3BTEE

The crystal structures of the complexes between bovine beta-trypsin and ten p1 variants of bpti.
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
221
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title The crystal structures of the complexes between bovine beta-trypsin and ten P1 variants of BPTI.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 54
structure length 221
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3bteE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3bteE02
2Z6BD 1NRPH 1T8OA 2FODA 5CHAB 2ZQ2A 3MU4A 1GI4A 3SJKA 4B2CA 1H9HE 1SOTA 1YM0A 4ABJA 3P92A 3PTNA 2BQWB 1CGJE 4Y76A 4BANB 2IN2A 1MMJN 1QJ6B 3DT0H 2LNCA 3E0PB 3FP8E 1CA0B 2AMPA 1C5VA 1UCYE 1K1PA 1JRSA 1G2MA 2ZU3A 1O3IA 1LTOA 2VINA 3NZIA 1TOMH 1UVTH 1O3MA 1FPHH 1VGCC 1YGCH 1XVOA 3KCGH 4Y8ZA 2WPIS 5DP7A 6CHAC 1Y5BT 4OS6A 4I33A 4AFZA 2SGDE 5LPFA 5K0HA 2ZGJA 4FUDA 4WMDA 2QGRA 4NCYA 1C1PA 1F2SE 1BCUH 1K1JA 3UFAA 1O32A 2ZU2A 5A2MH 3WY8A 1O3AA 2JH0D 3U8TH 2WUCA 1LDTT 1LPGB 1ELCA 1MD7A 3UR6A 3M3SA 1WBGB 2D1JA 1NS3A 3P8FA 2XYAA 1LPKB 5DP8A 5GWZA 1ZSJA 3SV2H 1QB1A 2HNTF 3LPRA 3SJ9A 1P10A 3SQEE 3E90B 1SSXA 4AG1A 3BTEE 1NU7B 1KY9A 2GT7A 3RMMH 4XOJA 3LDXH 1Q31A 1VITF 3A8BA 4E7NA 3RM0H 4DIHH 1TFXA 1SGCA 3HK6B 2Y7XA 2GZ8A 1T31A 1U6QA 4INKA 1ZTJA 2OINA 1GWAA 4ZROA 1MU8B 2RG3A 3LJJA 4CRFA 3URCA 3QWCH 2ANWA 1MD8A 3UQVA 1A7SA 1ZPZA 4E05H 1O2YA 3A8CA 4DURA 2J38A 1AFEH 1NT1A 2OBQA 1DXWA 1G36A 2GV7A 1TBZH 1A61H 2ZGCA 2WV4A 3SI4H 2UUYA 3F9EA 1H1BA 2BHGA 1GHVH 3AAVA 4X2WA 3C1KA 3MFJA 1A0JA 2GCTC 1QNJA 2FOBA 3RMLH 3RP2A 1SGFG 2XBYA 3GY8A 4X8TH 3LGVA 3A83A 1EZQA 1OKXA 1G3DA 2ANYA 3SGBE 2SGFE 5LPEA 3GY6A 2XBXA 2TRMA 2HRVA 3HGPA 4AGKA 1H9IE 1AD8H 1Y5AT 1BJUA 1LMWB 2P8OB 2YNBA 1GL1A 1V2LT 4Q7XA 2XTTB 1KLTA 2FX6A 3VEQB 1J14A 1SHYA 4ABBA 1QR3E 2TGTA 3FP7E 3UWIA 4KKDA 1NESE 2FEQH 2JETC 1QBVH 1XUHA 1HAGE 1YKTA 1S85A 3A7TA 4PROA 1CGIE 3MH4A 2BD5A 3MNXA 3SUDA 1IQHA 1NFWA 3MO6A 5ESBA 1P57B 3BV9B 3P95A 1RD3B 3MHWU 2DE8A 4B76A 5F8TA 1BUIA 2ZA5A 2F9VA 3STJA 4O97A 3D23A 5J4QA 4UD9H 1WTHD 1GCTB 2O9QA 2FI3E 1KDQA 3LGWA 4MNYA 1HBTH 1OWIA 2ZIQH 1UTJA 4A1VA 4Z6AH 1CA0C 5GJ4B 2ZF0H 4FUBA 1P2MA 4UFGH 3T28A 3BTHE 2PGBB 2B7DH 1GHAF 1PYTD 2PKAA 3V3MA 1DICA 1GJ4H 2ODQA 1Z71A 3RC6A 7GCHG 3S7KB 3GYMA 1ESAA 3VB6A 3H5CB 2R2MB 1C4V2 3T26A 1WQVH 2IPHA 1IHTH 2C8XB 4AB9A 5JYIA 4MNXA 5C1XA 1YPEH 4B71A 1ETTH 1W13U 4YOIA 1UJ1A 4CHAB 1QBNA 1KDQB 2OC1A 1GJCB 1C5ZB 1WOFA 3IITA 2BQ6B 3ODDA 2A4RA 3ZZ4A 2M5TA 3LGYA 3F6UH 2IOTA 5SGAE 4TPIZ 1JRTA 1LVYA 1S81A 2FTMA 1ID5H 1RIWB 1O3BA 2AGIX 3ELAH 2OCVB 4XSKU 3U9AH 4MPWA 1NO9H 2PKAB 1ABJH 1G2LA 3A82A 4KTSA 3K6YA 4X6MA 2ESTE 4AOQA 2VWLA 1TPAE 3O8CA 2TIOA 5ETXA 8GCHF 5C20A 3RXSA 2CF9H 2ILNA 1UMAH 3N7OA 1QA7A 1TNLA 3GY3A 2VGCC 2V35A 3U8RH 1FLEE 1ZPBA 1MTUA 1P2KA 2I6SA 1QJ1B 3U8OH 2H9EH 2BDGA 3NK8A 3OY5U 2AMDA 1BRCE 4WF8A 3RXLA 2CN0H 3SNDA 2SNVA 1ZHMA 4BAHB 3TH3H 5EOKA 2FP7B 4GLYA 1C2KA 1ZJKA 2P3FH 2PUXB 5L2ZH 1GDNA 4HFPB 3UIRA 1GJAB 2HOBA 1FUJA 5FCRA 1TQ7B 1SLUB 2ZU1A 2G52A 2P95A 3QTVH 2K1QA 2BY5X 1RJXB 1P3CA 1WUNH 1FN6A 3P8OA 5EW1H 1RS0A 2IJOB 4Y0ZE 1MTWA 1NU9A 2BOKA 1GI7B 1RFNA 1PPZA 2FLRH 4WY3A 1O2PA 2P8OC 2A45B 1Y3XA 2PSYA 2VH0A 3P8NA 1FDPA 4FUCA 1DXPA 1Y5UT 1YPKH 4U30A 2BLWA 3GISB 1RTFB 1UO6A 1C2GA 1ZHPA 1C5NH 2UWPA 2A4QA 3VXEH 1MH0A 2ZPSA 3LU9B 2GT8A 3JZ1B 1LHCH 1TBQH 4O3TA 1O3DA 1GPZA 1F5LA 4Y0YE 1O2IA 4KTUA 2PGQB 5E0HA 1O2NA 2LPRA 1NTPA 1IQMA 3SOSA 4D8NA 1Z8IB 3SJ8A 4D76A 1OOKB 7GCHF 1WCZA 2W3KA 2O8UA 2H9HA 1GHZA 1C1SA 2WYGA 1EATA 3E1XB 1GI1A 5DJ7A 1GVLA 2BMGB 2V6NA 3TGJE 1O3LA 3QUMP 4U01A 4YO9A 1AZ8A 1C4U2 1QY6A 4AB8A 4BTTB 3UTUH 4I7YH 3HKJB 1OWDA 2P3UB 2AIPA 1V2WT 1HAZB 2DE9A 1GCTC 1K22H 3CP7A 5E2OA 1T8NA 4X6PA 4NA7A 1DS2E 1S0RA 5T6GA 1GI0A 1GBMA 3SV6A 4YT6H 5DP9A 4Y11E 3NUMA 2VIOA 1SI5H 2Y7ZA 3MU5A 9ESTA 1UK4A 3TJNA 1EZUC 1S84A 1QRWA 3D49H 2ZCHP 5EG4A 4UDWH 4NWKA 3F1SB 2RA0A 3M35A 1P9SA 1UTNA 3O8RA 2VIWA 1P04A 1Y3UA 2PWXA 1C9TA 2ZDMA 3M61U 1ELBA 1ABIH 2NU1E 2XWBI 3EA8A 1H4WA 2PTNA 3ATWA 2NU3E 1YPLH 3DFJA 1RXPA 1BMMH 1CBWB 1Z1IA 2PHBA 1O2LA 4GSOA 3UNRA 3LIWA 1SFQB 1SL3A 2VIQA 1P9UA 1DE7H 5DP4A 3MYWA 1HYLA 3ZVAA 2WYJA 2GZ7A 3TLOA 5GCHG 3TK5A 1TX7A 4MNVA 1TPOA 1P09A 1ELGA 2J2UA 2HPQH 1TQ0B 2XCNA 3A87A 1UTQA 1L2EA 1Q2WA 2FM2A 3ZZBA 1D6RA 2JKHA 2QY0B 3A85A 3B23B 1ACBE 1GDQA 1SLVB 1MKWH 1K28D 2QF0A 3A84A 5FCKA 2I6QA 4BAMB 1ZGVA 2HALA 4I8JA 2VVVA 2P59A 1NRNH 1XMNB 4X6NA 1HXFH 3GY4A 4AFUA 2W7UA 1BTYA 2TGAA 3EQ0H 1EZSC 1FY8E 1O2OA 4K1EA 1AU8A 2Y5HA 4B2BA 3RU4E 1UHBA 2ANKH 1AWHB 2Z7FE 4IMQA 4U32A 4D7FA 3LGUA 1GVZA 2F9NA 4CRGA 4DIIH 2GCHG 1AY6H 3ATLA 4QT8C 2FIRH 1GJ9B 5EU8A 3KQCA 2ZNKH 5C5NA 3U69H 1AKSB 2BD2A 1TGSZ 3I77A 1JWTA 4MVNA 1O31A 2Z9JA 4ESTE 1W0YH 1TRNA 3KEEA 3SJIA 1ELEE 1EB2A 1CT4E 1K1IA 1EJAA 1VR1H 4JMYA 1B5GH 1HAIH 3MI4A 1TYNA 4Y8XA 1FQ3A 3OTJE 2C4FH 1OWHA 1P2JA 2PR3A 1HFDA 2A5IA 1UHBB 4ABDA 1E36B 2WPMS 3PROA 4A5TS 1BTXA 2XBWA 3LJOA 2Y5GA 3ATIA 1YPMH 4DT7B 4HI3A 1A3EH 1FAKH 1IQFA 2QF3A 3PWCA 3RXEA 3AW1A 2GMTB 1C1WH 2HLCA 1FIWA 1BRAA 1C5RA 2QYIA 1DFPA 3FZDA 1T7CA 4FUGA 1LQEA 3KQDA 1MKWK 4CR9A 1HJAB 3RXFA 1SGNE 1JXPA 3H7TA 9LPRA 3SV9A 3Q00A 1ZHRA 1FNIA 1O3JA 4NIVA 2FTLE 2FMJA 3M7QA 1G3CA 2A2QH 1ZOMA 4CH2B 2XCFA 5TCAA 3ZZ5A 1BTWA 1AQ7A 4WMFA 4Y7BA 1D4PB 1HDTH 2D2DA 1SC8U 1DY8A 2G4TA 1MCTA 3RXJA 3SN8A 1TNHA 1PYTC 5EQSA 1GMHG 1EAWA 3PWBA 2B9LA 5GCHF 4X1QU 1S6HA 4KP0A 3IWMA 3QLPH 1FV9A 1P2NA 7LPRA 4FU8A 1E34B 4XE4A 1P05A 2UWOA 2ZGBH 4JZEH 1C2JA 3GY2A 3RM2H 2HPPH 3IG6B 4FUJA 1O5GH 1GHYH 3RXCA 4ZKNU 4E06H 3GY5A 5GDSH 2OC0A 3SBKA 2UWLA 1SQAA 1CBWC 3TNTA 2ZFTA 4ISOA 1QCPA 3TK9A 3BTTE 3M7TA 1TNKA 3VPKA 4UONA 2NU4E 2ZHEH 1TNGA 3RLYH 1ZJDA 1V2PT 1TNJA 1V3XA 1BDAA 1C9PA 2GCHF 4CR5A 2P94A 2C90B 1ZSLA 3NXPA 1JMOH 1LCYA 3FZZA 1W11U 2ZZUH 4OS5A 2PUQH 1XXFA 2VIDA 4ZKOU 5DGJA 1QJ7B 1GGDC 1GJ5H 3EAJA 1F5RA 2SGAA 4GPGA 4UEHH 4K8BA 1C5YB 3DUXH 1ETRH 1QL7A 4CRDA 1W10U 1TLDA 1V2KT 4Q2KA 1F0UA 1M9UA 3P70B 4A1XA 3KNXA 3STIA 4TWYA 3URDA 3S0NA 4AN7A 1EXFA 1UK2A 3UR9A 2BZAA 4ABFA 1HJ8A 1HV7A 2ZCKP 2ZP0H 2UUKB 1AIXH 2OQ5A 2BLVA 3DA9B 1P02A 1KXCA 5BRRE 3L6PA 3A7VA 3GCOA 2FDAA 5F6MA 8LPRA 2VU8E 3SJOA 3QX5H 3ZVBA 1FONA 3K65B 4I8GA 2FZZA 2Y80A 3RXOA 3MH6A 4YT7H 2VGCB 4IS5A 1MZAA 1O37A 5I25A 3GCNA 1FY1A 3SU5A 3D65E 1C5OH 4JZDH 2JH6D 2UUFB 1ZPCA 1OP8A 3E0NB 2GMTC 3HK3B 4D9QA 1TX6A 1NY22 3ODFA 1O2QA 2RA3A 1IQJA 2HNTC 2FESH 1GMHF 1YC0A 4ZHAA 2AERH 2CHAC 1C2EA 4Y71A 3FANA 1HJAC 1ZTKA 4ZXYH 1W8BH 2AGGX 3V7TA 3LH1A 5A09A 4YOGA 1ESBA 1QGFA 3QZRA 2FOAA 1SQOA 2H6MA 3A8AA 1DANH 1MBMA 1PQ7A 1T32A 2B5TB 5LPRA 1GI8B 4NIYA 3ZVCA 2ZFQH 3LT3A 5DK1A 1ZYOA 2BVXH 4CRAA 4BAQB 2J34A 1EJMA 1YPGH 5AF9H 5C67A 2Z9LA 1Z6JH 2GKVE 6GCHG 4MTBA 3NWUA 2ZDAH 4CREA 1MQ5A 5EGMA 1ETSH 2D8WA 4INLA 3UWJH 2D26C 1IQEA 5EQRA 4X2XA 4Y8YA 2QXIA 5GIBA 4Y6DA 1CGHA 2ZFFH 2Y82A 1BHXF 5FPSA 2ZTXA 1ANEA 1A5IA 2XXLA 1TWXB 4A1TA 1P01A 4H4FA 1QQUA 1Q3XA 3SORA 1GMDG 3KQEA 1YLCA 4NWLA 1KIGH 1TNIA 1MU6B 4WVPE 5H4IB 2XNIA 4YTAA 1QHRB 3B9FH 1SG8B 1EJNA 4TY7A 3GICB 4SGAE 5I46H 5DO4H 2CV3A 2ZECA 1SGIB 1HAHH 2AMQA 3BG8A 2BTCE 1P3EA 5HXFA 4ZMAH 3U98H 2VIVA 4AORA 5A8XA 1P2QA 5A0CA 2FYRA 1C5WB 1JIMA 3T27A 1OYQA 2WPLS 1C5SA 1L1GA 2G00A 2G8TA 1NRRH 1H8IH 5A8YA 1O3EA 2OQUA 1QL8A 1OXGA 4NFEA 3TJVA 4CBNA 3RXRA 4DY7B 5EW2H 4XDEA 1RTLA 2C3SA 3L33A 2C8WB 3PV4A 1ESTA 3QO6A 3GY7A 2Q6GA 3KL6A 1ANCA 1GBEA 3DFLA 4U2WA 4CRCA 1V2JT 2J4IA 2A4GA 4GHTA 2ZEBA 1THRH 1XVMA 2FPZA 4ZKSU 1Z8JB 1GI5A 1O5FH 4F49A 2CMYA 4K1TA 1ZLRA 3SHAH 3OU0A 1T4UH 1W14U 1SVPA 1BRUP 2BVSH 4MDSA 1XX9A 3V12A 3ZVGA 4BXSA 1ANBA 3MU1A 3SQHE 3T2NA 1O3CA 4O9VA 5FX6A 2GVFA 3GCHB 3AASA 4MPUA 1MTSA 1BOQA 1YCPM 1XUFA 4NSVA 1P2OA 2H9TH 5JPMH 1CT0E 1QRZA 1TALA 2EI8A 3W94A 1V2VT 3PO1B 1UTOA 1GBLA 5C5OA 1GBTA 5LGOA 3BSQA 2WUBA 1WV7H 5C1UA 1A3BH 3AAUA 3SUFA 3DD2H 5EXMA 4FUHA 3BIUH 2A7CA 3A80A 6GCHF 2PTCE 3BTKE 3TU7H 3G01A 2QXHA 2P3TB 1A0LA 2Z9KA 1OWJA 3PB1E 1SFIA 1QTFA 2V3HH 1CQQA 4TY6A 4UFEH 1ELTA 2A1DB 1HNEE 1TBRH 3HPTB 2XC5A 1BRBE 1ZRBA 3BEFB 5E0GA 1O35A 4MNWA 1W2KH 3R0FA 1Z8RA 3FP6E 1ELFA 3RLWH 1BZXE 1GI9B 1GMDF 2PV9B 1O3OA 4MPVA 1TE0A 3SU6A 5HMAA 3BIVH 1OP2A 1A4WH 4LXBH 1VCWA 2F9BH 4IN2A 5JBAS 3MH7A 3UPEA 1Y3WA 4SGBE 2XRCA 1O2SA 2W7SA 4XBCA 3BTME 2H1UA 3EDXB 1J9CH 1N6XA 1EP6A 1NFYA 3TH4H 1EPTA 1YP9A 3LGTA 1BBRH 2A31A 5G4BA 2QN5T 5TCCA 1O38A 2SGQE 3TJUA 3VGCB 1ZMLA 5IDKA 1FY3A 3RDZA 1E37B 1O33A 1UVPA 1TA2A 1HXEH 2BDIA 2F9PA 2W3IA 4X1PU 2XWAA 5EXLA 4A7IB 3LKWA 2Z3DA 1KYNA 1A46H 2GTBA 1YYY1 4K69A 1S6FA 4IN1A 2EC9H 3K9XB 1O34A 1B0EA 4ABIA 1EPTB 3KHVA 2ZTYA 1EOLA 4X1NU 4FU9A 3SUEA 2YNAA 1SLWB 1GG6C 1HPGA 2ZTZA 4GUXA 1NZQH 1PPHE 1V2ST 4NFFA 4JYTA 1C5UA 4WH8A 2V0BA 3SO3A 3QDZB 2FOCA 3SU3A 1SQTA 4ABGA 4ASHA 2HNTE 4JYVH 5JDUB 4DGJA 2QAAA 4ISIH 1GMCG 1AN1E 4VGCB 3SNAA 3UNSA 4I8HA 3MNSA 2ZDLA 3A81A 3RU4T 3BEIB 1S0QA 1CVWH 1DSUA 2PW8H 1BBRK 1KTTB 4UFFH 2C8ZB 2STBE 4H6TA 4OS2A 2ZDKA 1BQYA 2SGPE 4H42U 2F91A 4D9RA 1HAPH 1LQDB 3DHKH 4A6LA 1S82A 1UVSH 5DP6A 1Y59T 1Z1JA 2VIPA 5LH8A 1FAXA 1HCGA 1QRXA 2FOEA 5ESTE 1O30A 1MQ6A 3RC4A 3P17H 1CO7E 1FXYA 2A5KA 2Z94A 3GCHC 4WJG2 2J95A 2NU2E 1C5XB 1C1MA 1GJ7B 1OWKA 4AZ2B 3T25A 1UVOA 2PFEA 2OD3B 2QV1A 2ZQ1A 3TJOA 3PO1C 2RDLA 4NG9H 1VITH 1N6YA 1AKSA 1C1UH 1HAXB 1DT2A 2ZGHA 4MQAA 1GGDB 1C5PA 2OBOA 1KXEA 1L0ZA 2AS9A 1GI2A 4UFDH 2BD4A 1AMHA 2B8OH 3BTFE 5EPYA 3RU4D 1O3GA 1P12E 3S9BA 3HKIB 4X6OA 4IMZA 4ABHA 6LPRA 4ABAA 3RXAA 1D9IA 1IAUA 1BTHH 2FS9A 3F9FA 5AVDA 3R3GB 2BX3A 2R9PA 2ZU5A 3L3TA 4CRBA 2CF8H 2Y81A 3FFGA 1XUIA 1XKAC 2HGTH 5F8ZA 3S69A 2SNWA 4GAWA 3ZZDA 1BB0B 4O3UA 2Q1JA 1CE5A 4HTCH 3SUGA 3LGIA 1HAOH 3BG4B 2FI4E 2GV6A 2VH6A 2BX4A 1GI3A 1LHFH 2BZ6H 3AW0A 4THNH 1BTPA 4JCNA 4TPYA 3RXUA 4BAOB 2BD3A 1MTNC 4R0IA 3ZV8A 5T6FA 1Y3VA 3NPSA 4ZHMU 1N1LA 3S9AA 1K21H 3VGCC 1CHOG 1O0DH 3Q3XA 3Q77A 1C1TA 2Z9IA 3TNSA 4B73A 2CHAB 2DUCA 4OGYA 2VWOA 1LKAA 4HZHA 2EI7A 2AEIH 1O3PB 1SGQE 1A0HB 3HGNA 1ARCA 2OUAA 1GMCF 2OLGA 1FY5A 2BOHB 1D3TB 1UVUH 1J8AA 3LC5A 1C5TA 1EPTC 2BDHA 2C8YB 4Q7YA 1CA8B 5EXNA 4E7RG 2ZHQH 5DP5A 5F8XA 1YPHC 1K9OE 4F4OC 3VB3A 1AUJA 1LVOA 1GCDA 1QB6A 3MH5A 2OC8A 1E38B 1IQKA 1EKBB 1C1QA 2B0FA 1PQ5A 1XUJA 4AFSA 1GVKB 3TITA 3AVZA 4I32A 2R2WU 5C3NA 1AE5A 3O8BA 2CXVA 3RXQA 3UOUA 1C2MA 1KXBA 1LVMA 3TGKE 2BY7X 2G51A 3KGPA 1V2UT 3LC3A 3F9GA 3QGJA 1VCPA 1P8VC 1TPSA 1FPCH 2GDDA 5DG6A 1KSNA 1KTSB 2BDAA 3ZZCA 3A7ZA 1GBCA 2ZWLH 3OSYA 1ELAA 4FVBA 2FOHA 1F0SA 2OTVA 5TJXA 1VJAU 1GJ6A 4VGCC 7KMEH 1GBIA 1FZZA 1HLTH 2ZG0H 5AFYH 1BT7A 1PPCE 2G5NA 2VB0A 4AYYB 3ZZ9A 1AVWA 4B1TA 5JB9S 4I31A 1O3NA 1O2UA 3I78A 3UY9A 1F0RA 5JBTA 1MBQA 2A5AA 3M5MA 3KQBA 2BB4A 1TOCB 4TYDA 1W12U 3RUOA 2PSXA 1O5EH 2A2XH 1FMGA 3S9CA 4DJZB 1GHXH 1N8OB 1J16A 1ELVA 1YLDA 3P8GA 4AFQA 1AFQB 3GDVA 6ESTA 4I8KA 1PJPA 1O2TA 5FBIA 2QA9E 4IGDA 1C5LH 1C2DA 2GX4A 1BHXB 1C1OA 3BTQE 2VJ1A 3ZYDA 3SU4A 1AE8H 1O2HA 4ZUHA 3BF6H 2BD8A 1GBFA 1F92A 3SNEA 1GDUA 1HUTH 1SBWA 4WWYA 4ZXXH 1BITA 1UK3A 3TPIZ 3UOPA 1EUFA 2EI6A 2O8LA 5AFZH 1P0SH 1EX3A 1ELDE 1CU1A 1DY9A 3NKKA 2BYAX 1DPOA 3A86A 5DKMA 1XUGA 4XBDA 3FAOA 3F68H 1OPHB 4FUIA 2FXRA 4IW4E 3T29A 3I29A 2JH5D 1TMBH 3GYLB 1H8DH 2SGEE 1CHOF 4I8LA 2O8TA 2ZFRH 2ASUB 1AO5A 1S83A 2Z3EA 1ZMNA 1O5BB 2ALVA 4J2YB 1HAVA 1OP0A 1TABE 1AGJA 5EODA 1PPBH 1O5AB 3MNBA 1G30B 2F83A 1C4Y2 3PM3A 4Y7AA 1BMLA 3RMNH 5L2YH 1DWDH 3BG4C 3PLBA 1F5KU 1H9LB 1UCYH 1THSH 1W3CA 2ANMH 2J9NA 1O5DH 1SMFE 4DW2U 1SGFA 1GHAG 2OP9A 1K1LA 1GBDA 4CH8B 2O8WA 4Q80A 1NFXA 2TGPZ 2NU0E 1HRTH 1HAYB 1TX8A 3ZZ8A 2C93B 3M5NA 3T62A 1T8MA 4OS7A 1PFXC 2ODPA 1IQLA 1TMTH 1HAVB 4NSYA 1V6DA 4WXVA 1WAYB 4B74A 4AG2A 1NN6A 1TGCA 1HJ9A 1X7AC 2ZDNA 2PKSB 2FO9A 3ZVDA 2THFB 2ZC9H 2ZHWH 3M37A 1P06A 5C2ZA 2G55A 3U1IB 4FU7A 2GD4B 2W5EA 4K2YA 1FN8A 2AH4X 1QURH 4AYVB 2AYWA 2TPIZ 5FXLA 1VZQH 4YESB 5L6NH 2SFAA 3A89A 4NGAH 3FVFB 2VWMA 3D62A 1DVAH 1MAXA 1LVBA 1NRQH 2VVUA 3RXKA 3ZZ3A 1C2FA 1TB6H 4J1YA 2FOGA 2F3CE 1BMNH 8GCHG 1O2GH 1DDJA 1AVGH 3ENSB 1O39A 1JBUH 2ZCLP 4RKOB 4KGAA 2G81E 4X8VH 3SU0A 1O5CB 2R3UA 1NFUA 1C2HA 1PQ8A 3VB7A 2F9UA 1O3KA 1Z7KA 1TONA 1UCYK 4K8YA 4IBLH 1NC6A 1PPEE 2WV5A 5E0JA 1G3BA 3Q3YA 2ZU4A 1LHGH 1AUTC 2ZFSA 2ODYB 1MKXH 1HIAA 1EAIA 1DX5M 1KLJH 1AWFH 2H5DA 3MMGA 1A2CH 1GBBA 2CGAA 4BTUB 4DOQA 5E8EH 1N8OC 1S5SA 2TGDA 4CBOA 1GG6B 4MG3A 3GCTG 1AFQC 4BTIB 4WXIA 2Z3CA 1TGTA 3MOCA 4JK5A 3RXGA 3SV7A 3EA9A 2R3YA 2EEKA 4B2AA 2ZKSA 3MNCA 1YF4A 1K1MA 1Z8GA 4UE7H 1QBOA 5ABWA 2FWWA 5HGGA 4JK6A 4DVAU 2GZ9A 5CHAC 1HIAB 1DM4B 3PMBB 4X8UH 3RXDA 1O2KA 1AHTH 1ARBA 2HVXA 1RGQA 5GXPA 2QIQA 3QTOH 1SGDE 3TIUA 3U1JB 1J17T 1YPHE 2VVCA 2QC2A 1NPMA 1EASA 3PMJA 4Z0KA 3RXTA 4A92A 3TH2H 4WH6A 1UTMA 3PYHA 3QK1A 3BTWE 4FUEA 1DITH 1DWBH 2A4OA 1E35B 5A8ZA 2XBVA 1C1RA 1LO6A 1MKXK 3EA7A 2UUJB 1TA6A 1VJ9U 1HB0B 4M7GA 1IHSH 4ZHLU 1SGPE 4K60A 3W95A 3KN2A 1TIOA 4JZFH 2BVRH 3T5FH 1ZTLA 5T3HA 1ZR0A 2WPHS 2BXTH 1EOJA 2RCEA 4AGJA 1GL0E 1L1JA 4MLFB 3BTGE 2AIQA 1KXAA 4IC6A 2STAE 3ITIA 1TRMA 4K5ZA 4LK4A 3MU0A 2BD9A 1V2RT 4BXWA 3UQOA 1EAXA 1BBRE 1FI8A 2FOFA 1MUEB 1SOZA 3GDUA 4GCHG 3VXFH 3JZ2B 4ISHH 4NZQA 3OX7U 3ESTA 4FUFA 3TK6A 1XM1A 5CE1A 4X1RU 1WTGH 8ESTE 2PKSC 2BDYA 1OSSA 1P2IA 1RRKA 3SNCA 1MTVA 1K1OA 3M3VA 1EAUA 1G32B 1SPJA 1C1VH 5HYOA 4BNRA 3P6ZB 1C5MD 3ZZ6A 3M36A 1CHGA 4IC5A 1GHBG 2ALPA 4X1SU 2F9OA 4O03A 1V2QT 5CMXH 3RXHA 2OC7A 1O2VA 3ZZ7A 4DCDA 1GHWH 2XC0A 1MTNB 3SHCH 1DUEA 1L4DA 2KAIA 2XC4A 1ZSKA 1B0FA 3GCTF 1INCA 1AB9B 3A88A 2BDCA 1QIXB 5JB8S 1JOUB 2ZDVH 7ESTE 3M5LA 1UTKA 3RXIA 1XKBC 2EA3A 4YM9A 2ZGXH 1ZRKA 1JIRA 2ULLA 3RC5A 2BLOA 1HGTH 1IOEA 2WINI 2ZI2H 2A32A 1PPFE 1TMUH 2WPKS 2AFQB 1W0ZU 1WSSH 4GHQA 2Y5FA 2BQ7B 1EB1H 2Q6DA 3MO9A 3VB5A 1SLXB 4X0WU 1PPGE 3NCLA 4LZ1H 3C27B 5T6DA 2TBSA 2KAIB 1O3HA 1W7GH 5EQQA 3TGIE 1AZZA 1BA8B 4RKJB 1OYTH 3SZNA 1MCVA 1VCQA 2P93A 2ZO3H 3LONA 3SW2B 3M7UA 1NROH 3OY6U 3ZVFA 2H5CA 3CENA 1EZXC 3HATH 1ZGIA 4NA8A 3RXPA 3M5OA 1K1NA 1GI6A 3RXBA 4KTCA 2PLXA 1BJVA 4Y79A 3PMAB 3UREA 3TVJB 1G9IE 1RTKA 5A0BA 5C1YA 3A8DA 2A0QB 1SHHB 1YPJH 3BTDE 1AI8H 1EP5A 4K1SA 4K3JA 3QN7A 3K6ZA 1BMAA 1ORFA 2FS8A 3M3TA 4MPXA 3MU8A 1IQIA 2GGVB 3S7HB 3RXMA 2BDBA 1O3FA 1O2WA 2QXGA 4ABEA 1P11E 2BY8X 4WMEA 1KLIH 1BIOA 3E3TA 1FIZA 1TGNA 3EYDA 1QA0A 3QGNB 1V2OT 1OWEA 1V2MT 3A7YA 2VWNA 4LOYH 3SU1A 4AX9H 1C1NA 4KELA 4R8TB 4H6SB 2YOLA 4GCHF 5BPEA 2OXSA 1FJSA 1QL9A 1DWCH 1LKBA 3MWIU 3V0XA 1DLEA 3QZQA 4CHAC 3EE0B 1LHDH 4OS1A 1W7XH 1L1NA 3ZVEA 1D3QB 3ATMA 1EQ9A 4Q7ZA 2Q6FA 4YLUA 3UUZA 3PLPA 1GBHA 1UTPA 3V13A 1MAYA 1RIWC 2BD7A 5F03A 1FY4A 3KIDU 1LPZB 2ZPRA 2BM2A 3VFEA 1GHBF 1XXDA 1SGRE 1T8LA 3GDSA 1AVXA 1O2JA 1CSOE 1SGYE 3RXVA 1PQAA 1LHEH 2G5VA 4JZ1A 1SR5C 4YOJA 4FVDA 2BLQA 2BY9X 1VGCB 3PTBA 2QCYA 4X2YA 5AHGH 5FBEA 5HM2A 4DG4A 1F7ZA 3SU2A 1OS8A 4BAKB 6CHAB 2FX4A 3E8LA 1TAWA 1GJ8B 3ATKA 1OX1A 3PLKA 1C2IA 3E91A 5HM9A 1KXFA 1TPPA 2Z9GA 4Y10E 1QFKH 1GBAA 1GJBB 4OS4A 3SGQE 1BTZA 5L30H 3E16B 1DLKB 5PTPA 1ANDA 3H7OA 1ZMJA 3A7WA 1D6WA 1IQGA 4XBBA 3LOXA 3EGKH 1DUAA 1YCPH 1Z6EA 1WU1A 2H2ZA 1A1RA 1D3PB 1V2NT 1NRSH 2V3OH 1DOJA 1Y3YA 4NIXA 5EPNA 4TWWA 5FHTA 3SGAE 1O2XA 2VNTA 5FX5A 1AB9C 1Y8TA 5JBBS 4D7GA 1O36A 3GOVB 2J92A 3MO3A 4FXGH 1BTUA 3RMOH 1SGTA 4ZAEA 1TRYA 4YLQH 2W26A 3K2UA 1F0TA 4HGCA 4BOHA 3MTYA 3Q3KA 2O8MA 4JYUH 1A5HA 4NA9H 1DSTA 1CT2E 1SGEE 5JBCS 2R0LA 2WPJS 3CS7A 1WQSA 3Q76A 1B7XB 1MZDA 2G4UA 4X2VA 1WYKA 3VB4A 1GJDB 1P03A 3E6PH 4ISNA 5FAHA 3F9HA 4GVUA 1J15A 2XW9A 5GPIB 2R0KA 3ZV9A 4RN6A 1QQ4A 2ZHDA 3KF2A 5J4SA 2Y6TA 1TGBA 1VITG 2GCTB 1IQNA 3BEUA 1GBKA 1DWEH 1C5QA 3ZZAA 3LH3A 1L4ZA 2A7HA 1D3DB 4INHA 2FYQA 2GDEH 1A5GH 2FLBH 1C2LA 1SB1H 4NIWA 3SI3H 3SNBA 5DPAA 1THPB 1GBJA 4OGXA 1K2I1 4ISLA 4JZIA 5FPYA 2A7JA 2CJIA 2ZPQA 2ZFPH 2ZHFH 2GP9B 1YCPK 5FPTA 2NWNA 5E2PA 1O2RA 2HWLB 3PMHB 2BXUH 3CS0A 1QB9A 1O2MA 3UNQA 2FI5E 3ZYEA 4B75A 3A7XA 3BN9A 4X8SH 2QXJA 2FOMB 4RSPA 4XFQA 4YZUA 5DP3A 2JETB 1YBWA 4ZKRU 1G3EA 3B8JA 2AGEX 4ZH8A 1ZZZA 2J94A 2BY6X 2P16A 8KME2 5B6OA 4NZLA 3OYPA 1T4VH 5A0AE 3SV8A 5K7RA 1O2ZA 1KXDA 3O8DA 1G37A 1UTLM 4LZ4B 1NM6A 5IYTA 1XUKA 1V2TT 1E0FD
chains in the Genus database with same CATH superfamily
2Z6BD 1NRPH 1T8OA 2FODA 5CHAB 2ZQ2A 3MU4A 1GI4A 3SJKA 4B2CA 1H9HE 2KCOA 1SOTA 1YM0A 4ABJA 3P92A 3PTNA 2BQWB 1CGJE 4Y76A 4BANB 2IN2A 1MMJN 1QJ6B 3DT0H 2LNCA 3E0PB 3FP8E 1CA0B 2AMPA 1C5VA 1UCYE 1K1PA 1JRSA 1G2MA 2ZU3A 1O3IA 1LTOA 2VINA 3NZIA 1TOMH 1UVTH 1O3MA 1FPHH 1VGCC 1YGCH 1XVOA 3KCGH 4Y8ZA 2WPIS 5DP7A 2RFKC 6CHAC 1Y5BT 4OS6A 4I33A 4AFZA 2SGDE 5LPFA 5K0HA 2ZGJA 4FUDA 4WMDA 2QGRA 1VKYA 4NCYA 1C1PA 1F2SE 1BCUH 1K1JA 3UFAA 1O32A 2ZU2A 5A2MH 3WY8A 1O3AA 2JH0D 3U8TH 2WUCA 1LDTT 1LPGB 1ELCA 1MD7A 3UR6A 3M3SA 1WBGB 2D1JA 1NS3A 3P8FA 2XYAA 3OE7D 1LPKB 5DP8A 5GWZA 1ZSJA 3SV2H 1QB1A 2HNTF 3LPRA 3SJ9A 1P10A 3SQEE 3E90B 1SSXA 4AG1A 3BTEE 1NU7B 1KY9A 2GT7A 3RMMH 4XOJA 3LDXH 1Q31A 1VITF 3A8BA 4E7NA 2K8IA 3RM0H 1TFXA 4DIHH 1SGCA 3HK6B 2Y7XA 2GZ8A 1T31A 4Q4LA 1U6QA 4INKA 1ZTJA 2OINA 1GWAA 4ZROA 1MU8B 2RG3A 3LJJA 4CRFA 3URCA 3QWCH 2ANWA 1MD8A 3UQVA 1A7SA 1ZPZA 4E05H 1O2YA 3A8CA 4DURA 2J38A 1AFEH 1NT1A 2OBQA 1DXWA 1G36A 2GV7A 1TBZH 1A61H 2ZGCA 2WV4A 3SI4H 2UUYA 3F9EA 1H1BA 2BHGA 2OK5A 1GHVH 3AAVA 4X2WA 3C1KA 3MFJA 1A0JA 2GCTC 1QNJA 2FOBA 3RMLH 3RP2A 1SGFG 3MQKC 2XBYA 3GY8A 4X8TH 3LGVA 3A83A 1EZQA 5B6LA 1OKXA 1G3DA 2ANYA 3SGBE 2SGFE 5LPEA 3GY6A 2XBXA 2TRMA 2HRVA 3HGPA 4AGKA 1H9IE 1AD8H 1Y5AT 1BJUA 1LMWB 2P8OB 2YNBA 5EJZA 1GL1A 1V2LT 4Q7XA 2XTTB 4HG6A 1KLTA 2FX6A 3VEQB 1J14A 1SHYA 4ABBA 1QR3E 2TGTA 3FP7E 3UWIA 4KKDA 1NESE 2FEQH 2JETC 2L74A 1QBVH 1XUHA 1HAGE 1YKTA 1S85A 3A7TA 4PROA 1CGIE 3MH4A 2BD5A 3MNXA 3SUDA 1IQHA 1NFWA 3MO6A 5ESBA 1P57B 3BV9B 3P95A 1RD3B 4ACBA 3MHWU 2DE8A 4B76A 5F8TA 1BUIA 2ZA5A 2F9VA 2PP6A 3STJA 4O97A 3D23A 5J4QA 4UD9H 1WTHD 1GCTB 2O9QA 2FI3E 1KDQA 5KGOA 3LGWA 4MNYA 1HBTH 1OWIA 2ZIQH 3DSPA 1UTJA 4A1VA 4Z6AH 1CA0C 5GJ4B 2ZF0H 4FUBA 1P2MA 4UFGH 2J5UA 3T28A 3BTHE 2PGBB 2B7DH 4RT0A 1GHAF 1PYTD 2PKAA 3V3MA 1DICA 1GJ4H 2ODQA 1Z71A 3RC6A 7GCHG 3S7KB 3GYMA 1ESAA 3VB6A 3H5CB 2R2MB 1C4V2 3T26A 1WQVH 2IPHA 1IHTH 2C8XB 4AB9A 5JYIA 4MNXA 5C1XA 1YPEH 4B71A 1ETTH 1W13U 4YOIA 1UJ1A 4CHAB 1QBNA 1KDQB 2OC1A 1GJCB 1C5ZB 1WOFA 3IITA 2BQ6B 3ODDA 2A4RA 3ZZ4A 2M5TA 3LGYA 3F6UH 2IOTA 3EE7A 5SGAE 4TPIZ 1JRTA 1LVYA 1S81A 2FTMA 1ID5H 1RIWB 1O3BA 2AGIX 3ELAH 2OCVB 4XSKU 3U9AH 4I86A 4MPWA 1NO9H 2PKAB 1ABJH 1G2LA 3A82A 4KTSA 3K6YA 4X6MA 2ESTE 4AOQA 2VWLA 1TPAE 4TSFD 3O8CA 2TIOA 5ETXA 8GCHF 1YY3A 5C20A 3RXSA 2CF9H 2ILNA 1UMAH 3N7OA 1QA7A 1TNLA 3GY3A 2VGCC 2V35A 3U8RH 1FLEE 1ZPBA 1MTUA 1P2KA 2I6SA 1QJ1B 3U8OH 2H9EH 2BDGA 3NK8A 3OY5U 3F2FA 2AMDA 1BRCE 4WF8A 3RXLA 2CN0H 3SNDA 2SNVA 1ZHMA 4BAHB 3TH3H 5EOKA 2FP7B 4GLYA 1C2KA 1ZJKA 2P3FH 2PUXB 5L2ZH 1GDNA 1WDIA 4HFPB 3UIRA 1GJAB 2HOBA 1FUJA 5FCRA 1TQ7B 1SLUB 2ZU1A 2G52A 2P95A 3QTVH 2K1QA 2BY5X 1RJXB 1P3CA 1WUNH 1FN6A 3P8OA 5EW1H 1RS0A 2IJOB 4Y0ZE 1MTWA 1NU9A 2BOKA 1GI7B 1RFNA 1PPZA 2FLRH 4WY3A 1O2PA 2P8OC 2A45B 1Y3XA 2PSYA 2VH0A 3P8NA 1FDPA 4FUCA 1DXPA 1Y5UT 1YPKH 4U30A 2BLWA 3GISB 1RTFB 1UO6A 1C2GA 1ZHPA 1C5NH 2UWPA 2A4QA 3VXEH 1MH0A 2ZPSA 3LU9B 2GT8A 3JZ1B 1LHCH 1TBQH 4O3TA 1O3DA 1GPZA 1F5LA 4Y0YE 1O2IA 4KTUA 2PGQB 5E0HA 1O2NA 2LPRA 1NTPA 1IQMA 4FOUC 3SOSA 4D8NA 1Z8IB 3SJ8A 4D76A 1OOKB 7GCHF 1WCZA 2W3KA 2O8UA 2H9HA 1GHZA 1C1SA 2WYGA 1EATA 3E1XB 1GI1A 5DJ7A 1GVLA 2BMGB 2V6NA 3TGJE 1O3LA 3QUMP 4U01A 4YO9A 1AZ8A 1C4U2 1QY6A 4AB8A 4BTTB 3UTUH 4I7YH 3HKJB 1OWDA 2P3UB 2AIPA 1V2WT 1HAZB 2DE9A 1GCTC 1K22H 3CP7A 5E2OA 1T8NA 4X6PA 4NA7A 1DS2E 1S0RA 5T6GA 1GI0A 1GBMA 3SV6A 4YT6H 5DP9A 4Y11E 4ZCNA 3NUMA 2VIOA 1SI5H 2Y7ZA 3MU5A 9ESTA 1UK4A 3TJNA 1EZUC 1S84A 1QRWA 3D49H 2ZCHP 5EG4A 4UDWH 4NWKA 5DSFA 3F1SB 2RA0A 3M35A 1P9SA 1UTNA 3O8RA 2VIWA 1P04A 1Y3UA 2PWXA 1C9TA 2ZDMA 3M61U 1ELBA 1ABIH 2NU1E 2XWBI 3EA8A 1H4WA 2PTNA 3ATWA 2NU3E 1YPLH 3DFJA 1RXPA 1BMMH 1CBWB 1Z1IA 2PHBA 1O2LA 4GSOA 3UNRA 3LIWA 1SFQB 1H8ED 1SL3A 2VIQA 1P9UA 1DE7H 5DP4A 2KCAA 3MYWA 1HYLA 3ZVAA 2WYJA 2GZ7A 3TLOA 5GCHG 3TK5A 1TX7A 4MNVA 1TPOA 1P09A 1ELGA 2J2UA 2HPQH 1TQ0B 2XCNA 3A87A 1UTQA 2W6ID 1L2EA 1Q2WA 2FM2A 3ZZBA 1D6RA 4B6EA 2JKHA 2QY0B 3A85A 3B23B 1ACBE 1GDQA 1SLVB 1MKWH 1K28D 2QF0A 3A84A 5FCKA 2I6QA 4BAMB 1ZGVA 5KECA 2HALA 4I8JA 2VVVA 2P59A 1NRNH 1XMNB 4X6NA 1HXFH 3GY4A 4AFUA 2W7UA 1BTYA 2TGAA 3EQ0H 1EZSC 1FY8E 1O2OA 4K1EA 1AU8A 3FO8D 2Y5HA 4B2BA 3RU4E 1UHBA 2ANKH 1AWHB 2Z7FE 4IMQA 2KCPA 4U32A 4D7FA 3LGUA 1GVZA 2F9NA 4CRGA 4DIIH 2GCHG 1AY6H 3ATLA 4QT8C 2FIRH 1GJ9B 5EU8A 3KQCA 2ZNKH 5C5NA 3U69H 1AKSB 2BD2A 1TGSZ 3I77A 1JWTA 4MVNA 1O31A 2Z9JA 4ESTE 1W0YH 1TRNA 3KEEA 3SJIA 1ELEE 1EB2A 1CT4E 1K1IA 1EJAA 1VR1H 4JMYA 1B5GH 1HAIH 3MI4A 1TYNA 4Y8XA 1FQ3A 3OTJE 2C4FH 1OWHA 1P2JA 2PR3A 1HFDA 2A5IA 1UHBB 4ABDA 1E36B 2WPMS 3PROA 4A5TS 1BTXA 2XBWA 3LJOA 2Y5GA 3ATIA 1YPMH 4DT7B 4HI3A 1A3EH 1FAKH 1IQFA 2QF3A 3PWCA 3RXEA 3AW1A 2GMTB 1C1WH 2HLCA 1FIWA 1BRAA 1C5RA 2QYIA 1DFPA 2KX4A 3FZDA 1T7CA 4FUGA 1LQEA 3KQDA 1MKWK 4CR9A 1HJAB 3RXFA 1SGNE 1JXPA 3H7TA 9LPRA 3SV9A 3Q00A 1ZHRA 1FNIA 1O3JA 4NIVA 2FTLE 3FN8A 2FMJA 1S6LA 3M7QA 1G3CA 2A2QH 1ZOMA 4CH2B 2XCFA 5TCAA 3ZZ5A 1BTWA 1AQ7A 2JJ1D 4WMFA 4Y7BA 1D4PB 1HDTH 2D2DA 1SC8U 1DY8A 2G4TA 2YMSD 1MCTA 3RXJA 3SN8A 1TNHA 1PYTC 5EQSA 1GMHG 1EAWA 3PWBA 2B9LA 5GCHF 4X1QU 1S6HA 4KP0A 3IWMA 1QZ8A 3QLPH 1FV9A 3N7EA 1P2NA 7LPRA 4FU8A 1E34B 4XE4A 1P05A 2UWOA 2ZGBH 4JZEH 1C2JA 3GY2A 3RM2H 2HPPH 3IG6B 4FUJA 1NBME 1O5GH 1GHYH 3RXCA 4ZKNU 4E06H 3GY5A 5GDSH 2OC0A 2IPQX 3SBKA 4M9FA 2UWLA 1SQAA 1CBWC 3TNTA 2ZFTA 4ISOA 1QCPA 3TK9A 3BTTE 3M7TA 1TNKA 3VPKA 4UONA 2NU4E 2ZHEH 1TNGA 1E79D 3RLYH 1ZJDA 1V2PT 1TNJA 1V3XA 3DCLA 1BDAA 1C9PA 2GCHF 4CR5A 2P94A 2C90B 1ZSLA 3NXPA 1JMOH 1LCYA 3FZZA 1W11U 2ZZUH 4OS5A 2PUQH 1XXFA 2VIDA 4ZKOU 5DGJA 1QJ7B 1GGDC 1GJ5H 3EAJA 3H09A 1F5RA 2SGAA 4GPGA 4UEHH 4K8BA 1C5YB 3DUXH 1ETRH 3AK5A 1QL7A 4CRDA 1W10U 1TLDA 1V2KT 4Q2KA 1F0UA 1M9UA 3P70B 2KCYA 4A1XA 3KNXA 3STIA 4TWYA 3URDA 3S0NA 4AN7A 1EXFA 1UK2A 3UR9A 2BZAA 4ABFA 4OM9A 1HJ8A 1HV7A 2ZCKP 2ZP0H 2UUKB 2K0QA 1AIXH 2OQ5A 2BLVA 3DA9B 3OEED 1P02A 1KXCA 5BRRE 3L6PA 3A7VA 3GCOA 2FDAA 5F6MA 8LPRA 2VU8E 3SJOA 3QX5H 3ZVBA 1FONA 3K65B 4I8GA 2FZZA 3PRBA 2Y80A 3RXOA 3MH6A 5DN6D 4YT7H 2VGCB 4IS5A 1MZAA 1O37A 3F0PA 5I25A 3GCNA 1FY1A 3SU5A 3D65E 1C5OH 4JZDH 2JH6D 2UUFB 1ZPCA 1OP8A 2RDEA 3E0NB 2GMTC 2J98B 3HK3B 4D9QA 1TX6A 1NY22 3ODFA 1O2QA 2RA3A 1IQJA 2HNTC 2FESH 1GMHF 1YC0A 4ZHAA 2AERH 2CHAC 1C2EA 4Y71A 3FANA 1HJAC 1ZTKA 4ZXYH 1W8BH 2AGGX 3V7TA 3LH1A 5A09A 4YOGA 1ESBA 1QGFA 3QZRA 2FOAA 1SQOA 2H6MA 3A8AA 3KQ5A 1DANH 1MBMA 1PQ7A 1T32A 2B5TB 5LPRA 1GI8B 4NIYA 3ZVCA 2WSSD 2ZFQH 3LT3A 5DK1A 1ZYOA 2BVXH 4CRAA 4BAQB 2J34A 1EJMA 1YPGH 5AF9H 5C67A 2Z9LA 1Z6JH 2GKVE 6GCHG 4MTBA 3NWUA 2ZDAH 4CREA 1MQ5A 5EGMA 2EQNA 1ETSH 1E1QD 2D8WA 1E1RD 4INLA 3UWJH 2D26C 1IQEA 5EQRA 4X2XA 2V7QD 4Y8YA 2QXIA 5GIBA 4Y6DA 1CGHA 2ZFFH 2Y82A 1BHXF 5FPSA 2ZTXA 2HLDD 1ANEA 1A5IA 2XXLA 1TWXB 4A1TA 3DSOA 1P01A 4H4FA 1QQUA 1Q3XA 3SORA 1GMDG 3KQEA 1YLCA 4NWLA 1KIGH 1TNIA 1MU6B 4WVPE 5H4IB 3SYJA 2XNIA 4YTAA 1QHRB 3B9FH 1SG8B 1EJNA 4TY7A 3GICB 4SGAE 5I46H 5DO4H 2CV3A 2ZECA 1SGIB 1HAHH 2AMQA 3BG8A 2BTCE 1P3EA 5HXFA 4ZMAH 3U98H 2VIVA 4AORA 5A8XA 1P2QA 5A0CA 2FYRA 1C5WB 5T1VA 1JIMA 3T27A 1OYQA 2WPLS 1C5SA 1L1GA 2G00A 2G8TA 3DSGA 1NRRH 1H8IH 5A8YA 1O3EA 1QL8A 2OQUA 1OXGA 4NFEA 3TJVA 4CBNA 3RXRA 4DY7B 5EW2H 4XDEA 1RTLA 2C3SA 2QF5A 3L33A 2C8WB 3PV4A 1ESTA 3QO6A 4TT3D 3GY7A 2Q6GA 3KL6A 1ANCA 1GBEA 3DFLA 4U2WA 4CRCA 1V2JT 2J4IA 2A4GA 4GHTA 2ZEBA 1THRH 1XVMA 2FPZA 5F53A 4ZKSU 1Z8JB 1GI5A 1O5FH 4F49A 2CMYA 4K1TA 1ZLRA 3SHAH 3OU0A 1T4UH 1W14U 1SVPA 1BRUP 2BVSH 4MDSA 1XX9A 3V12A 3ZVGA 4BXSA 1ANBA 3MU1A 3SQHE 3T2NA 1O3CA 4O9VA 5FX6A 2GVFA 3GCHB 3AASA 5C0TA 4MPUA 1MTSA 1BOQA 1YCPM 1XUFA 4NSVA 1P2OA 2H9TH 5JPMH 1CT0E 1QRZA 1TALA 2EI8A 3W94A 1V2VT 3PO1B 1UTOA 1GBLA 5C5OA 1GBTA 5LGOA 3BSQA 3OEHD 2WUBA 1WV7H 5C1UA 1A3BH 3AAUA 3SUFA 3DD2H 5EXMA 4FUHA 3BIUH 2A7CA 3A80A 6GCHF 2PTCE 3BTKE 3TU7H 3G01A 2QXHA 2P3TB 1A0LA 2Z9KA 1OWJA 3PB1E 1SFIA 1QTFA 2V3HH 1CQQA 4TY6A 4UFEH 1ELTA 2A1DB 2LELA 1HNEE 1TBRH 3HPTB 2XC5A 1BRBE 1ZRBA 3BEFB 5E0GA 1O35A 4MNWA 1W2KH 3R0FA 1Z8RA 3FP6E 1ELFA 3RLWH 1BZXE 1GI9B 1GMDF 2PV9B 1O3OA 4MPVA 1TE0A 3SU6A 5HMAA 3BIVH 1OP2A 1A4WH 4LXBH 1VCWA 2F9BH 2XOKD 4IN2A 5JBAS 3MH7A 3UPEA 1Y3WA 4SGBE 2XRCA 1O2SA 2W7SA 4XBCA 3BTME 2H1UA 3EDXB 1J9CH 1N6XA 1EP6A 1NFYA 3TH4H 1EPTA 1YP9A 3WWBA 3LGTA 1BBRH 2A31A 5G4BA 2QN5T 5TCCA 1O38A 2SGQE 2M2AA 4B6FA 3TJUA 3VGCB 1ZMLA 2WZQA 5IDKA 1FY3A 3RDZA 1E37B 1O33A 1UVPA 1TA2A 1HXEH 2BDIA 2F9PA 2W3IA 4X1PU 2XWAA 5EXLA 4A7IB 3LKWA 2Z3DA 1KYNA 1A46H 2GTBA 1YYY1 4K69A 1S6FA 4IN1A 2EC9H 3K9XB 1O34A 1B0EA 4XRNA 4ABIA 1EPTB 3KHVA 2ZTYA 5HKKD 1EOLA 4X1NU 4FU9A 3SUEA 2YNAA 1SLWB 1GG6C 1HPGA 2ZTZA 4GUXA 1BMFD 1NZQH 1PPHE 1V2ST 4NFFA 4JYTA 4ASUD 1C5UA 4WH8A 2V0BA 4RT1A 3SO3A 3QDZB 2FOCA 3SU3A 1SQTA 4ABGA 4ASHA 2HNTE 4JYVH 5JDUB 3PRDA 4DGJA 2QAAA 4ISIH 1GMCG 1AN1E 4VGCB 3SNAA 3UNSA 3UB0A 4I8HA 4XD7D 3MNSA 2ZDLA 3A81A 3RU4T 3BEIB 1S0QA 1CVWH 1DSUA 2PW8H 1BBRK 1KTTB 4UFFH 2C8ZB 2STBE 4H6TA 4OS2A 2ZDKA 1BQYA 2SGPE 4H42U 2F91A 4D9RA 1HAPH 1LQDB 3DHKH 4A6LA 3U28C 1S82A 1UVSH 5DP6A 3FOAA 1Y59T 1Z1JA 2VIPA 5LH8A 1FAXA 1HCGA 1QRXA 2FOEA 5ESTE 1O30A 1MQ6A 3RC4A 3P17H 1CO7E 1FXYA 2A5KA 2Z94A 3GCHC 4WJG2 2J95A 2JDID 1KMHB 2NU2E 1C5XB 1C1MA 1GJ7B 1OWKA 4AZ2B 3T25A 1UVOA 2PFEA 2OD3B 2QV1A 2ZQ1A 3TJOA 3PO1C 2RDLA 4NG9H 1VITH 1N6YA 1AKSA 1C1UH 1HAXB 1DT2A 2ZGHA 4MQAA 1GGDB 1C5PA 2OBOA 1KXEA 1L0ZA 2AS9A 1GI2A 4UFDH 2BD4A 1AMHA 2B8OH 3BTFE 5EPYA 3RU4D 1O3GA 1P12E 3S9BA 3HKIB 4X6OA 4IMZA 4ABHA 6LPRA 4ABAA 3RXAA 1D9IA 3OFND 1IAUA 1BTHH 2FS9A 3UAIC 3F9FA 5GNDA 5AVDA 3R3GB 2BX3A 2R9PA 2ZU5A 3L3TA 4CRBA 2CF8H 2Y81A 3FFGA 1XUIA 1XKAC 2HGTH 5F8ZA 3S69A 2SNWA 4GAWA 3ZZDA 1BB0B 4O3UA 2Q1JA 1CE5A 4HTCH 3SUGA 3LGIA 1HAOH 3BG4B 2FI4E 2GV6A 2VH6A 2BX4A 1GI3A 1LHFH 3SZEA 2BZ6H 3AW0A 4THNH 1BTPA 4JCNA 4TPYA 3RXUA 4BAOB 2BD3A 1MTNC 4R0IA 3ZV8A 5T6FA 1Y3VA 3NPSA 4ZHMU 1N1LA 3S9AA 1K21H 3VGCC 1CHOG 5KEDA 1O0DH 3Q3XA 3Q77A 1W0KD 1C1TA 2Z9IA 3TNSA 4B73A 2CHAB 2DUCA 4OGYA 2VWOA 1LKAA 4HZHA 2EI7A 2AEIH 1O3PB 1SGQE 1A0HB 3HGNA 1ARCA 2OUAA 1GMCF 2OLGA 1FY5A 2BOHB 1D3TB 1UVUH 1J8AA 3LC5A 1C5TA 3VG8A 1EPTC 2BDHA 2C8YB 4Q7YA 1CA8B 5EXNA 4E7RG 2ZHQH 5DP5A 5F8XA 1YPHC 1K9OE 4F4OC 3VB3A 1AUJA 1LVOA 1GCDA 1QB6A 3MH5A 2OC8A 1E38B 1IQKA 1EKBB 1C1QA 2B0FA 1PQ5A 1XUJA 4AFSA 1GVKB 3TITA 3AVZA 4I32A 2R2WU 3PV2A 5C3NA 1AE5A 3O8BA 2CXVA 3RXQA 3UOUA 1C2MA 1KXBA 1LVMA 3TGKE 2BY7X 2G51A 3KGPA 1V2UT 3LC3A 3F9GA 3QGJA 1VCPA 3WWFA 1P8VC 1TPSA 1FPCH 2GDDA 5DG6A 1KSNA 1KTSB 2BDAA 3ZZCA 3A7ZA 1GBCA 2ZWLH 3OSYA 1ELAA 4FVBA 2FOHA 1F0SA 2OTVA 5TJXA 1VJAU 1NBMD 1GJ6A 4VGCC 7KMEH 1GBIA 1FZZA 1HLTH 2ZG0H 5AFYH 1BT7A 1PPCE 2G5NA 2VB0A 4AYYB 3ZZ9A 1AVWA 4B1TA 5JB9S 4I31A 1O3NA 1O2UA 3I78A 3UY9A 1F0RA 5JBTA 1MBQA 2A5AA 3M5MA 3KQBA 2BB4A 1TOCB 4TYDA 1W12U 3RUOA 2PSXA 1O5EH 2A2XH 1FMGA 3S9CA 4DJZB 3F0OA 1GHXH 1N8OB 1J16A 1ELVA 1YLDA 3P8GA 4AFQA 1AFQB 3GDVA 6ESTA 4I8KA 1PJPA 1O2TA 5FBIA 2QA9E 4IGDA 1C5LH 1C2DA 2GX4A 1BHXB 1C1OA 3BTQE 2VJ1A 3ZYDA 3SU4A 1AE8H 1O2HA 4ZUHA 3BF6H 2BD8A 1GBFA 1F92A 3SNEA 1GDUA 1HUTH 1SBWA 4WWYA 4ZXXH 1BITA 1UK3A 3TPIZ 3UOPA 1EUFA 2EY4C 2EI6A 2O8LA 5AFZH 1P0SH 1EX3A 1ELDE 1CU1A 1DY9A 3NKKA 2BYAX 1DPOA 3A86A 4F55A 5DKMA 1XUGA 4XBDA 3FAOA 3F68H 1OPHB 4FUIA 5C17A 2FXRA 4IW4E 3T29A 3KYGA 3I29A 2JH5D 1TMBH 3GYLB 1H8DH 2L6OA 2SGEE 1CHOF 4I8LA 2O8TA 2ZFRH 2ASUB 1AO5A 1SKYE 1S83A 2VBCA 2Z3EA 1ZMNA 2J98A 1O5BB 2ALVA 4J2YB 1HAVA 1OP0A 1TABE 1AGJA 5EODA 1PPBH 2HVYB 1O5AB 4RI0A 3MNBA 1G30B 2F83A 1C4Y2 3PM3A 4Y7AA 1BMLA 3RMNH 5L2YH 1DWDH 3BG4C 3PLBA 1F5KU 1H9LB 1UCYH 3CNRA 1THSH 1W3CA 2ANMH 2J9NA 3F2HA 1O5DH 1SMFE 4DW2U 1SGFA 1GHAG 2OP9A 1K1LA 1GBDA 1H8HD 4CH8B 2O8WA 4Q80A 1NFXA 2TGPZ 1EFRD 2NU0E 1HRTH 1HAYB 1TX8A 3ZZ8A 2C93B 3M5NA 3T62A 1T8MA 1OHHD 1PFXC 4OS7A 5C94A 2ODPA 1IQLA 1TMTH 1HAVB 2QF4A 4NSYA 1V6DA 4WXVA 1WAYB 4B74A 4AG2A 1NN6A 1TGCA 1HJ9A 1X7AC 2ZDNA 2PKSB 2FO9A 3ZVDA 2THFB 2ZC9H 2ZHWH 3M37A 1P06A 5C2ZA 2G55A 3U1IB 4FU7A 2GD4B 2W5EA 4K2YA 1FN8A 2AH4X 1QURH 4AYVB 1YLNA 2AYWA 2WV9A 2TPIZ 5FXLA 1VZQH 4YESB 5L6NH 2SFAA 3A89A 4NGAH 3FVFB 2VWMA 3D62A 1DVAH 1MAXA 1LVBA 2YMSB 1NRQH 2VVUA 3RXKA 3ZZ3A 1C2FA 1TB6H 4J1YA 2FOGA 2F3CE 1BMNH 8GCHG 1O2GH 1W0JD 1DDJA 1AVGH 3ENSB 1O39A 1JBUH 2ZCLP 4RKOB 4KGAA 2G81E 4X8VH 3SU0A 1O5CB 2R3UA 1NFUA 1C2HA 1PQ8A 3VB7A 2F9UA 1O3KA 1Z7KA 1TONA 1UCYK 4K8YA 4IBLH 1NC6A 1PPEE 2WV5A 5E0JA 1G3BA 3Q3YA 2ZU4A 1LHGH 1AUTC 2ZFSA 2ODYB 1MKXH 1HIAA 1EAIA 1DX5M 1KLJH 1AWFH 2H5DA 3MMGA 1A2CH 2IJD1 1UW7A 1GBBA 2CGAA 2GJGA 4BTUB 4DOQA 1SQRA 5E8EH 1N8OC 1S5SA 2TGDA 4CBOA 1GG6B 4MG3A 2WHXA 3GCTG 1AFQC 4BTIB 4WXIA 5FL7D 2Z3CA 1TGTA 3MOCA 4JK5A 3RXGA 3SV7A 3EA9A 2R3YA 2EEKA 4B2AA 2ZKSA 3MNCA 1YF4A 1K1MA 1Z8GA 4UE7H 1QBOA 5ABWA 2FWWA 5HGGA 4JK6A 4DVAU 2GZ9A 5CHAC 1HIAB 1DM4B 3PMBB 4X8UH 3RXDA 4Z1MD 1O2KA 1AHTH 1ARBA 2HVXA 1RGQA 5GXPA 2QIQA 3QTOH 1SGDE 3TIUA 3U1JB 1J17T 1YPHE 2VVCA 2QC2A 1NPMA 1EASA 3PMJA 4Z0KA 3RXTA 4A92A 3TH2H 4WH6A 1UTMA 3PYHA 3QK1A 3BTWE 4FUEA 1DITH 5CHBA 1DWBH 2A4OA 1E35B 2KM0A 5A8ZA 2XBVA 1C1RA 1YWUA 1LO6A 1MKXK 3EA7A 2UUJB 1TA6A 1VJ9U 1HB0B 4M7GA 1IHSH 4ZHLU 1SGPE 2CK3D 4K60A 3W95A 2KR7A 3KN2A 1TIOA 4JZFH 2BVRH 3T5FH 1ZTLA 5T3HA 1ZR0A 2WPHS 3OAAD 2BXTH 1EOJA 2RCEA 4AGJA 1GL0E 1L1JA 4MLFB 3BTGE 2JIZD 2AIQA 1KXAA 4IC6A 2STAE 3ITIA 1TRMA 4K5ZA 4LK4A 3MU0A 2BD9A 1V2RT 4BXWA 3UQOA 1EAXA 1BBRE 1FI8A 2FOFA 5C0UA 1MUEB 1SOZA 3GDUA 4GCHG 5EJLA 3VXFH 3JZ2B 4ISHH 4NZQA 3OX7U 3ESTA 4FUFA 3TK6A 1XM1A 5CE1A 4X1RU 1WTGH 8ESTE 2PKSC 2BDYA 1OSSA 1P2IA 1RRKA 3SNCA 1COWD 1MTVA 1K1OA 3M3VA 1EAUA 1G32B 1SPJA 1C1VH 5HYOA 3OTPA 4BNRA 3P6ZB 1C5MD 3ZZ6A 3M36A 1CHGA 4IC5A 1WXRA 3N7DA 1GHBG 2ALPA 4X1SU 2F9OA 4O03A 1V2QT 5CMXH 3RXHA 2OC7A 1O2VA 4ACAA 3ZZ7A 2YMSC 4DCDA 1GHWH 2XC0A 1MTNB 3SHCH 1DUEA 1L4DA 2KAIA 2XC4A 1ZSKA 1B0FA 3GCTF 1INCA 1AB9B 3A88A 3W1EA 2BDCA 1QIXB 5JB8S 1JOUB 2ZDVH 3ZIAD 4Q63A 7ESTE 3M5LA 1UTKA 3RXIA 1XKBC 2EA3A 4YM9A 2ZGXH 1ZRKA 5CDFE 1JIRA 2ULLA 3RC5A 2BLOA 1HGTH 1IOEA 2WINI 2ZI2H 2A32A 1PPFE 2W6JD 1TMUH 2WPKS 2AFQB 1W0ZU 1WSSH 4GHQA 2Y5FA 5IK2D 2BQ7B 1EB1H 2Q6DA 3MO9A 3VB5A 1SLXB 4X0WU 1PPGE 2QE7D 3NCLA 4LZ1H 2J97A 3C27B 5T6DA 2TBSA 2KAIB 1O3HA 1W7GH 5EQQA 3TGIE 1AZZA 1BA8B 4RKJB 1OYTH 3SZNA 1MCVA 1VCQA 2P93A 2ZO3H 3LONA 2AHME 3SW2B 3M7UA 1NROH 3OY6U 3ZVFA 2H5CA 3CENA 4P00A 1EZXC 3HATH 1ZGIA 4NA8A 3RXPA 3M5OA 4YXWD 1K1NA 1GI6A 3RXBA 4KTCA 2PLXA 1BJVA 4Y79A 3PMAB 2WPDD 3UREA 3TVJB 4P02A 1G9IE 1RTKA 5A0BA 5C1YA 3A8DA 2A0QB 3F3BA 1SHHB 1YPJH 3BTDE 3KYFA 1AI8H 1MABB 1EP5A 4K1SA 4K3JA 3QN7A 3K6ZA 1BMAA 1ORFA 2FS8A 3M3TA 4MPXA 3MU8A 1IQIA 2GGVB 3S7HB 3RXMA 2BDBA 1O3FA 1O2WA 2QXGA 4ABEA 1P11E 2BY8X 4WMEA 1KLIH 1BIOA 3E3TA 1FIZA 1TGNA 3EYDA 1QA0A 3QGNB 1V2OT 1OWEA 1V2MT 3A7YA 2VWNA 4LOYH 1FX0B 3SU1A 4AX9H 1C1NA 4KELA 4R8TB 4H6SB 2YOLA 4GCHF 5BPEA 2OXSA 1FJSA 1QL9A 1DWCH 1LKBA 3MWIU 3V0XA 1DLEA 2KFWA 3QZQA 3EE0B 1LHDH 4CHAC 4OS1A 1W7XH 1L1NA 3ZVEA 1D3QB 3ATMA 3GS9A 1EQ9A 4Q7ZA 2Q6FA 4YLUA 3UUZA 3PLPA 1GBHA 1UTPA 3V13A 3F2GA 1MAYA 1RIWC 2BD7A 5F03A 1FY4A 3KIDU 1LPZB 2ZPRA 2BM2A 3VFEA 1GHBF 1XXDA 1SGRE 1T8LA 3GDSA 1AVXA 1O2JA 1CSOE 1SGYE 3RXVA 1PQAA 1LHEH 2F43B 2G5VA 4JZ1A 1SR5C 4YOJA 4FVDA 2BLQA 2BY9X 1VGCB 3PTBA 4DT4A 2QCYA 4X2YA 5AHGH 5FBEA 5HM2A 4DG4A 1F7ZA 3N99A 1OS8A 3SU2A 4BAKB 6CHAB 2FX4A 2V3MA 3E8LA 1TAWA 1GJ8B 3ATKA 1OX1A 3PLKA 1C2IA 3E91A 5HM9A 1KXFA 1TPPA 2Z9GA 4Y10E 1QFKH 1GBAA 1GJBB 4OS4A 3SGQE 1BTZA 3PV5A 5L30H 3E16B 1DLKB 5PTPA 1ANDA 3H7OA 1ZMJA 3A7WA 1D6WA 1IQGA 4XBBA 3LOXA 3EGKH 1DUAA 1YCPH 1Z6EA 1WU1A 2H2ZA 1A1RA 1D3PB 1V2NT 1NRSH 4FETA 2V3OH 1DOJA 1Y3YA 4NIXA 5EPNA 4TWWA 5FHTA 3SGAE 1O2XA 2VNTA 5FX5A 1AB9C 1Y8TA 5JBBS 4D7GA 1O36A 3GOVB 2J92A 3MO3A 4FXGH 1BTUA 3RMOH 1SGTA 4ZAEA 1TRYA 4YLQH 2W26A 3K2UA 2KZ4A 1F0TA 4HGCA 4BOHA 3MTYA 3Q3KA 2O8MA 4JYUH 1A5HA 4NA9H 1DSTA 1CT2E 1SGEE 5JBCS 2R0LA 1K0HA 2WPJS 3CS7A 1WQSA 3NRLA 1B7XB 3Q76A 1MZDA 2G4UA 4X2VA 3FKSD 1WYKA 3VB4A 1GJDB 1P03A 3E6PH 4ISNA 5FAHA 3F9HA 4GVUA 1J15A 2XW9A 5GPIB 2R0KA 3ZV9A 4RN6A 1QQ4A 2ZHDA 3KF2A 5J4SA 2Y6TA 4AC9A 1TGBA 2XNDD 1VITG 2GCTB 1IQNA 3BEUA 1GBKA 1DWEH 5HIZA 1C5QA 3ZZAA 3LH3A 1L4ZA 2A7HA 1D3DB 4INHA 2FYQA 2GDEH 1A5GH 2FLBH 1C2LA 1SB1H 5EJ1A 4NIWA 3SI3H 3SNBA 5DPAA 1THPB 1GBJA 4OGXA 1K2I1 4ISLA 4JZIA 5FPYA 2A7JA 2CJIA 2F4LA 2ZPQA 2ZFPH 2ZHFH 2GP9B 1YCPK 5FPTA 2NWNA 5E2PA 1O2RA 2HWLB 2JJ2D 3PMHB 2BXUH 3CS0A 1QB9A 1O2MA 5HIYA 3UNQA 2FI5E 3ZYEA 4B75A 3A7XA 3BN9A 4X8SH 2QXJA 2FOMB 4RSPA 4XFQA 4YZUA 5DP3A 2JETB 1YBWA 3WW7A 4ZKRU 1G3EA 3B8JA 2AGEX 4ZH8A 1ZZZA 5EIYA 2J94A 2BY6X 2LP6A 2P16A 8KME2 5B6OA 4NZLA 3OYPA 1T4VH 5A0AE 3SV8A 5K7RA 1O2ZA 1KXDA 3O8DA 1G37A 1UTLM 4F48B 4LZ4B 1NM6A 5IYTA 1XUKA 1V2TT 1E0FD
chains in the Genus database with same CATH topology
2Z6BD 1NRPH 1T8OA 2FODA 5CHAB 2ZQ2A 3MU4A 1GI4A 3SJKA 4B2CA 1H9HE 1SOTA 1YM0A 4ABJA 3P92A 3PTNA 2BQWB 1CGJE 4Y76A 4BANB 2IN2A 1MMJN 1QJ6B 3DT0H 2LNCA 3E0PB 3FP8E 1CA0B 2AMPA 1C5VA 1UCYE 1K1PA 1JRSA 1G2MA 2ZU3A 1O3IA 1LTOA 2VINA 3NZIA 1TOMH 1UVTH 1O3MA 1FPHH 1VGCC 1YGCH 1XVOA 3KCGH 4Y8ZA 2WPIS 5DP7A 6CHAC 1Y5BT 4OS6A 4I33A 4AFZA 2SGDE 5LPFA 5K0HA 2ZGJA 4FUDA 4WMDA 2QGRA 4NCYA 1C1PA 1F2SE 1BCUH 1K1JA 3UFAA 1O32A 2ZU2A 5A2MH 3WY8A 1O3AA 2JH0D 3U8TH 2WUCA 1LDTT 1LPGB 1ELCA 1MD7A 3UR6A 3M3SA 1WBGB 2D1JA 1NS3A 3P8FA 2XYAA 1LPKB 5DP8A 5GWZA 1ZSJA 3SV2H 1QB1A 2HNTF 3LPRA 3SJ9A 1P10A 3SQEE 3E90B 1SSXA 4AG1A 3BTEE 1NU7B 1KY9A 2GT7A 3RMMH 4XOJA 3LDXH 1Q31A 1VITF 3A8BA 4E7NA 3RM0H 4DIHH 1TFXA 1SGCA 3HK6B 2Y7XA 2GZ8A 1T31A 1U6QA 4INKA 1ZTJA 2OINA 1GWAA 4ZROA 1MU8B 2RG3A 3LJJA 4CRFA 3URCA 3QWCH 2ANWA 1MD8A 3UQVA 1A7SA 1ZPZA 4E05H 1O2YA 3A8CA 4DURA 2J38A 1AFEH 1NT1A 2OBQA 1DXWA 1G36A 2GV7A 1TBZH 1A61H 2ZGCA 2WV4A 3SI4H 2UUYA 3F9EA 1H1BA 2BHGA 1GHVH 3AAVA 4X2WA 3C1KA 3MFJA 1A0JA 2GCTC 1QNJA 2FOBA 3RMLH 3RP2A 1SGFG 2XBYA 3GY8A 4X8TH 3LGVA 3A83A 1EZQA 1OKXA 1G3DA 2ANYA 3SGBE 2SGFE 5LPEA 3GY6A 2XBXA 2TRMA 2HRVA 3HGPA 4AGKA 1H9IE 1AD8H 1Y5AT 1BJUA 1LMWB 2P8OB 2YNBA 1GL1A 1V2LT 4Q7XA 2XTTB 1KLTA 2FX6A 3VEQB 1J14A 1SHYA 4ABBA 1QR3E 2TGTA 3FP7E 3UWIA 4KKDA 1NESE 2FEQH 2JETC 1QBVH 1XUHA 1HAGE 1YKTA 1S85A 3A7TA 4PROA 1CGIE 3MH4A 2BD5A 3MNXA 3SUDA 1IQHA 1NFWA 3MO6A 5ESBA 1P57B 3BV9B 3P95A 1RD3B 3MHWU 2DE8A 4B76A 5F8TA 1BUIA 2ZA5A 2F9VA 3STJA 4O97A 3D23A 5J4QA 4UD9H 1WTHD 1GCTB 2O9QA 2FI3E 1KDQA 3LGWA 4MNYA 1HBTH 1OWIA 2ZIQH 1UTJA 4A1VA 4Z6AH 1CA0C 5GJ4B 2ZF0H 4FUBA 1P2MA 4UFGH 3T28A 3BTHE 2PGBB 2B7DH 1GHAF 1PYTD 2PKAA 3V3MA 1DICA 1GJ4H 2ODQA 1Z71A 3RC6A 7GCHG 3S7KB 3GYMA 1ESAA 3VB6A 3H5CB 2R2MB 1C4V2 3T26A 1WQVH 2IPHA 1IHTH 2C8XB 4AB9A 5JYIA 4MNXA 5C1XA 1YPEH 4B71A 1ETTH 1W13U 4YOIA 1UJ1A 4CHAB 1QBNA 1KDQB 2OC1A 1GJCB 1C5ZB 1WOFA 3IITA 2BQ6B 3ODDA 2A4RA 3ZZ4A 2M5TA 3LGYA 3F6UH 2IOTA 5SGAE 4TPIZ 1JRTA 1LVYA 1S81A 2FTMA 1ID5H 1RIWB 1O3BA 2AGIX 3ELAH 2OCVB 4XSKU 3U9AH 4MPWA 1NO9H 2PKAB 1ABJH 1G2LA 3A82A 4KTSA 3K6YA 4X6MA 2ESTE 4AOQA 2VWLA 1TPAE 3O8CA 2TIOA 5ETXA 8GCHF 5C20A 3RXSA 2CF9H 2ILNA 1UMAH 3N7OA 1QA7A 1TNLA 3GY3A 2VGCC 2V35A 3U8RH 1FLEE 1ZPBA 1MTUA 1P2KA 2I6SA 1QJ1B 3U8OH 2H9EH 2BDGA 3NK8A 3OY5U 2AMDA 1BRCE 4WF8A 3RXLA 2CN0H 3SNDA 2SNVA 1ZHMA 4BAHB 3TH3H 5EOKA 2FP7B 4GLYA 1C2KA 1ZJKA 2P3FH 2PUXB 5L2ZH 1GDNA 4HFPB 3UIRA 1GJAB 2HOBA 1FUJA 5FCRA 1TQ7B 1SLUB 2ZU1A 2G52A 2P95A 3QTVH 2K1QA 2BY5X 1RJXB 1P3CA 1WUNH 1FN6A 3P8OA 5EW1H 1RS0A 2IJOB 4Y0ZE 1MTWA 1NU9A 2BOKA 1GI7B 1RFNA 1PPZA 2FLRH 4WY3A 1O2PA 2P8OC 2A45B 1Y3XA 2PSYA 2VH0A 3P8NA 1FDPA 4FUCA 1DXPA 1Y5UT 1YPKH 4U30A 2BLWA 3GISB 1RTFB 1UO6A 1C2GA 1ZHPA 1C5NH 2UWPA 2A4QA 3VXEH 1MH0A 2ZPSA 3LU9B 2GT8A 3JZ1B 1LHCH 1TBQH 4O3TA 1O3DA 1GPZA 1F5LA 4Y0YE 1O2IA 4KTUA 2PGQB 5E0HA 1O2NA 2LPRA 1NTPA 1IQMA 3SOSA 4D8NA 1Z8IB 3SJ8A 4D76A 1OOKB 7GCHF 1WCZA 2W3KA 2O8UA 2H9HA 1GHZA 1C1SA 2WYGA 1EATA 3E1XB 1GI1A 5DJ7A 1GVLA 2BMGB 2V6NA 3TGJE 1O3LA 3QUMP 4U01A 4YO9A 1AZ8A 1C4U2 1QY6A 4AB8A 4BTTB 3UTUH 4I7YH 3HKJB 1OWDA 2P3UB 2AIPA 1V2WT 1HAZB 2DE9A 1GCTC 1K22H 3CP7A 5E2OA 1T8NA 4X6PA 4NA7A 1DS2E 1S0RA 5T6GA 1GI0A 1GBMA 3SV6A 4YT6H 5DP9A 4Y11E 3NUMA 2VIOA 1SI5H 2Y7ZA 3MU5A 9ESTA 1UK4A 3TJNA 1EZUC 1S84A 1QRWA 3D49H 2ZCHP 5EG4A 4UDWH 4NWKA 3F1SB 2RA0A 3M35A 1P9SA 1UTNA 3O8RA 2VIWA 1P04A 1Y3UA 2PWXA 1C9TA 2ZDMA 3M61U 1ELBA 1ABIH 2NU1E 2XWBI 3EA8A 1H4WA 2PTNA 3ATWA 2NU3E 1YPLH 3DFJA 1RXPA 1BMMH 1CBWB 1Z1IA 2PHBA 1O2LA 4GSOA 3UNRA 3LIWA 1SFQB 1SL3A 2VIQA 1P9UA 1DE7H 5DP4A 3MYWA 1HYLA 3ZVAA 2WYJA 2GZ7A 3TLOA 5GCHG 3TK5A 1TX7A 4MNVA 1TPOA 1P09A 1ELGA 2J2UA 2HPQH 1TQ0B 2XCNA 3A87A 1UTQA 1L2EA 1Q2WA 2FM2A 3ZZBA 1D6RA 2JKHA 2QY0B 3A85A 3B23B 1ACBE 1GDQA 1SLVB 1MKWH 1K28D 2QF0A 3A84A 5FCKA 2I6QA 4BAMB 1ZGVA 2HALA 4I8JA 2VVVA 2P59A 1NRNH 1XMNB 4X6NA 1HXFH 3GY4A 4AFUA 2W7UA 1BTYA 2TGAA 3EQ0H 1EZSC 1FY8E 1O2OA 4K1EA 1AU8A 2Y5HA 4B2BA 3RU4E 1UHBA 2ANKH 1AWHB 2Z7FE 4IMQA 4U32A 4D7FA 3LGUA 1GVZA 2F9NA 4CRGA 4DIIH 2GCHG 1AY6H 3ATLA 4QT8C 2FIRH 1GJ9B 5EU8A 3KQCA 2ZNKH 5C5NA 3U69H 1AKSB 2BD2A 1TGSZ 3I77A 1JWTA 4MVNA 1O31A 2Z9JA 4ESTE 1W0YH 1TRNA 3KEEA 3SJIA 1ELEE 1EB2A 1CT4E 1K1IA 1EJAA 1VR1H 4JMYA 1B5GH 1HAIH 3MI4A 1TYNA 4Y8XA 1FQ3A 3OTJE 2C4FH 1OWHA 1P2JA 2PR3A 1HFDA 2A5IA 1UHBB 4ABDA 1E36B 2WPMS 3PROA 4A5TS 1BTXA 2XBWA 3LJOA 2Y5GA 3ATIA 1YPMH 4DT7B 4HI3A 1A3EH 1FAKH 1IQFA 2QF3A 3PWCA 3RXEA 3AW1A 2GMTB 1C1WH 2HLCA 1FIWA 1BRAA 1C5RA 2QYIA 1DFPA 3FZDA 1T7CA 4FUGA 1LQEA 3KQDA 1MKWK 4CR9A 1HJAB 3RXFA 1SGNE 1JXPA 3H7TA 9LPRA 3SV9A 3Q00A 1ZHRA 1FNIA 1O3JA 4NIVA 2FTLE 2FMJA 3M7QA 1G3CA 2A2QH 1ZOMA 4CH2B 2XCFA 5TCAA 3ZZ5A 1BTWA 1AQ7A 4WMFA 4Y7BA 1D4PB 1HDTH 2D2DA 1SC8U 1DY8A 2G4TA 1MCTA 3RXJA 3SN8A 1TNHA 1PYTC 5EQSA 1GMHG 1EAWA 3PWBA 2B9LA 5GCHF 4X1QU 1S6HA 4KP0A 3IWMA 3QLPH 1FV9A 1P2NA 7LPRA 4FU8A 1E34B 4XE4A 1P05A 2UWOA 2ZGBH 4JZEH 1C2JA 3GY2A 3RM2H 2HPPH 3IG6B 4FUJA 1O5GH 1GHYH 3RXCA 4ZKNU 4E06H 3GY5A 5GDSH 2OC0A 3SBKA 2UWLA 1SQAA 1CBWC 3TNTA 2ZFTA 4ISOA 1QCPA 3TK9A 3BTTE 3M7TA 1TNKA 3VPKA 4UONA 2NU4E 2ZHEH 1TNGA 3RLYH 1ZJDA 1V2PT 1TNJA 1V3XA 1BDAA 1C9PA 2GCHF 4CR5A 2P94A 2C90B 1ZSLA 3NXPA 1JMOH 1LCYA 3FZZA 1W11U 2ZZUH 4OS5A 2PUQH 1XXFA 2VIDA 4ZKOU 5DGJA 1QJ7B 1GGDC 1GJ5H 3EAJA 1F5RA 2SGAA 4GPGA 4UEHH 4K8BA 1C5YB 3DUXH 1ETRH 1QL7A 4CRDA 1W10U 1TLDA 1V2KT 4Q2KA 1F0UA 1M9UA 3P70B 4A1XA 3KNXA 3STIA 4TWYA 3URDA 3S0NA 4AN7A 1EXFA 1UK2A 3UR9A 2BZAA 4ABFA 1HJ8A 1HV7A 2ZCKP 2ZP0H 2UUKB 1AIXH 2OQ5A 2BLVA 3DA9B 1P02A 1KXCA 5BRRE 3L6PA 3A7VA 3GCOA 2FDAA 5F6MA 8LPRA 2VU8E 3SJOA 3QX5H 3ZVBA 1FONA 3K65B 4I8GA 2FZZA 2Y80A 3RXOA 3MH6A 4YT7H 2VGCB 4IS5A 1MZAA 1O37A 5I25A 3GCNA 1FY1A 3SU5A 3D65E 1C5OH 4JZDH 2JH6D 2UUFB 1ZPCA 1OP8A 3E0NB 2GMTC 3HK3B 4D9QA 1TX6A 1NY22 3ODFA 1O2QA 2RA3A 1IQJA 2HNTC 2FESH 1GMHF 1YC0A 4ZHAA 2AERH 2CHAC 1C2EA 4Y71A 3FANA 1HJAC 1ZTKA 4ZXYH 1W8BH 2AGGX 3V7TA 3LH1A 5A09A 4YOGA 1ESBA 1QGFA 3QZRA 2FOAA 1SQOA 2H6MA 3A8AA 1DANH 1MBMA 1PQ7A 1T32A 2B5TB 5LPRA 1GI8B 4NIYA 3ZVCA 2ZFQH 3LT3A 5DK1A 1ZYOA 2BVXH 4CRAA 4BAQB 2J34A 1EJMA 1YPGH 5AF9H 5C67A 2Z9LA 1Z6JH 2GKVE 6GCHG 4MTBA 3NWUA 2ZDAH 4CREA 1MQ5A 5EGMA 1ETSH 2D8WA 4INLA 3UWJH 2D26C 1IQEA 5EQRA 4X2XA 4Y8YA 2QXIA 5GIBA 4Y6DA 1CGHA 2ZFFH 2Y82A 1BHXF 5FPSA 2ZTXA 1ANEA 1A5IA 2XXLA 1TWXB 4A1TA 1P01A 4H4FA 1QQUA 1Q3XA 3SORA 1GMDG 3KQEA 1YLCA 4NWLA 1KIGH 1TNIA 1MU6B 4WVPE 5H4IB 2XNIA 4YTAA 1QHRB 3B9FH 1SG8B 1EJNA 4TY7A 3GICB 4SGAE 5I46H 5DO4H 2CV3A 2ZECA 1SGIB 1HAHH 2AMQA 3BG8A 2BTCE 1P3EA 5HXFA 4ZMAH 3U98H 2VIVA 4AORA 5A8XA 1P2QA 5A0CA 2FYRA 1C5WB 1JIMA 3T27A 1OYQA 2WPLS 1C5SA 1L1GA 2G00A 2G8TA 1NRRH 1H8IH 5A8YA 1O3EA 2OQUA 1QL8A 1OXGA 4NFEA 3TJVA 4CBNA 3RXRA 4DY7B 5EW2H 4XDEA 1RTLA 2C3SA 3L33A 2C8WB 3PV4A 1ESTA 3QO6A 3GY7A 2Q6GA 3KL6A 1ANCA 1GBEA 3DFLA 4U2WA 4CRCA 1V2JT 2J4IA 2A4GA 4GHTA 2ZEBA 1THRH 1XVMA 2FPZA 4ZKSU 1Z8JB 1GI5A 1O5FH 4F49A 2CMYA 4K1TA 1ZLRA 3SHAH 3OU0A 1T4UH 1W14U 1SVPA 1BRUP 2BVSH 4MDSA 1XX9A 3V12A 3ZVGA 4BXSA 1ANBA 3MU1A 3SQHE 3T2NA 1O3CA 4O9VA 5FX6A 2GVFA 3GCHB 3AASA 4MPUA 1MTSA 1BOQA 1YCPM 1XUFA 4NSVA 1P2OA 2H9TH 5JPMH 1CT0E 1QRZA 1TALA 2EI8A 3W94A 1V2VT 3PO1B 1UTOA 1GBLA 5C5OA 1GBTA 5LGOA 3BSQA 2WUBA 1WV7H 5C1UA 1A3BH 3AAUA 3SUFA 3DD2H 5EXMA 4FUHA 3BIUH 2A7CA 3A80A 6GCHF 2PTCE 3BTKE 3TU7H 3G01A 2QXHA 2P3TB 1A0LA 2Z9KA 1OWJA 3PB1E 1SFIA 1QTFA 2V3HH 1CQQA 4TY6A 4UFEH 1ELTA 2A1DB 1HNEE 1TBRH 3HPTB 2XC5A 1BRBE 1ZRBA 3BEFB 5E0GA 1O35A 4MNWA 1W2KH 3R0FA 1Z8RA 3FP6E 1ELFA 3RLWH 1BZXE 1GI9B 1GMDF 2PV9B 1O3OA 4MPVA 1TE0A 3SU6A 5HMAA 3BIVH 1OP2A 1A4WH 4LXBH 1VCWA 2F9BH 4IN2A 5JBAS 3MH7A 3UPEA 1Y3WA 4SGBE 2XRCA 1O2SA 2W7SA 4XBCA 3BTME 2H1UA 3EDXB 1J9CH 1N6XA 1EP6A 1NFYA 3TH4H 1EPTA 1YP9A 3LGTA 1BBRH 2A31A 5G4BA 2QN5T 5TCCA 1O38A 2SGQE 3TJUA 3VGCB 1ZMLA 5IDKA 1FY3A 3RDZA 1E37B 1O33A 1UVPA 1TA2A 1HXEH