1YPMH 2SGPE 1MKXK 3LH1A 5G4BA 3UOUA 5DKMA 4B2AA 3V13A 5LH8A 4UEHH 1TPOA 4LOYH 3T5FH 4TY7A 1GMCF 4H4FA 4X2YA 4X8VH 2FI5E 2A2QH 3ZZ8A 1NY22 2XRCA 3LPRA 4UFEH 2NWNA 4ZXXH 2GKVE 3UQOA 1F5LA 1AVWA 1BHXF 1AUJA 4SGAE 1GGDC 1GDQA 1Z7KA 2GCTB 2H2ZA 4FVDA 3S9CA 3ZZDA 1MH0A 3SU4A 3SUGA 4A1XA 5LGOA 2AEIH 3ZVEA 1NU7B 1WUNH 3Q77A 1ANCA 1FAKH 2PKAA 2HGTH 2A1DB 1K21H 1YPJH 2FOBA 1RTKA 3MU0A 4X8SH 2XCNA 1O2NA 2XC0A 3GYMA 2F9PA 1TX8A 4OGXA 1MCTA 5LPRA 3AW0A 4I33A 1GHVH 3NPSA 3PO1B 5FPTA 1YCPH 3PLPA 3BTGE 1MD7A 4ISHH 4UFGH 3K9XB 1C4U2 1GI3A 1YKTA 3QGJA 1S5SA 1SOTA 2BDAA 1OOKB 2QYIA 1NTPA 1OS8A 5C20A 3EA9A 3D65E 1ELBA 2ZU5A 4X1QU 2VH6A 3MNSA 4RKOB 5FX5A 4B73A 3KL6A 1MQ5A 1AWHB 4M7GA 4X1PU 1P2MA 3NXPA 1TABE 4K69A 1HCGA 1BBRH 1ZTJA 2B9LA 1THPB 3NZIA 1Z8JB 1ELGA 3U98H 3RXRA 3TGJE 1SGFA 2VGCC 3ITIA 2G4TA 2H1UA 1FY4A 2AIPA 2ZHQH 1OWIA 1B0EA 1OPHB 3TH4H 4IBLH 1QFKH 3TLOA 3MO3A 1MTSA 1O3DA 3HGPA 2QN5T 1PPBH 1DY8A 1GJ9B 2O8MA 3TJVA 6LPRA 1HAVB 1MU6B 1TRNA 1O2UA 2AGEX 4MPXA 1AO5A 1C1MA 1O0DH 3MH7A 4XE4A 3PYHA 1NRPH 1AI8H 1W11U 1IAUA 1QQUA 1CGHA 1GHWH 1S85A 1SFQB 3BIUH 5C5OA 1KXDA 1TPSA 1AFEH 2PKSC 3O8CA 1O5FH 1ZRBA 1AY6H 1GJ7B 3EYDA 4ZROA 2XBXA 5FCRA 1N8OB 1PYTD 2VVCA 1JXPA 1V2VT 1GL0E 1QL7A 4FU9A 5GCHG 3LGIA 3UNSA 4B2BA 1OP8A 2BDGA 2PW8H 2BOKA 3RXTA 2Z9IA 5T6DA 7GCHF 1L0ZA 4YO9A 5DP3A 2FYRA 2J4IA 4JYTA 4AOQA 1QBOA 1FAXA 1QCPA 3RMLH 3TNSA 1XUIA 4H6SB 3HPTB 1PPFE 2FDAA 3KQEA 3LC3A 1N6XA 1SGFG 4DG4A 2UUKB 4A5TS 4CRCA 4WMEA 3SBKA 7KMEH 1ZPZA 1QGFA 2ALPA 2W7UA 1EZUC 1EASA 3B9FH 3F9FA 3MTYA 4CREA 1DPOA 5FX6A 1TMTH 4ISOA 4YZUA 3V12A 2G8TA 4JZDH 1FQ3A 3M7TA 1O3GA 3E6PH 4FXGH 3S7KB 3ZVBA 2FX6A 1ABIH 3EE0B 1EZQA 1AVXA 4J2YB 1OKXA 1V2KT 4YTAA 1AKSB 1LVMA 3SJKA 1O3HA 1LHDH 2FTLE 1NU9A 1HAVA 1O38A 1HAPH 4A1VA 3UUZA 3L33A 3NCLA 2FX4A 1G9IE 4K1EA 1XM1A 2J34A 5ABWA 1P8VC 1FI8A 1ELTA 4CRAA 1KXEA 2C8WB 2ZHDA 1D3PB 3SQHE 9ESTA 1GBJA 1FN8A 2ILNA 3SGBE 4I8GA 5F03A 1D6WA 4HTCH 4O3UA 3EA8A 2QV1A 4BAMB 1GI2A 2XBVA 3RM2H 1BMMH 3R3GB 4YESB 3ELAH 4O3TA 1G2MA 1ANEA 1GI6A 2OC1A 2RG3A 2F91A 1GWAA 2A5KA 1TGSZ 1P05A 1YLCA 3RDZA 1GBFA 3DA9B 1GJDB 4ABAA 1O2PA 2HNTE 1GCTC 1TMUH 3LONA 4XDEA 4IC5A 3N7OA 5EXNA 3NUMA 3ATLA 4F49A 1AQ7A 1FONA 1VGCC 2C90B 4X1RU 2ASUB 2GDDA 3MNCA 1KLTA 3SZNA 4K2YA 3VB3A 5I25A 2FS8A 1HJAB 1MKWK 2GDEH 3SV2H 3SV7A 3A83A 4DIIH 1N6YA 1KIGH 2A4QA 3RU4E 2R0LA 4TWWA 3VB7A 1LMWB 2LPRA 2WPHS 2OTVA 1W7XH 1LKBA 2O8UA 2OCVB 1AKSA 1EJNA 1P0SH 4X6OA 4AB8A 1KLIH 3OU0A 2VIOA 4Q7YA 3RLWH 3A80A 1NZQH 1BZXE 1UVUH 3UWJH 1ELFA 3RXSA 1GBAA 1FY5A 2R2WU 1O3BA 1UTLM 1TIOA 2QF0A 2BY9X 2VIDA 2D1JA 4Q7XA 1KDQB 1YPEH 1V6DA 1K1PA
chains in the Genus database with same CATH superfamily
1PQ5A 1UVSH 2V35A 3LGYA 1OXGA 1SGPE 2ZPQA 5HM2A 5L6NH 3EGKH 1VCWA 1S6FA 5I46H 5J4SA 5EIYA 2V3MA 1IQJA 1JMOH 1EJAA 4PROA 3RXLA 4X2XA 1YP9A 4CH8B 1IQGA 1XUHA 2FO9A 1GVLA 2W7SA 3Q00A 7LPRA 1GI9B 4J1YA 1MCVA 1DY9A 2A2XH 3ATMA 4ZXYH 3UY9A 1GJ6A 1V2UT 3AASA 2D8WA 2YNAA 3MU5A 3U8TH 3BSQA 1GI1A 3UOPA 2AHME 2VWNA 2ZGBH 4NWLA 1T32A 3RXJA 1ZHMA 1BTHH 2YNBA 1L1JA 3LU9B 3VEQB 2BY5X 4XBCA 4YT7H 3OAAD 2FEQH 2CJIA 1YPHC 3OFND 1AB9C 2V3OH 2QA9E 1NFYA 2ZU2A 4ABJA 1RTFB 3RXCA 3UTUH 2Y81A 1OP0A 3F9EA 1ZPBA 1QA0A 4AB9A 5JBAS 2BQ7B 3PLBA 1C5RA 1L1NA 4X2WA 4Y10E 1IQHA 3F1SB 1S6HA 1CBWB 2GP9B 2BX4A 1K2I1 1TBZH 5C1YA 3FP7E 1SGNE 2BYAX 2WV4A 1FUJA 4ISIH 1TRYA 3BG4B 1KDQA 3PRDA 3RP2A 1K1OA 4ZCNA 1RIWC 4CH2B 1CA0B 3SNDA 5EQSA 4TSFD 1W0ZU 1V2MT 2VWOA 5FCKA 2B0FA 2TGTA 4UFFH 2PGBB 1HAGE 2OC8A 3MMGA 2OQ5A 4THNH 2EI6A 2JH6D 1SI5H 5F8XA 1V2JT 1ZSJA 4OGYA 4K8BA 4K8YA 4Y8YA 1ELVA 1BTPA 3BEFB 4BTTB 3VGCC 1K1JA 4Y7AA 1AZ8A 5EW2H 2L6OA 1JIMA 3MU1A 1P12E 1TFXA 4ZHMU 4Y11E 4NZLA 2V6NA 2AGIX 1S0RA 2HWLB 1HIAB 2XXLA 2IN2A 2QY0B 1Y3VA 3SZEA 5DP9A 1AB9B 2IPQX 4R8TB 3E16B 2HPQH 3P17H 3DT0H 1ARBA 3PV2A 1IQEA 2PUXB 3ZVCA 5J4QA 4ZUHA 4DCDA 1ZTLA 2HLCA 1IHSH 4TPYA 3JZ1B 4FUFA 3PM3A 1BRAA 1ZRKA 1K1IA 1F2SE 3MHWU 3FP8E 1LHGH 1YBWA 5HXFA 1H8IH 1O3MA 2Z6BD 1MAXA 1MAYA 2OBOA 3S7HB 1GJBB 2A4OA 3A8BA 3RC5A 4OS4A 3SV9A 3MFJA 1K1MA 5FAHA 1IOEA 1SSXA 3ZYEA 2G51A 1O2XA 2THFB 1RIWB 1P04A 1KXCA 1S84A 4FVBA 1O5GH 5EGMA 5HIZA 3U9AH 3RM0H 4MNXA 4AG1A 1IQLA 2GV6A 5FBEA 2BX3A 1BMAA 3ZZ5A 2AFQB 5CHBA 3LKWA 1FLEE 1IQNA 1JRSA 4X8UH 2O8WA 1NROH 4B1TA 1C2HA 3PWBA 4E7NA 2FOCA 2P8OC 3A7WA 2BY8X 2KCPA 3TU7H 4OS7A 3GY2A 5K7RA 2ZQ1A 1QY6A 3VB4A 3EAJA 3UR6A 4D8NA 4H6TA 2Y5GA 1BDAA 1G30B 3CENA 1RTLA 1CT0E 1M9UA 3U28C 3TGKE 1HIAA 1D6RA 5JBTA 1BMLA 3RXHA 3RLYH 3LGVA 4GCHG 4ABGA 3GCNA 1G3EA 2WSSD 2C93B 3I78A 8GCHG 5CDFE 2AMQA 2C8YB 3A86A 3D62A 1HAHH 2K0QA 4OS1A 1GJ8B 1ZMNA 2GT7A 4Q4LA 1IQMA 5AFYH 2ZDNA 4BTIB 1UW7A 1AVGH 1V2ST 2FP7B 3LT3A 2NU0E 1GI0A 3NWUA 1P2JA 1WQVH 4X2VA 1BMNH 1WSSH 1O35A 2BDBA 1TGBA 3O8RA 1KMHB 1EB2A 1FNIA 4MPWA 1Y5AT 1GJ4H 1O36A 3TH2H 1CGIE 1BRUP 3TJNA 1J15A 1GCDA 1NFUA 2Q6DA 3A7YA 1GPZA 5HIYA 3SI4H 5HMAA 3DCLA 3T2NA 3K6ZA 3URCA 1Z1JA 1D9IA 4QT8C 3F2HA 4AX9H 5DP8A 1YM0A 3RXIA 1WBGB 2VNTA 4VGCC 1HAYB 3VXFH 1QJ1B 1O2RA 2RCEA 2VVUA 3AAUA 1CT4E 1O2LA 3GS9A 1O5BB 5C17A 3K6YA 1W13U 3RXFA 2ZFRH 1A46H 3E90B 1KYNA 1LCYA 1SHYA 1O2WA 2ZFTA 1LVOA 1AGJA 4DY7B 1IQIA 2BDYA 4CHAC 1SGIB 1H9LB 2UWPA 4K1SA 4XFQA 4NIWA 1UO6A 1ZSLA 1HYLA 3QN7A 1BIOA 1C1QA 4WF8A 4FUGA 1SQRA 1BTZA 2HLDD 4GHTA 3M36A 1C1NA 1GBDA 5AVDA 3BEUA 3FO8D 4I31A 5DK1A 2W5EA 1HV7A 4AFSA 1O2KA 2VWLA 4KKDA 3M5MA 1LO6A 3BTME 3TK9A 3HATH 4JMYA 3ZVDA 1SL3A 1F5RA 5TCAA 2H5DA 4CBNA 4BAQB 1UMAH 3PMAB 3ZVFA 3P92A 5HYOA 1L1GA 1VCQA 1GHBG 1DWCH 3FZDA 5JB9S 1YWUA 5JBCS 1C5VA 1E37B 2PGQB 1AMHA 1O3JA 5JYIA 2OUAA 2IPHA 6GCHG 2IJD1 2ZIQH 4A7IB 1SQOA 1YY3A 1NESE 2BZAA 1UTPA 4WH6A 5EJLA 3A82A 2HNTF 4BAOB 3A7ZA 1HAXB 4JK6A 2Q6FA 1ELEE 1VZQH 1H9IE 2QXGA 1NRSH 3SGQE 2G5VA 1FX0B 1SC8U 1W3CA 4BXWA 1QB6A 1TBQH 2A7CA 2D26C 4CHAB 1JIRA 2WV9A 2P59A 2PTNA 3N99A 1GBTA 4Z1MD 5F8ZA 3SV6A 3T26A 2BDHA 2PSYA 2KAIB 1C5MD 2BLQA 2PR3A 1HXEH 3SJ8A 2BQ6B 1MABB 1CQQA 1PJPA 1TRMA 2ZCKP 3RXKA 1DLEA 3SUFA 1AIXH 1O2TA 2XWBI 3UR9A 1MBMA 2Z9KA 5L30H 1DSUA 1SBWA 1QJ6B 1C5SA 2J9NA 2FESH 3KF2A 1Y3WA 1G32B 1P10A 2BD3A 2HNTC 2J95A 4ABEA 1GJAB 2QXIA 6ESTA 1Y3YA 1YCPM 2RA3A 1OX1A 2GVFA 1C2MA 3UB0A 1S6LA 4RKJB 2KM0A 2BD9A 3GCTG 2I6QA 3QK1A 1C1WH 3WWBA 5IYTA 4ABFA 1GGDB 4Q80A 2GX4A 1ZYOA 1DFPA 1F5KU 4A6LA 2PV9B 3M5OA 1C5NH 2ANYA 1TNKA 1PPEE 7ESTE 1QB9A 1A5IA 3T25A 2ZFPH 1XX9A 2JIZD 4GUXA 1K9OE 1O3KA 2QXHA 3LOXA 1DSTA 5A09A 2P94A 2I6SA 3GY6A 1CE5A 1W2KH 2JH0D 1P9UA 1B7XB 4FUCA 4BTUB 2OBQA 3MYWA 2R3YA 3IWMA 3V3MA 3B23B 5T1VA 4DGJA 3FP6E 4JZ1A 2OLGA 2J92A 2DE8A 2WPDD 4TY6A 3PV4A 1ESTA 1XKBC 3PMHB 4U2WA 5GDSH 2UWOA 4KTSA 1DVAH 4AGKA 2ZA5A 3MNBA 2KAIA 3OY5U 5CE1A 2ZTYA 1T8OA 2WPMS 4B6EA 1P3CA 1ARCA 2HALA 3GY3A 1RD3B 2B5TB 2BVXH 2CF8H 2BVSH 2XW9A 2FXRA 1ZR0A 5K0HA 4MPUA 1C2EA 2AYWA 3ZZCA 3SJ9A 3C1KA 3F2FA 4Y8ZA 5DGJA 1BJUA 2WYJA 5C5NA 1HRTH 1C9TA 1LHCH 3E0PB 3SORA 2Z9JA 1NRQH 1MBQA 1THSH 3F3BA 2TPIZ 2ZFSA 1C5LH 1E34B 1RFNA 1T31A 2A4RA 2KFWA 2W6ID 4Z0KA 4UFDH 1O3NA 2VGCB 2PTCE 3A88A 4MLFB 4MPVA 1H8HD 3ZV9A 1Y3UA 1T8MA 1V2PT 2SNWA 4YOIA 4E06H 2GD4B 2ZHWH 4WJG2 3SU1A 2H5CA 4B71A 2VBCA 1C5UA 1WDIA 2R3UA 1UTMA 4D9QA 1LPKB 2D2DA 5DJ7A 1MKXH 2SGAA 1O2ZA 2LNCA 2W3KA 1ZJKA 5CMXH 1K22H 1O2YA 2JDID 3I77A 4GLYA 4LXBH 4AGJA 4CR5A 1YPKH 2PKSB 4ABBA 3R0FA 1TOCB 3BTKE 1C5YB 3DUXH 3F2GA 4JZIA 3UPEA 3VB5A 1FIWA 3HKJB 4Y71A 5EXMA 2GZ7A 5IDKA 2BDIA 5DP6A 1EOJA 1Y3XA 3SHCH 2BVRH 1T8NA 1T7CA 1MU8B 2GV7A 1TNIA 1ZPCA 2FLRH 5LPEA 3QLPH 1BRBE 3DFLA 3AAVA 1SG8B 3QWCH 3L6PA 4O97A 1GMDF 4Z6AH 1C5ZB 5C94A 4BAHB 1EATA 4WWYA 1ZJDA 2J98B 5EPNA 4NSYA 3BTTE 2OXSA 3CS7A 1TNHA 3ZZ9A 1A7SA 2RFKC 3SN8A 2ZCHP 3DHKH 2A45B 3RXBA 1SLWB 1W0YH 1KXFA 3ZZAA 5GWZA 1C1UH 4ASUD 1O2JA 1OP2A 1S82A 1P9SA 3BV9B 1GI4A 4R0IA 1C2LA 4GAWA 1BTXA 3SU3A 4FUJA 1PPZA 2Q1JA 3G01A 2FOEA 5EW1H 4CRFA 2YMSC 3GY8A 2RDLA 4Y79A 5GPIB 1LKAA 2FI4E 3RXQA 1SGQE 1GBEA 1BTUA 1HPGA 1O2VA 4HGCA 1QZ8A 1EPTC 4O03A 3OE7D 3SUEA 1FY8E 3PTBA 4IN2A 3KGPA 4GCHF 2C3SA 3UQVA 4NFEA 4YT6H 8GCHF 2G4UA 3SU2A 1BTWA 4GVUA 4BAKB 2ALVA 2EA3A 1C1VH 1DICA 2TIOA 2ZG0H 1HUTH 3Q3YA 4Y0ZE 2ESTE 4E7RG 1A0HB 2ZFFH 5C2ZA 1MTNC 3KCGH 5BRRE 3VXEH 1O3FA 2ZTZA 1COWD 2XOKD 1E1QD 1TYNA 3SNBA 1BQYA 1HGTH 3O8DA 1ANDA 2Y6TA 4WVPE 1TAWA 4IN1A 2FPZA 5C1UA 3IITA 1VCPA 2BLOA 2A4GA 1QR3E 2CF9H 4IS5A 1E0FD 2BHGA 4XOJA 5HGGA 1D3QB 3A85A 2VJ1A 4FUDA 2J98A 4I32A 3M5LA 1HB0B 3MH6A 3HGNA 2Z9LA 1ZSKA 3T29A 1NO9H 1GCTB 1FDPA 3ZYDA 2P3UB 5CHAC 2C8XB 1EZXC 1K1LA 4CRDA 1VGCB 1DITH 2J38A 2VIVA 3ODDA 3M5NA 2AS9A 2G81E 1P06A 1EPTB 4WMDA 3U8OH 1L4ZA 1GBMA 3TGIE 1GBHA 2SGFE 1Y8TA 2FODA 3FZZA 2F9VA 1GMHF 2BM2A 1VITG 2Z94A 2ZNKH 3PLKA 1PFXC 2NU1E 3D23A 4TYDA 3NKKA 1RS0A 1SPJA 1XUFA 1TMBH 2B7DH 3KHVA 5GNDA 1F92A 3TJUA 2BB4A 1Z8IB 2F4LA 1LPGB 1PQAA 1FZZA 3E91A 2Y5FA 5T6GA 2R2MB 3RXMA 1D3DB 1ZGVA 4XRNA 1ZHRA 4OM9A 3ZV8A 1O3PB 1TB6H 3ZZBA 1ETRH 1CSOE 3SNCA 4F48B 1O5EH 1UCYK 4ZKRU 5TCCA 1N1LA 1TGTA 5EODA 4UE7H 1JRTA 1O3EA 2O8TA 4DT7B 2BD4A 4RSPA 5JPMH 3S69A 1O31A 3E8LA 3A89A 1GHBF 2FOAA 2ZCLP 2F3CE 3STJA 3V7TA 1ABJH 3A7VA 4LK4A 1E36B 1F7ZA 2H9TH 1X7AC 3I29A 8LPRA 1EFRD 2HOBA 3OTPA 2J94A 2XWAA 3M3SA 4B74A 4CRGA 3E1XB 1GBBA 3QZRA 1FIZA 2F83A 4HG6A 1L4DA 1HNEE 3LH3A 3O8BA 1G3BA 2LELA 4XBDA 5FXLA 1O2MA 1UHBB 3LC5A 1XMNB 3EE7A 1QIXB 5E8EH 3PRBA 4Q63A 7GCHG 4ABHA 3AW1A 1EPTA 3QX5H 1FPCH 2VIWA 1GL1A 3GY7A 1TGNA 3SOSA 5C67A 2WHXA 2WPKS 2OD3B 1OSSA 2GZ8A 1QB1A 2BLWA 2Q6GA 2KR7A 3IG6B 2AMPA 1UTQA 4WXIA 2FOFA 2QC2A 2SGQE 2A32A 4U30A 1ELCA 2Y80A 1QRXA 3SQEE 3BTEE 3Q3KA 1H4WA 2IOTA 3GCTF 1P2QA 2FS9A 4MDSA 1P01A 1KXAA 2WINI 1A0LA 1MMJN 4X6PA 1KLJH 1UVOA 2BD7A 1BITA 3SJOA 3RXOA 2QIQA 1O5DH 4Y76A 1DX5M 1TPAE 1WAYB 2CXVA 4GHQA 4ESTE 5ESTE 2ZI2H 5FPSA 2BD5A 3OEED 4JZEH 1MQ6A 1MKWH 2PLXA 4FETA 1BRCE 2XTTB 3MO6A 1BA8B 3LDXH 3UREA 4NZQA 1RXPA 2ZHEH 2HRVA 3A8CA 3GCOA 4NG9H 4RI0A 3WWFA 1CHOG 1F0RA 3VGCB 5GJ4B 4KGAA 5DSFA 1GHZA 2F9BH 3FFGA 3K2UA 4NWKA 4X1NU 4YOGA 2CHAC 2K8IA 1C5QA 2EEKA 4CRBA 4TWYA 3BG8A 1C1SA 1TNLA 3RUOA 3M3TA 3PV5A 2FI3E 2QF3A 3GOVB 1XVOA 3ZIAD 5L2ZH 2H9HA 1KXBA 4MQAA 1A61H 5F6MA 2ANKH 4AZ2B 4WH8A 2AH4X 1CA8B 2YOLA 4I8KA 2PFEA 1C5OH 1UHBA 2VWMA 3L3TA 3MU4A 3BTDE 2FOGA 3RXDA 4AYVB 2NU3E 1JOUB 1ORFA 3N7DA 4OS6A 2A7HA 1TA6A 2QE7D 3AVZA 3P6ZB 1ELAA 5GCHF 2JJ1D 2CK3D 1H8ED 1C5PA 5T6FA 1V2TT 4D9RA 1QL9A 3A84A 5FL7D 4AFZA 1TE0A 3M37A 1BBRK 5T3HA 1MUEB 1O5AB 1DUEA 4Y7BA 2XBWA 1EJMA 1MD8A 1O2SA 1OWJA 2QF5A 2FOMB 3BIVH 4K5ZA 4WXVA 1ESAA 3UWIA 1CO7E 1TALA 2ZQ2A 4YM9A 2SGDE 4K60A 4FU8A 3GDVA 3MH4A 5DP5A 1AE5A 1LHFH 2UUYA 2LP6A 3RU4D 3LJOA 3TPIZ 2ZTXA 4DOQA 1C1PA 3SYJA 3DD2H 1THRH 3CP7A 1G3DA 2P3FH 3RC4A 1EP6A 2BXUH 1XUJA 2P8OB 4DW2U 2WZQA 2GCHG 4MNYA 1LTOA 3F9GA 3P8GA 4IMZA 1O30A 1TX6A 1PPCE 1RRKA 1UK3A 2R9PA 4X6NA 1LVBA 1FY3A 3SU0A 1FY1A 2G00A 2WYGA 2GT8A 5A8YA 4F55A 4K1TA 1GI7B 1W12U 1O3LA 1NFXA 2GCTC 1AFQC 1XUKA 3TJOA 2HPPH 5AHGH 4D7FA 4ZHLU 1EAWA 2ZZUH 1XKAC 3SU6A 1GHYH 1HXFH 1A5HA 4NCYA 4ZMAH 1NN6A 1NBME 2ODYB 3UFAA 2WPIS 4ZKOU 4YOJA 1IHTH 4KTUA 4NFFA 5DG6A 3MU8A 5H4IB 2BQWB 1PPGE 4X1SU 1XXDA 4ACBA 4XBBA 1SB1H 2P3TB 1W7GH 5AFZH 3A81A 5DP4A 3E0NB 1O3IA 1TPPA 2AERH 5AF9H 5B6LA 1C4Y2 1NFWA 3A87A 1J9CH 1AUTC 2A5AA 1ZMLA 1P2NA 2NU4E 4I7YH 1U6QA 1ZGIA 4FUBA 1TGCA 1W0KD 4FUEA 1V2RT 1O2QA 3UNRA 3ZZ4A 4VGCB 4JZFH 1Y59T 2QCYA 1DANH 2BDCA 1C1TA 1NRRH 1GI8B 1ZTKA 5C0TA 1UVPA 3PMBB 3PMJA 4AFQA 1ACBE 1C5WB 1PQ7A 1C2KA 2JETC 3DSPA 1A0JA 3Q76A 3TIUA 2W3IA 2TBSA 3RU4T 1YLDA 1ZLRA 1AFQB 1EOLA 1YGCH 4X8TH 5TJXA 1GHAG 1P57B 2ZGJA 1AD8H 4B75A 1MZAA 4AYYB 2Z3CA 1SQAA 3S9BA 3MO9A 1TNJA 1G36A 1YPGH 3ESTA 3PB1E 2K1QA 2A5IA 3RMOH 4NA7A 1EP5A 3HK6B 1G37A 2AMDA 1DWDH 1OYTH 1SGRE 2OINA 2TGAA 2W26A 2VIQA 2ZFQH 4INLA 2PUQH 2BD2A 5LPFA 1BOQA 4BNRA 1EX3A 1K1NA 1YYY1 2ZDKA 1NT1A 3KQBA 1O2HA 1GBCA 4FU7A 2GZ9A 4D76A 4HZHA 1Z6EA 5EJ1A 3H7OA 5EXLA 3DSOA 1GHXH 4YXWD 1N8OC 2G52A 5KEDA 4RT1A 2C8ZB 5GIBA 1SLXB 2BY6X 1AN1E 5DPAA 3LJJA 1VITF 1VITH 3GY5A 2FZZA 1ZOMA 2FWWA 2YMSD 2FM2A 1HFDA 5EU8A 1DWEH 2ZU3A 2JETB 2P16A 4A92A 2M5TA 2GGVB 2ZU4A 5EQRA 3SHAH 2XCFA 1ESBA 3TH3H 1BCUH 1DLKB 1O33A 3N7EA 1V2NT 1V2OT 4DVAU 2ZGHA 1BHXB 2ZKSA 1HAIH 2FLBH 3OY6U 3MH5A 1TNGA 2VU8E 2EC9H 3KYGA 1SKYE 4B6FA 2ZP0H 4MVNA 3HK3B 1GVZA 4TT3D 3M7UA 1Z1IA 4A1TA 5ETXA 1S81A 1WV7H 1RGQA 2NU2E 3DFJA 4ISLA 3GISB 2R0KA 2JH5D 2STBE 4XSKU 4ZH8A 4WMFA 1UTKA 4BXSA 2A31A 3F6UH 1DM4B 5A8ZA 4IMQA 2OC7A 3P8FA 3ATWA 3MOCA 1OWHA 1Z71A 1T4UH 4JK5A 3QTOH 3AK5A 2VH0A 1QRZA 5JDUB 3FOAA 1KTTB 4AFUA 3WY8A 3BTQE 4MNWA 3T27A 2A0QB 1AWFH 3RXEA 4HFPB 2Y7XA 2Y5HA 3ZVAA 1SVPA 1Y5BT 2KCAA 3WW7A 4JYUH 4ACAA 2J97A 5E0GA 3SNAA 1QJ7B 3OSYA 3UNQA 2BXTH 5JB8S 1BB0B 2VINA 4UD9H 5E2PA 1UCYE 3U8RH 2RDEA 1J16A 1ANBA 1D4PB 4AN7A 3SGAE 3OEHD 3TK6A 4Y8XA 1F0TA 1IQFA 1GJ5H 2BTCE 2P93A 3MI4A 3U69H 5A0AE 3A8AA 1SGEE 1H8DH 2ODPA 5A0BA 1NRNH 1W8BH 1S83A 1C9PA 3SW2B 2TGDA 4FUHA 3RXVA 5GXPA 1HJAC 3H7TA 4I8JA 1JBUH 3EDXB 2Y7ZA 1J8AA 1C5XB 3KQCA 4YLUA 4B76A 2WUBA 3KYFA 4K3JA 5E0HA 2CN0H 4CBOA 1SLUB 2V0BA 1FPHH 1CHOF 1DXWA 3SUDA 1HLTH 5C0UA 1TOMH 1MZDA 2ANWA 2SGEE 3RMNH 2HVYB 2WPLS 1YF4A 2ZDLA 1UK2A 1P2IA 4SGBE 3W94A 2FOHA 3ZVGA 1Z8GA 1B5GH 1PPHE 1G2LA 1L2EA 3MQKC 3S9AA 1WTHD 3E3TA 3H5CB 3KQ5A 1O39A 8KME2 3GCHC 3QDZB 4NIXA 3U1IB 4BANB 1FV9A 5HM9A 1GDUA 2ANMH 2Z3DA 3ATIA 2GJGA 1C1RA 2ZC9H 1GMCG 4OS2A 3M35A 1O2OA 2PSXA 3Q3XA 4NA8A 1LPZB 1F0UA 1WTGH 4TPIZ 3FVFB 1VJAU 3ZZ3A 1QBVH 5E0JA 1H9HE 3KIDU 1LHEH 3ZZ7A 4HI3A 5F8TA 1C5TA 4BOHA 5FHTA 1O2GH 3P8OA 1OWDA 2BD8A 3TK5A 2Z7FE 1BT7A 2J2UA 1ZHPA 2AIQA 1EUFA 1O5CB 5A0CA 2A7JA 1XUGA 4X0WU 4LZ4B 1P2OA 1XXFA 1SMFE 2ZEBA 4ABDA 3LGWA 4O9VA 3FANA 2VIPA 2WV5A 4I8LA 1Q3XA 2DUCA 1UJ1A 1OWKA 1HJ8A 5EJZA 3SI3H 2UUFB 4B2CA 3V0XA 3M7QA 1O3OA 3LGUA 5C1XA 1FN6A 2ZO3H 1C2JA 1PYTC 1CU1A 2L74A 1WQSA 2TGPZ 2JKHA 1MTWA 1GBKA 2GCHF 4GPGA 1KY9A 2ZPRA 3EQ0H 1GDNA 4KP0A 3GCHB 2QAAA 2YMSB 4Y0YE 4KELA 1UTNA 2OC0A 3RXPA 1O2IA 3LGTA 2SFAA 2F9UA 3VB6A 3QZQA 1KTSB 1O3CA 1CBWC 3A7XA 2ZF0H 3FKSD 1RJXB 1KSNA 3U1JB 1BBRE 2H6MA 3BG4C 2FYQA 3T28A 1CA0C 2XC5A 3NK8A 3GICB 2KCOA 1JWTA 1C2GA 1O34A 4E05H 3KNXA 4UONA 2V7QD 1HAOH 3GYLB 1FJSA 3ATKA 3SJIA 1A5GH 1GVKB 2XBYA 4Q2KA 1CHGA 4I8HA 4NGAH 4UDWH 3VFEA 2FIRH 3LIWA 1MTNB 3RC6A 2PP6A 1SFIA 2F9NA 3P95A 4U32A 3BTWE 1O37A 1QURH 2ZPSA 3F9HA 1QNJA 4ZAEA 1VJ9U 1NM6A 2UWLA 1HAZB 3QGNB 4ABIA 1DUAA 4U01A 5C3NA 1SGYE 2OP9A 3RXAA 3TITA 1EZSC 1SOZA 1XVMA 1WU1A 1SQTA 2V3HH 6GCHF 1QBNA 1J14A 1EXFA 1FMGA 1FXYA 1H1BA 1SLVB 4MG3A 1ID5H 4KTCA 5CHAB 1VR1H 3F68H 3UIRA 5A2MH 3M61U 2OQUA 2Z9GA 4F4OC 4X6MA 1HJ9A 2EQNA 1A2CH 2BOHB 1OWEA 1GBIA 4Y6DA 1EAUA 2PHBA 4DT4A 3CS0A 4RN6A 1DE7H 2W6JD 3MNXA 5EQQA 1NC6A 4LZ1H 1YLNA 3QO6A 1GHAF 2GTBA 3SV8A 3STIA 4ISNA 2WPJS 4IW4E 4ZKSU 2Z3EA 3BN9A 1W14U 2STAE 1W0JD 5EG4A 5BPEA 2Y82A 1EAXA 1G3CA 1OYQA 4AC9A 1P09A 1S0QA 1EB1H 3MWIU 5PTPA 2RA0A 5B6OA 1QQ4A 1TX7A 2VVVA 1QA7A 2CGAA 1Z6JH 2F9OA 1ETTH 1J17T 1TONA 2O8LA 1A3EH 6CHAC 2KZ4A 1TQ7B 1W10U 1ZMJA 2P95A 5SGAE 1AU8A 1TWXB 3PTNA 4IC6A 4YLQH 8ESTE 9LPRA 1E38B 4AORA 1YPLH 2GMTC 1C2DA 3CNRA 1UTOA 3VG8A 1TBRH 5IK2D 1O3AA 1Y5UT 1ELDE 4CR9A 4DIHH 3P70B 4GSOA 5DO4H 5EOKA 1Q31A 4DJZB 3A8DA 1MTVA 1QL8A 4AG2A 3M3VA 1P02A 1QHRB 1TA2A 1C2IA 2AGGX 2ODQA 3OTJE 1A3BH 1AE8H 1C4V2 4JCNA 1MTUA 1YCPK 1Q2WA 1DS2E 1BTYA 5ESBA 4JYVH 5FPYA 5F53A 1DT2A 1GMDG 3OX7U 2O9QA 1A1RA 1NS3A 1WOFA 4ZKNU 1HBTH 2ZGCA 4NIYA 3K65B 1P2KA 1QTFA 4NSVA 1T4VH 1GG6C 2FMJA 5DP7A 1LVYA 2EI7A 1D3TB 3W95A 5A8XA 1DXPA 1K28D 1WCZA 2G55A 2QGRA 1V2LT 1QRWA 2ZDAH 4NA9H 3RXUA 3B8JA 1DWBH 1SR5C 3GDSA 1BJVA 2EI8A 2ZGXH 3QUMP 4H42U 1LQDB 4D7GA 1UVTH 3EA7A 2ZECA 3D49H 4INKA 3HKIB 3SU5A 6CHAB 2QF4A 1SGDE 3BF6H 1ZZZA 3QTVH 4MTBA 1V3XA 1E35B 1O32A 4M9FA 2GMTB 1EKBB 3P8NA 5FBIA 1SHHB 1Z8RA 1INCA 1CT2E 4IGDA 2C4FH 2JJ2D 3GY4A 1GI5A 1LQEA 3RXGA 2XNIA 4ZHAA 1A4WH 3F0PA 1HDTH 3KEEA 4FUIA 1P3EA 1ETSH 1UK4A 2ZHFH 2QXJA 2ZDVH 1C2FA 3BEIB 4Q7ZA 2CHAB 3BTFE 1SGCA 3KQDA 4NIVA 1PQ8A 2IJOB 1TQ0B 1WYKA 3PWCA 3PROA 1IQKA 2G5NA 5L2YH 1UTJA 3KN2A 1T8LA 1DDJA 1SGTA 3SO3A 2DE9A 1YC0A 2EY4C 1YPHE 4DURA 1AHTH 1UCYH 3JZ2B 1GG6B 3VPKA 3S0NA 3OYPA 2SNVA 2ZWLH 5JBBS 3T62A 1LDTT 2H9EH 2ZDMA 1P11E 1BUIA 4ASHA 2HVXA 2VB0A 2WUCA 3ENSB 1GJCB 2PKAB 1F0SA 2BMGB 3FAOA 3RMMH 2CMYA 2XC4A 3URDA 2XYAA 2BZ6H 3NRLA 3TVJB 3ZZ6A 1AZZA 3ODFA 2J5UA 1B0FA 1P03A 1NPMA 4OS5A 3C27B 4P00A 3GDUA 5E2OA 2UUJB 1GMHG 2FTMA 1V2WT 3SNEA 1CVWH 3A7TA 2ULLA 1EQ9A 5EPYA 2BLVA 1C1OA 1V2QT 1EAIA 2TRMA 1GBLA 3PO1C 2ZU1A 4INHA 2PWXA 2CV3A 3TNTA 2B8OH 2BY7X 4WY3A 1DOJA 3BTHE 4MNVA 1TLDA 1CGJE 1YPMH 2SGPE 1MKXK 3LH1A 5G4BA 3UOUA 5DKMA 4B2AA 3V13A 5LH8A 4P02A 4UEHH 1TPOA 4LOYH 3T5FH 4TY7A 1GMCF 4H4FA 4X2YA 4X8VH 1BMFD 2FI5E 2A2QH 3ZZ8A 1NY22 2XRCA 3DSGA 3LPRA 4UFEH 2NWNA 4ZXXH 2GKVE 3UQOA 1F5LA 1AVWA 1VKYA 1BHXF 1AUJA 1K0HA 4SGAE 1GGDC 1GDQA 2KX4A 1Z7KA 2GCTB 2H2ZA 4FVDA 3S9CA 3ZZDA 1MH0A 3SU4A 3SUGA 4A1XA 5LGOA 2AEIH 1WXRA 5DN6D 3ZVEA 1NU7B 5KECA 1WUNH 3Q77A 1ANCA 1FAKH 2PKAA 2HGTH 2A1DB 1K21H 1YPJH 2FOBA 1RTKA 3MU0A 4X8SH 2XCNA 1O2NA 2XC0A 3GYMA 2F9PA 1TX8A 4OGXA 1MCTA 2KCYA 5LPRA 3AW0A 4I33A 1GHVH 3NPSA 3PO1B 5FPTA 1YCPH 3PLPA 3BTGE 1MD7A 3H09A 4ISHH 4UFGH 3K9XB 1C4U2 3F0OA 1GI3A 1YKTA 3QGJA 1S5SA 1SOTA 2BDAA 1OOKB 2QYIA 1NTPA 1OS8A 5C20A 3EA9A 3D65E 1ELBA 2ZU5A 4X1QU 2VH6A 3MNSA 4RKOB 5FX5A 4B73A 3KL6A 1MQ5A 1AWHB 4M7GA 4X1PU 1P2MA 3NXPA 1TABE 4K69A 1HCGA 1BBRH 1ZTJA 2B9LA 1THPB 3NZIA 1Z8JB 1ELGA 3U98H 3RXRA 3TGJE 1SGFA 2VGCC 3ITIA 2G4TA 2H1UA 1FY4A 2AIPA 2ZHQH 1OWIA 1B0EA 1OPHB 3TH4H 4IBLH 1QFKH 3TLOA 3MO3A 1MTSA 1O3DA 3HGPA 2QN5T 1PPBH 1DY8A 1GJ9B 2O8MA 3TJVA 6LPRA 1HAVB 1MU6B 1TRNA 1O2UA 2AGEX 4MPXA 2OK5A 1AO5A 1C1MA 1O0DH 3MH7A 4XE4A 3PYHA 1NRPH 2M2AA 1AI8H 1W11U 2XNDD 1IAUA 1QQUA 1CGHA 1GHWH 1S85A 1SFQB 3BIUH 5C5OA 1KXDA 1TPSA 1AFEH 2PKSC 3O8CA 1O5FH 1ZRBA 1AY6H 1OHHD 1GJ7B 3EYDA 4ZROA 2XBXA 5FCRA 1N8OB 1PYTD 2VVCA 1JXPA 1V2VT 1GL0E 1QL7A 4FU9A 5GCHG 4FOUC 3LGIA 3UNSA 4B2BA 1OP8A 3W1EA 2BDGA 2PW8H 2BOKA 3RXTA 2Z9IA 5T6DA 7GCHF 1L0ZA 4YO9A 5DP3A 2FYRA 2J4IA 4JYTA 4AOQA 1QBOA 1FAXA 1QCPA 3RMLH 3TNSA 1XUIA 4H6SB 3HPTB 1PPFE 2FDAA 3KQEA 3LC3A 1N6XA 1SGFG 4DG4A 2UUKB 4A5TS 4CRCA 4WMEA 3SBKA 7KMEH 1ZPZA 5HKKD 1QGFA 2ALPA 2W7UA 1EZUC 1EASA 3B9FH 3F9FA 3MTYA 4CREA 1DPOA 5FX6A 1TMTH 4ISOA 4YZUA 3V12A 2G8TA 4JZDH 1FQ3A 3M7TA 1O3GA 3E6PH 4FXGH 3S7KB 3ZVBA 2FX6A 1ABIH 3EE0B 1EZQA 1AVXA 4J2YB 1OKXA 1V2KT 4YTAA 1AKSB 1LVMA 3SJKA 1O3HA 1LHDH 2FTLE 1NU9A 1HAVA 1O38A 1HAPH 4A1VA 3UUZA 3FN8A 3L33A 3NCLA 2FX4A 1G9IE 4RT0A 4K1EA 1XM1A 2J34A 5ABWA 1P8VC 1FI8A 1E79D 1ELTA 4CRAA 1KXEA 2C8WB 2ZHDA 1D3PB 3SQHE 4XD7D 9ESTA 1GBJA 1FN8A 2ILNA 3SGBE 4I8GA 5F03A 1D6WA 1NBMD 4HTCH 4O3UA 3EA8A 2QV1A 4BAMB 1GI2A 2XBVA 4I86A 3RM2H 1BMMH 3R3GB 4YESB 3ELAH 4O3TA 1G2MA 1ANEA 1GI6A 2OC1A 2F43B 2RG3A 2F91A 1GWAA 2A5KA 1TGSZ 1P05A 1YLCA 3RDZA 1GBFA 3DA9B 1GJDB 4ABAA 1E1RD 1O2PA 1GCTC 1TMUH 2HNTE 3LONA 4XDEA 4IC5A 3N7OA 5EXNA 3NUMA 3ATLA 4F49A 1AQ7A 1FONA 1VGCC 2C90B 4X1RU 2ASUB 2GDDA 3MNCA 1KLTA 3SZNA 4K2YA 3VB3A 5I25A 5KGOA 2FS8A 1HJAB 1MKWK 2GDEH 3SV2H 3SV7A 3A83A 4DIIH 1N6YA 1KIGH 2A4QA 3RU4E 2R0LA 4TWWA 3VB7A 1LMWB 2LPRA 2WPHS 2OTVA 1W7XH 1LKBA 2O8UA 2OCVB 1AKSA 1EJNA 1P0SH 4X6OA 4AB8A 1KLIH 3OU0A 2VIOA 4Q7YA 3UAIC 3RLWH 3A80A 1NZQH 1BZXE 1UVUH 3UWJH 1ELFA 3RXSA 1GBAA 1FY5A 2R2WU 1O3BA 1UTLM 1TIOA 2QF0A 2BY9X 2VIDA 2D1JA 4Q7XA 1KDQB 1YPEH 1V6DA 1K1PA
chains in the Genus database with same CATH topology
1PQ5A 1UVSH 2V35A 3LGYA 1OXGA 1SGPE 2ZPQA 5HM2A 5L6NH 3EGKH 1VCWA 1S6FA 5I46H 5J4SA 1IQJA 1JMOH 1EJAA 4PROA 3RXLA 4X2XA 1YP9A 4CH8B 1IQGA 1XUHA 2FO9A 1GVLA 2W7SA 3Q00A 7LPRA 1GI9B 4J1YA 1MCVA 1DY9A 2A2XH 3ATMA 4ZXYH 3UY9A 1GJ6A 1V2UT 3AASA 2D8WA 2YNAA 3MU5A 3U8TH 3BSQA 1GI1A 3UOPA 2VWNA 2ZGBH 4NWLA 1T32A 3RXJA 1ZHMA 1BTHH 2YNBA 1L1JA 3LU9B 3VEQB 2BY5X 4XBCA 4YT7H 2FEQH 2CJIA 1YPHC 1AB9C 2V3OH 2QA9E 1NFYA 2ZU2A 4ABJA 1RTFB 3RXCA 3UTUH 2Y81A 1OP0A 3F9EA 1ZPBA 1QA0A 4AB9A 5JBAS 2BQ7B 3PLBA 1C5RA 1L1NA 4X2WA 4Y10E 1IQHA 3F1SB 1S6HA 1CBWB 2GP9B 2BX4A 1K2I1 1TBZH 5C1YA 3FP7E 1SGNE 2BYAX 2WV4A 1FUJA 4ISIH 1TRYA 3BG4B 1KDQA 3RP2A 1K1OA 1RIWC 4CH2B 1CA0B 3SNDA 5EQSA 1W0ZU 1V2MT 2VWOA 5FCKA 2B0FA 2TGTA 4UFFH 2PGBB 1HAGE 2OC8A 3MMGA 2OQ5A 4THNH 2EI6A 2JH6D 1SI5H 5F8XA 1V2JT 1ZSJA 4OGYA 4K8BA 4K8YA 4Y8YA 1ELVA 1BTPA 3BEFB 4BTTB 3VGCC 1K1JA 4Y7AA 1AZ8A 5EW2H 1JIMA 3MU1A 1P12E 1TFXA 4ZHMU 4Y11E 4NZLA 2V6NA 2AGIX 1S0RA 2HWLB 1HIAB 2XXLA 2IN2A 2QY0B 1Y3VA 5DP9A 1AB9B 4R8TB 3E16B 2HPQH 3P17H 3DT0H 1ARBA 1IQEA 2PUXB 3ZVCA 5J4QA 4ZUHA 4DCDA 1ZTLA 2HLCA 1IHSH 4TPYA 3JZ1B 4FUFA 3PM3A 1BRAA 1ZRKA 1K1IA 1F2SE 3MHWU 3FP8E 1LHGH 1YBWA 5HXFA 1H8IH 1O3MA 2Z6BD 1MAXA 1MAYA 2OBOA 3S7HB 1GJBB 2A4OA 3A8BA 3RC5A 4OS4A 3SV9A 3MFJA 1K1MA 5FAHA 1IOEA 1SSXA 3ZYEA 2G51A 1O2XA 2THFB 1RIWB 1P04A 1KXCA 1S84A 4FVBA 1O5GH 5EGMA 3U9AH 3RM0H 4MNXA 4AG1A 1IQLA 2GV6A 5FBEA 2BX3A 1BMAA 3ZZ5A 2AFQB 3LKWA 1FLEE 1IQNA 1JRSA 4X8UH 2O8WA 1NROH 4B1TA 1C2HA 3PWBA 4E7NA 2FOCA 2P8OC 3A7WA 2BY8X 3TU7H 4OS7A 3GY2A 5K7RA 2ZQ1A 1QY6A 3VB4A 3EAJA 3UR6A 4D8NA 4H6TA 2Y5GA 1BDAA 1G30B 3CENA 1RTLA 1CT0E 1M9UA 3TGKE 1HIAA 1D6RA 5JBTA 1BMLA 3RXHA 3RLYH 3LGVA 4GCHG 4ABGA 3GCNA 1G3EA 2C93B 3I78A 8GCHG 2AMQA 2C8YB 3A86A 3D62A 1HAHH 4OS1A 1GJ8B 1ZMNA 2GT7A 4CR9A 1IQMA 5AFYH 2ZDNA 4BTIB 1V2ST 1AVGH 2FP7B 3LT3A 2NU0E 1GI0A 3NWUA 1P2JA 1WQVH 4X2VA 1BMNH 1WSSH 1O35A 2BDBA 1TGBA 3O8RA 1EB2A 1FNIA 4MPWA 1Y5AT 1GJ4H 1O36A 3TH2H 1CGIE 1BRUP 3TJNA 1J15A 1GCDA 1NFUA 2Q6DA 3A7YA 1GPZA 3SI4H 5HMAA 3T2NA 3K6ZA 3URCA 1Z1JA 1D9IA 4QT8C 4AX9H 5DP8A 1YM0A 3RXIA 1WBGB 2VNTA 4VGCC 1HAYB 3VXFH 1QJ1B 1O2RA 2RCEA 2VVUA 3AAUA 1CT4E 1O2LA 1O5BB 3K6YA 1W13U 3RXFA 2ZFRH 1A46H 3E90B 1KYNA 1LCYA 1SHYA 1O2WA 2ZFTA 1LVOA 1AGJA 4DY7B 1IQIA 2BDYA 4CHAC 1SGIB 1H9LB 2UWPA 4K1SA 4XFQA 4NIWA 1UO6A 1ZSLA 1HYLA 3QN7A 1BIOA 1C1QA 4WF8A 4FUGA 1BTZA 4GHTA 3M36A 1C1NA 1GBDA 5AVDA 3BEUA 4I31A 5DK1A 2W5EA 1HV7A 4AFSA 1O2KA 2VWLA 4KKDA 3M5MA 1LO6A 3BTME 3TK9A 3HATH 4JMYA 3ZVDA 1SL3A 1F5RA 5TCAA 2H5DA 4CBNA 4BAQB 1UMAH 3PMAB 3ZVFA 3P92A 5HYOA 1L1GA 1VCQA 1GHBG 1DWCH 3FZDA 5JB9S 5JBCS 1C5VA 2PGQB 1E37B 1AMHA 1O3JA 5JYIA 2OUAA 2IPHA 6GCHG 2ZIQH 4A7IB 1SQOA 2BZAA 1NESE 1UTPA 4WH6A 3A82A 2HNTF 4BAOB 3A7ZA 1HAXB 4JK6A 2Q6FA 1ELEE 1VZQH 1H9IE 2QXGA 1NRSH 3SGQE 2G5VA 1SC8U 1W3CA 4BXWA 1QB6A 1TBQH 2A7CA 2D26C 4CHAB 1JIRA 2P59A 2PTNA 1GBTA 5F8ZA 3SV6A 3T26A 2BDHA 2PSYA 2KAIB 1C5MD 2BLQA 2PR3A 1HXEH 3SJ8A 2BQ6B 3RXKA 1CQQA 1PJPA 1TRMA 2ZCKP 1DLEA 3SUFA 1AIXH 1O2TA 2XWBI 3UR9A 1MBMA 2Z9KA 5L30H 1DSUA 1SBWA 1QJ6B 1C5SA 2J9NA 2FESH 3KF2A 1Y3WA 1G32B 1P10A 2BD3A 2HNTC 2J95A 4ABEA 1GJAB 2QXIA 6ESTA 1Y3YA 1YCPM 2RA3A 1OX1A 2GVFA 1C2MA 4RKJB 2BD9A 3GCTG 2I6QA 3QK1A 1C1WH 4ABFA 5IYTA 1GGDB 4Q80A 2GX4A 1ZYOA 1DFPA 1F5KU 4A6LA 2PV9B 3M5OA 1C5NH 2ANYA 1TNKA 1PPEE 7ESTE 1QB9A 1A5IA 3T25A 2ZFPH 1XX9A 4GUXA 1K9OE 1O3KA 2QXHA 3LOXA 1DSTA 5A09A 2P94A 2I6SA 3GY6A 1CE5A 1W2KH 2JH0D 1P9UA 1B7XB 4FUCA 4BTUB 2OBQA 3MYWA 2R3YA 3IWMA 3V3MA 3B23B 4DGJA 3FP6E 4JZ1A 2OLGA 2J92A 2DE8A 4TY6A 3PV4A 1ESTA 1XKBC 3PMHB 4U2WA 5GDSH 2UWOA 4KTSA 1DVAH 4AGKA 2ZA5A 3MNBA 2KAIA 3OY5U 5CE1A 2ZTYA 1T8OA 2WPMS 1P3CA 1ARCA 2HALA 3GY3A 1RD3B 2B5TB 2BVXH 2CF8H 2BVSH 2XW9A 2FXRA 1ZR0A 5K0HA 4MPUA 1C2EA 2AYWA 3ZZCA 3SJ9A 3C1KA 4Y8ZA 5DGJA 1BJUA 2WYJA 5C5NA 1HRTH 1C9TA 1LHCH 3E0PB 3SORA 2Z9JA 1NRQH 1MBQA 1THSH 2TPIZ 2ZFSA 1C5LH 1E34B 1RFNA 1T31A 2A4RA 4Z0KA 4UFDH 1O3NA 2VGCB 2PTCE 3A88A 4MLFB 4MPVA 3ZV9A 1Y3UA 1T8MA 1V2PT 2SNWA 4YOIA 4E06H 2GD4B 2ZHWH 4WJG2 3SU1A 2H5CA 4B71A 1C5UA 2R3UA 1UTMA 4D9QA 1LPKB 2D2DA 5DJ7A 1MKXH 2SGAA 1O2ZA 2LNCA 2W3KA 1ZJKA 5CMXH 1K22H 1O2YA 3I77A 4GLYA 4LXBH 4AGJA 4CR5A 1YPKH 2PKSB 4ABBA 3R0FA 1TOCB 3BTKE 1C5YB 3DUXH 4JZIA 3VB5A 3UPEA 1FIWA 3HKJB 4Y71A 5EXMA 2GZ7A 5IDKA 2BDIA 5DP6A 1EOJA 1Y3XA 3SHCH 2BVRH 1T8NA 1T7CA 1MU8B 2GV7A 1TNIA 1ZPCA 2FLRH 5LPEA 3QLPH 1BRBE 3DFLA 3AAVA 1SG8B 3QWCH 3L6PA 4O97A 1GMDF 4Z6AH 1C5ZB 4BAHB 1EATA 4WWYA 1ZJDA 5EPNA 4NSYA 3BTTE 2OXSA 3CS7A 1TNHA 3ZZ9A 1A7SA 3SN8A 2ZCHP 3DHKH 2A45B 3RXBA 1SLWB 1W0YH 1KXFA 3ZZAA 5GWZA 1C1UH 1O2JA 1OP2A 1S82A 1P9SA 3BV9B 1GI4A 4R0IA 1C2LA 4GAWA 1BTXA 3SU3A 4FUJA 1PPZA 2Q1JA 3G01A 2FOEA 5EW1H 4CRFA 3GY8A 2RDLA 4Y79A 5GPIB 1LKAA 2FI4E 3RXQA 1SGQE 1GBEA 1BTUA 1HPGA 1O2VA 4HGCA 1EPTC 4O03A 3SUEA 1FY8E 3PTBA 4IN2A 3KGPA 4GCHF 2C3SA 3UQVA 4NFEA 4YT6H 8GCHF 2G4UA 3SU2A 1BTWA 4GVUA 4BAKB 2ALVA 2EA3A 1C1VH 1DICA 2TIOA 2ZG0H 1HUTH 3Q3YA 4Y0ZE 2ESTE 4E7RG 1A0HB 2ZFFH 5C2ZA 1MTNC 3KCGH 5BRRE 3VXEH 1O3FA 2ZTZA 1TYNA 3SNBA 1BQYA 1HGTH 3O8DA 1ANDA 2Y6TA 4WVPE 1TAWA 4IN1A 2FPZA 5C1UA 3IITA 1VCPA 2BLOA 2A4GA 1QR3E 2CF9H 4IS5A 1E0FD 2BHGA 4XOJA 5HGGA 1D3QB 3A85A 2VJ1A 4FUDA 4I32A 3M5LA 1HB0B 3MH6A 3HGNA 2Z9LA 1ZSKA 3T29A 1NO9H 1GCTB 1FDPA 3ZYDA 2P3UB 5CHAC 2C8XB 1EZXC 1K1LA 4CRDA 1VGCB 1DITH 2J38A 2VIVA 3ODDA 3M5NA 2AS9A 2G81E 1P06A 1EPTB 4WMDA 3U8OH 1L4ZA 1GBMA 3TGIE 1GBHA 2SGFE 1Y8TA 2FODA 3FZZA 2F9VA 1GMHF 2BM2A 1VITG 2Z94A 2ZNKH 3PLKA 1PFXC 2NU1E 3D23A 4TYDA 3NKKA 1RS0A 1SPJA 1XUFA 1TMBH 2B7DH 3KHVA 1F92A 3TJUA 2BB4A 1Z8IB 1LPGB 1PQAA 1FZZA 3E91A 2Y5FA 5T6GA 2R2MB 3RXMA 1D3DB 1ZGVA 1ZHRA 3ZV8A 1O3PB 1TB6H 3ZZBA 1ETRH 1CSOE 3SNCA 1O5EH 1UCYK 4ZKRU 5TCCA 1N1LA 1TGTA 5EODA 4UE7H 1JRTA 1O3EA 2O8TA 4DT7B 2BD4A 4RSPA 5JPMH 3S69A 1O31A 3E8LA 3A89A 1GHBF 2FOAA 2ZCLP 2F3CE 3STJA 3V7TA 1ABJH 3A7VA 4LK4A 1E36B 1F7ZA 2H9TH 1X7AC 3I29A 8LPRA 2HOBA 2J94A 2XWAA 3M3SA 4B74A 4CRGA 3E1XB 1GBBA 3QZRA 1FIZA 2F83A 1L4DA 1HNEE 3LH3A 3O8BA 1G3BA 4XBDA 5FXLA 1O2MA 1UHBB 3LC5A 1XMNB 1QIXB 5E8EH 7GCHG 4ABHA 3AW1A 1EPTA 3QX5H 1FPCH 2VIWA 1GL1A 3GY7A 1TGNA 3SOSA 5C67A 2WPKS 2OD3B 1OSSA 2GZ8A 1QB1A 2BLWA 2Q6GA 3IG6B 2AMPA 1UTQA 4WXIA 2FOFA 2QC2A 2SGQE 2A32A 4U30A 1ELCA 2Y80A 1QRXA 3SQEE 3BTEE 3Q3KA 1H4WA 2IOTA 3GCTF 1P2QA 2FS9A 4MDSA 1P01A 1KXAA 2WINI 1A0LA 1MMJN 4X6PA 1KLJH 1UVOA 2BD7A 1BITA 3SJOA 3RXOA 2QIQA 1O5DH 4Y76A 1DX5M 1TPAE 1WAYB 2CXVA 4GHQA 4ESTE 5ESTE 2ZI2H 5FPSA 2BD5A 4JZEH 1MQ6A 1MKWH 2PLXA 1BRCE 2XTTB 3MO6A 1BA8B 3LDXH 3UREA 4NZQA 1RXPA 2ZHEH 2HRVA 3A8CA 3GCOA 4NG9H 1CHOG 1F0RA 3VGCB 5GJ4B 4KGAA 1GHZA 2F9BH 3FFGA 3K2UA 4NWKA 4X1NU 4YOGA 2CHAC 4CRBA 1C5QA 2EEKA 4TWYA 3BG8A 1C1SA 1TNLA 3RUOA 3M3TA 2FI3E 2QF3A 3GOVB 1XVOA 5L2ZH 2H9HA 1KXBA 4MQAA 1A61H 5F6MA 2ANKH 4AZ2B 4WH8A 2AH4X 1CA8B 2YOLA 4I8KA 2PFEA 1C5OH 1UHBA 2VWMA 3L3TA 3MU4A 3BTDE 2FOGA 3RXDA 4AYVB 2NU3E 1JOUB 1ORFA 4OS6A 2A7HA 1TA6A 3AVZA 3P6ZB 1ELAA 5GCHF 1C5PA 5T6FA 1V2TT 4D9RA 1QL9A 3A84A 4AFZA 1TE0A 3M37A 1BBRK 5T3HA 1MUEB 1O5AB 1DUEA 4Y7BA 2XBWA 1EJMA 1MD8A 1O2SA 1OWJA 3BIVH 2FOMB 4K5ZA 4WXVA 1ESAA 3UWIA 1CO7E 1TALA 2ZQ2A 4YM9A 2SGDE 4K60A 4FU8A 3GDVA 3MH4A 5DP5A 1AE5A 1LHFH 2UUYA 3RU4D 3TPIZ 3LJOA 2ZTXA 4DOQA 1C1PA 3DD2H 1THRH 3CP7A 1G3DA 2P3FH 3RC4A 1EP6A 2BXUH 1XUJA 2P8OB 4DW2U 2GCHG 4MNYA 1LTOA 3F9GA 3P8GA 4IMZA 1O30A 1TX6A 1PPCE 1RRKA 1UK3A 2R9PA 4X6NA 1LVBA 1FY3A 3SU0A 1FY1A 2G00A 2WYGA 2GT8A 5A8YA 4K1TA 1GI7B 1W12U 1O3LA 1NFXA 2GCTC 1AFQC 1XUKA 3TJOA 2HPPH 5AHGH 4D7FA 4ZHLU 1EAWA 2ZZUH 1XKAC 3SU6A 1GHYH 1HXFH 1A5HA 4NCYA 4ZMAH 1NN6A 3UFAA 2ODYB 4ZKOU 2WPIS 4YOJA 1IHTH 4KTUA 4NFFA 5DG6A 3MU8A 5H4IB 2BQWB 1PPGE 4X1SU 1XXDA 4XBBA 1SB1H 2P3TB 1W7GH 5AFZH 3A81A 5DP4A 3E0NB 1O3IA 1TPPA 2AERH 5AF9H 1C4Y2 1NFWA 3A87A 1J9CH 1AUTC 2A5AA 1ZMLA 1P2NA 2NU4E 4I7YH 1U6QA 1ZGIA 4FUBA 1TGCA 4FUEA 1V2RT 1O2Q