4YM9A

Crystal structure of porcine pancreatic elastase (ppe) in complex with the novel inhibitor jm102
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chymotrypsin-like elastase family member 1
publication title Clickable 4-Oxo-beta-lactam-Based Selective Probing for Human Neutrophil Elastase Related Proteomes.
pubmed doi rcsb
molecule tags Hydrolase
total genus 60
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ym9A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ym9A01
1H8IH 4Y11E 1MTNC 1OSSA 1ZMNA 3SGQE 2D8WA 4MNVA 5EPYA 1YYY1 4WMFA 3KL6A 4OS6A 7LPRA 1DFPA 1T32A 1TBZH 3A85A 4Q7XA 2A5IA 2OC1A 1EP6A 4B76A 3MH7A 1F92A 3O8CA 4ZKNU 2UUYA 2WV5A 3M5OA 3DD2H 1F0UA 3L33A 2ZGJA 2ZGBH 2BLQA 3LIWA 1Y5UT 1O5GH 3ZVGA 1GI2A 3BTDE 3GY2A 1DWCH 1DWEH 3BTWE 4JZEH 4E06H 1QTFA 2PV9B 1DS2E 4FUGA 1GI4A 1WU1A 3T27A 1HB0B 1IQHA 2P3FH 3PTNA 1TRYA 1LHEH 1ORFA 4AFSA 2Q1JA 1A5HA 2HNTE 4IN2A 3OSYA 4NSVA 9ESTA 4ZUHA 2ZWLH 3DHKH 1QB9A 4R0IA 4WY3A 5DP3A 3OX7U 2XBVA 4I33A 2ZQ2A 1GBDA 1O33A 1HFDA 2G8TA 4Q80A 1C5YB 3BG8A 1PPCE 2A4QA 1GG6B 1HAVA 1NU7B 2QC2A 1KXBA 1BIOA 4YOJA 4X1NU 1C2JA 4D8NA 3SNDA 4JMYA 1RTLA 2JKHA 4AORA 1GHXH 5A8ZA 4O9VA 1TMUH 1G9IE 1V2NT 1EPTB 1C1MA 4D7GA 4B1TA 3SN8A 1YPKH 1NRSH 4D9QA 4DT7B 2GT7A 3JZ1B 1KIGH 4DCDA 3QTVH 2JH5D 3KCGH 1S82A 2VU8E 3RXOA 1GDQA 4J1YA 1O5EH 1GJ5H 3GY5A 1C5NH 3ZVDA 5A0CA 2ALVA 3ZVEA 1PPFE 3SNBA 1MZAA 3QGNB 5AFZH 4MPWA 1AB9B 1D4PB 1QB6A 1QRXA 2ZC9H 3PLBA 1EAUA 1KXAA 2FYRA 1N8OC 3A7VA 1J15A 1CBWB 8LPRA 2ZHDA 3UQVA 5JBTA 1O2HA 2Y80A 3U8RH 3A8CA 2PKAB 3T5FH 2FWWA 1MTWA 3K2UA 1Z8JB 3S0NA 1D3PB 2FESH 3RXVA 1TONA 5K7RA 4MPXA 4VGCB 1O2RA 2XTTB 1ZZZA 3P92A 3TGKE 2RCEA 3CS0A 2HPQH 3PTBA 1EZQA 1SSXA 3NPSA 1G37A 1F0SA 3TJUA 4IN1A 2G55A 2VIOA 3QZRA 1AUJA 3IITA 5L2YH 1AWHB 1DWDH 2YNBA 7GCHG 1UMAH 1PPHE 2D26C 2FI5E 1C2MA 1A0JA 1MQ6A 1PPZA 4CRCA 5LPEA 3Q3KA 5K0HA 1V2VT 1C2DA 4KP0A 3F9HA 3O8BA 2Z9JA 1CQQA 3Q76A 2RG3A 4GUXA 1DXPA 2BZAA 3UOPA 1QJ6B 4A1XA 2FIRH 3NKKA 1AZZA 3A80A 2QN5T 3SV9A 1GWAA 5EW1H 2BOKA 2OBOA 4KTUA 2IJOB 1NTPA 2GV6A 1A46H 3BTHE 1HDTH 2J94A 4CRAA 1IQNA 2BY9X 1A3BH 3S9AA 2FOAA 4CR9A 1HJ8A 3PLPA 1Y59T 2UUJB 3UY9A 2ZFFH 2BY7X 1KXDA 5LH8A 1BRBE 1W12U 1DVAH 1G3BA 4UFDH 2OXSA 3VFEA 1O3AA 5GJ4B 3U9AH 1ELVA 2H9HA 4AZ2B 1SC8U 3FP7E 3SV7A 3ZYDA 2Q6GA 4K8BA 1EJMA 2A4RA 4BAOB 2BM2A 2XWAA 3A7TA 2H2ZA 2ZPSA 1PQ7A 1K28D 1TNGA 1ZTJA 4K5ZA 1OWDA 1ELTA 3TK6A 1GBJA 3RU4E 1SGPE 3E16B 1ZGIA 3EA7A 4KGAA 5EQQA 2TBSA 5HXFA 4UDWH 2F3CE 1FN6A 3ELAH 4CBOA 3PMBB 2AIQA 1WYKA 3UFAA 2UWLA 3P17H 1GBIA 2BLWA 2O8TA 3SW2B 4KTSA 3RXDA 2HOBA 1NZQH 3UWIA 1SGCA 4H6TA 5T6FA 2FDAA 1KLIH 2WPIS 2BVRH 2BQWB 1F5LA 1ELBA 1C2LA 1MU6B 6GCHG 4NA7A 4Q7YA 4U2WA 5TJXA 4ABHA 4CRGA 2G81E 1H9HE 1P9UA 1N6YA 1YF4A 1FAXA 3S7HB 2Z9KA 1EP5A 1BRCE 1P12E 5DKMA 1KLTA 2R2MB 2QAAA 5F8ZA 1CHOF 3GCHB 1C2IA 2UWPA 2XC0A 1DT2A 1AKSA 1GG6C 4MLFB 1S83A 4ABIA 1PJPA 2DUCA 1YPHE 2DE9A 2P3TB 1GMHF 3ZZ9A 2BMGB 4CRBA 1VCWA 2R0KA 3P70B 4O97A 2BX3A 2ZHFH 2GCHF 3WY8A 3MU0A 1YLDA 4MDSA 4ISIH 1EPTC 1BRAA 1ZPCA 1O2MA 2UUFB 1WSSH 1A1RA 1KTSB 1P2OA 1O3NA 2EEKA 3U1IB 3URCA 1RTKA 1C1TA 1NRNH 4IBLH 1H9IE 2JH6D 2V0BA 1HXFH 2CJIA 1AE8H 1T8LA 4INLA 3SOSA 4WMDA 2VIQA 2XC5A 3OU0A 4U30A 2H1UA 2WUCA 5FPSA 1QURH 4M7GA 1WTGH 3BTKE 1BJVA 1G3CA 4INHA 5C1XA 1KDQB 4ZHMU 1AB9C 4X1QU 1ELDE 5JDUB 1GBLA 3SUFA 1K2I1 1LVOA 1ABJH 1O3DA 2Y82A 3DUXH 3ZVBA 1GPZA 5TCCA 5A0BA 4NFFA 1CBWC 1P2QA 2SGAA 2VNTA 3M7TA 1P09A 2WINI 1O3MA 3EDXB 4DY7B 2ZGCA 2V6NA 1WTHD 1K1LA 1INCA 1UHBB 1F7ZA 3HK6B 4FXGH 4VGCC 1MBMA 1GJ7B 2BVSH 1FMGA 1C4U2 3TH2H 4RN6A 3HGNA 2OCVB 1SOTA 2FP7B 4BNRA 1O2XA 1D6RA 1Y3WA 1FY4A 4ASHA 4NIWA 4LZ1H 2GGVB 2F83A 3R0FA 4K60A 4BTIB 3SJKA 3RC6A 2FLRH 2Y5FA 1Z6JH 1ETSH 4K2YA 4GHTA 1O3EA 2UWOA 1MKXK 4KELA 3MU4A 2GKVE 1JRTA 1UTQA 1SGTA 1NRQH 3LJJA 4H4FA 4YM9A 3D62A 3UR6A 3LT3A 3RXGA 3ZZDA 3ZZ3A 1NO9H 1V2WT 2A45B 2QXHA 1C5VA 2HNTC 1C2HA 5GCHF 2V3OH 1BTYA 2GDEH 2O8WA 4CBNA 3UPEA 1H8DH 3B9FH 3QUMP 2QF0A 1SGYE 2WYGA 2Q6FA 1MCVA 3E90B 3NWUA 2FOBA 3DFLA 1ZSKA 1DPOA 2VVVA 1C9PA 1GBTA 1O0DH 2QA9E 3MOCA 1CGHA 1HPGA 2VVCA 5EXLA 5DP8A 3TU7H 5B6OA 3UIRA 4AB9A 3S69A 2LNCA 1T8OA 5CE1A 1GI8B 1MZDA 3Q77A 2ZIQH 1AUTC 2A4OA 2H6MA 2ZCKP 1LPGB 1IOEA 3AAUA 3ZZAA 2H5CA 1CGIE 5EPNA 3P8FA 1GJCB 1GHZA 3LU9B 1NESE 2EC9H 1SVPA 3ZZ6A 2ZEBA 5I46H 1FJSA 1W7XH 3SV2H 3N7OA 1OP0A 2P8OB 3FP6E 1DUAA 1ZSJA 1DOJA 4WMEA 1V2MT 3K6ZA 4XBBA 2AEIH 5ABWA 1RTFB 4RSPA 1NS3A 5E2PA 1UK2A 2AMPA 1LQEA 1TGBA 1SGFG 2ULLA 5BRRE 1MKXH 3TITA 2TGDA 5JBCS 3NK8A 1F0TA 1GVKB 1JOUB 3H7OA 1QQUA 3SNAA 3NZIA 1CHOG 2FXRA 3VXFH 1C4V2 4GPGA 5EQSA 2ZTXA 1FDPA 1W13U 1FY8E 1UCYK 1V2UT 3M3VA 2ZGHA 1HYLA 1PYTD 2VH0A 1DDJA 1GMHG 2ZP0H 4TWYA 1DX5M 4ZXXH 3GDUA 2F91A 2AMQA 3ODDA 5EOKA 1YPEH 5DK1A 2P59A 1UK4A 3A7YA 3GCHC 1AIXH 4MNXA 3MNXA 1SHYA 1TABE 1JBUH 1O2TA 1XUFA 1FI8A 1UO6A 2ZFRH 1TNJA 1O3FA 5GXPA 2PWXA 4FVDA 4ABBA 1BT7A 3RXKA 1O2YA 1E37B 3TK5A 3ZVFA 1QQ4A 2CGAA 3DT0H 1ZJDA 3AW0A 4LXBH 3A83A 3MNSA 1AZ8A 2Y5HA 1O2WA 2VH6A 2C8WB 1GBMA 1IHTH 4ISLA 4B2CA 1V2JT 3W94A 1G32B 2BDIA 1GMDF 1AFEH 2BD8A 3RXIA 1O5FH 3RLWH 5F6MA 1AY6H 7KMEH 1S6HA 3KNXA 1SMFE 4Y10E 1LHDH 3A81A 7GCHF 1LVYA 4Y76A 2ILNA 1Y5BT 5J4QA 3FANA 1VITF 3AVZA 1NU9A 1YKTA 3LGTA 3TJVA 1RFNA 1Q3XA 1SGIB 2HLCA 1C1OA 3BTQE 2O9QA 3ATKA 3F6UH 4K3JA 2FOFA 2HGTH 1MTUA 2J2UA 1SGDE 7ESTE 1P11E 3I77A 1LKBA 4IC5A 1AFQC 2R9PA 2R3UA 3LGVA 1TNLA 4E7RG 1ARCA 3CP7A 1UCYH 1U6QA 3EAJA 1BBRK 2BY8X 2YNAA 1L4ZA 4MNWA 4BAHB 5FAHA 1AVXA 1KYNA 1V2LT 4YTAA 3BTFE 1J8AA 1AD8H 1THSH 1CT0E 5AHGH 5GCHG 4F4OC 1VGCB 2TRMA 2VVUA 1HNEE 1E36B 3TGJE 2AIPA 3V3MA 3KQCA 1UTLM 2AH4X 2XCFA 3BF6H 2AERH 1EQ9A 1C4Y2 1QA7A 2ZU3A 3ATIA 1HLTH 2PR3A 1C5ZB 2QIQA 1PFXC 1ZMLA 1V2PT 4X1PU 1TA6A 1P10A 3RXTA 1ZMJA 1ZYOA 1O3BA 1GJBB 4FUEA 3S9CA 5DO4H 1O5CB 4CH8B 4NG9H 1EZUC 3ZZBA 1TWXB 4NGAH 4THNH 1YCPK 1GI5A 4WXIA 2J38A 4XE4A 1YPHC 1TBRH 4I8JA 1C5XB 1Y3UA 4X0WU 1L2EA 1EASA 2VWNA 3LGIA 3ZYEA 3VB7A 1QRWA 3TVJB 2R0LA 1IAUA 1IQEA 1ABIH 3HPTB 2Z6BD 1XKBC 1P02A 2F9BH 3SGBE 6GCHF 3A8BA 4MQAA 1P2IA 1Z1JA 4ZKOU 2TGTA 3OY6U 3FZDA 4NWKA 5C2ZA 2KAIA 4Y7BA 1GVZA 2FLBH 2NU3E 2ZFSA 2GZ8A 3SU3A 2V35A 3RXFA 1RJXB 1GI1A 1FY1A 1P0SH 1O2KA 2P8OC 1DXWA 1QJ1B 1BBRH 1EJNA 4NZLA 2OTVA 2ZHWH 2ZFPH 4GAWA 2FX6A 3PLKA 2HNTF 3M3SA 4TWWA 1EAIA 1Y3XA 1C1WH 1QFKH 3K6YA 2P16A 1L4DA 1V2ST 1O3HA 2TGPZ 3ZZCA 4I7YH 2NWNA 5A8XA 4NSYA 1QRZA 1UTPA 2A31A 1NPMA 1QA0A 2VWOA 4FUFA 3SO3A 4CRDA 5SGAE 3ZVAA 1V3XA 1QB1A 4AG1A 3GY6A 3HGPA 3LH3A 3P8OA 2H5DA 1LHCH 1LQDB 4ISHH 1OWJA 3NUMA 3SQHE 2GX4A 1BTWA 3SU0A 4AB8A 4BXSA 1TE0A 4NFEA 3AW1A 4DGJA 3BTEE 2FTMA 1GHWH 3I78A 3UNQA 2FO9A 6ESTA 1YCPH 4Y8ZA 2XBYA 1IQIA 2Z94A 2CV3A 2J9NA 1AVGH 3M36A 1UJ1A 1GMDG 1J14A 2QY0B 3GOVB 3F68H 5DGJA 3M37A 3RM2H 1LPZB 1DY9A 1BB0B 1PPGE 1EOLA 3MH4A 3P8GA 2ZZUH 3RXLA 4MTBA 3Q3XA 3RXAA 4LZ4B 1ZTKA 5T6DA 1UTMA 1VITG 1O5DH 3TGIE 5JB8S 1ZPZA 3SU1A 1TRMA 2NU4E 3TJOA 2UUKB 2ODPA 5C5OA 1Z1IA 3NCLA 2XCNA 1BDAA 2ZNKH 2K1QA 3UNSA 3C1KA 1PPBH 1O39A 4OGXA 4YT7H 2RA3A 4MVNA 2J34A 3VB6A 4X6MA 1CHGA 3O8DA 1FNIA 1CVWH 1PYTC 1MCTA 3SHAH 1HAZB 3AASA 3SUDA 2STAE 3LC5A 1ANEA 2ANMH 3H7TA 1YC0A 4GHQA 3FAOA 3RLYH 1Z71A 2OUAA 2XXLA 1TX7A 4DURA 2ZU2A 4CREA 2RA0A 3IWMA 4OS5A 5C67A 2GDDA 5ESBA 1KXCA 2NU2E 1T7CA 1TALA 3GYMA 1T8NA 1W7GH 1AGJA 1DM4B 2SGEE 2Z7FE 4HZHA 4ABEA 1P06A 2HWLB 3TNSA 1LVMA 1EKBB 1NFUA 4YT6H 4ZAEA 3RP2A 1L1NA 1AMHA 3KHVA 1JIMA 1ZGVA 5I25A 1ETRH 1FONA 3RXHA 1OWEA 1O2PA 2HALA 1VGCC 1TQ0B 3ZZ8A 1BHXF 1TMBH 1SGRE 1YPJH 4X8SH 3GDSA 5E0JA 1QR3E 1YPLH 1A5IA 1LTOA 3ATWA 2CN0H 1S85A 1EB2A 1Q2WA 2HVXA 4NA9H 1S84A 2FTLE 1EATA 1MMJN 3A84A 5T6GA 3T28A 3HKJB 1ZHMA 4NWLA 5DP7A 1TB6H 1FXYA 2ANYA 1XUHA 1O3OA 5IYTA 1YPMH 3MU5A 4UONA 2O8LA 1BTUA 1XX9A 1THRH 2ZG0H 5C1YA 3ZVCA 2BXTH 1GHVH 3T2NA 1EPTA 3TH4H 1LDTT 1HAPH 2AGGX 1K9OE 1C5LH 1GI0A 1GBBA 3GYLB 4UD9H 3EGKH 2TIOA 2WUBA 4ABDA 1IQKA 3P8NA 4FUDA 1W0ZU 1QBVH 2FMJA 6LPRA 1W14U 3MYWA 3MWIU 1G36A 2BHGA 2VIPA 5EXNA 2W3IA 1LKAA 2BTCE 1P04A 1G2MA 3KN2A 2A7HA 3RMNH 2W26A 3A7XA 1MAXA 4Y8XA 3U8TH 1TPSA 3PWBA 1WUNH 4D9RA 1SQOA 4J2YB 5HYOA 4E05H 1GJDB 2Y7XA 3BIVH 3UTUH 2GV7A 2TGAA 1D3QB 1BHXB 2A1DB 1N1LA 2ASUB 2PKAA 1W8BH 2SNWA 1DY8A 1GBFA 3VXEH 1FAKH 1MD8A 1WBGB 2FOEA 3PMJA 4CHAB 4ZHLU 4XFQA 1OYQA 1MTVA 3U69H 4X1RU 1G3EA 2A5KA 1C2EA 5FPYA 2GT8A 5DP5A 1O3CA 1ANDA 3LPRA 5EODA 2P94A 3RC5A 2AGIX 1GVLA 4ISOA 1OP8A 3M7QA 3PM3A 1AI8H 3T26A 1H4WA 1VJAU 2BD5A 4KTCA 9LPRA 2ZDNA 2Q6DA 3QDZB 5FCKA 2THFB 1OYTH 3VEQB 1O2JA 3SJ9A 4RKOB 1MTSA 3ZZ7A 4K1TA 1HAXB 4Y6DA 1NFYA 1AFQB 2PLXA 1GL1A 2OBQA 2Z9IA 4TY7A 2F9NA 3GY8A 3U8OH 2EI8A 8ESTE 1Z6EA 2B0FA 2FI3E 3A88A 5ETXA 2FS9A 2WPHS 3RXPA 4OS2A 4B2AA 2BDBA 3KQDA 2XYAA 4ISNA 1B5GH 3E6PH 3PWCA 2QYIA 2ZCHP 4WJG2 4OS1A 2QXGA 3C27B 2PKSB 4UFEH 2ANKH 1YLCA 1J9CH 3HK3B 1GJ4H 2BDGA 4ESTE 2VINA 3ITIA 5FHTA 2XBXA 3LGWA 1K22H 4GLYA 4OS4A 3MMGA 1OX1A 1XXFA 3FVFB 1C9TA 2ZA5A 1XUIA 2CF8H 1TIOA 4BTUB 1NFXA 5E2OA 2GMTC 5DP9A 1W2KH 3SORA 2B5TB 1D6WA 2QXIA 1TX6A 4BAMB 1DITH 1EZSC 1O38A 2WV4A 1CU1A 1TNIA 4JK5A 4I32A 5EG4A 2Y5GA 2C8YB 2ZECA 4I8KA 2WPMS 4Y0YE 2SFAA 5E8EH 2GCTB 1TYNA 4FU8A 2Z9LA 5C3NA 1JIRA 2BD2A 1TOMH 2VWMA 1QL8A 2ESTE 4AFZA 3RXRA 4B75A 1NM6A 1CA8B 1X7AC 3A7WA 1ZLRA 2ZTZA 1SQTA 4IMQA 2BD7A 1FPCH 1LMWB 2VB0A 3L6PA 4WXVA 2R3YA 2W5EA 3RXCA 3SI4H 3MNCA 5F8TA 4E7NA 3STIA 3A89A 4NIVA 1C1RA 3KF2A 4FUCA 4MNYA 3VB4A 1GJ9B 1ID5H 2Y7ZA 3RXMA 1KXFA 5L2ZH 1M9UA 4U32A 3M3TA 1HAIH 1PPEE 2JH0D 1O2GH 6CHAB 1KLJH 3PMHB 2HPPH 3QO6A 1ELFA 2NU0E 5H4IB 1BOQA 1CGJE 2ZFTA 3GY3A 2A2XH 3ATLA 2FEQH 4Q2KA 2OD3B 1ACBE 4ZMAH 3SHCH 1C1SA 2SGQE 2XWBI 2ZTYA 1SI5H 1GL0E 1O35A 4OS7A 4TPYA 1QGFA 1CO7E 2GZ9A 1UVPA 1C5TA 2ZFQH 2ZPQA 4A92A 2DE8A 1O5AB 1IQFA 1SLXB 2W7SA 3MH5A 1C5RA 2P93A 3PO1B 3SU5A 1HAYB 4IS5A 4UEHH 1V2OT 1D9IA 1HAVB 4GVUA 4CRFA 1UVOA 3MI4A 1HAHH 1T4VH 5DP6A 1A2CH 3KQEA 5F8XA 3SZNA 1C5OH 1QCPA 4ABGA 4B74A 2XBWA 1O2ZA 2G4TA 2WPKS 1Y3VA 4AX9H 1ESTA 1AU8A 1AHTH 4IGDA 4BANB 1C5SA 1GI6A 1HAGE 4AOQA 5HM9A 1KDQA 1OWIA 2ZGXH 5GPIB 4U01A 1J16A 1QBOA 1ZJKA 4ZKRU 3TK9A 4AGKA 3MFJA 1BTXA 2TPIZ 2RDLA 1EZXC 4X1SU 3FFGA 1ZOMA 4R8TB 5E0GA 4AG2A 1UK3A 5FBIA 2PTCE 2H9TH 3TLOA 1SGFA 2HRVA 4DW2U 5JB9S 4JYUH 3ODFA 1WQSA 2LPRA 4D76A 4K8YA 4CH2B 1P9SA 4CHAC 3RU4T 1LHFH 1K1MA 3OY5U 3U1JB 1KSNA 1O3KA 3BTTE 1UHBA 1SGNE 2ZU5A 1HGTH 4BOHA 3M5NA 3Q00A 1TPPA 3AAVA 3UREA 3T25A 3GICB 2ZDLA 1MQ5A 5EXMA 4NA8A 3UOUA 4I8HA 4YLUA 3GCTG 2BYAX 1V2RT 3M5LA 1AN1E 1JXPA 1W3CA 1NFWA 1RRKA 2PGQB 2BQ6B 1BRUP 1EX3A 1F0RA 2G5VA 2B9LA 1K1JA 1K1NA 1LHGH 4ABFA 1O3IA 4F49A 1C1UH 1O30A 1Y5AT 2WPJS 1DSUA 1K1OA 1QNJA 4LK4A 1FZZA 2B8OH 4WF8A 1GBCA 3SUEA 4A7IB 1FV9A 2OQ5A 1IHSH 1GBAA 4IMZA 1XKAC 2BD9A 1P8VC 3SJ8A 4BTTB 4LOYH 1QIXB 1OP2A 2A7JA 2BY5X 3KQBA 3P6ZB 3BTGE 1T4UH 3BEFB 4AYVB 1OWHA 4ZKSU 1KY9A 1L1JA 1DWBH 1TGNA 1O37A 2CHAC 1HAOH 1Y8TA 1HBTH 2J92A 2PKSC 2BVXH 4DIHH 2ODYB 2FODA 3EA9A 1BQYA 1OKXA 2AFQB 2ZI2H 1RD3B 1EXFA 2PSYA 4K1SA 1C5UA 1YM0A 1TQ7B 4X2WA 1N6XA 5LPFA 4A6LA 3GCOA 1W0YH 3RXUA 3GCNA 3M35A 2BDHA 1JWTA 1CT4E 1GJAB 3A8AA 3RMLH 3UR9A 2A32A 3RXQA 4YOIA 1UTOA 4IW4E 2R2WU 5JBBS 3SJOA 1P01A 3E0PB 2Z3EA 1VITH 2OC0A 3EE0B 1FPHH 5T3HA 1XXDA 2VGCC 3BEUA 3U98H 2GCTC 1Z8RA 2FYQA 4MPVA 1C5PA 3CENA 3PB1E 1EB1H 5FPTA 4O3TA 3E1XB 1OPHB 1WAYB 3EYDA 5AFYH 1CT2E 2F9PA 1TMTH 1H9LB 1LVBA 3SNCA 1DSTA 1DUEA 3Q3YA 5EW2H 2BQ7B 1AWFH 2QF3A 5DJ7A 5JYIA 4FUIA 1A7SA 2EI6A 3RC4A 4X6NA 4ABAA 1H1BA 1S0RA 1A4WH 3EA8A 4X8UH 2BB4A 3QX5H 1GBHA 1AVWA 3ATMA 5HM2A 3MU1A 2BD4A 2EA3A 2GD4B 2XNIA 2PFEA 3MH6A 1P3CA 6CHAC 1D3TB 1G2LA 4AGJA 3M7UA 1P2JA 1FLEE 5A09A 2YOLA 1VCQA 5EU8A 3LDXH 2ZHEH 1XUGA 1Q31A 3SU2A 1L1GA 1HUTH 1S0QA 5CMXH 1V2QT 1G30B 1QY6A 3BV9B 1ESAA 4WH6A 3MO9A 1HJ9A 1EJAA 1C1VH 2GTBA 1WQVH 4HI3A 1DE7H 5FCRA 1UVSH 2W3KA 4GSOA 4BAKB 2VIDA 2ZDAH 2FS8A 3PO1C 1EAWA 1FN8A 4QT8C 3BSQA 1VCPA 5AF9H 1AKSB 1NY22 2BLVA 2IPHA 4DJZB 4TY6A 1GBKA 1GGDC 2AS9A 1GI9B 1B0FA 1GMCG 5G4BA 1HRTH 1C5QA 1ZTLA 2VWLA 3LGUA 3PROA 3ENSB 4ZHAA 1E34B 4ABJA 1TA2A 1W10U 2P95A 3PMAB 1FY3A 1HXEH 5A2MH 4FU7A 1SL3A 3LONA 3FP8E 4K69A 1TRNA 2J95A 2Z9GA 4OGYA 3ZZ5A 4B73A 1RIWC 1YCPM 2V3HH 1CSOE 2BDAA 2ZU1A 2ZDMA 1BTHH 2PSXA 2SGDE 2VJ1A 4Y7AA 2BLOA 1GHAG 2FOCA 2GMTB 1TPOA 3GISB 3GY7A 1K1PA 2A2QH 2OLGA 4BAQB 4B71A 1RGQA 2FOGA 4XSKU 3V12A 1GHBF 1BMAA 1TNHA 1C1QA 1NROH 3MO6A 1UTJA 3R3GB 1E35B 4GCHG 1OWKA 2XW9A 2F9OA 2ZF0H 5IDKA 1P57B 2WPLS 1MUEB 2PUXB 3EQ0H 5GWZA 1GBEA 5GDSH 3RUOA 4Z6AH 1AE5A 3D49H 1ZPBA 1FIZA 2VIWA 1NC6A 3BN9A 4B2BA 4XOJA 5PTPA 1IQMA 1VZQH 3TJNA 3SI3H 3MTYA 1MD7A 3V7TA 1SB1H 5JPMH 1ZHRA 1XUJA 1O2OA 3M61U 5DP4A 1EUFA 5FXLA 3TIUA 4FU9A 2O8UA 2G4UA 4FUJA 4JZDH 3E3TA 3BG4C 3W95A 3TH3H 1SLUB 3CS7A 3BEIB 4FUHA 5C20A 2ZO3H 2EI7A 4RKJB 1O2IA 1ZHPA 3KGPA 3QLPH 4HTCH 1E0FD 1MU8B 2QCYA 1TLDA 1TBQH 3MO3A 2PW8H 3E91A 1S6FA 1EAXA 2VIVA 1C5WB 1GDNA 1B0EA 1BMNH 3RXSA 5LGOA 4UFFH 1TX8A 1LO6A 1HV7A 4TYDA 2OQUA 2CF9H 2D2DA 4TPIZ 2PHBA 1SHHB 2GVFA 1XM1A 1FQ3A 1VR1H 4Z0KA 5ESTE 2OC7A 4WVPE 4NIXA 2SGFE 5HMAA 2STBE 1F5RA 1P3EA 2Z3DA 3H5CB 5L6NH 5E0HA 2AMDA 1SFIA 1TNKA 4X2YA 3VB3A 4A1VA 1WCZA 1Z8GA 3SBKA 1SBWA 3FZZA 4Y79A 1C2FA 1QJ7B 3UWJH 1SR5C 2PGBB 2FOHA 5DPAA 2JETB 1XVMA 2PTNA 3SUGA 4AFQA 3B23B 1BMLA 2ZHQH 2BDYA 1KXEA 1HJAB 4X8TH 2A0QB 4UE7H 1FY5A 1GJ8B 4FVBA 2O8MA 1ANBA 1XMNB 1AQ7A 3JZ2B 3LH1A 2CXVA 1P05A 2C8XB 1O2NA 1LCYA 3UUZA 2BX4A 2OINA 5A8YA 4JYVH 4HGCA 1MBQA 3SQEE 2FX4A 5TCAA 2GZ7A 2FOMB 1P2MA 3E0NB 3VGCB 1BJUA 4XDEA 2A5AA 1A5GH 3VB5A 1C1PA 1TGCA 3NXPA 1AO5A 1TOCB 1K21H 2BOHB 2G51A 3T62A 1T31A 1CA0B 3V0XA 2P3UB 1ESBA 3OYPA 3RMMH 1O2LA 1MKWK 3IG6B 1DANH 3RU4D 1PQAA 1DLEA 4MPUA 4ZROA 3ZZ4A 1TGTA 1PQ5A 2W7UA 4JZ1A 2XRCA 2IN2A 1BITA 1L0ZA 3KEEA 1A0HB 4H42U 4X8VH 4YOGA 1QHRB 1BCUH 3RXJA 1HIAB 2PUQH 1J17T 2A4GA 1B7XB 1OOKB 1THPB 1TFXA 1MH0A 5FX6A 1NT1A 1C5MD 8GCHF 4K1EA 3SV8A 3MNBA 1E38B 4YZUA 4UFGH 5GIBA 1BTPA 2AGEX 1KTTB 3F1SB 4SGAE 3GCTF 4Y0ZE 1QL7A 1O2UA 1O3GA 2Y81A 1UVTH 5CHAB 3SJIA 3F9FA 1IQJA 3F9GA 2QV1A 1GDUA 3P95A 3G01A 1SLVB 1CE5A 1PQ8A 1UTKA 2CHAB 1D3DB 3SU4A 2SGPE 1A0LA 1GHBG 3DFJA 3E8LA 3QGJA 3SU6A 5EQRA 1GCTB 2BXUH 3LJOA 5J4SA 1QL9A 4PROA 1WOFA 2BZ6H 1BMMH 1P2NA 1UVUH 1UTNA 1MTNB 1TGSZ 4X2XA 4I31A 2ZPRA 2FI4E 1BA8B 1SPJA 3SGAE 1TPAE 1A61H 4JK6A 3RXEA 1ZR0A 4X6PA 1MKWH 1GI7B 3D65E 3SV6A 4AFUA 2J4IA 2FZZA 3LOXA 1EOJA 2VGCB 4A1TA 3I29A 3PV4A 2C4FH 1F5KU 3TPIZ 3ZV9A 4NCYA 1HCGA 3STJA 2QXJA 3UQOA 4I8LA 5AVDA 2M5TA 2C90B 1O2VA 4MG3A 3QN7A 3A82A 4BXWA 1ELCA 4DIIH 4SGBE 2F9VA 4JZFH 2I6QA 1RS0A 2G5NA 4XBCA 4YO9A 5FBEA 4NIYA 2Y6TA 1P03A 1C1NA 5EGMA 4WWYA 3LGYA 4AYYB 1F2SE 2WYJA 5DG6A 3O8RA 5C1UA 1JMOH 1Z7KA 1O36A 2ANWA 2FM2A 1O5BB 1FUJA 3A7ZA 1SLWB 2B7DH 3K9XB 5F03A 1W11U 1IQGA 1MAYA 1ELEE 3DA9B 3T29A 2ZQ1A 2C93B 3RXBA 1C2GA 1O2QA 1T8MA 4DG4A 1DICA 3ZV8A 8KME2 2A7CA 1TAWA 1V2TT 4A5TS 1K1IA 2AYWA 1UCYE 1BTZA 1XUKA 2OP9A 4H6SB 1SQAA 2Z3CA 1O31A 1GHYH 3PYHA 1FIWA 3SNEA 3LKWA 5L30H 3QTOH 3RMOH 4O03A 1NN6A 1QBNA 1ETTH 1OS8A 2JETC 2ZCLP 3S9BA 1GGDB 2SNVA 3K65B 1ELAA 1LPKB 2KAIB 1HJAC 3B8JA 5HGGA 1SFQB 4X6OA 3BTME 2IOTA 2ALPA 3V13A 2ZKSA 1ZSLA 1N8OB 4DOQA 1ELGA 3BIUH 3M5MA 4YLQH 1V6DA 2ZDKA 4AN7A 3HATH 2G00A 1YP9A 2CMYA 2F9UA 1GMCF 1S81A 5A0AE 2GCHG 1WV7H 1O2SA 1O3JA 1ZRBA 3A87A 3ESTA 2BD3A 1RIWB 1NRRH 1BUIA 3QWCH 1HIAA 1YBWA 5C5NA 2C3SA 4JYTA 3VGCC 4D7FA 2G52A 2ODQA 3MHWU 3LC3A 1ZRKA 3VPKA 3GDVA 1O32A 1P2KA 1CA0C 5BPEA 1NRPH 3F9EA 1S5SA 4FUBA 5LPRA 2BY6X 2I6SA 8GCHG 3URDA 5JBAS 1SG8B 1SGQE 5FX5A 4Y71A 2H9EH 1O3LA 1Z8IB 3RM0H 1GHAF 1O34A 1ANCA 1VJ9U 3D23A 4ZXYH 3RDZA 1C2KA 1SOZA 1XVOA 1YPGH 1O3PB 1OXGA 1SGEE 2D1JA 3L3TA 3HKIB 4INKA 1ARBA 1BBRE 4I8GA 1YGCH 4IC6A 2NU1E 3TNTA 3MU8A 2ZU4A 1GCDA 1IQLA 4GCHF 1GJ6A 1G3DA 3GY4A 4HFPB 4O3UA 3BG4B 2FPZA 4Y8YA 1RXPA 2OC8A 5CHAC 3KIDU 1Y3YA 4JZIA 3UNRA 4YESB 3A86A 4WH8A 2ZDVH 3QZQA 2QGRA 1A3EH 3OTJE 3S7KB 4DVAU 1JRSA 3QK1A 4XBDA 4NZQA 1BZXE 2BDCA 2XC4A 1GCTC 1GI3A 3A8DA 4KKDA 1V2KT 2GP9B 1DLKB 4JCNA 4Q7ZA 4CR5A 4X2VA 4ZH8A 2C8ZB
chains in the Genus database with same CATH superfamily
1H8IH 2KCAA 4Y11E 1MTNC 1OSSA 1ZMNA 3SGQE 2D8WA 4MNVA 5EPYA 1YYY1 4WMFA 3KL6A 4OS6A 7LPRA 1DFPA 1T32A 1TBZH 3A85A 4Q7XA 2A5IA 2OC1A 1EP6A 4B76A 3MH7A 1F92A 3O8CA 4ZKNU 2UUYA 2WV5A 3M5OA 3CNRA 3DD2H 1F0UA 3L33A 2ZGJA 2ZGBH 2OK5A 2BLQA 3LIWA 1Y5UT 1O5GH 3ZVGA 1GI2A 3BTDE 3GY2A 2QE7D 1DWCH 1DWEH 3BTWE 4JZEH 4E06H 1QTFA 2PV9B 1DS2E 4FUGA 1GI4A 1WU1A 3T27A 1HB0B 1IQHA 2L6OA 2P3FH 3PTNA 1TRYA 1LHEH 1ORFA 4AFSA 2Q1JA 1A5HA 2HNTE 4IN2A 3OSYA 4NSVA 9ESTA 4ZUHA 2ZWLH 3DHKH 1QB9A 4R0IA 4WY3A 5DP3A 3OX7U 2XBVA 4I33A 2ZQ2A 1GBDA 5HIYA 1O33A 1HFDA 2G8TA 4Q80A 1C5YB 3BG8A 1PPCE 2A4QA 1GG6B 1HAVA 1NU7B 2QC2A 1KXBA 1BIOA 4YOJA 4X1NU 1C2JA 4D8NA 3SNDA 4JMYA 1RTLA 2JKHA 4AORA 1GHXH 5A8ZA 4O9VA 1TMUH 1G9IE 1V2NT 1EPTB 1C1MA 4D7GA 4B1TA 3SN8A 1YPKH 1NRSH 4D9QA 4DT7B 2GT7A 3JZ1B 1KIGH 4DCDA 3QTVH 2JH5D 3KCGH 1S82A 2VU8E 3RXOA 1GDQA 4J1YA 1O5EH 1GJ5H 3GY5A 1C5NH 3ZVDA 5A0CA 2ALVA 3ZVEA 1PPFE 3SNBA 1MZAA 5C17A 3QGNB 5AFZH 4MPWA 1AB9B 1D4PB 1QB6A 1QRXA 2ZC9H 3PLBA 1EAUA 1KXAA 4P02A 2FYRA 1N8OC 3A7VA 1J15A 1CBWB 8LPRA 2ZHDA 3UQVA 5JBTA 1O2HA 2Y80A 3U8RH 3A8CA 2PKAB 3T5FH 2FWWA 1MTWA 2KCPA 1Z8JB 3K2UA 3S0NA 3NRLA 2CK3D 1D3PB 2FESH 2W6JD 3RXVA 1TONA 5K7RA 4MPXA 2WHXA 4VGCB 1O2RA 2XTTB 1ZZZA 3P92A 3TGKE 2RCEA 3CS0A 2HPQH 3PTBA 1EZQA 1SSXA 3NPSA 1G37A 1F0SA 3TJUA 4IN1A 2G55A 2VIOA 3QZRA 1AUJA 3IITA 5L2YH 1AWHB 1DWDH 3F2GA 2YNBA 7GCHG 1UMAH 1PPHE 2D26C 2FI5E 1C2MA 1A0JA 1MQ6A 1PPZA 4CRCA 5LPEA 3Q3KA 5K0HA 1V2VT 1C2DA 4KP0A 3F9HA 3O8BA 2Z9JA 1CQQA 3Q76A 2RG3A 4GUXA 5B6LA 1DXPA 2BZAA 3UOPA 1QJ6B 4RT1A 3SZEA 4A1XA 2FIRH 3NKKA 1AZZA 2J97A 3A80A 2QN5T 3SV9A 1GWAA 5EW1H 2BOKA 2OBOA 4KTUA 2IJOB 1NTPA 2GV6A 1A46H 3BTHE 1HDTH 2J94A 4CRAA 1IQNA 2BY9X 1A3BH 3S9AA 2FOAA 4CR9A 1HJ8A 3PLPA 1Y59T 2UUJB 3UY9A 2ZFFH 2BY7X 1KXDA 5LH8A 1BRBE 1W12U 1DVAH 1G3BA 4UFDH 2J5UA 2OXSA 3VFEA 1O3AA 3KYGA 5GJ4B 3U9AH 1ELVA 2H9HA 4AZ2B 1SC8U 3FP7E 3SV7A 3ZYDA 2Q6GA 4K8BA 1EJMA 2A4RA 4BAOB 2BM2A 2XWAA 3A7TA 2H2ZA 2ZPSA 1PQ7A 1K28D 1TNGA 5HIZA 1ZTJA 2F43B 4K5ZA 1OWDA 1ELTA 3TK6A 1GBJA 3RU4E 1SGPE 3E16B 1ZGIA 3EA7A 4KGAA 5EQQA 2TBSA 5HXFA 4UDWH 2F3CE 1FN6A 3ELAH 4CBOA 1K0HA 3PMBB 2AIQA 1WYKA 3UFAA 2UWLA 3P17H 1GBIA 2BLWA 5IK2D 2O8TA 3SW2B 4KTSA 3RXDA 2HOBA 1NZQH 3UWIA 1SGCA 4H6TA 5T6FA 2FDAA 4XD7D 1KLIH 2WPIS 2BVRH 2BQWB 1F5LA 1ELBA 1C2LA 1MU6B 6GCHG 3FN8A 4NA7A 4Q7YA 4U2WA 5TJXA 4ABHA 4CRGA 2G81E 1H9HE 1P9UA 3GS9A 1N6YA 1YF4A 1FAXA 3S7HB 2Z9KA 1EP5A 1BRCE 1P12E 5DKMA 1KLTA 2R2MB 2QAAA 5F8ZA 1CHOF 3GCHB 1C2IA 2UWPA 2XC0A 1DT2A 1AKSA 4XRNA 1GG6C 4MLFB 1S83A 4ABIA 1PJPA 2DUCA 1YPHE 2DE9A 2P3TB 1GMHF 3ZZ9A 2BMGB 3KYFA 4CRBA 1VCWA 2R0KA 3P70B 4O97A 2BX3A 2ZHFH 3UB0A 2GCHF 3WY8A 3MU0A 1YLDA 4MDSA 4ISIH 1EPTC 1BRAA 1ZPCA 5CDFE 1O2MA 2UUFB 1WSSH 1A1RA 1KTSB 1P2OA 1O3NA 4AC9A 2EEKA 3U1IB 3URCA 1RTKA 1C1TA 1NRNH 4IBLH 2J98B 1H9IE 2JH6D 2V0BA 1HXFH 2CJIA 1AE8H 1T8LA 4INLA 3SOSA 4WMDA 2VIQA 2XC5A 3OU0A 4U30A 2H1UA 2WUCA 5FPSA 1QURH 4M7GA 1WTGH 3BTKE 1BJVA 1G3CA 4INHA 5C1XA 1KDQB 4ZHMU 1AB9C 4X1QU 5C0UA 1ELDE 5JDUB 1GBLA 3SUFA 1K2I1 1LVOA 1ABJH 3N7EA 1O3DA 1S6LA 2Y82A 3DUXH 1GPZA 5TCCA 3ZVBA 5A0BA 4NFFA 4RT0A 1CBWC 1P2QA 2SGAA 2VNTA 3M7TA 1P09A 2WINI 1O3MA 3EDXB 4DY7B 2ZGCA 2WV9A 3F3BA 2V6NA 1WTHD 1K1LA 1INCA 1UHBB 1F7ZA 3HK6B 5GNDA 4FXGH 4VGCC 1MBMA 1GJ7B 2BVSH 1FMGA 1C4U2 3TH2H 4RN6A 3HGNA 2OCVB 1SOTA 2FP7B 4BNRA 1O2XA 5C94A 1D6RA 1Y3WA 1FY4A 4ASHA 4NIWA 4LZ1H 2GGVB 2F83A 3R0FA 4K60A 4BTIB 3SJKA 3RC6A 2FLRH 2Y5FA 1Z6JH 1ETSH 4K2YA 4GHTA 1O3EA 2UWOA 1MKXK 4KELA 3MU4A 2GKVE 1JRTA 1UTQA 1SGTA 1NRQH 3LJJA 4H4FA 4YM9A 3D62A 3UR6A 3LT3A 4ZCNA 3RXGA 3ZZDA 3ZZ3A 1NO9H 1V2WT 2A45B 2QXHA 1C5VA 2HNTC 1C2HA 5GCHF 2V3OH 1BTYA 2GDEH 2O8WA 4CBNA 3UPEA 1H8DH 3B9FH 3QUMP 2QF0A 1SGYE 2WYGA 2Q6FA 1MCVA 2M2AA 3E90B 3NWUA 2FOBA 3DFLA 1ZSKA 1DPOA 2VVVA 1C9PA 1GBTA 1O0DH 2QA9E 3MOCA 1CGHA 1HPGA 2VVCA 3DSOA 5EXLA 3AK5A 5DP8A 3TU7H 2YMSB 5B6OA 1UW7A 3UIRA 4AB9A 3S69A 2LNCA 1T8OA 5CE1A 1GI8B 1MZDA 3Q77A 2ZIQH 1AUTC 2A4OA 2H6MA 2ZCKP 1LPGB 1IOEA 3AAUA 3ZZAA 2H5CA 1CGIE 5EPNA 2JJ1D 3P8FA 1GJCB 1GHZA 3LU9B 1NESE 2EC9H 1SVPA 3ZZ6A 2ZEBA 5I46H 1FJSA 1W7XH 3SV2H 3N7OA 1OP0A 2P8OB 3FP6E 1DUAA 1ZSJA 1DOJA 4WMEA 3DCLA 1V2MT 3K6ZA 4XBBA 2AEIH 3WWFA 5ABWA 1RTFB 4RSPA 1NS3A 5E2PA 1UK2A 2AMPA 1LQEA 1TGBA 1SGFG 2ULLA 5BRRE 1MKXH 3TITA 2TGDA 5JBCS 3NK8A 1F0TA 1GVKB 1JOUB 3H7OA 1QQUA 5C0TA 3SNAA 3NZIA 1CHOG 2FXRA 3VXFH 1C4V2 4GPGA 5EQSA 2ZTXA 1FDPA 1W13U 1FY8E 1UCYK 1V2UT 3M3VA 2ZGHA 1HYLA 1PYTD 2VH0A 1DDJA 1GMHG 2ZP0H 4TWYA 1DX5M 4ZXXH 3GDUA 2F91A 2AMQA 3ODDA 5EOKA 1YPEH 3FKSD 2J98A 5DK1A 2P59A 1UK4A 3A7YA 3GCHC 1AIXH 4MNXA 3MNXA 1SHYA 1TABE 1JBUH 1O2TA 3EE7A 1XUFA 1FI8A 1UO6A 2ZFRH 1TNJA 1O3FA 5GXPA 2PWXA 4FVDA 4ABBA 1BT7A 3RXKA 1O2YA 2JJ2D 1E37B 3TK5A 3ZVFA 1QQ4A 2CGAA 3DT0H 1ZJDA 3AW0A 4LXBH 3A83A 3MNSA 1AZ8A 2Y5HA 1O2WA 2VH6A 2C8WB 1GBMA 1IHTH 4ISLA 4B2CA 1V2JT 3W94A 1G32B 2BDIA 3MQKC 1GMDF 1AFEH 2BD8A 3RXIA 1O5FH 3RLWH 5F6MA 1AY6H 7KMEH 1S6HA 3KNXA 1SMFE 4Y10E 1LHDH 3A81A 7GCHF 1LVYA 4Y76A 2ILNA 1Y5BT 5J4QA 3FANA 1VITF 3AVZA 1NU9A 1YKTA 1SKYE 3LGTA 3TJVA 1RFNA 1Q3XA 1SGIB 2HLCA 1C1OA 3BTQE 2O9QA 3ATKA 3F6UH 4K3JA 2FOFA 2HGTH 1MTUA 2J2UA 1SGDE 7ESTE 1P11E 3I77A 1LKBA 4IC5A 1AFQC 2R9PA 2R3UA 2HVYB 3LGVA 1TNLA 4E7RG 1ARCA 3CP7A 1UCYH 1U6QA 3EAJA 1BBRK 2BY8X 2YNAA 1L4ZA 4MNWA 4BAHB 5FAHA 1AVXA 1KYNA 1V2LT 4YTAA 3BTFE 1J8AA 1AD8H 1THSH 1CT0E 5AHGH 5GCHG 4F4OC 1VGCB 4RI0A 2TRMA 2VVUA 1HNEE 3N99A 1E36B 3TGJE 2AIPA 3V3MA 2AHME 3KQCA 1UTLM 2AH4X 2XCFA 3BF6H 5FL7D 2KCOA 2AERH 1EQ9A 1C4Y2 1QA7A 2ZU3A 3ATIA 1HLTH 2PR3A 1C5ZB 2QIQA 1PFXC 1ZMLA 1V2PT 4X1PU 1TA6A 4F55A 1P10A 3RXTA 1ZMJA 1ZYOA 1O3BA 1GJBB 4FUEA 3S9CA 5DO4H 1O5CB 4CH8B 4NG9H 1EZUC 3ZZBA 1TWXB 4NGAH 4THNH 1YCPK 1GI5A 4WXIA 2J38A 4XE4A 1YPHC 1TBRH 4I8JA 1C5XB 1W0JD 1Y3UA 2YMSC 4X0WU 1L2EA 1EASA 2VWNA 3LGIA 3ZYEA 3VB7A 1QRWA 3TVJB 2R0LA 1IAUA 1IQEA 1ABIH 3HPTB 2Z6BD 1YWUA 1VKYA 1XKBC 1P02A 2F9BH 3SGBE 6GCHF 2WZQA 3A8BA 4MQAA 1P2IA 1Z1JA 4ZKOU 2TGTA 3OY6U 3FZDA 4NWKA 5C2ZA 2KAIA 4Y7BA 1GVZA 2FLBH 2NU3E 2ZFSA 2GZ8A 3SU3A 2V35A 1QZ8A 3RXFA 1RJXB 1GI1A 1FY1A 1P0SH 1O2KA 2KCYA 3PV2A 2P8OC 1DXWA 1QJ1B 1BBRH 1EJNA 4NZLA 2OTVA 2ZHWH 2ZFPH 4GAWA 2FX6A 3PLKA 2HNTF 3M3SA 4TWWA 2LELA 1EAIA 1Y3XA 1C1WH 1QFKH 3K6YA 2P16A 1L4DA 1V2ST 4YXWD 1O3HA 2TGPZ 3ZZCA 4I7YH 2NWNA 5A8XA 4NSYA 1QRZA 1UTPA 2A31A 1NPMA 1QA0A 2VWOA 4FUFA 3SO3A 4CRDA 5SGAE 3ZVAA 1V3XA 1QB1A 4AG1A 3GY6A 3HGPA 3LH3A 3P8OA 2H5DA 1LHCH 1LQDB 4ISHH 1OWJA 3NUMA 3SQHE 3DSGA 2GX4A 1BTWA 5T1VA 3SU0A 4AB8A 4BXSA 1TE0A 4NFEA 3AW1A 4DGJA 3BTEE 2FTMA 1GHWH 3I78A 3UNQA 2FO9A 6ESTA 1YCPH 4Y8ZA 2XBYA 1IQIA 2Z94A 2CV3A 2J9NA 1AVGH 3M36A 2RDEA 4Q4LA 1UJ1A 1GMDG 1J14A 2QY0B 3GOVB 3F68H 5DGJA 3M37A 3RM2H 1LPZB 1DY9A 1BB0B 1PPGE 1EOLA 2JDID 3MH4A 3P8GA 2ZZUH 5EJZA 3RXLA 4MTBA 3Q3XA 3RXAA 4LZ4B 1BMFD 1ZTKA 5T6DA 1UTMA 1VITG 2KR7A 1O5DH 3TGIE 5JB8S 1ZPZA 3SU1A 1TRMA 2NU4E 3TJOA 2UUKB 2ODPA 5C5OA 1Z1IA 3NCLA 2XCNA 1BDAA 2ZNKH 2WPDD 2K1QA 3UNSA 3C1KA 1PPBH 1O39A 4OGXA 4YT7H 2RA3A 4MVNA 2J34A 3VB6A 4X6MA 1KMHB 1CHGA 3O8DA 1FNIA 1CVWH 1PYTC 3KQ5A 1MCTA 3SHAH 1HAZB 2KM0A 3AASA 3SUDA 2STAE 3LC5A 1ANEA 2ANMH 3H7TA 1YC0A 3OAAD 4GHQA 3FAOA 3RLYH 1Z71A 2OUAA 2XXLA 1TX7A 4DURA 2ZU2A 4CREA 2RA0A 3IWMA 4OS5A 5C67A 2GDDA 5ESBA 1KXCA 2NU2E 1T7CA 1TALA 3GYMA 1T8NA 5EIYA 1W7GH 1AGJA 1DM4B 2SGEE 2Z7FE 4HZHA 4ABEA 1P06A 2HWLB 3TNSA 1LVMA 1EKBB 2V3MA 1NFUA 4YT6H 4ZAEA 3RP2A 1L1NA 1AMHA 2L74A 3KHVA 1JIMA 1ZGVA 5I25A 3OEHD 1ETRH 1FONA 3RXHA 1OWEA 1O2PA 2HALA 1VGCC 1TQ0B 2K0QA 3ZZ8A 1BHXF 1TMBH 1SGRE 1YPJH 4X8SH 3GDSA 5E0JA 1QR3E 1YPLH 1A5IA 1LTOA 3ATWA 2CN0H 1S85A 1EB2A 1Q2WA 2HVXA 4NA9H 1S84A 2FTLE 1EATA 1MMJN 3A84A 5T6GA 3T28A 3HKJB 1ZHMA 4NWLA 5DP7A 1TB6H 1FXYA 2ANYA 1XUHA 1O3OA 5IYTA 1YPMH 3MU5A 4UONA 2O8LA 1BTUA 1XX9A 1THRH 2ZG0H 5C1YA 3ZVCA 2BXTH 1GHVH 3T2NA 1EPTA 3TH4H 1LDTT 1HAPH 2AGGX 1K9OE 1C5LH 1GI0A 2GJGA 1GBBA 3GYLB 4UD9H 3EGKH 2TIOA 2WUBA 4ABDA 1IQKA 1OHHD 3P8NA 4TT3D 4FUDA 1W0ZU 1QBVH 2FMJA 6LPRA 1W14U 3MYWA 3MWIU 1G36A 2BHGA 2VIPA 5EXNA 2W3IA 1LKAA 2BTCE 1P04A 1G2MA 3WW7A 3KN2A 2A7HA 3RMNH 2W26A 3A7XA 1MAXA 4Y8XA 3U8TH 1TPSA 3PWBA 1WUNH 4D9RA 1SQOA 4J2YB 5HYOA 4E05H 1GJDB 2Y7XA 3BIVH 3UTUH 2GV7A 2TGAA 1D3QB 2HLDD 1BHXB 2A1DB 1N1LA 2ASUB 2PKAA 1W8BH 2SNWA 1DY8A 1GBFA 3VXEH 1FAKH 1MD8A 1WBGB 2FOEA 3PMJA 4CHAB 4ZHLU 4XFQA 1OYQA 1MTVA 1YY3A 3U69H 4X1RU 3PRBA 1G3EA 2A5KA 1C2EA 4B6EA 5FPYA 2GT8A 5DP5A 1O3CA 1ANDA 3LPRA 5EODA 2P94A 3RC5A 2AGIX 1GVLA 4ISOA 1OP8A 3M7QA 3PM3A 1AI8H 3T26A 1H4WA 1VJAU 2BD5A 4KTCA 9LPRA 2ZDNA 2Q6DA 3QDZB 5FCKA 2THFB 1OYTH 3VEQB 1O2JA 3SJ9A 4RKOB 1MTSA 3ZZ7A 1E1QD 4K1TA 1HAXB 4Y6DA 1NFYA 1AFQB 2PLXA 1GL1A 2OBQA 2Z9IA 4TY7A 2F9NA 3GY8A 3U8OH 2EI8A 8ESTE 1Z6EA 2B0FA 2FI3E 3A88A 5ETXA 2FS9A 2WPHS 3RXPA 4OS2A 4B2AA 2BDBA 3KQDA 2XYAA 4ISNA 1B5GH 3E6PH 3PWCA 2QYIA 2ZCHP 4WJG2 4OS1A 2QXGA 3C27B 2PKSB 4UFEH 2ANKH 1YLCA 1J9CH 3HK3B 1GJ4H 2BDGA 4ESTE 2VINA 3ITIA 5FHTA 2XBXA 3LGWA 1K22H 4GLYA 4OS4A 3MMGA 1OX1A 1XXFA 3FVFB 1C9TA 2ZA5A 1XUIA 2CF8H 1TIOA 4BTUB 1NFXA 5E2OA 2GMTC 5DP9A 4I86A 1W2KH 3SORA 2B5TB 1D6WA 2QXIA 1TX6A 4BAMB 1DITH 1EZSC 1O38A 2WV4A 1CU1A 1TNIA 4JK5A 4I32A 5EG4A 2Y5GA 2C8YB 3W1EA 1E79D 2ZECA 4I8KA 2WPMS 4Y0YE 2SFAA 5E8EH 5DN6D 2GCTB 1TYNA 4FU8A 2Z9LA 5C3NA 1JIRA 2BD2A 1TOMH 2VWMA 1QL8A 2ESTE 4AFZA 3RXRA 4B75A 1NM6A 1CA8B 1X7AC 3A7WA 1ZLRA 2ZTZA 1SQTA 4IMQA 2BD7A 1FPCH 1LMWB 2VB0A 3L6PA 4WXVA 2R3YA 2W5EA 3RXCA 3SI4H 3MNCA 5F8TA 4E7NA 3STIA 3A89A 4NIVA 1C1RA 3KF2A 4FUCA 4MNYA 3VB4A 1GJ9B 1ID5H 2Y7ZA 3RXMA 1KXFA 5L2ZH 3DSPA 1M9UA 4U32A 3M3TA 1HAIH 1PPEE 2JH0D 1O2GH 6CHAB 1KLJH 2JIZD 3PMHB 4M9FA 2HPPH 3QO6A 1ELFA 2NU0E 5H4IB 1BOQA 1CGJE 2ZFTA 2IJD1 3GY3A 2A2XH 3ATLA 2FEQH 4Q2KA 2OD3B 1ACBE 4ZMAH 3SHCH 1C1SA 2SGQE 2XWBI 2ZTYA 1SI5H 5DSFA 1GL0E 1O35A 4OS7A 4TPYA 1QGFA 1MABB 4Q63A 1CO7E 2GZ9A 1UVPA 1C5TA 2ZFQH 2ZPQA 4A92A 2DE8A 1O5AB 4F48B 1IQFA 1SLXB 2W7SA 3MH5A 1C5RA 2P93A 3PO1B 3SU5A 1HAYB 4IS5A 4UEHH 1V2OT 1D9IA 1HAVB 4GVUA 4CRFA 1UVOA 3MI4A 1HAHH 1T4VH 5DP6A 1A2CH 3KQEA 5F8XA 3SZNA 1C5OH 1QCPA 4ABGA 4B74A 2XBWA 1O2ZA 2G4TA 2WPKS 1Y3VA 4AX9H 4FOUC 1ESTA 1AU8A 1W0KD 1AHTH 4IGDA 4BANB 1C5SA 1GI6A 1FX0B 4ACAA 1HAGE 4AOQA 5HM9A 1KDQA 1OWIA 2ZGXH 5GPIB 4U01A 1J16A 1QBOA 1ZJKA 4ZKRU 3TK9A 4AGKA 3MFJA 1BTXA 2TPIZ 2RDLA 1EZXC 4X1SU 3FFGA 1ZOMA 4R8TB 5E0GA 4AG2A 1UK3A 3PRDA 5FBIA 2PTCE 2H9TH 3TLOA 1SGFA 2HRVA 4DW2U 5JB9S 4JYUH 3ODFA 1WQSA 2LPRA 4D76A 4K8YA 4CH2B 1P9SA 4CHAC 3RU4T 1LHFH 1K1MA 3OY5U 3U1JB 1KSNA 1O3KA 3BTTE 1UHBA 1SGNE 2ZU5A 1HGTH 4BOHA 3M5NA 1EFRD 3Q00A 5HKKD 1TPPA 3AAVA 3UREA 3T25A 3F2FA 3GICB 3F2HA 5KECA 2ZDLA 1MQ5A 5EXMA 4NA8A 3UOUA 4I8HA 4YLUA 3GCTG 2BYAX 1V2RT 3M5LA 1AN1E 1JXPA 1W3CA 1NFWA 1RRKA 2PGQB 2XNDD 2BQ6B 1BRUP 1EX3A 1F0RA 2G5VA 2B9LA 1K1JA 1K1NA 1LHGH 4ABFA 1O3IA 4F49A 1C1UH 1O30A 1Y5AT 2WPJS 1DSUA 1K1OA 1QNJA 4LK4A 1FZZA 4FETA 2B8OH 4WF8A 1GBCA 3SUEA 4A7IB 1FV9A 2OQ5A 1IHSH 1GBAA 4IMZA 1XKAC 1H8HD 1P8VC 2BD9A 3SJ8A 4BTTB 4LOYH 1QIXB 1OP2A 2A7JA 2BY5X 3KQBA 3P6ZB 3BTGE 3PV5A 1T4UH 3BEFB 4AYVB 1OWHA 4ZKSU 1KY9A 1L1JA 1DWBH 1TGNA 1O37A 2CHAC 1HAOH 1Y8TA 1HBTH 2J92A 2PKSC 5F53A 2BVXH 4DIHH 2ODYB 2FODA 3EA9A 1BQYA 1OKXA 2AFQB 2ZI2H 1RD3B 1EXFA 2PSYA 4K1SA 1C5UA 1YM0A 1TQ7B 4X2WA 1N6XA 5LPFA 4A6LA 3GCOA 1W0YH 3RXUA 3GCNA 3M35A 2BDHA 1JWTA 1CT4E 1GJAB 3A8AA 3RMLH 3UR9A 2A32A 3RXQA 4YOIA 1UTOA 4IW4E 2KFWA 2R2WU 5JBBS 3SJOA 1P01A 3E0PB 2Z3EA 1VITH 2OC0A 3EE0B 1FPHH 5T3HA 2EY4C 1XXDA 2VGCC 3BEUA 3U98H 2GCTC 3SYJA 1Z8RA 2FYQA 4MPVA 1C5PA 3CENA 3PB1E 1EB1H 5FPTA 4O3TA 3E1XB 1OPHB 1WAYB 3EYDA 5AFYH 1CT2E 2F9PA 1TMTH 1H9LB 1LVBA 3SNCA 1DSTA 1DUEA 3Q3YA 5EW2H 2BQ7B 1AWFH 2QF3A 5DJ7A 5JYIA 4FUIA 1A7SA 2EI6A 3RC4A 3F0PA 4X6NA 4ABAA 1H1BA 1S0RA 1A4WH 3EA8A 4X8UH 2BB4A 3QX5H 2XOKD 1GBHA 1AVWA 3ATMA 5HM2A 3MU1A 2BD4A 2EA3A 2GD4B 2XNIA 2PFEA 3MH6A 1P3CA 3F0OA 6CHAC 1D3TB 1G2LA 4AGJA 3M7UA 1SQRA 1NBME 1P2JA 1FLEE 5A09A 2YOLA 1VCQA 5EU8A 3LDXH 2ZHEH 1XUGA 1Q31A 3SU2A 1L1GA 1HUTH 1S0QA 5CMXH 1V2QT 1G30B 1QY6A 3BV9B 3VG8A 1ESAA 4WH6A 3MO9A 1HJ9A 1EJAA 1C1VH 2GTBA 1WQVH 4HI3A 1DE7H 5FCRA 3OE7D 1UVSH 2W3KA 4GSOA 2KZ4A 4BAKB 2VIDA 2ZDAH 2FS8A 2WSSD 1EAWA 1FN8A 3PO1C 4QT8C 3BSQA 1VCPA 5AF9H 1AKSB 1NY22 2BLVA 2IPHA 4DJZB 4TY6A 1GBKA 1GGDC 2AS9A 1GI9B 1B0FA 1GMCG 5G4BA 1HRTH 1C5QA 1ZTLA 2VWLA 3LGUA 3OFND 3PROA 3ENSB 4ZHAA 1E34B 1WDIA 4ABJA 1TA2A 1W10U 2P95A 3PMAB 1FY3A 1HXEH 5A2MH 3H09A 4FU7A 1SL3A 3LONA 3FP8E 4K69A 1TRNA 2J95A 2Z9GA 4OGYA 3ZZ5A 4B73A 1NBMD 1RIWC 1YCPM 2V3HH 1CSOE 2BDAA 2ZU1A 2ZDMA 1BTHH 2PSXA 2SGDE 2VJ1A 4Y7AA 2BLOA 1GHAG 2FOCA 2GMTB 1TPOA 3GISB 3GY7A 1K1PA 2A2QH 2OLGA 4BAQB 4B71A 1RGQA 2FOGA 4XSKU 3V12A 1GHBF 1BMAA 1TNHA 1C1QA 1NROH 3MO6A 1UTJA 3R3GB 1E35B 4GCHG 1OWKA 2XW9A 2F9OA 2ZF0H 5IDKA 1P57B 2WPLS 1MUEB 2PUXB 3EQ0H 5GWZA 1GBEA 5GDSH 3RUOA 4Z6AH 1AE5A 3D49H 1ZPBA 1FIZA 2VIWA 1NC6A 3BN9A 4B2BA 4XOJA 5PTPA 1IQMA 1VZQH 3TJNA 3SI3H 3MTYA 1MD7A 3V7TA 1SB1H 5JPMH 1ZHRA 1XUJA 1O2OA 3M61U 5DP4A 1EUFA 5FXLA 3TIUA 4FU9A 2O8UA 2G4UA 4FUJA 4JZDH 3E3TA 2VBCA 3BG4C 3W95A 3TH3H 1SLUB 3CS7A 3BEIB 4FUHA 5C20A 2RFKC 1YLNA 2EI7A 2ZO3H 4RKJB 1O2IA 4ASUD 1ZHPA 3KGPA 3QLPH 4HTCH 1E0FD 1MU8B 3ZIAD 2QCYA 1TLDA 1TBQH 3MO3A 2PW8H 3E91A 2W6ID 1S6FA 1EAXA 2VIVA 1C5WB 1GDNA 1B0EA 1BMNH 3RXSA 5LGOA 4UFFH 1TX8A 1LO6A 1HV7A 4TYDA 2OQUA 2CF9H 2D2DA 4TPIZ 2PHBA 1SHHB 2GVFA 1XM1A 1FQ3A 1VR1H 4Z0KA 5ESTE 2OC7A 4WVPE 4NIXA 2SGFE 5HMAA 2STBE 1F5RA 1P3EA 2Z3DA 3H5CB 5L6NH 5E0HA 2AMDA 1SFIA 1TNKA 4X2YA 3VB3A 4A1VA 1WCZA 1Z8GA 3SBKA 1SBWA 3FZZA 4Y79A 1C2FA 1QJ7B 3UWJH 1SR5C 2PGBB 2FOHA 5DPAA 2JETB 1XVMA 2PTNA 3SUGA 4AFQA 3B23B 1BMLA 2ZHQH 2BDYA 2F4LA 1KXEA 1HJAB 4X8TH 2A0QB 4UE7H 1FY5A 1GJ8B 4FVBA 2O8MA 1ANBA 1XMNB 1AQ7A 3JZ2B 4HG6A 3LH1A 2CXVA 1P05A 2C8XB 1O2NA 1LCYA 3UUZA 1H8ED 2BX4A 2OINA 5A8YA 4JYVH 4HGCA 1MBQA 4OM9A 3SQEE 2FX4A 5TCAA 2GZ7A 2FOMB 1P2MA 3E0NB 3VGCB 1BJUA 4XDEA 2A5AA 1A5GH 3VB5A 1C1PA 1TGCA 3NXPA 1AO5A 1TOCB 1K21H 2BOHB 2G51A 3T62A 1T31A 1CA0B 2QF5A 3V0XA 2P3UB 1ESBA 3OYPA 3RMMH 1O2LA 1MKWK 3IG6B 1DANH 3RU4D 1PQAA 1DLEA 4MPUA 4ZROA 3ZZ4A 1TGTA 1PQ5A 2W7UA 3OTPA 2XRCA 4JZ1A 2IN2A 1BITA 1L0ZA 3KEEA 1A0HB 3OEED 4H42U 4X8VH 4YOGA 1QHRB 1BCUH 3RXJA 1HIAB 2PUQH 1J17T 2A4GA 1B7XB 1OOKB 1THPB 1TFXA 1MH0A 5FX6A 1NT1A 1C5MD 8GCHF 4K1EA 3SV8A 3MNBA 1E38B 4YZUA 4UFGH 5GIBA 1BTPA 2AGEX 1KTTB 3F1SB 4SGAE 3GCTF 4Y0ZE 1QL7A 1O2UA 1O3GA 2Y81A 1UVTH 5CHAB 3SJIA 3F9FA 1IQJA 3FO8D 3F9GA 4ACBA 2QV1A 1GDUA 3P95A 3G01A 1SLVB 1CE5A 1PQ8A 1UTKA 2CHAB 1D3DB 3SU4A 2SGPE 1A0LA 1GHBG 3DFJA 3E8LA 3QGJA 3SU6A 3WWBA 5EQRA 1GCTB 4TSFD 2YMSD 1COWD 3U28C 2BXUH 3LJOA 5J4SA 1QL9A 4PROA 1WOFA 2BZ6H 1BMMH 1P2NA 1UVUH 1UTNA 1MTNB 1TGSZ 4X2XA 2K8IA 4I31A 2ZPRA 2FI4E 1BA8B 1SPJA 3SGAE 1TPAE 1A61H 4JK6A 3RXEA 1ZR0A 4X6PA 1MKWH 1GI7B 3D65E 3SV6A 4AFUA 2J4IA 2FZZA 3LOXA 1EOJA 2VGCB 4A1TA 3I29A 3PV4A 2C4FH 1F5KU 3TPIZ 3ZV9A 4NCYA 1HCGA 3STJA 2QXJA 3UQOA 4I8LA 5AVDA 2M5TA 2C90B 1O2VA 4MG3A 3QN7A 3A82A 4BXWA 1ELCA 4DIIH 4SGBE 2F9VA 4JZFH 2I6QA 1RS0A 2G5NA 4XBCA 4YO9A 5FBEA 2EQNA 4NIYA 2Y6TA 1P03A 1C1NA 5EGMA 4WWYA 3LGYA 4AYYB 1F2SE 4Z1MD 2PP6A 2WYJA 5DG6A 1WXRA 3O8RA 5C1UA 1JMOH 1Z7KA 1O36A 2ANWA 2FM2A 1O5BB 1FUJA 3A7ZA 1SLWB 2B7DH 3K9XB 5F03A 1W11U 1IQGA 1MAYA 1ELEE 3DA9B 3T29A 2ZQ1A 2C93B 5EJ1A 3RXBA 1C2GA 1O2QA 1T8MA 4DG4A 1DICA 3ZV8A 8KME2 3FOAA 4DT4A 2A7CA 1TAWA 1V2TT 4A5TS 1K1IA 2AYWA 3UAIC 1UCYE 1BTZA 1XUKA 2OP9A 4H6SB 1SQAA 2Z3CA 4P00A 1O31A 1GHYH 2V7QD 1FIWA 3PYHA 3SNEA 3LKWA 5L30H 3QTOH 5EJLA 3RMOH 4O03A 1NN6A 1QBNA 1ETTH 1OS8A 2JETC 2ZCLP 3S9BA 1GGDB 2SNVA 2QF4A 3K65B 1ELAA 1LPKB 2KAIB 1HJAC 3B8JA 5HGGA 1SFQB 4X6OA 3BTME 2IOTA 2ALPA 3V13A 2ZKSA 1ZSLA 1N8OB 4DOQA 1ELGA 3BIUH 3M5MA 4YLQH 1V6DA 2ZDKA 4AN7A 3HATH 2G00A 1YP9A 2CMYA 2F9UA 1GMCF 1S81A 5A0AE 2GCHG 1WV7H 1O2SA 1O3JA 1ZRBA 3A87A 3ESTA 2BD3A 1RIWB 1NRRH 1BUIA 3QWCH 1HIAA 1YBWA 5C5NA 2C3SA 4JYTA 3VGCC 4D7FA 2G52A 2ODQA 3MHWU 3LC3A 1ZRKA 3VPKA 3GDVA 1O32A 1P2KA 2LP6A 1CA0C 5BPEA 1NRPH 3F9EA 1S5SA 4FUBA 5LPRA 2BY6X 3N7DA 2I6SA 4B6FA 8GCHG 3URDA 5JBAS 1SG8B 1SGQE 5FX5A 1E1RD 4Y71A 2IPQX 2H9EH 1O3LA 1Z8IB 3RM0H 1GHAF 1O34A 1ANCA 1VJ9U 3D23A 4ZXYH 3RDZA 1C2KA 1SOZA 1XVOA 1YPGH 1O3PB 1OXGA 1SGEE 2D1JA 3L3TA 3HKIB 4INKA 1ARBA 5KEDA 1BBRE 4I8GA 1YGCH 5KGOA 4IC6A 2NU1E 3TNTA 3MU8A 2ZU4A 1GCDA 1IQLA 4GCHF 1GJ6A 1G3DA 3GY4A 4HFPB 4O3UA 3BG4B 2FPZA 4Y8YA 2KX4A 1RXPA 2OC8A 5CHAC 3KIDU 1Y3YA 4JZIA 3UNRA 4YESB 3A86A 4WH8A 2ZDVH 3QZQA 5CHBA 2QGRA 1A3EH 3OTJE 3S7KB 4DVAU 1JRSA 3QK1A 4XBDA 4NZQA 1BZXE 2BDCA 2XC4A 1GCTC 1GI3A 3A8DA 4KKDA 1V2KT 2GP9B 1DLKB 4JCNA 4Q7ZA 4CR5A 4X2VA 4ZH8A 2C8ZB
chains in the Genus database with same CATH topology
1H8IH 4Y11E 1MTNC 1OSSA 1ZMNA 3SGQE 2D8WA 4MNVA 5EPYA 1YYY1 4WMFA 3KL6A 4OS6A 7LPRA 1DFPA 1T32A 1TBZH 3A85A 4Q7XA 2A5IA 2OC1A 1EP6A 4B76A 3MH7A 1F92A 3O8CA 4ZKNU 2UUYA 2WV5A 3M5OA 3DD2H 1F0UA 3L33A 2ZGJA 2ZGBH 2BLQA 3LIWA 1Y5UT 1O5GH 3ZVGA 1GI2A 3BTDE 3GY2A 1DWCH 1DWEH 3BTWE 4JZEH 4E06H 1QTFA 2PV9B 1DS2E 4FUGA 1GI4A 1WU1A 3T27A 1HB0B 1IQHA 2P3FH 3PTNA 1TRYA 1LHEH 1ORFA 4AFSA 2Q1JA 1A5HA 2HNTE 4IN2A 3OSYA 4NSVA 9ESTA 4ZUHA 2ZWLH 3DHKH 1QB9A 4R0IA 4WY3A 5DP3A 3OX7U 2XBVA 4I33A 2ZQ2A 1GBDA 1O33A 1HFDA 2G8TA 4Q80A 1C5YB 3BG8A 1PPCE 2A4QA 1GG6B 1HAVA 1NU7B 2QC2A 1KXBA 1BIOA 4YOJA 4X1NU 1C2JA 4D8NA 3SNDA 4JMYA 1RTLA 2JKHA 4AORA 1GHXH 5A8ZA 4O9VA 1TMUH 1G9IE 1V2NT 1EPTB 1C1MA 4D7GA 4B1TA 3SN8A 1YPKH 1NRSH 4D9QA 4DT7B 2GT7A 3JZ1B 1KIGH 4DCDA 3QTVH 2JH5D 3KCGH 1S82A 2VU8E 3RXOA 1GDQA 4J1YA 1O5EH 1GJ5H 3GY5A 1C5NH 3ZVDA 5A0CA 2ALVA 3ZVEA 1PPFE 3SNBA 1MZAA 3QGNB 5AFZH 4MPWA 1AB9B 1D4PB 1QB6A 1QRXA 2ZC9H 3PLBA 1EAUA 1KXAA 2FYRA 1N8OC 3A7VA 1J15A 1CBWB 8LPRA 2ZHDA 3UQVA 5JBTA 1O2HA 2Y80A 3U8RH 3A8CA 2PKAB 3T5FH 2FWWA 1MTWA 3K2UA 1Z8JB 3S0NA 1D3PB 2FESH 3RXVA 1TONA 5K7RA 4MPXA 4VGCB 1O2RA 2XTTB 1ZZZA 3P92A 3TGKE 2RCEA 3CS0A 2HPQH 3PTBA 1EZQA 1SSXA 3NPSA 1G37A 1F0SA 3TJUA 4IN1A 2G55A 2VIOA 3QZRA 1AUJA 3IITA 5L2YH 1AWHB 1DWDH 2YNBA 7GCHG 1UMAH 1PPHE 2D26C 2FI5E 1C2MA 1A0JA 1MQ6A 1PPZA 4CRCA 5LPEA 3Q3KA 5K0HA 1V2VT 1C2DA 4KP0A 3F9HA 3O8BA 2Z9JA 1CQQA 3Q76A 2RG3A 4GUXA 1DXPA 2BZAA 3UOPA 1QJ6B 4A1XA 2FIRH 3NKKA 1AZZA 3A80A 2QN5T 3SV9A 1GWAA 5EW1H 2BOKA 2OBOA 4KTUA 2IJOB 1NTPA 2GV6A 1A46H 3BTHE 1HDTH 2J94A 4CRAA 1IQNA 2BY9X 1A3BH 3S9AA 2FOAA 4CR9A 1HJ8A 3PLPA 1Y59T 2UUJB 3UY9A 2ZFFH 2BY7X 1KXDA 5LH8A 1BRBE 1W12U 1DVAH 1G3BA 4UFDH 2OXSA 3VFEA 1O3AA 5GJ4B 3U9AH 1ELVA 2H9HA 4AZ2B 1SC8U 3FP7E 3SV7A 3ZYDA 2Q6GA 4K8BA 1EJMA 2A4RA 4BAOB 2BM2A 2XWAA 3A7TA 2H2ZA 2ZPSA 1PQ7A 1K28D 1TNGA 1ZTJA 4K5ZA 1OWDA 1ELTA 3TK6A 1GBJA 3RU4E 1SGPE 3E16B 1ZGIA 3EA7A 4KGAA 5EQQA 2TBSA 5HXFA 4UDWH 2F3CE 1FN6A 3ELAH 4CBOA 3PMBB 2AIQA 1WYKA 3UFAA 2UWLA 3P17H 1GBIA 2BLWA 2O8TA 3SW2B 4KTSA 3RXDA 2HOBA 1NZQH 3UWIA 1SGCA 4H6TA 5T6FA 2FDAA 1KLIH 2WPIS 2BVRH 2BQWB 1F5LA 1ELBA 1C2LA 1MU6B 6GCHG 4NA7A 4Q7YA 4U2WA 5TJXA 4ABHA 4CRGA 2G81E 1H9HE 1P9UA 1N6YA 1YF4A 1FAXA 3S7HB 2Z9KA 1EP5A 1BRCE 1P12E 5DKMA 1KLTA 2R2MB 2QAAA 5F8ZA 1CHOF 3GCHB 1C2IA 2UWPA 2XC0A 1DT2A 1AKSA 1GG6C 4MLFB 1S83A 4ABIA 1PJPA 2DUCA 1YPHE 2DE9A 2P3TB 1GMHF 3ZZ9A 2BMGB 4CRBA 1VCWA 2R0KA 3P70B 4O97A 2BX3A 2ZHFH 2GCHF 3WY8A 3MU0A 1YLDA 4MDSA 4ISIH 1EPTC 1BRAA 1ZPCA 1O2MA 2UUFB 1WSSH 1A1RA 1KTSB 1P2OA 1O3NA 2EEKA 3U1IB 3URCA 1RTKA 1C1TA 1NRNH 4IBLH 1H9IE 2JH6D 2V0BA 1HXFH 2CJIA 1AE8H 1T8LA 4INLA 3SOSA 4WMDA 2VIQA 2XC5A 3OU0A 4U30A 2H1UA 2WUCA 5FPSA 1QURH 4M7GA 1WTGH 3BTKE 1BJVA 1G3CA 4INHA 5C1XA 1KDQB 4ZHMU 1AB9C 4X1QU 1ELDE 5JDUB 1GBLA 3SUFA 1K2I1 1LVOA 1ABJH 1O3DA 2Y82A 3DUXH 3ZVBA 1GPZA 5TCCA 5A0BA 4NFFA 1CBWC 1P2QA 2SGAA 2VNTA 3M7TA 1P09A 2WINI 1O3MA 3EDXB 4DY7B 2ZGCA 2V6NA 1WTHD 1K1LA 1INCA 1UHBB 1F7ZA 3HK6B 4FXGH 4VGCC 1MBMA 1GJ7B 2BVSH 1FMGA 1C4U2 3TH2H 4RN6A 3HGNA 2OCVB 1SOTA 2FP7B 4BNRA 1O2XA 1D6RA 1Y3WA 1FY4A 4ASHA 4NIWA 4LZ1H 2GGVB 2F83A 3R0FA 4K60A 4BTIB 3SJKA 3RC6A 2FLRH 2Y5FA 1Z6JH 1ETSH 4K2YA 4GHTA 1O3EA 2UWOA 1MKXK 4KELA 3MU4A 2GKVE 1JRTA 1UTQA 1SGTA 1NRQH 3LJJA 4H4FA 4YM9A 3D62A 3UR6A 3LT3A 3RXGA 3ZZDA 3ZZ3A 1NO9H 1V2WT 2A45B 2QXHA 1C5VA 2HNTC 1C2HA 5GCHF 2V3OH 1BTYA 2GDEH 2O8WA 4CBNA 3UPEA 1H8DH 3B9FH 3QUMP 2QF0A 1SGYE 2WYGA 2Q6FA 1MCVA 3E90B 3NWUA 2FOBA 3DFLA 1ZSKA 1DPOA 2VVVA 1C9PA 1GBTA 1O0DH 2QA9E 3MOCA 1CGHA 1HPGA 2VVCA 5EXLA 5DP8A 3TU7H 5B6OA 3UIRA 4AB9A 3S69A 2LNCA 1T8OA 5CE1A 1GI8B 1MZDA 3Q77A 2ZIQH 1AUTC 2A4OA 2H6MA 2ZCKP 1LPGB 1IOEA 3AAUA 3ZZAA 2H5CA 1CGIE 5EPNA 3P8FA 1GJCB 1GHZA 3LU9B 1NESE 2EC9H 1SVPA 3ZZ6A 2ZEBA 5I46H 1FJSA 1W7XH 3SV2H 3N7OA 1OP0A 2P8OB 3FP6E 1DUAA 1ZSJA 1DOJA 4WMEA 1V2MT 3K6ZA 4XBBA 2AEIH 5ABWA 1RTFB 4RSPA 1NS3A 5E2PA 1UK2A 2AMPA 1LQEA 1TGBA 1SGFG 2ULLA 5BRRE 1MKXH 3TITA 2TGDA 5JBCS 3NK8A 1F0TA 1GVKB 1JOUB 3H7OA 1QQUA 3SNAA 3NZIA 1CHOG 2FXRA 3VXFH 1C4V2 4GPGA 5EQSA 2ZTXA 1FDPA 1W13U 1FY8E 1UCYK 1V2UT 3M3VA 2ZGHA 1HYLA 1PYTD 2VH0A 1DDJA 1GMHG 2ZP0H 4TWYA 1DX5M 4ZXXH 3GDUA 2F91A 2AMQA 3ODDA 5EOKA 1YPEH 5DK1A 2P59A 1UK4A 3A7YA 3GCHC 1AIXH 4MNXA 3MNXA 1SHYA 1TABE 1JBUH 1O2TA 1XUFA 1FI8A 1UO6A 2ZFRH 1TNJA 1O3FA 5GXPA 2PWXA 4FVDA 4ABBA 1BT7A 3RXKA 1O2YA 1E37B 3TK5A 3ZVFA 1QQ4A 2CGAA 3DT0H 1ZJDA 3AW0A 4LXBH 3A83A 3MNSA 1AZ8A 2Y5HA 1O2WA 2VH6A 2C8WB 1GBMA 1IHTH 4ISLA 4B2CA 1V2JT 3W94A 1G32B 2BDIA 1GMDF 1AFEH 2BD8A 3RXIA 1O5FH 3RLWH 5F6MA 1AY6H 7KMEH 1S6HA 3KNXA 1SMFE 4Y10E 1LHDH 3A81A 7GCHF 1LVYA 4Y76A 2ILNA 1Y5BT 5J4QA 3FANA 1VITF 3AVZA 1NU9A 1YKTA 3LGTA 3TJVA 1RFNA 1Q3XA 1SGIB 2HLCA 1C1OA 3BTQE 2O9QA 3ATKA 3F6UH 4K3JA 2FOFA 2HGTH 1MTUA 2J2UA 1SGDE 7ESTE 1P11E 3I77A 1LKBA 4IC5A 1AFQC 2R9PA 2R3UA 3LGVA 1TNLA 4E7RG 1ARCA 3CP7A 1UCYH 1U6QA 3EAJA 1BBRK 2BY8X 2YNAA 1L4ZA 4MNWA 4BAHB 5FAHA 1AVXA 1KYNA 1V2LT 4YTAA 3BTFE 1J8AA 1AD8H 1THSH 1CT0E 5AHGH 5GCHG 4F4OC 1VGCB 2TRMA 2VVUA 1HNEE 1E36B 3TGJE 2AIPA 3V3MA 3KQCA 1UTLM 2AH4X 2XCFA 3BF6H 2AERH 1EQ9A 1C4Y2 1QA7A 2ZU3A 3ATIA 1HLTH 2PR3A 1C5ZB 2QIQA 1PFXC 1ZMLA 1V2PT 4X1PU 1TA6A 1P10A 3RXTA 1ZMJA 1ZYOA 1O3BA 1GJBB 4FUEA 3S9CA 5DO4H 1O5CB 4CH8B 4NG9H 1EZUC 3ZZBA 1TWXB 4NGAH 4THNH 1YCPK 1GI5A 4WXIA 2J38A 4XE4A 1YPHC 1TBRH 4I8JA 1C5XB 1Y3UA 4X0WU 1L2EA 1EASA 2VWNA 3LGIA 3ZYEA 3VB7A 1QRWA 3TVJB 2R0LA 1IAUA 1IQEA 1ABIH 3HPTB 2Z6BD 1XKBC 1P02A 2F9BH 3SGBE 6GCHF 3A8BA 4MQAA 1P2IA 1Z1JA 4ZKOU 2TGTA 3OY6U 3FZDA 4NWKA 5C2ZA 2KAIA 4Y7BA 1GVZA 2FLBH 2NU3E 2ZFSA 2GZ8A 3SU3A 2V35A 3RXFA 1RJXB 1GI1A 1FY1A 1P0SH 1O2KA 2P8OC 1DXWA 1QJ1B 1BBRH 1EJNA 4NZLA 2OTVA 2ZHWH 2ZFPH 4GAWA 2FX6A 3PLKA 2HNTF 3M3SA 4TWWA 1EAIA 1Y3XA 1C1WH 1QFKH 3K6YA 2P16A 1L4DA 1V2ST 1O3HA 2TGPZ 3ZZCA 4I7YH 2NWNA 5A8XA 4NSYA 1QRZA 1UTPA 2A31A 1NPMA 1QA0A 2VWOA 4FUFA 3SO3A 4CRDA 5SGAE 3ZVAA 1V3XA 1QB1A 4AG1A 3GY6A 3HGPA 3LH3A 3P8OA 2H5DA 1LHCH 1LQDB 4ISHH 1OWJA 3NUMA 3SQHE 2GX4A 1BTWA 3SU0A 4AB8A 4BXSA 1TE0A 4NFEA 3AW1A 4DGJA 3BTEE 2FTMA 1GHWH 3I78A 3UNQA 2FO9A 6ESTA 1YCPH 4Y8ZA 2XBYA 1IQIA 2Z94A 2CV3A 2J9NA 1AVGH 3M36A 1UJ1A 1GMDG 1J14A 2QY0B 3GOVB 3F68H 5DGJA 3M37A 3RM2H 1LPZB 1DY9A 1BB0B 1PPGE 1EOLA 3MH4A 3P8GA 2ZZUH 3RXLA 4MTBA 3Q3XA 3RXAA 4LZ4B 1ZTKA 5T6DA 1UTMA 1VITG 1O5DH 3TGIE 5JB8S 1ZPZA 3SU1A 1TRMA 2NU4E 3TJOA 2UUKB 2ODPA 5C5OA 1Z1IA 3NCLA 2XCNA 1BDAA 2ZNKH 2K1QA 3UNSA 3C1KA 1PPBH 1O39A 4OGXA 4YT7H 2RA3A 4MVNA 2J34A 3VB6A 4X6MA 1CHGA 3O8DA 1FNIA 1CVWH 1PYTC 1MCTA 3SHAH 1HAZB 3AASA 3SUDA 2STAE 3LC5A 1ANEA 2ANMH 3H7TA 1YC0A 4GHQA 3FAOA 3RLYH 1Z71A 2OUAA 2XXLA 1TX7A 4DURA 2ZU2A 4CREA 2RA0A 3IWMA 4OS5A 5C67A 2GDDA 5ESBA 1KXCA 2NU2E 1T7CA 1TALA 3GYMA 1T8NA 1W7GH 1AGJA 1DM4B 2SGEE 2Z7FE 4HZHA 4ABEA 1P06A 2HWLB 3TNSA 1LVMA 1EKBB 1NFUA 4YT6H 4ZAEA 3RP2A 1L1NA 1AMHA 3KHVA 1JIMA 1ZGVA 5I25A 1ETRH 1FONA 3RXHA 1OWEA 1O2PA 2HALA 1VGCC 1TQ0B 3ZZ8A 1BHXF 1TMBH 1SGRE 1YPJH 4X8SH 3GDSA 5E0JA 1QR3E 1YPLH 1A5IA 1LTOA 3ATWA 2CN0H 1S85A 1EB2A 1Q2WA 2HVXA 4NA9H 1S84A 2FTLE 1EATA 1MMJN 3A84A 5T6GA 3T28A 3HKJB 1ZHMA 4NWLA 5DP7A 1TB6H 1FXYA 2ANYA 1XUHA 1O3OA 5IYTA 1YPMH 3MU5A 4UONA 2O8LA 1BTUA 1XX9A 1THRH 2ZG0H 5C1YA 3ZVCA 2BXTH 1GHVH 3T2NA 1EPTA 3TH4H 1LDTT 1HAPH 2AGGX 1K9OE 1C5LH 1GI0A 1GBBA 3GYLB 4UD9H 3EGKH 2TIOA 2WUBA 4ABDA 1IQKA 3P8NA 4FUDA 1W0ZU 1QBVH 2FMJA 6LPRA 1W14U 3MYWA 3MWIU 1G36A 2BHGA 2VIPA 5EXNA 2W3IA 1LKAA 2BTCE 1P04A 1G2MA 3KN2A 2A7HA 3RMNH 2W26A 3A7XA 1MAXA 4Y8XA 3U8TH 1TPSA 3PWBA 1WUNH 4D9RA 1SQOA 4J2YB 5HYOA 4E05H 1GJDB 2Y7XA 3BIVH 3UTUH 2GV7A 2TGAA 1D3QB 1BHXB 2A1DB 1N1LA 2ASUB 2PKAA 1W8BH 2SNWA 1DY8A 1GBFA 3VXEH 1FAKH 1MD8A 1WBGB 2FOEA 3PMJA 4CHAB 4ZHLU 4XFQA 1OYQA 1MTVA 3U69H 4X1RU 1G3EA 2A5KA 1C2EA 5FPYA 2GT8A 5DP5A 1O3CA 1ANDA 3LPRA 5EODA 2P94A 3RC5A 2AGIX 1GVLA 4ISOA 1OP8A 3M7QA 3PM3A 1AI8H 3T26A 1H4WA 1VJAU</