4YM9A

Crystal structure of porcine pancreatic elastase (ppe) in complex with the novel inhibitor jm102
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Chymotrypsin-like elastase family member 1
publication title Clickable 4-Oxo-beta-lactam-Based Selective Probing for Human Neutrophil Elastase Related Proteomes.
pubmed doi rcsb
total genus 60
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ym9A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ym9A01
4B2BA 4Y10E 3E0NB 1RTLA 4ZHMU 1KXBA 4AN7A 2AH4X 4JYTA 1THPB 5FPSA 1FUJA 2VVVA 1XUFA 2UUKB 1HAZB 4YZUA 1V2NT 1HAXB 1E0FD 4XOJA 1BJUA 2A32A 1MKWH 2VU8E 3TNTA 6LPRA 1EQ9A 2F9UA 4JCNA 1AFQC 1GBEA 3VB4A 2BD4A 2XC5A 3EA9A 3SN8A 3B8JA 1JOUB 1BT7A 1C5LH 1HJAC 1L4ZA 3PV4A 4H6SB 2W7UA 3BTEE 3EAJA 3URDA 4MNWA 4X8SH 3E8LA 2BY7X 2C90B 1GBAA 1ZRBA 3PTBA 5BPEA 4BANB 1JWTA 3GDUA 1E35B 3BTTE 1VCQA 3AW1A 1WBGB 1KDQB 5T3HA 1X7AC 1SG8B 2BLVA 3SJOA 1TOCB 4ISOA 3ATMA 3RXEA 1W2KH 2XBVA 1A4WH 4RKJB 4CBNA 2Z9GA 5ESBA 1GBCA 2FOCA 1TGCA 1RIWC 3ATLA 4NIXA 3LU9B 1JRSA 2JH6D 1BMMH 4TPIZ 3STJA 2BD9A 3MNSA 3ZV9A 2EI7A 1CGJE 1EOJA 2F9VA 3R0FA 5DG6A 3RM0H 1C5ZB 1O3LA 5HXFA 2ZFFH 2ALPA 2BD7A 5GJ4B 1IQJA 2PTCE 3GCHB 1XUIA 1YPEH 1XXFA 3RMNH 1TNIA 1YPKH 2GMTC 3G01A 3QZQA 2F9PA 1FLEE 4B1TA 1O2KA 1C1NA 1W7XH 7LPRA 1Y8TA 2ALVA 4FXGH 4YTAA 1VZQH 3LH3A 4MLFB 1XUHA 4WF8A 1TYNA 3UIRA 5F03A 1HAOH 1K28D 2PSXA 1Z8IB 3LONA 3ZVFA 3S0NA 1ZTLA 1C4V2 5FPTA 4KGAA 1Q3XA 1GBIA 4FU8A 1T4VH 1AB9C 1YP9A 3KGPA 1FPCH 3JZ1B 4FUBA 5F6MA 2BDBA 4A92A 1LTOA 1P2NA 2W3KA 4Y76A 1NRQH 3OY5U 1ELDE 3E6PH 1GBFA 3M7QA 1BOQA 2AGGX 2ZHQH 3T26A 3M61U 1J17T 5HM2A 1QR3E 3GDSA 8KME2 1FZZA 2GDEH 5IDKA 1NY22 3HGPA 1XVOA 1C2KA 1ZJKA 4ABJA 1V2VT 1C2IA 1GHBG 3E3TA 2AEIH 3PWCA 3A87A 1YBWA 5EQQA 3MH4A 1IQNA 1CE5A 1YKTA 4Y11E 3RXJA 1HUTH 2ZDVH 1AFQB 1A3BH 4CRBA 1EP5A 1VJAU 1Q31A 1HJAB 1TX6A 3BTKE 4X6NA 4YT7H 1YPGH 1UCYE 1EJNA 1EZXC 2JKHA 2BDHA 1HAYB 2ZEBA 1IHTH 2NU0E 2BM2A 4LOYH 4TWWA 5LGOA 5DP4A 3VGCC 2SGEE 2IPHA 1TNJA 4KELA 1VCPA 1ESBA 1QNJA 3SUFA 1D3PB 1MD7A 3K6ZA 2TGPZ 1A1RA 1YGCH 1UK4A 4GCHF 3ZYEA 1RIWB 1O2HA 1AFEH 1YPJH 1D6WA 1G2LA 1WSSH 1DWBH 1NZQH 1E38B 1HGTH 1ZMLA 3MU8A 5T6FA 2C3SA 3A8AA 4XBDA 3RUOA 1K21H 1TMTH 2SGFE 2NU4E 2WPMS 2PR3A 2GMTB 2I6QA 3LH1A 1QB9A 1UJ1A 2TGDA 3P8FA 3TU7H 3SHCH 2QXGA 1J8AA 2R0KA 3VEQB 4WXIA 5GIBA 2XC0A 5DP3A 1DICA 3T25A 1LHFH 1K22H 1LO6A 4YESB 5FX6A 4OS4A 1GHWH 1C5VA 2FWWA 3Q77A 1EOLA 3A82A 5DP5A 2PHBA 1Z8JB 1C5RA 1UCYK 1P03A 4HI3A 3IWMA 4OS2A 4AOQA 2UUFB 3SU2A 3P92A 1SGIB 4I32A 1XUKA 1K9OE 5DO4H 1OX1A 1HDTH 1G9IE 5JB8S 1T7CA 1LPZB 3ZZ9A 1YCPK 3K2UA 3PLBA 1RFNA 3BSQA 1ELTA 1GMDF 1SQAA 3SU0A 2G5NA 2VIVA 5PTPA 5JPMH 1V6DA 2ZF0H 1FDPA 1O3KA 3BF6H 1Y5BT 3M5MA 2RA3A 3KIDU 5C2ZA 1TPOA 5FBEA 1GHAG 2XYAA 3UR6A 1QURH 1HCGA 3SZNA 4OS7A 1O2LA 3PWBA 2PTNA 5L2YH 2H6MA 2FODA 1C2JA 3RXIA 3ZZ5A 1W7GH 1CA0B 3QK1A 1UK2A 3UNSA 3NZIA 1HXEH 2ZGXH 4A6LA 5E0GA 5C20A 2QC2A 1O5GH 5LH8A 2BDGA 1LVYA 2WV5A 2ULLA 4UE7H 4YLQH 4CR9A 4WJG2 5GPIB 3FP8E 3GY2A 2BQ6B 1L0ZA 4E7NA 2F9OA 2ZG0H 1HAPH 1O38A 4OGYA 3ZYDA 2HWLB 4HGCA 1L1GA 2SGPE 3SI4H 3MH6A 3VGCB 4CRFA 4MVNA 1CU1A 1TQ7B 4O03A 3SV7A 5LPRA 1TPSA 3SU6A 1AVWA 1O34A 3KNXA 3UOPA 3RDZA 1GJ9B 2STBE 6GCHG 1DITH 2FM2A 3MYWA 5EPYA 1OS8A 2M5TA 4CR5A 1GVKB 4I7YH 3BTDE 4GVUA 4X2WA 3VXEH 1RGQA 3GY8A 1AGJA 4ISNA 5L6NH 1V2UT 2J2UA 1CT2E 1GI2A 3VB6A 5EW1H 2XTTB 1W10U 2P3TB 1BBRE 2OC8A 1UVOA 4FUEA 4CRCA 1N6XA 1RD3B 5DGJA 4DCDA 3MOCA 4NFFA 2VWNA 1OWEA 1O2JA 2UUYA 3HPTB 1RTFB 3LGTA 5G4BA 3M5OA 3JZ2B 1V2PT 4Y7BA 1MKXK 2A1DB 1G32B 2GP9B 3KQBA 1ZPCA 1HV7A 4ZKNU 4XBCA 1B0EA 5TJXA 4ABHA 4JK6A 1G3DA 2WUCA 5K0HA 1ANDA 1ZR0A 4X1RU 3E91A 2JH5D 3EE0B 3LPRA 1MMJN 4OGXA 3TK5A 3BTME 2QGRA 2FESH 4UFGH 3ZZAA 4MDSA 4AYYB 1J9CH 3H5CB 1ZPBA 3V12A 1WU1A 1SGPE 4BTTB 1KXCA 2ZHWH 1PQ5A 4CBOA 1LVBA 2VIWA 1GI7B 1QHRB 4IMZA 3PYHA 2XWAA 1FJSA 1ZSKA 1V3XA 4XFQA 3MU1A 3QX5H 1IQGA 1EB1H 1TPAE 2ANMH 3A8DA 4WH6A 4UFEH 4NZLA 4JYVH 1OKXA 3PTNA 2BQ7B 3PLPA 4IN2A 1A5GH 4JZEH 1GI9B 1VITH 2BLQA 3O8RA 3RC4A 5HM9A 1EASA 1S6HA 1EZUC 1O5CB 3OYPA 1BBRK 3A7VA 2JETC 3PMBB 4O97A 3EYDA 4MTBA 1C2DA 4CRAA 4A1XA 1BMAA 1D6RA 3FFGA 1MCVA 2R9PA 4X8UH 4JZFH 5EPNA 1C2LA 3FANA 1CGIE 1P2KA 3ZZ6A 1ACBE 1QQUA 1ZJDA 7GCHF 2VNTA 2F3CE 3CP7A 4LZ1H 2G52A 5JBAS 4CHAC 1D3TB 1AD8H 1Z1IA 2ZU3A 3UR9A 3SOSA 4Q7XA 1QRXA 1LHEH 4YOIA 2OXSA 1S81A 1IHSH 1NFYA 1G36A 5DP6A 2QXIA 3BTGE 4ZAEA 2C8WB 3A7YA 3S9CA 1EB2A 1QL9A 1S6FA 3T62A 1GI1A 4Y8ZA 1KLTA 1NRPH 1V2JT 1DM4B 1A2CH 1SFIA 1SOZA 4FVDA 5CMXH 1BTHH 3SORA 1C2FA 1EXFA 1FY3A 1DVAH 3QZRA 2D8WA 3SO3A 4B74A 2ZGBH 1NROH 1GI6A 1O33A 1QY6A 3M3TA 1NU7B 4B2AA 5JBCS 3V3MA 1Z6EA 2ZGJA 1LKAA 4D7FA 1O3MA 3VB7A 2VWLA 1C1PA 1ELFA 1W11U 3QGNB 4ZKSU 3PO1B 4YLUA 5F8XA 4OS1A 2P16A 1EX3A 1C9PA 2PV9B 1W3CA 3H7OA 5EXLA 2FMJA 2P94A 3KQDA 1DE7H 3MTYA 1PPHE 3E0PB 3V7TA 2P8OB 4MPUA 1MH0A 2JH0D 2OBOA 2OLGA 1BUIA 1WQSA 1O2XA 1GJ8B 1TBRH 4UFFH 1HPGA 2H5CA 1MCTA 1XM1A 2H9HA 1GI8B 3KF2A 4LXBH 1HIAA 4X1SU 2HALA 2OD3B 3A83A 2ZDAH 1AMHA 1BQYA 1OWKA 4AG1A 5DKMA 1BTYA 5EXNA 3OSYA 2PFEA 2STAE 2CXVA 1O2IA 4MG3A 4KTCA 3HK3B 4I8JA 1CQQA 3ODDA 2QN5T 1O5AB 2BVRH 2H5DA 1C5YB 1HRTH 1O36A 2GDDA 1ANBA 4HZHA 2H1UA 2QA9E 2ODPA 5BRRE 1EPTC 3M36A 2ZWLH 3E1XB 5J4QA 3HGNA 3MH5A 3F68H 1BIOA 4RSPA 1VITG 3RXMA 3PROA 1MTWA 2SNVA 3AVZA 4X6OA 1XX9A 3FP6E 4D9QA 5LPEA 2XNIA 5HYOA 1TGSZ 3SGBE 1VGCC 1AKSA 1FQ3A 1DXPA 1ELEE 3GISB 1W8BH 5EQSA 1F0SA 2FPZA 1AN1E 1BTWA 1GL1A 5T6DA 1QFKH 3LKWA 3BV9B 1ZLRA 5HMAA 2Y82A 4GHTA 3BEFB 1ZGVA 4Y71A 4E05H 1ID5H 5EQRA 1AVXA 1A61H 3KEEA 1BMNH 1TA6A 3O8DA 2PKAB 1MTNC 3UREA 1TRYA 1DXWA 3A8CA 1FY1A 3ODFA 2RCEA 3KQCA 4X2YA 2FYQA 3ESTA 4WY3A 3LC5A 3N7OA 1DT2A 1SB1H 4AX9H 1CBWC 1RXPA 2BVSH 2PSYA 4HFPB 3FZDA 1PQ8A 3BTQE 5TCAA 4K60A 3TGJE 3M35A 3U98H 1O3CA 1AU8A 3V13A 1O2OA 1DLEA 2BX4A 4I8HA 2FOAA 1THSH 4R0IA 2H2ZA 4NIVA 1IQIA 2ZKSA 3UNQA 3RLWH 4NFEA 1HNEE 1FN8A 7ESTE 3CS7A 1MTSA 1YF4A 2O8TA 3NPSA 1P2QA 2FIRH 3TJUA 2O8WA 1UTPA 1GBDA 6CHAC 2Z9JA 1FONA 3B23B 3ZZ3A 4DJZB 3EQ0H 5DP8A 4BNRA 4A1VA 1DLKB 1LPGB 1UVUH 3SV6A 2ZFQH 1MZAA 3RXLA 2A4RA 4ASHA 1O2TA 1O2QA 2GCHF 4MQAA 1CVWH 1ZTKA 1KXAA 1ESTA 4YM9A 1O2VA 5C1XA 2XWBI 3GOVB 1O3AA 1F5RA 3TGKE 2WPJS 1MQ5A 3BG4C 5C1YA 4K69A 1BTZA 1NT1A 1HB0B 1T4UH 2ZQ2A 2GCHG 5FX5A 2R3YA 1QRZA 1QBOA 2VWMA 4WMFA 2BY5X 4Y79A 3NCLA 1TNKA 2V35A 1P3EA 2BYAX 2P3FH 2FTLE 1BMLA 1IQLA 1WTGH 2C8ZB 1TA2A 1KTTB 2P93A 1DUAA 3OX7U 1LHCH 1A46H 3TJNA 3SU5A 3R3GB 1O35A 1EPTB 4J2YB 1SGQE 3LOXA 5GCHF 2UWPA 1GJ4H 2J95A 1O37A 3I29A 4X8VH 4Y6DA 4ABAA 4JK5A 4RN6A 2R0LA 4IMQA 2QXHA 1V2LT 3Q3YA 2B7DH 3SUDA 5JDUB 5TCCA 1C5NH 1V2WT 3E16B 1O2SA 1J15A 2P59A 2ZU4A 4GAWA 2BXUH 4MNVA 4ZXXH 3W95A 1VGCB 1C1VH 2SGQE 1P3CA 1OOKB 1HYLA 1GMHF 2FTMA 3ENSB 1UHBA 4ABBA 4ZHLU 1P04A 1IQHA 1NESE 1G3CA 1QA7A 1YCPM 2CMYA 2EA3A 1G3BA 2FOBA 4INLA 1OPHB 4AB9A 3GDVA 3ITIA 2I6SA 1H8DH 4ESTE 1MTNB 2B5TB 3U1JB 1BDAA 1ESAA 4ISHH 4X0WU 1N8OC 3T29A 2QAAA 2O8LA 3RXUA 2BLOA 1QB1A 2TGTA 2GKVE 4Q80A 3W94A 3VPKA 2BOHB 1UK3A 1CBWB 1XUJA 4O3UA 1SC8U 2CV3A 2FO9A 4DOQA 2VGCC 3D23A 3P95A 3EDXB 2UWOA 1SPJA 3SNEA 1UTMA 1UTKA 2VIQA 5AF9H 2OBQA 1C1WH 4Z6AH 2BB4A 4WWYA 4X1QU 4UEHH 1SLVB 1C5TA 4DY7B 3RU4D 1GBKA 2ZIQH 4NIYA 4E7RG 4Z0KA 1GHZA 2AYWA 2BY9X 2BD8A 4Q7ZA 6CHAB 1O0DH 3O8BA 4ABDA 2G4UA 4GCHG 1QQ4A 1UTQA 2CJIA 2G55A 3MO3A 3RXKA 1CGHA 2LNCA 4FUIA 3U9AH 3K9XB 5JYIA 3S9BA 2NWNA 1AY6H 1IAUA 4U30A 1GJDB 2FOHA 2Q6DA 3RXCA 3RU4E 1QGFA 3SV9A 4YOGA 1JXPA 1V2ST 2VB0A 2ZDKA 4KP0A 1SSXA 3GICB 3UOUA 1O2WA 3VB3A 4BAKB 5A0AE 1LMWB 3P17H 5CHAC 1P06A 1K1LA 2ZDLA 2W7SA 3MU5A 1AB9B 2OQ5A 5ABWA 2TBSA 1S85A 5E0HA 5EGMA 2P3UB 1V2MT 4FUGA 3TGIE 1C1UH 1MKWK 5E2OA 2ODQA 1QJ6B 5IYTA 1P09A 1Y3VA 4SGAE 2PWXA 3NKKA 1YM0A 1ZSJA 3SNDA 1AO5A 1RRKA 1F0RA 4TYDA 3B9FH 4AZ2B 1P2IA 2Z7FE 2BHGA 1GMDG 1C2MA 1CHOF 2HLCA 4NCYA 2SGDE 4UDWH 4ABEA 4CRDA 3UWIA 2C4FH 3SUEA 1DY8A 1LQDB 4D8NA 1IQKA 2SGAA 3A80A 4TWYA 2G5VA 2ZFSA 4NA9H 2ZP0H 4UFDH 1GJ7B 1EAIA 1CHOG 4TY7A 1K1IA 1G30B 5DP9A 2HPQH 2PKAA 1GWAA 2QY0B 3KQEA 3MU4A 2FS9A 2NU1E 4M7GA 3FZZA 1UVSH 2VH0A 4X2VA 1Q2WA 1NRNH 1PPEE 1DS2E 1HAGE 4Y7AA 2H9TH 2OC1A 1C5MD 4AGKA 4BAOB 1MBMA 9ESTA 1AI8H 1N8OB 3P8NA 2Y6TA 4ZKRU 4A1TA 4ABIA 3M3VA 5SGAE 1KDQA 4BXWA 1TNGA 2PKSC 3KN2A 3ZZBA 1S0QA 1SGFA 1T8OA 1WV7H 3VB5A 3F9FA 5ETXA 8GCHF 2VGCB 3RXPA 2IJOB 1VCWA 3BIUH 2A5AA 4TY6A 1O3OA 2F9NA 2KAIB 3RXFA 2D26C 4DURA 1S5SA 3RC6A 3SQHE 1UVTH 1EZSC 1SQTA 4O3TA 3A84A 1ZMJA 2OINA 3SQEE 4Q7YA 4ISIH 3SI3H 1A0JA 3STIA 1AE5A 1EP6A 3FVFB 3ZVGA 1T32A 1C5WB 3DUXH 1ANCA 4Q2KA 3ZV8A 2HNTC 1HJ9A 1EJMA 4ZH8A 5H4IB 1CT0E 3ZZ8A 4X2XA 1H8IH 3P8OA 3RP2A 1LVMA 2ANYA 2ZU1A 2YNBA 2BY6X 1Y5AT 2QIQA 3M3SA 4AG2A 2EC9H 5GWZA 1F92A 3BIVH 1P0SH 2Z9LA 1P05A 3RXBA 3ZVEA 1TRNA 4WMEA 2Q6GA 1QL7A 1TB6H 2Z3CA 1DOJA 3SJIA 1P2OA 3QN7A 3GCTF 2ZTZA 4FU9A 2A2XH 4KTUA 3RXTA 4DIIH 1ETSH 2ODYB 3MO6A 2BTCE 1W13U 4K8YA 3RU4T 1GI5A 1GDNA 2HGTH 1MZDA 1A5HA 2Z3DA 1MUEB 2HRVA 2Y7ZA 3RXRA 3CS0A 2ZZUH 1EPTA 2BX3A 3OU0A 4MPXA 5JBTA 1Y3YA 5A0BA 3PLKA 2XXLA 5A09A 2AFQB 3GY5A 3UQOA 2Z9IA 2AMQA 2WYGA 1O2PA 5JB9S 3QWCH 1EAXA 1BJVA 1K1MA 4U01A 4UONA 1O39A 1TGTA 3EGKH 3Q00A 5EXMA 3TJVA 1C2HA 1GJBB 1UTOA 1J14A 2C8XB 3TNSA 1TAWA 1Y3XA 1O3FA 1Y3WA 1KLJH 4BOHA 2W26A 1AHTH 3MNCA 1YC0A 3ATIA 3SNCA 1CO7E 1NC6A 4I8LA 5A8YA 2Z9KA 1C1SA 4NWKA 1JMOH 3A86A 1G37A 1DSUA 2Y5GA 6ESTA 5I46H 2HNTE 3PB1E 1O2NA 2FX4A 1KSNA 2OP9A 3GYLB 4WH8A 1PYTC 1V2RT 1GBLA 1NFUA 3U69H 1LKBA 2ZFTA 2BD2A 1SFQB 2PKSB 4DGJA 4HTCH 1OYQA 4ABGA 7GCHG 4FU7A 1L1NA 1O2MA 1ARCA 3SJ8A 2YNAA 2ZCKP 1C5QA 3T28A 3NK8A 1MU8B 4BAHB 2CF8H 1AQ7A 2XBXA 3P6ZB 3LT3A 1QRWA 3CENA 1XXDA 4XSKU 4ZKOU 1SHHB 3ZVDA 4TPYA 2XRCA 3MWIU 3QLPH 1TRMA 4FUCA 4GPGA 3SW2B 1K1PA 1FNIA 1SLWB 3RXAA 2WPLS 4NIWA 1W0YH 3S7HB 1RTKA 1O5FH 2VVUA 1SGDE 4GLYA 3SU4A 3SNBA 2PUQH 1GBJA 3M7UA 1F5LA 1GVLA 1GI4A 2ILNA 3V0XA 1Y5UT 1INCA 2WV4A 5JBBS 2F83A 4X8TH 1A7SA 2A4OA 5EODA 1MU6B 1O5BB 3F9HA 2A7JA 1YLDA 4UD9H 2R2MB 2F9BH 1ARBA 1NN6A 4RKOB 4ISLA 1KY9A 4ZXYH 1AE8H 4BAMB 1PYTD 3ZZCA 2AIPA 3A7XA 1VR1H 2FOEA 1C1MA 1YPHE 1O3DA 2Y5FA 1O5EH 5AHGH 3IG6B 1C5OH 1BCUH 1FXYA 1E36B 2A5IA 5EG4A 9LPRA 1GL0E 2FLBH 2ZFRH 3A7TA 3C1KA 5E0JA 3DHKH 5EU8A 2FLRH 1NFWA 4BAQB 2IN2A 3TH4H 1MAYA 1LDTT 4NSVA 4OS6A 1ZTJA 1B7XB 5DPAA 2CF9H 3HKJB 3KHVA 3BG8A 3TPIZ 1MBQA 4O9VA 3TH2H 1TMBH 1S83A 1V2QT 1WOFA 5FCKA 4THNH 1OWHA 2OC7A 2QYIA 3AAUA 4AFZA 3H7TA 2GZ9A 3GCHC 4A5TS 2D2DA 1V2KT 2VINA 4PROA 3D65E 2TIOA 2J94A 2O9QA 5FPYA 1T31A 3QUMP 5FXLA 1AUJA 3GY4A 1M9UA 2FOFA 2JETB 2Q1JA 4NGAH 3A8BA 1OXGA 4Y0ZE 1O3EA 1AZZA 1BTXA 1D3QB 1GDUA 1U6QA 4JZIA 4I8KA 4KKDA 5C67A 5AFZH 3LGIA 1ORFA 3GY3A 3LGWA 3QO6A 3A7ZA 4VGCC 3RM2H 1EAUA 2Y80A 1PJPA 2GZ8A 1P9SA 3I77A 1QTFA 1C5XB 3RMOH 1BTUA 3A7WA 2ZTYA 1PPBH 2VJ1A 4DIHH 3SV2H 2O8UA 4CHAB 1FAXA 4H4FA 1BB0B 1FV9A 1TONA 3TJOA 2BLWA 3A81A 4MNYA 1F5KU 1OP2A 2CHAC 4JMYA 1V2TT 1NS3A 3HKIB 1AIXH 2O8MA 2SNWA 1NPMA 1SLXB 2KAIA 2NU2E 2EEKA 2BDYA 4IW4E 1ZHMA 2VH6A 5C5NA 2B9LA 1UCYH 2Z94A 5K7RA 1QBNA 1GCTC 1ELGA 3BN9A 1CT4E 2ZA5A 3U8TH 1PPFE 3D62A 1YCPH 1IOEA 2FYRA 1SGFG 1EATA 1P11E 2H9EH 3SNAA 2A7HA 2TRMA 1C2EA 1NU9A 1SGNE 1C2GA 2V6NA 2GT8A 3SBKA 3RXDA 4DVAU 3RLYH 4YO9A 4XE4A 2Y5HA 4FUJA 1W0ZU 1HLTH 5I25A 1S0RA 1JIRA 1GJ6A 2FP7B 2QF3A 4ZMAH 1Z6JH 8LPRA 3LGVA 2FOMB 3VXFH 4X1PU 2FI4E 3BEIB 4MNXA 1OWIA 4ZROA 4X6MA 1P12E 1TNLA 4GSOA 1HJ8A 1WUNH 2DUCA 4U2WA 3Q76A 2ZCLP 4LZ4B 2B8OH 1ABJH 1O3PB 3E90B 1D3DB 4WXVA 3P70B 4B73A 1SQOA 2F91A 3TVJB 1HAVB 3ZZ7A 2XBWA 2GTBA 1TBZH 1XKAC 4JZDH 2R3UA 1TMUH 1CHGA 5LPFA 1H4WA 1O3BA 1WQVH 1O2GH 4JYUH 3LGUA 1SBWA 2TPIZ 3RC5A 4F4OC 2Q6FA 2PGBB 1F0UA 4AGJA 3LIWA 3MNBA 1MTUA 2GX4A 2V3OH 5A8XA 1DUEA 2G51A 4K8BA 1TQ0B 2ZECA 2AS9A 2FXRA 1JIMA 1F7ZA 1GBTA 2V3HH 2WPKS 3HK6B 1SHYA 1O3GA 4MPWA 2BXTH 2WUBA 1PFXC 4YOJA 2UUJB 4VGCB 3UTUH 1KTSB 1S84A 1Y59T 3QDZB 2GZ7A 3SHAH 5A0CA 1GJCB 1TPPA 2D1JA 2PGQB 1KXFA 1UO6A 1YLCA 3SJ9A 2J92A 3FP7E 1MKXH 1FAKH 3K6YA 5CE1A 1F2SE 3F9EA 2ZPSA 3NWUA 2C8YB 2CHAB 1KXDA 1Z8RA 3NXPA 2BMGB 3ZZ4A 5GCHG 3WY8A 1PPCE 3RXQA 4XDEA 1GHBF 1HFDA 2RA0A 1O3JA 4GHQA 1UMAH 5DK1A 4K1EA 1OWDA 3BTWE 1ABIH 3RMMH 4ABFA 1QJ7B 2RDLA 1C1TA 1GCTB 5J4SA 3I78A 1GMHG 4OS5A 2LPRA 2A5KA 1CA0C 2IOTA 4I8GA 2PLXA 4NA8A 3ZVBA 5ESTE 4Y8YA 1RS0A 3SU1A 1EKBB 1ETTH 3ATKA 2B0FA 4B2CA 5DP7A 3DD2H 2ANKH 1L1JA 3U8RH 5FHTA 1WCZA 1F0TA 3QTOH 1IQFA 4K2YA 4X6PA 2RG3A 2BZAA 3A89A 1P9UA 1QL8A 4IGDA 1BBRH 3M37A 4LK4A 5C3NA 4K5ZA 1T8MA 1A3EH 3F1SB 1YPMH 3Q3KA 2XCNA 2BDAA 2UWLA 4DW2U 2J9NA 1AWHB 2ZDMA 1ZGIA 1O31A 1QIXB 2ZPRA 4INHA 2OQUA 4D76A 3MHWU 1LHGH 5B6OA 3URCA 1N1LA 1C1RA 1MAXA 3LDXH 4K1SA 2BDIA 1DWCH 1IQEA 1O3HA 2ZFPH 2EI6A 2OC0A 1P2JA 3ZVCA 1QA0A 1HAHH 1O2ZA 3S7KB 3BG4B 1ZRKA 1AWFH 2DE9A 3ZZDA 1C1QA 2ZGCA 2OUAA 1DDJA 2A45B 1BA8B 3L33A 1GMCF 3L3TA 2PW8H 2ZC9H 3TIUA 5A8ZA 3K65B 3DT0H 1BTPA 2FX6A 1FPHH 2BOKA 2AMPA 3PM3A 1LHDH 1T8LA 4QT8C 2HOBA 1C4Y2 1DFPA 1GMCG 2AGEX 1E37B 4FVBA 4XBBA 3S69A 1FMGA 2ZQ1A 3TK6A 1GCDA 3GY7A 2WYJA 5EW2H 4H42U 2VWOA 1P01A 1C9TA 1ZOMA 4IBLH 3ATWA 2BZ6H 2ZCHP 3M5LA 2GGVB 4CH2B 3SUGA 4AFSA 2R2WU 1TALA 3ELAH 1FIZA 1SL3A 3TITA 1PQ7A 1TABE 4DT7B 1GHAF 3L6PA 1G3EA 1WAYB 4WMDA 2XCFA 1Z71A 2FS8A 1KIGH 3ZVAA 4INKA 2VIOA 3RMLH 2THFB 3GY6A 1C1OA 3EA7A 1THRH 2VIDA 5DJ7A 1BZXE 1GVZA 3T5FH 4B76A 2P95A 1HIAB 1FIWA 4NZQA 2ZHDA 1RJXB 8ESTE 5F8ZA 1A0HB 1GBBA 1TIOA 1ETRH 2A31A 1Z8GA 1KLIH 1UVPA 3VFEA 3F9GA 1SMFE 3T2NA 1HAIH 1FI8A 4CH8B 1TWXB 2Z3EA 4AORA 2G00A 1W12U 5F8TA 1EJAA 3FAOA 2AGIX 2AMDA 1TFXA 1NFXA 3DFLA 1Z1JA 3OTJE 1ZMNA 1ELAA 2A7CA 3MNXA 4NSYA 1TE0A 2OCVB 4NA7A 1O2UA 1ELCA 2A2QH 4A7IB 3RXSA 1OWJA 2GVFA 1SGEE 1K1JA 3LJJA 3KCGH 4AFQA 6GCHF 1GI0A 4Y0YE 1C5PA 1TX8A 2G81E 8GCHG 1GBHA 3A85A 1GHVH 2A0QB 3MI4A 3SU3A 1GGDC 5T6GA 3RXVA 1H9HE 4IS5A 5FCRA 1SOTA 1AKSB 4J1YA 1JBUH 3SV8A 1SR5C 4BTUB 1HAVA 3M7TA 2WPHS 2BD3A 1XUGA 1TX7A 3TK9A 2C93B 3DA9B 2ZDNA 1BRUP 1A0LA 5GXPA 5HGGA 1H9IE 1GG6C 2WPIS 3BTFE 1FN6A 3MH7A 1XKBC 3S9AA 1PQAA 1VJ9U 3SJKA 3UFAA 3BEUA 1P2MA 2CN0H 1TBQH 1UTLM 5CHAB 1YYY1 1SVPA 1EZQA 1Z7KA 4MPVA 2GCTC 2YOLA 1T8NA 4ZUHA 2ZNKH 1N6YA 3RXHA 1BHXF 2CGAA 3PO1C 4H6TA 3O8CA 1Y3UA 3TH3H 1W14U 3UNRA 3MO9A 2GT7A 4BXSA 4E06H 1D4PB 3T27A 1C5SA 3IITA 2ZGHA 4CREA 2BDCA 2HPPH 1UTJA 3GCTG 2A4GA 3AAVA 2QF0A 1BRBE 1K1OA 2WINI 2G4TA 2P8OC 1SI5H 2ZHFH 1BHXB 1JRTA 3F6UH 5E2PA 1D9IA 2ZU2A 4DG4A 1CA8B 1B0FA 1AVGH 3QTVH 3UQVA 1O30A 1YPHC 1XMNB 1ZPZA 1SGYE 5AVDA 2ZO3H 3MFJA 1XVMA 2J34A 1G2MA 1ELVA 3MMGA 2ZPQA 1PPGE 1BRCE 2QV1A 2V0BA 1LCYA 3EA8A 1KXEA 1UTNA 2G8TA 1SLUB 2XBYA 5AFYH 1QJ1B 1AZ8A 1MD8A 1GPZA 3GCOA 1BITA 1AUTC 2BD5A 2GV7A 3GCNA 3LGYA 5C5OA 3MU0A 1EAWA 1GDQA 4NG9H 1NO9H 2QCYA 1C4U2 1P8VC 3LC3A 5L30H 1O3IA 4Y8XA 4AB8A 1H1BA 3AW0A 4AFUA 1OP8A 1GJAB 4D7GA 3P8GA 2W5EA 2A4QA 4BTIB 1LVOA 1WTHD 4GUXA 2ANWA 1HBTH 1P57B 2FI3E 2HNTF 3PMHB 4D9RA 1DSTA 2ZTXA 1TLDA 4B71A 2BY8X 1QBVH 3UUZA 1DX5M 3UY9A 1IQMA 1GI3A 1ANEA 1CSOE 3PMJA 3RXGA 2BQWB 7KMEH 4I31A 2VIPA 1ZSLA 4IN1A 3NUMA 4FUHA 4R8TB 1DWDH 1ZHPA 1GGDB 5GDSH 1GJ5H 2ESTE 2PUXB 3SGQE 2AERH 1GBMA 3RXOA 3KL6A 1UHBB 1NRSH 2QXJA 3QGJA 4IC5A 2ZI2H 3LJOA 1OP0A 1GHXH 1LPKB 2TGAA 1OSSA 3DFJA 4SGBE 1GG6B 2XW9A 3HATH 3BTHE 4U32A 1NM6A 3PMAB 1PPZA 3UPEA 1O3NA 4I33A 1C5UA 2HVXA 4NWLA 1BRAA 1O2YA 2BVXH 1P10A 4KTSA 1FY8E 1ZYOA 3UWJH 1L2EA 2FEQH 3D49H 3Q3XA 2GCTB 1DPOA 1A5IA 2FZZA 1DWEH 5C1UA 1HXFH 1J16A 1NRRH 5FBIA 1O32A 4X1NU 3AASA 1O2RA 3U1IB 2AIQA 5EOKA 5E8EH 1FY5A 1TOMH 3C27B 1OYTH 3A88A 2GV6A 5FAHA 4WVPE 1S82A 1ZZZA 2OTVA 4JZ1A 2Z6BD 4CRGA 1P02A 1WYKA 4YT6H 3TLOA 1QCPA 2FI5E 1E34B 4F49A 1ZHRA 4B75A 1LQEA 2ZHEH 5L2ZH 1ELBA 2Y7XA 3SGAE 1K2I1 1V2OT 1KYNA 1TNHA 1B5GH 1TGNA 2VVCA 3GYMA 2XC4A 4FUDA 4K1TA 1YPLH 1SGCA 2J38A 3OY6U 1EUFA 2FOGA 4FUFA 1NTPA 2DE8A 1SGTA 3U8OH 1TGBA 2K1QA 1DANH 2SFAA 1H9LB 1DY9A 1FY4A 2W3IA 4IC6A 4AYVB 1K1NA 1O5DH 1GHYH 1MTVA 2GD4B 2ASUB 1L4DA 1MQ6A 3M5NA 2ZU5A 1SGRE 1VITF 2NU3E 2EI8A 4ZHAA 2Y81A 1QB6A 4K3JA 2J4IA 2FDAA 5A2MH
chains in the Genus database with same CATH superfamily
4B2BA 4Y10E 3E0NB 2WSSD 1RTLA 4HG6A 4ZHMU 1KXBA 4AN7A 2AH4X 4JYTA 1THPB 5FPSA 1FUJA 2VVVA 1XUFA 2UUKB 1HAZB 4YZUA 1V2NT 1HAXB 1E0FD 4XOJA 1BJUA 2A32A 1MKWH 2VU8E 3TNTA 6LPRA 1EQ9A 2F9UA 4JCNA 3OAAD 1AFQC 1GBEA 3VB4A 2BD4A 2XC5A 3EA9A 3SN8A 3B8JA 1JOUB 1BT7A 1C5LH 1HJAC 1L4ZA 3SZEA 3PV4A 4H6SB 2W7UA 3BTEE 3EAJA 1H8ED 3URDA 4MNWA 4X8SH 3E8LA 2BY7X 2C90B 1GBAA 1ZRBA 3PTBA 3N7EA 5BPEA 4BANB 1JWTA 3VG8A 3GDUA 3OTPA 1E35B 3BTTE 1VCQA 3AW1A 1WBGB 1KDQB 5T3HA 1X7AC 1SG8B 2BLVA 4B6FA 3SJOA 1TOCB 4ISOA 3ATMA 3RXEA 5FL7D 2W6ID 1W2KH 2XBVA 1A4WH 4RKJB 4CBNA 2Z9GA 5ESBA 2LP6A 1GBCA 2FOCA 1TGCA 1RIWC 3ATLA 4NIXA 3LU9B 2L6OA 1JRSA 2JH6D 1BMMH 4TPIZ 3STJA 2BD9A 3MNSA 3ZV9A 2EI7A 1CGJE 1EOJA 2F9VA 3R0FA 5DG6A 3RM0H 1C5ZB 1O3LA 5HXFA 2ZFFH 2ALPA 2BD7A 5GJ4B 1IQJA 2PTCE 3GCHB 1XUIA 3MQKC 2CK3D 1YPEH 1XXFA 3RMNH 1TNIA 1YPKH 2GMTC 3G01A 3QZQA 2F9PA 1FLEE 4B1TA 1O2KA 1C1NA 1W7XH 7LPRA 1Y8TA 2ALVA 4FXGH 4YTAA 2EQNA 1VZQH 3LH3A 4MLFB 1XUHA 4WF8A 1TYNA 3UIRA 5F03A 1HAOH 1K28D 2PSXA 1Z8IB 3LONA 3ZVFA 3S0NA 1ZTLA 1C4V2 5FPTA 4KGAA 1Q3XA 1GBIA 4FU8A 1T4VH 1AB9C 1YP9A 3KGPA 1FPCH 3JZ1B 4FUBA 5F6MA 2BDBA 4A92A 1LTOA 1P2NA 2W3KA 3GS9A 4Y76A 1NRQH 3OY5U 2EY4C 3WWFA 1ELDE 2WZQA 3E6PH 1GBFA 3M7QA 1BOQA 1H8HD 2AGGX 2ZHQH 3T26A 3M61U 1J17T 5HM2A 1QR3E 4RT0A 3GDSA 8KME2 1FZZA 1NBME 2GDEH 5IDKA 1NY22 3HGPA 1COWD 1XVOA 1C2KA 1ZJKA 4ABJA 1V2VT 1C2IA 1GHBG 3E3TA 2AEIH 3PWCA 3A87A 1YBWA 5EQQA 3MH4A 1IQNA 1CE5A 1YKTA 4Y11E 3RXJA 1HUTH 2ZDVH 1AFQB 1A3BH 4CRBA 1EP5A 1VJAU 1Q31A 1HJAB 1TX6A 3BTKE 4X6NA 5GNDA 4YT7H 1YPGH 1UCYE 1EJNA 1EZXC 2JKHA 2BDHA 1HAYB 2ZEBA 1IHTH 2NU0E 2BM2A 4LOYH 4TWWA 5HKKD 5LGOA 5DP4A 3VGCC 2SGEE 1W0JD 1TNJA 2IPHA 4KELA 1VCPA 1ESBA 1QNJA 3SUFA 1D3PB 1MD7A 3K6ZA 2TGPZ 1A1RA 1YGCH 1UK4A 4GCHF 3ZYEA 1RIWB 1SQRA 2KCAA 1O2HA 5CDFE 1AFEH 1YPJH 1D6WA 1G2LA 1WSSH 1DWBH 1NZQH 1E38B 1HGTH 1ZMLA 3MU8A 5T6FA 2C3SA 3A8AA 4XBDA 3RUOA 1K21H 1TMTH 2SGFE 2NU4E 2WPMS 2PR3A 2GMTB 2I6QA 3LH1A 1QB9A 1UJ1A 2TGDA 3P8FA 3TU7H 3SHCH 5KGOA 2QXGA 1J8AA 2R0KA 3VEQB 4WXIA 5GIBA 2XC0A 5DP3A 1DICA 3T25A 1LHFH 2KCOA 1K22H 1LO6A 4YESB 5FX6A 4OS4A 1GHWH 1C5VA 2FWWA 3Q77A 1EOLA 3A82A 5DP5A 2PHBA 2IPQX 1Z8JB 2RFKC 1C5RA 1E79D 1UCYK 1P03A 4HI3A 1YY3A 3IWMA 4OS2A 3KYGA 4AOQA 2UUFB 3SU2A 3P92A 1SGIB 4I32A 1XUKA 1K9OE 5DO4H 1OX1A 1HDTH 1G9IE 5JB8S 1T7CA 1LPZB 3ZZ9A 1YCPK 3K2UA 3PLBA 1RFNA 3BSQA 1ELTA 3N7DA 1GMDF 1SQAA 3SU0A 2G5NA 2VIVA 5PTPA 5JPMH 1V6DA 2M2AA 2ZF0H 1FDPA 1O3KA 3BF6H 1Y5BT 3M5MA 2RA3A 3KIDU 5C2ZA 1TPOA 5FBEA 1GHAG 2XYAA 3UR6A 1QURH 1HCGA 3SZNA 2KCPA 2L74A 1O2LA 4OS7A 3PWBA 2PTNA 5L2YH 2H6MA 2FODA 1C2JA 3RXIA 3ZZ5A 1W7GH 1CA0B 3QK1A 1UK2A 3UNSA 3NZIA 1HXEH 2ZGXH 4A6LA 5E0GA 1E1RD 5C20A 2QC2A 1O5GH 5LH8A 2BDGA 1LVYA 2WV5A 2ULLA 4UE7H 4YLQH 4CR9A 4WJG2 5GPIB 3FP8E 3GY2A 3NRLA 2BQ6B 1L0ZA 4E7NA 2F9OA 2ZG0H 1HAPH 1O38A 4OGYA 3ZYDA 5C0UA 2HWLB 4HGCA 1L1GA 2SGPE 3SI4H 3MH6A 3VGCB 4CRFA 4MVNA 1CU1A 2QF4A 1TQ7B 4O03A 3SV7A 5LPRA 1TPSA 3SU6A 1AVWA 1O34A 3KNXA 3UOPA 3RDZA 1GJ9B 2STBE 6GCHG 1DITH 2FM2A 3MYWA 3SYJA 5EPYA 1OS8A 2M5TA 4CR5A 1GVKB 4I7YH 3BTDE 4GVUA 4X2WA 3VXEH 3OEHD 3FO8D 1RGQA 2F43B 2K0QA 1AGJA 3GY8A 4ISNA 1V2UT 5L6NH 2WV9A 2J2UA 1CT2E 1GI2A 3VB6A 5EW1H 2XTTB 1W10U 2P3TB 1BBRE 2OC8A 1UVOA 4FUEA 4CRCA 1N6XA 1RD3B 5DGJA 4DCDA 3MOCA 4NFFA 2VWNA 1OWEA 1O2JA 2UUYA 3HPTB 1RTFB 3LGTA 5G4BA 3M5OA 3JZ2B 1V2PT 4Y7BA 1MKXK 2A1DB 1G32B 2GP9B 3KQBA 5DN6D 1ZPCA 1HV7A 4ZKNU 4XBCA 1B0EA 5TJXA 4ABHA 4JK6A 1G3DA 2WUCA 5K0HA 1ANDA 1ZR0A 4X1RU 3E91A 2JH5D 3EE0B 3LPRA 1MMJN 4OGXA 3TK5A 3BTME 2QGRA 2FESH 4UFGH 3ZZAA 4MDSA 4AYYB 1J9CH 3H5CB 1ZPBA 3V12A 1WU1A 1SGPE 4BTTB 1KXCA 2ZHWH 4AC9A 1PQ5A 4CBOA 1LVBA 2VIWA 1GI7B 1QHRB 4IMZA 3PYHA 2KR7A 2XWAA 1FJSA 1ZSKA 1V3XA 4XFQA 3MU1A 3QX5H 1IQGA 1EB1H 1TPAE 2ANMH 3A8DA 4WH6A 4UFEH 4NZLA 4JYVH 1OKXA 3PTNA 3U28C 2BQ7B 5EJLA 3PLPA 4IN2A 1A5GH 4JZEH 1GI9B 1VITH 2BLQA 3O8RA 3RC4A 5HM9A 1EASA 1S6HA 1EZUC 1O5CB 3OYPA 1BBRK 3A7VA 2JETC 3PMBB 4O97A 3EYDA 4MTBA 1C2DA 4CRAA 4A1XA 1BMAA 1D6RA 3FFGA 1MCVA 2R9PA 4X8UH 4JZFH 5EPNA 1C2LA 3FANA 1CGIE 1P2KA 3ZZ6A 1ACBE 1QQUA 1ZJDA 7GCHF 2VNTA 1OHHD 2F3CE 3CP7A 4LZ1H 2G52A 5JBAS 4CHAC 1D3TB 1AD8H 1Z1IA 2ZU3A 3UR9A 3SOSA 4Q7XA 1QRXA 1LHEH 4YOIA 2OXSA 1S81A 3DCLA 1IHSH 1NFYA 1G36A 5DP6A 2QXIA 3BTGE 4ZAEA 2C8WB 3A7YA 3S9CA 1EB2A 1QL9A 1S6FA 3T62A 1GI1A 4Y8ZA 1KLTA 1NRPH 1V2JT 1DM4B 1A2CH 1SFIA 1SOZA 4FVDA 5CMXH 1BTHH 3SORA 1C2FA 1EXFA 1FY3A 1DVAH 3QZRA 2D8WA 3SO3A 4B74A 2QE7D 2ZGBH 1NROH 1GI6A 2LELA 1O33A 1QY6A 2J97A 3M3TA 1NU7B 4B2AA 5JBCS 3V3MA 1Z6EA 2ZGJA 1LKAA 4D7FA 1O3MA 3VB7A 2VWLA 1C1PA 1ELFA 1W11U 3QGNB 4ZKSU 3PO1B 4YLUA 5F8XA 4OS1A 2P16A 1EX3A 1C9PA 2PV9B 1W3CA 3H7OA 5EXLA 2FMJA 2P94A 3KQDA 1DE7H 3MTYA 1PPHE 3E0PB 3V7TA 2P8OB 4MPUA 1MH0A 2JH0D 2OBOA 2OLGA 1BUIA 1WQSA 1O2XA 1GJ8B 1TBRH 4UFFH 1HPGA 2H5CA 1MCTA 1XM1A 2H9HA 1GI8B 2KCYA 3KF2A 4LXBH 1HIAA 4X1SU 2HALA 2OD3B 3A83A 2ZDAH 1AMHA 1BQYA 1OWKA 4AG1A 5DKMA 1BTYA 5EXNA 3OSYA 2PFEA 2STAE 2CXVA 1FX0B 1O2IA 1E1QD 4MG3A 4KTCA 3HK3B 4I8JA 1CQQA 3ODDA 2QN5T 1O5AB 2BVRH 2H5DA 1C5YB 1HRTH 1O36A 2GDDA 1ANBA 4HZHA 2H1UA 2QA9E 2ODPA 5BRRE 1EPTC 3M36A 2ZWLH 3E1XB 5J4QA 3HGNA 3H09A 3MH5A 3F68H 1BIOA 4RSPA 1VITG 3RXMA 3PROA 1MTWA 2SNVA 3AVZA 4X6OA 1XX9A 3FP6E 5T1VA 4D9QA 5LPEA 2XNIA 5HYOA 1TGSZ 2KM0A 3SGBE 1VGCC 1AKSA 1FQ3A 1DXPA 1ELEE 3GISB 1W8BH 5EQSA 1F0SA 2FPZA 1AN1E 1BTWA 1GL1A 5T6DA 1QFKH 3LKWA 4ACAA 3BV9B 1VKYA 1ZLRA 2Y82A 5HMAA 4GHTA 3BEFB 1ZGVA 4Y71A 4E05H 1ID5H 5EQRA 1AVXA 1A61H 3KEEA 1BMNH 1TA6A 3O8DA 2PKAB 5HIYA 1MTNC 3UREA 1TRYA 1DXWA 3A8CA 1FY1A 3ODFA 2RCEA 3KQCA 4X2YA 4FOUC 2FYQA 3ESTA 4WY3A 3LC5A 3N7OA 1DT2A 1SB1H 4AX9H 1CBWC 1RXPA 2BVSH 2PSYA 4HFPB 3FZDA 1PQ8A 3BTQE 5TCAA 4K60A 3TGJE 2KX4A 3M35A 3U98H 2YMSD 1O3CA 1AU8A 3V13A 1O2OA 1DLEA 2BX4A 4I8HA 2FOAA 1THSH 4R0IA 2H2ZA 4NIVA 1IQIA 2ZKSA 3UNQA 3RLWH 4NFEA 1HNEE 1FN8A 7ESTE 3CS7A 1MTSA 1YF4A 2O8TA 3NPSA 1P2QA 2FIRH 3TJUA 2O8WA 1UTPA 1GBDA 6CHAC 2Z9JA 1FONA 3B23B 3ZZ3A 4DJZB 3EQ0H 5DP8A 4BNRA 4A1VA 1DLKB 2JJ1D 1LPGB 1UVUH 3SV6A 2ZFQH 1MZAA 3RXLA 2A4RA 4ASHA 1O2TA 1O2QA 2GCHF 4MQAA 1CVWH 1ZTKA 1KXAA 1ESTA 4YM9A 1O2VA 5C1XA 2XWBI 3GOVB 1O3AA 1F5RA 3TGKE 2WPJS 1MQ5A 3BG4C 5C1YA 1W0KD 4K69A 1BTZA 1NT1A 1HB0B 1T4UH 2ZQ2A 4YXWD 2GCHG 5FX5A 2R3YA 1NBMD 1QRZA 4RT1A 1QBOA 2VWMA 4WMFA 2BY5X 4Y79A 3PV5A 3NCLA 1TNKA 2V35A 1P3EA 2BYAX 2P3FH 2FTLE 1BMLA 1IQLA 1WTGH 2C8ZB 1TA2A 1KTTB 2P93A 1DUAA 3OX7U 1LHCH 1A46H 3TJNA 3SU5A 3R3GB 1O35A 1EPTB 4J2YB 1SGQE 3LOXA 5GCHF 2UWPA 1GJ4H 2J95A 4OM9A 1O37A 3I29A 4X8VH 4Y6DA 4ABAA 4JK5A 4RN6A 2R0LA 4IMQA 2QXHA 1V2LT 3Q3YA 2B7DH 3SUDA 5JDUB 5TCCA 1C5NH 1V2WT 2QF5A 3E16B 1O2SA 1J15A 2P59A 2ZU4A 4GAWA 2BXUH 4MNVA 4ZXXH 3W95A 1VGCB 1C1VH 2SGQE 1P3CA 1OOKB 1HYLA 1GMHF 2FTMA 3ENSB 1UHBA 4ABBA 4ZHLU 1P04A 1IQHA 1NESE 1G3CA 1QA7A 1YCPM 2CMYA 2EA3A 1G3BA 2FOBA 4INLA 1OPHB 4AB9A 3GDVA 3ITIA 2I6SA 1H8DH 4ESTE 3OFND 1MTNB 2B5TB 3U1JB 1BDAA 1ESAA 4ISHH 4X0WU 1N8OC 3T29A 2QAAA 2O8LA 3RXUA 2BLOA 1QB1A 2TGTA 2GKVE 4Q80A 3W94A 3VPKA 2BOHB 1UK3A 1CBWB 1XUJA 4O3UA 1SC8U 2CV3A 2FO9A 4DOQA 2VGCC 3D23A 3P95A 3EDXB 2UWOA 1BMFD 1SPJA 3SNEA 1UTMA 1UTKA 2VIQA 5AF9H 2OBQA 1C1WH 4Z6AH 2BB4A 4WWYA 4X1QU 4UEHH 1SLVB 1C5TA 4DY7B 3RU4D 1GBKA 2ZIQH 4NIYA 4E7RG 4Z0KA 1GHZA 2AYWA 2BY9X 2BD8A 4Q7ZA 6CHAB 1O0DH 3O8BA 4ABDA 2G4UA 4GCHG 1QQ4A 1UTQA 2CJIA 2G55A 3MO3A 3RXKA 1CGHA 2LNCA 4FUIA 3U9AH 3K9XB 5JYIA 3S9BA 2NWNA 1AY6H 1IAUA 4U30A 1GJDB 2FOHA 2Q6DA 3RXCA 3RU4E 1QGFA 3SV9A 4YOGA 1JXPA 1V2ST 2VB0A 2ZDKA 4KP0A 1SSXA 3GICB 3UOUA 1O2WA 3VB3A 4BAKB 5A0AE 1LMWB 3P17H 5CHAC 4Q4LA 1P06A 1K1LA 2ZDLA 2W7SA 3MU5A 1AB9B 2OQ5A 5ABWA 2TBSA 1S85A 5E0HA 5EGMA 2P3UB 1V2MT 4FUGA 3TGIE 1C1UH 1MKWK 5E2OA 2ODQA 1QJ6B 5IYTA 1P09A 1Y3VA 4SGAE 2PWXA 3NKKA 1YM0A 1ZSJA 3SNDA 1AO5A 1RRKA 1F0RA 4TYDA 3B9FH 4AZ2B 1P2IA 2Z7FE 2BHGA 1GMDG 1C2MA 1CHOF 2HLCA 4NCYA 2SGDE 4UDWH 4ABEA 4CRDA 3UWIA 2C4FH 3SUEA 1DY8A 1LQDB 4D8NA 1IQKA 2SGAA 3A80A 4TWYA 2G5VA 2VBCA 2ZFSA 4NA9H 2ZP0H 4UFDH 1GJ7B 1EAIA 1CHOG 4TY7A 1K1IA 1G30B 5DP9A 2HPQH 2PKAA 1GWAA 2QY0B 3KQEA 3MU4A 2FS9A 2NU1E 4M7GA 3FZZA 1UVSH 2VH0A 4X2VA 1Q2WA 1NRNH 1PPEE 1DS2E 1HAGE 4Y7AA 2H9TH 2OC1A 1C5MD 4AGKA 4BAOB 1MBMA 9ESTA 1AI8H 1N8OB 3P8NA 2Y6TA 4ZKRU 4A1TA 4ABIA 3M3VA 5SGAE 1KDQA 4BXWA 1TNGA 4M9FA 2PKSC 3KN2A 3ZZBA 1S0QA 1SGFA 1T8OA 1WV7H 3VB5A 3F9FA 5ETXA 8GCHF 2VGCB 3RXPA 2IJOB 1VCWA 3BIUH 2A5AA 4TY6A 1O3OA 2F9NA 2KAIB 3RXFA 2D26C 4F55A 4DURA 1S5SA 3RC6A 3SQHE 1UVTH 1EZSC 1SQTA 4FETA 4O3TA 3A84A 1ZMJA 2OINA 3SQEE 4Q7YA 4ISIH 4TSFD 3SI3H 1A0JA 2JJ2D 3STIA 1AE5A 1EP6A 3FVFB 3ZVGA 1T32A 1C5WB 3DUXH 1ANCA 4Q2KA 3ZV8A 2HNTC 1HJ9A 1EJMA 4ZH8A 5H4IB 1CT0E 3WWBA 3ZZ8A 4X2XA 1H8IH 3P8OA 3RP2A 1LVMA 2ANYA 2ZU1A 2YNBA 3PRBA 2BY6X 1Y5AT 2QIQA 3M3SA 4AG2A 2EC9H 3PRDA 5GWZA 1F92A 3BIVH 1P0SH 2Z9LA 1P05A 3RXBA 3ZVEA 1TRNA 4WMEA 2Q6GA 1QL7A 1TB6H 2Z3CA 1DOJA 3SJIA 1P2OA 3QN7A 2V7QD 3GCTF 2ZTZA 4FU9A 2A2XH 4KTUA 3RXTA 4DIIH 2AHME 1ETSH 2ODYB 3MO6A 2BTCE 1W13U 4K8YA 3RU4T 4ACBA 1GI5A 1GDNA 2JIZD 2HGTH 1MZDA 1A5HA 2Z3DA 4P00A 1MUEB 2HRVA 2Y7ZA 3RXRA 3CS0A 2ZZUH 1EPTA 2BX3A 3OU0A 4Z1MD 4MPXA 5JBTA 1Y3YA 5A0BA 3PLKA 2XXLA 5A09A 2AFQB 3GY5A 3UQOA 2Z9IA 2AMQA 2WYGA 1O2PA 5JB9S 3QWCH 1EAXA 1BJVA 1K1MA 4U01A 4UONA 1O39A 1TGTA 3EGKH 3Q00A 5EXMA 3TJVA 1C2HA 1GJBB 1UTOA 1J14A 2C8XB 3TNSA 1TAWA 1Y3XA 1O3FA 1Y3WA 1KLJH 4BOHA 2W26A 1AHTH 3MNCA 1YC0A 3ATIA 3SNCA 1CO7E 1NC6A 4I8LA 5A8YA 2Z9KA 1C1SA 4NWKA 1JMOH 3A86A 1G37A 1DSUA 2Y5GA 6ESTA 5I46H 2HNTE 3PB1E 1O2NA 5EJZA 1KMHB 2FX4A 1KSNA 2OP9A 3GYLB 4WH8A 1PYTC 1V2RT 1GBLA 1NFUA 3U69H 1LKBA 2ZFTA 2BD2A 1SFQB 2PKSB 4B6EA 3FN8A 4DGJA 4HTCH 1OYQA 1EFRD 4ABGA 7GCHG 4FU7A 1L1NA 1O2MA 1ARCA 1YLNA 3SJ8A 2YNAA 2ZCKP 1C5QA 3T28A 3NK8A 1MU8B 4BAHB 4DT4A 2CF8H 1AQ7A 2HVYB 2XBXA 3P6ZB 3LT3A 1QRWA 3CENA 1XXDA 3DSGA 4XSKU 4ZKOU 1SHHB 3ZVDA 4TPYA 2XRCA 3MWIU 3QLPH 1TRMA 4FUCA 4GPGA 3SW2B 1K1PA 1FNIA 1SLWB 3RXAA 2WPLS 4NIWA 1W0YH 3S7HB 1RTKA 1O5FH 2VVUA 1SGDE 2V3MA 4GLYA 3SU4A 3SNBA 2PUQH 1GBJA 3M7UA 1F5LA 1GVLA 1GI4A 2IJD1 2ILNA 3V0XA 1Y5UT 1INCA 2WV4A 5JBBS 2F83A 4X8TH 1A7SA 2A4OA 5EODA 1MU6B 1O5BB 3F9HA 2A7JA 1YLDA 4UD9H 2R2MB 2F9BH 1ARBA 1NN6A 4RKOB 4ISLA 1KY9A 4ZXYH 1AE8H 4BAMB 1PYTD 3ZZCA 2AIPA 3A7XA 1VR1H 2FOEA 1C1MA 1YPHE 1O3DA 2XNDD 2Y5FA 3OE7D 1O5EH 5AHGH 3IG6B 1C5OH 1BCUH 1FXYA 1E36B 5KEDA 2A5IA 5EG4A 9LPRA 1GL0E 2FLBH 2ZFRH 5HIZA 3A7TA 3C1KA 5E0JA 3DHKH 5EU8A 2FLRH 1NFWA 4BAQB 2IN2A 3TH4H 1MAYA 1LDTT 4NSVA 4OS6A 1ZTJA 1B7XB 5DPAA 2CF9H 3HKJB 3KHVA 3BG8A 3TPIZ 1MBQA 4O9VA 3TH2H 1TMBH 1S83A 1V2QT 1WOFA 5FCKA 4THNH 1OWHA 2OC7A 2QYIA 3AAUA 4AFZA 3H7TA 2GZ9A 3F2FA 3GCHC 4A5TS 2D2DA 1V2KT 2VINA 4PROA 3D65E 2TIOA 2J94A 2O9QA 5FPYA 5EJ1A 1T31A 3QUMP 5FXLA 1AUJA 3GY4A 1M9UA 2FOFA 2JETB 2Q1JA 4NGAH 3A8BA 1OXGA 4Y0ZE 4ZCNA 4TT3D 1O3EA 1AZZA 1BTXA 1D3QB 1GDUA 1U6QA 4JZIA 4I8KA 4KKDA 5C67A 5AFZH 3LGIA 1ORFA 3GY3A 3LGWA 3QO6A 3A7ZA 2YMSC 4VGCC 3RM2H 1EAUA 2Y80A 1PJPA 2GZ8A 1P9SA 3I77A 1QTFA 1C5XB 3RMOH 1BTUA 3A7WA 2ZTYA 2J98B 1PPBH 2VJ1A 4Q63A 4DIHH 3SV2H 2O8UA 4CHAB 1FAXA 4H4FA 1BB0B 1FV9A 1TONA 3TJOA 2BLWA 3A81A 4MNYA 1F5KU 1OP2A 2CHAC 4JMYA 1V2TT 1NS3A 3HKIB 1AIXH 2O8MA 2SNWA 1NPMA 1SLXB 2KAIA 2NU2E 2EEKA 2BDYA 4IW4E 1ZHMA 2VH6A 5C5NA 2B9LA 3UB0A 1UCYH 2Z94A 5K7RA 1QBNA 1GCTC 1ELGA 3BN9A 1CT4E 2ZA5A 3U8TH 1PPFE 3D62A 1YCPH 1IOEA 2FYRA 1SGFG 1EATA 1P11E 2H9EH 5EIYA 3SNAA 2A7HA 2TRMA 1C2EA 1NU9A 1SGNE 3AK5A 1C2GA 2V6NA 2GT8A 3SBKA 3RXDA 4DVAU 3RLYH 4YO9A 4XE4A 2GJGA 2Y5HA 4FUJA 3F0OA 1W0ZU 1HLTH 5I25A 1S0RA 1JIRA 1GJ6A 2FP7B 2QF3A 4ZMAH 1Z6JH 8LPRA 3LGVA 2FOMB 3VXFH 4X1PU 2FI4E 3BEIB 4MNXA 1OWIA 4ZROA 4X6MA 1P12E 1TNLA 4GSOA 1HJ8A 1WUNH 2DUCA 4U2WA 3Q76A 2ZCLP 4LZ4B 2B8OH 1ABJH 1O3PB 3OEED 3E90B 1D3DB 4WXVA 3P70B 4B73A 1SQOA 2F91A 3TVJB 1HAVB 3ZZ7A 2XBWA 2GTBA 1TBZH 1XKAC 4JZDH 2R3UA 1TMUH 1CHGA 3F3BA 5LPFA 1H4WA 1O3BA 1WQVH 1O2GH 4JYUH 3LGUA 1SBWA 2TPIZ 3RC5A 4F4OC 2Q6FA 2PGBB 1F0UA 5KECA 4AGJA 3LIWA 3MNBA 1MTUA 2GX4A 2V3OH 5A8XA 1DUEA 2G51A 2RDEA 4K8BA 1TQ0B 2ZECA 2AS9A 2FXRA 1JIMA 1F7ZA 2F4LA 1GBTA 5F53A 2V3HH 2WPKS 3HK6B 1SHYA 1O3GA 4MPWA 2BXTH 2WUBA 1PFXC 2YMSB 2UUJB 4VGCB 4YOJA 3UTUH 1KTSB 1S84A 1Y59T 3QDZB 2GZ7A 3SHAH 5A0CA 1GJCB 1TPPA 2D1JA 2PGQB 3N99A 1KXFA 1UO6A 1YLCA 3SJ9A 2J92A 3FP7E 3CNRA 1MKXH 1FAKH 3K6YA 5CE1A 1F2SE 3F9EA 2ZPSA 3NWUA 2C8YB 2CHAB 1KXDA 1Z8RA 1UW7A 2BMGB 3NXPA 3ZZ4A 5GCHG 3WY8A 1PPCE 3RXQA 4XDEA 1GHBF 1HFDA 2RA0A 1O3JA 5C0TA 4GHQA 1UMAH 5DK1A 4K1EA 1OWDA 3DSPA 3BTWE 1ABIH 3RMMH 4ABFA 1QJ7B 1WXRA 2RDLA 1C1TA 1GCTB 5J4SA 1WDIA 3I78A 1GMHG 4OS5A 2LPRA 2A5KA 1CA0C 2IOTA 4I8GA 2PLXA 4NA8A 3ZVBA 5ESTE 4Y8YA 1RS0A 3SU1A 1EKBB 1ETTH 3ATKA 2W6JD 2B0FA 4B2CA 3FKSD 5DP7A 3DD2H 2ANKH 1L1JA 2HLDD 3U8RH 5FHTA 1WCZA 1F0TA 3QTOH 1IQFA 4RI0A 4K2YA 4X6PA 2RG3A 1SKYE 2WHXA 2BZAA 3A89A 4P02A 1P9UA 1QL8A 4IGDA 1BBRH 3M37A 4LK4A 5C3NA 4K5ZA 1T8MA 1A3EH 3F1SB 2JDID 1YPMH 3Q3KA 2XCNA 2BDAA 2UWLA 4DW2U 2J9NA 1AWHB 2ZDMA 1ZGIA 1O31A 1QIXB 2ZPRA 4INHA 2OQUA 4D76A 3MHWU 1LHGH 5B6OA 3URCA 1N1LA 1C1RA 1MAXA 1K0HA 3LDXH 4K1SA 2BDIA 1DWCH 1IQEA 1O3HA 3KQ5A 2ZFPH 2EI6A 2OC0A 1P2JA 3ZVCA 1QA0A 1HAHH 1O2ZA 3S7KB 3BG4B 1ZRKA 1AWFH 2DE9A 3ZZDA 1C1QA 2KFWA 2ZGCA 2OUAA 1DDJA 2A45B 1BA8B 3L33A 1GMCF 3L3TA 2PW8H 2ZC9H 3TIUA 5A8ZA 3K65B 3DT0H 3ZIAD 1BTPA 2FX6A 1FPHH 2BOKA 2AMPA 3PM3A 1LHDH 1T8LA 4QT8C 3F0PA 2HOBA 1C4Y2 1DFPA 1GMCG 2AGEX 1E37B 4FVBA 4XBBA 3S69A 1FMGA 2ZQ1A 3TK6A 1GCDA 3GY7A 2WYJA 5EW2H 4H42U 2VWOA 1P01A 1C9TA 1ZOMA 4IBLH 1QZ8A 2J98A 3ATWA 2BZ6H 2ZCHP 3M5LA 2GGVB 4CH2B 3SUGA 4AFSA 2R2WU 1TALA 3ELAH 1FIZA 1SL3A 3TITA 1PQ7A 1TABE 4DT7B 1GHAF 3L6PA 1G3EA 1WAYB 4WMDA 2XCFA 1Z71A 2FS8A 1KIGH 3ZVAA 4INKA 2VIOA 3RMLH 2THFB 3GY6A 1C1OA 3EA7A 1THRH 2VIDA 5DJ7A 1BZXE 1GVZA 3T5FH 4B76A 2P95A 1HIAB 1FIWA 4NZQA 2ZHDA 1RJXB 8ESTE 5F8ZA 1A0HB 1GBBA 1TIOA 1ETRH 2A31A 1Z8GA 1KLIH 1UVPA 3VFEA 3F9GA 1SMFE 3T2NA 1HAIH 1FI8A 4CH8B 1TWXB 2Z3EA 4AORA 2G00A 1W12U 5F8TA 1EJAA 3FAOA 2AGIX 2AMDA 1TFXA 1NFXA 3DFLA 1Z1JA 3OTJE 1ZMNA 1ELAA 2A7CA 3MNXA 4NSYA 1TE0A 3W1EA 2OCVB 4NA7A 3KYFA 1O2UA 1MABB 1ELCA 2A2QH 4A7IB 3RXSA 1OWJA 2GVFA 1SGEE 1K1JA 3LJJA 3KCGH 4AFQA 6GCHF 4XRNA 1GI0A 4Y0YE 1C5PA 1TX8A 2G81E 5C94A 8GCHG 3F2HA 1GBHA 3A85A 1GHVH 2A0QB 3MI4A 3SU3A 1GGDC 5T6GA 3RXVA 1H9HE 4IS5A 5FCRA 1SOTA 1AKSB 4J1YA 1JBUH 3SV8A 1SR5C 3EE7A 4BTUB 1HAVA 3M7TA 2WPHS 2BD3A 1XUGA 1TX7A 3TK9A 2C93B 3DA9B 2ZDNA 1BRUP 1A0LA 5GXPA 5HGGA 1H9IE 1GG6C 2WPIS 3BTFE 1FN6A 3MH7A 1XKBC 3S9AA 1PQAA 1VJ9U 3SJKA 4ASUD 3F2GA 3UFAA 2KZ4A 3BEUA 1P2MA 2CN0H 1TBQH 1UTLM 5CHAB 1YYY1 1SVPA 1EZQA 1Z7KA 4MPVA 2GCTC 2YOLA 1T8NA 5CHBA 4ZUHA 2ZNKH 1N6YA 3RXHA 1BHXF 2CGAA 3PO1C 4H6TA 3O8CA 1Y3UA 3TH3H 1W14U 3UNRA 3MO9A 2GT7A 2OK5A 4BXSA 4E06H 1D4PB 3T27A 1C5SA 3IITA 3UAIC 2ZGHA 4I86A 4CREA 2BDCA 2HPPH 1UTJA 3GCTG 2A4GA 3AAVA 2QF0A 1BRBE 1K1OA 2WINI 3PV2A 2G4TA 2P8OC 1SI5H 2ZHFH 1BHXB 1JRTA 3F6UH 5E2PA 1D9IA 2ZU2A 4DG4A 1CA8B 1B0FA 1AVGH 3QTVH 3UQVA 1O30A 1YPHC 1XMNB 1ZPZA 1SGYE 5AVDA 2ZO3H 3MFJA 1XVMA 2J34A 1G2MA 1ELVA 3MMGA 2ZPQA 1PPGE 3DSOA 1BRCE 2QV1A 2V0BA 1LCYA 3EA8A 1KXEA 1UTNA 2G8TA 1SLUB 2XBYA 5AFYH 1QJ1B 1AZ8A 1MD8A 1GPZA 2K8IA 3GCOA 1BITA 1AUTC 2BD5A 2GV7A 3GCNA 3LGYA 5C5OA 3MU0A 1EAWA 1GDQA 5IK2D 4NG9H 1NO9H 2QCYA 1C4U2 1P8VC 3LC3A 5L30H 1O3IA 4Y8XA 4AB8A 1H1BA 2PP6A 3AW0A 4AFUA 1OP8A 1GJAB 4D7GA 3P8GA 2W5EA 2A4QA 2XOKD 4BTIB 1LVOA 4XD7D 1WTHD 4GUXA 2ANWA 1HBTH 1P57B 2FI3E 2HNTF 3PMHB 4D9RA 1DSTA 2ZTXA 1TLDA 4B71A 2BY8X 1QBVH 3UUZA 1DX5M 3UY9A 1IQMA 1GI3A 1ANEA 1CSOE 3PMJA 3RXGA 2BQWB 7KMEH 4I31A 2VIPA 1ZSLA 4IN1A 5B6LA 3NUMA 4FUHA 4R8TB 1DWDH 1ZHPA 1GGDB 5GDSH 1GJ5H 2ESTE 2PUXB 3SGQE 2AERH 1GBMA 3RXOA 3KL6A 1UHBB 1NRSH 2QXJA 3QGJA 4IC5A 2ZI2H 3LJOA 3WW7A 2J5UA 1OP0A 1GHXH 1LPKB 2TGAA 1OSSA 3DFJA 4SGBE 1GG6B 2XW9A 3HATH 3BTHE 4U32A 1NM6A 3PMAB 1PPZA 3UPEA 1O3NA 4I33A 1C5UA 2HVXA 4NWLA 1BRAA 1O2YA 1YWUA 2BVXH 1P10A 4KTSA 1FY8E 1ZYOA 3UWJH 1L2EA 2FEQH 3D49H 3Q3XA 2GCTB 1DPOA 1A5IA 2FZZA 1DWEH 5C1UA 1HXFH 1J16A 1NRRH 5FBIA 1O32A 4X1NU 3AASA 1O2RA 3U1IB 2AIQA 5EOKA 5E8EH 1FY5A 4F48B 1TOMH 3C27B 1OYTH 3A88A 2GV6A 5FAHA 4WVPE 1S82A 5C17A 1S6LA 1ZZZA 2OTVA 4JZ1A 2Z6BD 4CRGA 1P02A 1WYKA 4YT6H 3TLOA 1QCPA 5DSFA 2FI5E 1E34B 4F49A 1ZHRA 4B75A 1LQEA 2ZHEH 5L2ZH 1ELBA 2Y7XA 3SGAE 1K2I1 1V2OT 1KYNA 1TNHA 1B5GH 1TGNA 2VVCA 3GYMA 2XC4A 4FUDA 4K1TA 1YPLH 1SGCA 2J38A 3OY6U 1EUFA 2FOGA 4FUFA 1NTPA 2DE8A 1SGTA 3U8OH 1TGBA 2K1QA 1DANH 2SFAA 2WPDD 1H9LB 1DY9A 1FY4A 2W3IA 4IC6A 4AYVB 1K1NA 1O5DH 1GHYH 1MTVA 2GD4B 2ASUB 3FOAA 1L4DA 1MQ6A 3M5NA 2ZU5A 1SGRE 1VITF 2NU3E 2EI8A 4ZHAA 2Y81A 1QB6A 4K3JA 2J4IA 2FDAA 5A2MH
chains in the Genus database with same CATH topology
4B2BA 4Y10E 3E0NB 1RTLA 4ZHMU 1KXBA 4AN7A 2AH4X 4JYTA 1THPB 5FPSA 1FUJA 2VVVA 1XUFA 2UUKB 1HAZB 4YZUA 1V2NT 1HAXB 1E0FD 4XOJA 1BJUA 2A32A 1MKWH 2VU8E 3TNTA 6LPRA 1EQ9A 2F9UA 4JCNA 1AFQC 1GBEA 3VB4A 2BD4A 2XC5A 3EA9A 3SN8A 3B8JA 1JOUB 1BT7A 1C5LH 1HJAC 1L4ZA 3PV4A 4H6SB 2W7UA 3BTEE 3EAJA 3URDA 4MNWA 4X8SH 3E8LA 2BY7X 2C90B 1GBAA 1ZRBA 3PTBA 5BPEA 4BANB 1JWTA 3GDUA 1E35B 3BTTE 1VCQA 3AW1A 1WBGB 1KDQB 5T3HA 1X7AC 1SG8B 2BLVA 3SJOA 1TOCB 4ISOA 3ATMA 3RXEA 1W2KH 2XBVA 1A4WH 4RKJB 4CBNA 2Z9GA 5ESBA 1GBCA 2FOCA 1TGCA 1RIWC 3ATLA 4NIXA 3LU9B 1JRSA 2JH6D 1BMMH 4TPIZ 3STJA 2BD9A 3MNSA 3ZV9A 2EI7A 1CGJE 1EOJA 2F9VA 3R0FA 5DG6A 3RM0H 1C5ZB 1O3LA 5HXFA 2ZFFH 2ALPA 2BD7A 5GJ4B 1IQJA 2PTCE 3GCHB 1XUIA 1YPEH 1XXFA 3RMNH 1TNIA 1YPKH 2GMTC 3G01A 3QZQA 2F9PA 1FLEE 4B1TA 1O2KA 1C1NA 1W7XH 7LPRA 1Y8TA 2ALVA 4FXGH 4YTAA 1VZQH 3LH3A 4MLFB 1XUHA 4WF8A 1TYNA 3UIRA 5F03A 1HAOH 1K28D 2PSXA 1Z8IB 3LONA 3ZVFA 3S0NA 1ZTLA 1C4V2 5FPTA 4KGAA 1Q3XA 1GBIA 4FU8A 1T4VH 1AB9C 1YP9A 3KGPA 1FPCH 3JZ1B 4FUBA 5F6MA 2BDBA 4A92A 1LTOA 1P2NA 2W3KA 4Y76A 1NRQH 3OY5U 1ELDE 3E6PH 1GBFA 3M7QA 1BOQA 2AGGX 2ZHQH 3T26A 3M61U 1J17T 5HM2A 1QR3E 3GDSA 8KME2 1FZZA 2GDEH 5IDKA 1NY22 3HGPA 1XVOA 1C2KA 1ZJKA 4ABJA 1V2VT 1C2IA 1GHBG 3E3TA 2AEIH 3PWCA 3A87A 1YBWA 5EQQA 3MH4A 1IQNA 1CE5A 1YKTA 4Y11E 3RXJA 1HUTH 2ZDVH 1AFQB 1A3BH 4CRBA 1EP5A 1VJAU 1Q31A 1HJAB 1TX6A 3BTKE 4X6NA 4YT7H 1YPGH 1UCYE 1EJNA 1EZXC 2JKHA 2BDHA 1HAYB 2ZEBA 1IHTH 2NU0E 2BM2A 4LOYH 4TWWA 5LGOA 5DP4A 3VGCC 2SGEE 2IPHA 1TNJA 4KELA 1VCPA 1ESBA 1QNJA 3SUFA 1D3PB 1MD7A 3K6ZA 2TGPZ 1A1RA 1YGCH 1UK4A 4GCHF 3ZYEA 1RIWB 1O2HA 1AFEH 1YPJH 1D6WA 1G2LA 1WSSH 1DWBH 1NZQH 1E38B 1HGTH 1ZMLA 3MU8A 5T6FA 2C3SA 3A8AA 4XBDA 3RUOA 1K21H 1TMTH 2SGFE 2NU4E 2WPMS 2PR3A 2GMTB 2I6QA 3LH1A 1QB9A 1UJ1A 2TGDA 3P8FA 3TU7H 3SHCH 2QXGA 1J8AA 2R0KA 3VEQB 4WXIA 5GIBA 2XC0A 5DP3A 1DICA 3T25A 1LHFH 1K22H 1LO6A 4YESB 5FX6A 4OS4A 1GHWH 1C5VA 2FWWA 3Q77A 1EOLA 3A82A 5DP5A 2PHBA 1Z8JB 1C5RA 1UCYK 1P03A 4HI3A 3IWMA 4OS2A 4AOQA 2UUFB 3SU2A 3P92A 1SGIB 4I32A 1XUKA 1K9OE 5DO4H 1OX1A 1HDTH 1G9IE 5JB8S 1T7CA 1LPZB 3ZZ9A 1YCPK 3K2UA 3PLBA 1RFNA 3BSQA 1ELTA 1GMDF 1SQAA 3SU0A 2G5NA 2VIVA 5PTPA 5JPMH 1V6DA 2ZF0H 1FDPA 1O3KA 3BF6H 1Y5BT 3M5MA 2RA3A 3KIDU 5C2ZA 1TPOA 5FBEA 1GHAG 2XYAA 3UR6A 1QURH 1HCGA 3SZNA 4OS7A 1O2LA 3PWBA 2PTNA 5L2YH 2H6MA 2FODA 1C2JA 3RXIA 3ZZ5A 1W7GH 1CA0B 3QK1A 1UK2A 3UNSA 3NZIA 1HXEH 2ZGXH 4A6LA 5E0GA 5C20A 2QC2A 1O5GH 5LH8A 2BDGA 1LVYA 2WV5A 2ULLA 4UE7H 4YLQH 4CR9A 4WJG2 5GPIB 3FP8E 3GY2A 2BQ6B 1L0ZA 4E7NA 2F9OA 2ZG0H 1HAPH 1O38A 4OGYA 3ZYDA 2HWLB 4HGCA 1L1GA 2SGPE 3SI4H 3MH6A 3VGCB 4CRFA 4MVNA 1CU1A 1TQ7B 4O03A 3SV7A 5LPRA 1TPSA 3SU6A 1AVWA 1O34A 3KNXA 3UOPA 3RDZA 1GJ9B 2STBE 6GCHG 1DITH 2FM2A 3MYWA 5EPYA 1OS8A 2M5TA 4CR5A 1GVKB 4I7YH 3BTDE 4GVUA 4X2WA 3VXEH 1RGQA 3GY8A 1AGJA 4ISNA 5L6NH 1V2UT 2J2UA 1CT2E 1GI2A 3VB6A 5EW1H 2XTTB 1W10U 2P3TB 1BBRE 2OC8A 1UVOA 4FUEA 4CRCA 1N6XA 1RD3B 5DGJA 4DCDA 3MOCA 4NFFA 2VWNA 1OWEA 1O2JA 2UUYA 3HPTB 1RTFB 3LGTA 5G4BA 3M5OA 3JZ2B 1V2PT 4Y7BA 1MKXK 2A1DB 1G32B 2GP9B 3KQBA 1ZPCA 1HV7A 4ZKNU 4XBCA 1B0EA 5TJXA 4ABHA 4JK6A 1G3DA 2WUCA 5K0HA 1ANDA 1ZR0A 4X1RU 3E91A 2JH5D 3EE0B 3LPRA 1MMJN 4OGXA 3TK5A 3BTME 2QGRA 2FESH 4UFGH 3ZZAA 4MDSA 4AYYB 1J9CH 3H5CB 1ZPBA 3V12A 1WU1A 1SGPE 4BTTB 1KXCA 2ZHWH 1PQ5A 4CBOA 1LVBA 2VIWA 1GI7B 1QHRB 4IMZA 3PYHA 2XWAA 1FJSA 1ZSKA 1V3XA 4XFQA 3MU1A 3QX5H 1IQGA 1EB1H 1TPAE 2ANMH 3A8DA 4WH6A 4UFEH 4NZLA 4JYVH 1OKXA 3PTNA 2BQ7B 3PLPA 4IN2A 1A5GH 4JZEH 1GI9B 1VITH 2BLQA 3O8RA 3RC4A 5HM9A 1EASA 1S6HA 1EZUC 1O5CB 3OYPA 1BBRK 3A7VA 2JETC 3PMBB 4O97A 3EYDA 4MTBA 1C2DA 4CRAA 4A1XA 1BMAA 1D6RA 3FFGA 1MCVA 2R9PA 4X8UH 4JZFH 5EPNA 1C2LA 3FANA 1CGIE 1P2KA 3ZZ6A 1ACBE 1QQUA 1ZJDA 7GCHF 2VNTA 2F3CE 3CP7A 4LZ1H 2G52A 5JBAS 4CHAC 1D3TB 1AD8H 1Z1IA 2ZU3A 3UR9A 3SOSA 4Q7XA 1QRXA 1LHEH 4YOIA 2OXSA 1S81A 1IHSH 1NFYA 1G36A 5DP6A 2QXIA 3BTGE 4ZAEA 2C8WB 3A7YA 3S9CA 1EB2A 1QL9A 1S6FA 3T62A 1GI1A 4Y8ZA 1KLTA 1NRPH 1V2JT 1DM4B 1A2CH 1SFIA 1SOZA 4FVDA 5CMXH 1BTHH 3SORA 1C2FA 1EXFA 1FY3A 1DVAH 3QZRA 2D8WA 3SO3A 4B74A 2ZGBH 1NROH 1GI6A 1O33A 1QY6A 3M3TA 1NU7B 4B2AA 5JBCS 3V3MA 1Z6EA 2ZGJA 1LKAA 4D7FA 1O3MA 3VB7A 2VWLA 1C1PA 1ELFA 1W11U 3QGNB 4ZKSU 3PO1B 4YLUA 5F8XA 4OS1A 2P16A 1EX3A 1C9PA 2PV9B 1W3CA 3H7OA 5EXLA 2FMJA 2P94A 3KQDA 1DE7H 3MTYA 1PPHE 3E0PB 3V7TA 2P8OB 4MPUA 1MH0A 2JH0D 2OBOA 2OLGA 1BUIA 1WQSA 1O2XA 1GJ8B 1TBRH 4UFFH 1HPGA 2H5CA 1MCTA 1XM1A 2H9HA 1GI8B 3KF2A 4LXBH 1HIAA 4X1SU 2HALA 2OD3B 3A83A 2ZDAH 1AMHA 1BQYA 1OWKA 4AG1A 5DKMA 1BTYA 5EXNA 3OSYA 2PFEA 2STAE 2CXVA 1O2IA 4MG3A 4KTCA 3HK3B 4I8JA 1CQQA 3ODDA 2QN5T 1O5AB 2BVRH 2H5DA 1C5YB 1HRTH 1O36A 2GDDA 1ANBA 4HZHA 2H1UA 2QA9E 2ODPA 5BRRE 1EPTC 3M36A 2ZWLH 3E1XB 5J4QA 3HGNA 3MH5A 3F68H 1BIOA 4RSPA 1VITG 3RXMA 3PROA 1MTWA 2SNVA 3AVZA 4X6OA 1XX9A 3FP6E 4D9QA 5LPEA 2XNIA 5HYOA 1TGSZ 3SGBE 1VGCC 1AKSA 1FQ3A 1DXPA 1ELEE 3GISB 1W8BH 5EQSA 1F0SA 2FPZA 1AN1E 1BTWA 1GL1A 5T6DA 1QFKH 3LKWA 3BV9B 1ZLRA 5HMAA 2Y82A 4GHTA 3BEFB 1ZGVA 4Y71A 4E05H 1ID5H 5EQRA 1AVXA 1A61H 3KEEA 1BMNH 1TA6A 3O8DA 2PKAB 1MTNC 3UREA 1TRYA 1DXWA 3A8CA 1FY1A 3ODFA 2RCEA 3KQCA 4X2YA 2FYQA 3ESTA 4WY3A 3LC5A 3N7OA 1DT2A 1SB1H 4AX9H 1CBWC 1RXPA 2BVSH 2PSYA 4HFPB 3FZDA 1PQ8A 3BTQE 5TCAA 4K60A 3TGJE 3M35A 3U98H 1O3CA 1AU8A 3V13A 1O2OA 1DLEA 2BX4A 4I8HA 2FOAA 1THSH 4R0IA 2H2ZA 4NIVA 1IQIA 2ZKSA 3UNQA 3RLWH 4NFEA 1HNEE 1FN8A 7ESTE 3CS7A 1MTSA 1YF4A 2O8TA 3NPSA 1P2QA 2FIRH 3TJUA 2O8WA 1UTPA 1GBDA 6CHAC 2Z9JA 1FONA 3B23B 3ZZ3A 4DJZB 3EQ0H 5DP8A 4BNRA 4A1VA 1DLKB 1LPGB 1UVUH 3SV6A 2ZFQH 1MZAA 3RXLA 2A4RA 4ASHA 1O2TA 1O2QA 2GCHF 4MQAA 1CVWH 1ZTKA 1KXAA 1ESTA 4YM9A 1O2VA 5C1XA 2XWBI 3GOVB 1O3AA 1F5RA 3TGKE 2WPJS 1MQ5A 3BG4C 5C1YA 4K69A 1BTZA 1NT1A 1HB0B 1T4UH 2ZQ2A 2GCHG 5FX5A 2R3YA 1QRZA 1QBOA 2VWMA 4WMFA 2BY5X 4Y79A 3NCLA 1TNKA 2V35A 1P3EA 2BYAX 2P3FH 2FTLE 1BMLA 1IQLA 1WTGH 2C8ZB 1TA2A 1KTTB 2P93A 1DUAA 3OX7U 1LHCH 1A46H 3TJNA 3SU5A 3R3GB 1O35A 1EPTB 4J2YB 1SGQE 3LOXA 5GCHF 2UWPA 1GJ4H 2J95A 1O37A 3I29A 4X8VH 4Y6DA 4ABAA 4JK5A 4RN6A 2R0LA 4IMQA 2QXHA 1V2LT 3Q3YA 2B7DH 3SUDA 5JDUB 5TCCA 1C5NH 1V2WT 3E16B 1O2SA 1J15A 2P59A 2ZU4A 4GAWA 2BXUH 4MNVA 4ZXXH 3W95A 1VGCB 1C1VH 2SGQE 1P3CA 1OOKB 1HYLA 1GMHF 2FTMA 3ENSB 1UHBA 4ABBA 4ZHLU 1P04A 1IQHA 1NESE 1G3CA 1QA7A 1YCPM 2CMYA 2EA3A 1G3BA 2FOBA 4INLA 1OPHB 4AB9A 3GDVA 3ITIA 2I6SA 1H8DH 4ESTE 1MTNB 2B5TB 3U1JB 1BDAA 1ESAA 4ISHH 4X0WU 1N8OC 3T29A 2QAAA 2O8LA 3RXUA 2BLOA 1QB1A 2TGTA 2GKVE 4Q80A 3W94A 3VPKA 2BOHB 1UK3A 1CBWB 1XUJA 4O3UA 1SC8U 2CV3A 2FO9A 4DOQA 2VGCC 3D23A 3P95A 3EDXB 2UWOA 1SPJA 3SNEA 1UTMA 1UTKA 2VIQA 5AF9H 2OBQA 1C1WH 4Z6AH 2BB4A 4WWYA 4X1QU 4UEHH 1SLVB 1C5TA 4DY7B 3RU4D 1GBKA 2ZIQH 4NIYA 4E7RG 4Z0KA 1GHZA 2AYWA 2BY9X 2BD8A 4Q7ZA 6CHAB 1O0DH 3O8BA 4ABDA 2G4UA 4GCHG 1QQ4A 1UTQA 2CJIA 2G55A 3MO3A 3RXKA 1CGHA 2LNCA 4FUIA 3U9AH 3K9XB 5JYIA 3S9BA 2NWNA 1AY6H 1IAUA 4U30A 1GJDB 2FOHA 2Q6DA 3RXCA 3RU4E 1QGFA 3SV9A 4YOGA 1JXPA 1V2ST 2VB0A 2ZDKA 4KP0A 1SSXA 3GICB 3UOUA 1O2WA 3VB3A 4BAKB 5A0AE 1LMWB 3P17H 5CHAC 1P06A 1K1LA 2ZDLA 2W7SA 3MU5A 1AB9B 2OQ5A 5ABWA 2TBSA 1S85A 5E0HA 5EGMA 2P3UB 1V2MT 4FUGA 3TGIE 1C1UH 1MKWK 5E2OA 2ODQA 1QJ6B 5IYTA 1P09A 1Y3VA 4SGAE 2PWXA 3NKKA 1YM0A 1ZSJA 3SNDA 1AO5A 1RRKA 1F0RA 4TYDA 3B9FH 4AZ2B 1P2IA 2Z7FE 2BHGA 1GMDG 1C2MA 1CHOF 2HLCA 4NCYA 2SGDE 4UDWH 4ABEA 4CRDA 3UWIA 2C4FH 3SUEA 1DY8A 1LQDB 4D8NA 1IQKA 2SGAA 3A80A 4TWYA 2G5VA 2ZFSA 4NA9H 2ZP0H 4UFDH 1GJ7B 1EAIA 1CHOG 4TY7A 1K1IA 1G30B 5DP9A 2HPQH 2PKAA 1GWAA 2QY0B 3KQEA 3MU4A 2FS9A 2NU1E 4M7GA 3FZZA 1UVSH 2VH0A 4X2VA 1Q2WA 1NRNH 1PPEE 1DS2E 1HAGE 4Y7AA 2H9TH 2OC1A 1C5MD 4AGKA 4BAOB 1MBMA 9ESTA 1AI8H 1N8OB 3P8NA 2Y6TA 4ZKRU 4A1TA 4ABIA 3M3VA 5SGAE 1KDQA 4BXWA 1TNGA 2PKSC 3KN2A 3ZZBA 1S0QA 1SGFA 1T8OA 1WV7H 3VB5A 3F9FA 5ETXA 8GCHF 2VGCB 3RXPA 2IJOB 1VCWA 3BIUH 2A5AA 4TY6A 1O3OA 2F9NA 2KAIB 3RXFA 2D26C 4DUR