4YM9A

Crystal structure of porcine pancreatic elastase (ppe) in complex with the novel inhibitor jm102
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chymotrypsin-like elastase family member 1
publication title Clickable 4-Oxo-beta-lactam-Based Selective Probing for Human Neutrophil Elastase Related Proteomes.
pubmed doi rcsb
molecule tags Hydrolase
total genus 60
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ym9A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ym9A01
3H7TA 1QB9A 4U2WA 5L2ZH 1GI4A 2ZGHA 1K1IA 3GYMA 2FS9A 4BTUB 1O2XA 1GDQA 5C1XA 1HCGA 4X2WA 3NXPA 1ZRBA 2ZCLP 2ZTYA 4NG9H 1SLUB 3URCA 4CBNA 4DJZB 1DE7H 1PPCE 2TRMA 2ZFQH 1BZXE 1QJ6B 3SN8A 1SMFE 4RKJB 4X6PA 3GCHC 1OP8A 1Y5UT 3LJJA 3ZV8A 1MTVA 3UNSA 1YPHC 4MG3A 3QDZB 1C5TA 2BY6X 3QWCH 3A87A 1C9TA 1O3CA 1SGEE 8KME2 2Y5GA 1ZTLA 3LGVA 4UFDH 1HJ8A 1WUNH 5DP3A 3E0PB 1UVPA 2FODA 3TNTA 2XTTB 4NIWA 2C3SA 4IMZA 2W7SA 2WPJS 1QB1A 3AAVA 3AASA 3SW2B 1LVOA 4AYVB 1C5RA 2H5DA 1WYKA 3TGIE 4JK6A 2FEQH 1QL7A 1SHYA 2Z3DA 2QA9E 2V35A 4DOQA 3LH3A 2PGQB 1GG6C 5LH8A 4I8GA 2UWOA 2FOHA 3M7QA 2ZG0H 3R0FA 1OP2A 3EA9A 3MYWA 4MPXA 2JETB 2FYRA 4K60A 3A8BA 1GWAA 3OX7U 3BTWE 3F9GA 1HAOH 3CS0A 3GY3A 2THFB 1P2OA 1W14U 3VB7A 1DICA 1O3IA 3VXFH 1TGCA 3ZYDA 1EASA 1P2KA 2QGRA 1SOZA 2QXHA 4YM9A 4NFFA 3TJUA 3U8OH 4A7IB 1WU1A 1Z8GA 1BRUP 4RSPA 1F5RA 2FOGA 2VVUA 4Y8YA 1P01A 4NA7A 3QTOH 3RXJA 1GMDG 4ESTE 2BM2A 4JZDH 1Y3YA 1BBRK 1BTXA 1OSSA 2ESTE 1DSTA 3SORA 1HIAA 1G3EA 1TQ0B 2Z7FE 4J1YA 1AI8H 3A7XA 2GMTB 1V2JT 3ESTA 1ZGIA 4UFGH 1GBMA 2ZF0H 2CHAC 5B6OA 3BTFE 2XBWA 2J38A 4TY7A 1UCYK 1BMAA 5EW2H 2ZA5A 3SU4A 3F9HA 3U1IB 4J2YB 3TJOA 1F0RA 4ZH8A 1LHDH 3P8FA 2IN2A 1W0YH 3ATKA 3GDVA 4O03A 1K2I1 1ZPCA 3A89A 1SB1H 5GCHG 3PMBB 1GJ8B 3MNXA 3MWIU 1A5IA 1QJ1B 4ISLA 4DVAU 4ABJA 1QURH 2UUFB 3T27A 2OBQA 1GCTB 4HTCH 2O9QA 2BY9X 2RCEA 2LPRA 1XM1A 4X1RU 1UVOA 2HNTE 3RMOH 3M3SA 1C1TA 1L1NA 1BOQA 4FUEA 1FONA 4FXGH 1TONA 2G51A 2QYIA 3PMHB 1TGTA 1PPBH 2SNVA 4A1VA 2G8TA 8GCHF 3LGUA 1DOJA 1T8MA 1YPMH 2EI8A 3ATIA 1C2MA 2ZKSA 1CGHA 1GJ6A 3SO3A 1ZMLA 1Z8RA 2AEIH 1GHXH 4CRFA 1E34B 1TGBA 4ZKNU 2BZ6H 2IOTA 3SJIA 1MKXK 3QN7A 3OU0A 1EJAA 4ISIH 2DE8A 4CH2B 1F5LA 1TMTH 3MNBA 3EYDA 1SPJA 3BG8A 1ZJDA 1LPZB 1O2OA 3A7YA 3QO6A 1LVMA 1RTLA 1G32B 3MH4A 4KTCA 4KTUA 3UFAA 2A5KA 1D4PB 3RM2H 1IHSH 1EPTA 4TWWA 1T31A 2BD4A 1QB6A 1MZAA 3UOUA 3BN9A 1FY4A 5T6GA 1S85A 3A88A 2ZHQH 5F6MA 1BTWA 1O3FA 1BHXF 1ESAA 3RU4T 1G37A 3LPRA 2BX4A 2UWPA 4UDWH 1GGDC 3H7OA 1MAXA 2NU0E 1DY8A 1RXPA 4OS1A 1V2WT 1PPEE 2XNIA 2HPPH 1Z8IB 1DANH 3LIWA 1O2PA 1EAIA 1VITF 2BVRH 3UR9A 1TQ7B 4AFZA 2WPKS 4NFEA 1AZ8A 4OGXA 5E0GA 3Q77A 4GVUA 1OWDA 5GWZA 4IMQA 1C5PA 2J4IA 3RXHA 3EE0B 1ZMJA 2SGFE 4B73A 1DVAH 2GD4B 1HNEE 4GAWA 2BOHB 2AIPA 1VR1H 1VZQH 1BBRE 1QA7A 1FQ3A 1O38A 3SZNA 1IQGA 1O30A 3SBKA 1C1SA 5LGOA 1BBRH 4GUXA 1ETSH 3K65B 3STIA 3PMAB 1GI3A 1QHRB 3E3TA 1W3CA 1S6FA 5JDUB 1B0EA 3LU9B 2FYQA 3TJNA 1W13U 2WINI 4YZUA 2FDAA 1UCYE 4NZLA 1KLJH 1KXDA 1GVZA 4BAOB 3VB4A 5JBCS 3S9CA 3QZRA 1VGCC 2PR3A 3DA9B 2VGCC 2FI3E 1D6RA 2EI6A 1IQEA 5GXPA 1UCYH 3A85A 1XUFA 2A1DB 2R3UA 1DWEH 3MO6A 1V2VT 2QF3A 2R9PA 1G9IE 4OS4A 3QX5H 3UIRA 1AO5A 1SQAA 4GHQA 4B75A 1NN6A 4MDSA 1TPPA 2R0LA 2GTBA 2JH0D 4I32A 3KIDU 2A7HA 3PLKA 3U1JB 4JZEH 1UJ1A 3LGYA 5CHAB 1LHCH 3V0XA 1WOFA 2VIQA 1QBOA 1NZQH 1C5VA 3U98H 5L2YH 3HPTB 1ARCA 3ZVGA 3ELAH 1TLDA 2Q6DA 2J94A 3SUDA 1BTHH 2Z3EA 1ESTA 5HMAA 4DIHH 1NESE 2BLQA 3I78A 2CN0H 1D6WA 1TX8A 1LKAA 3BEIB 3E90B 3EGKH 3T28A 5FXLA 1O3DA 1SGQE 2GZ8A 1QBVH 2FOMB 1KXCA 1C2IA 3TPIZ 3RXKA 2ZFTA 1GHWH 2Y6TA 2EC9H 2ZHWH 2ZEBA 1A61H 4LZ4B 1FN6A 4ABBA 1W8BH 2Y5HA 2ZHEH 1GL1A 1ELGA 4U01A 1UTPA 1HJ9A 1HFDA 4JYTA 4I8KA 1O2SA 4E7RG 1KXEA 1ANDA 1TBZH 3SU3A 1GVLA 1V2PT 1IQIA 1THRH 5AVDA 1W12U 4Y79A 3TK5A 1JRSA 4MVNA 1CT2E 1GDUA 1QTFA 4Y8ZA 1ZOMA 1O3LA 1AB9B 1MTNB 3U8RH 2CMYA 5ESBA 2XC0A 4ABIA 2F91A 2RA3A 1KTSB 1MUEB 2C90B 4HI3A 1MTSA 3GY2A 4FVDA 2A4QA 2ZDNA 1H9HE 2AIQA 2XYAA 4NIXA 1T7CA 3NKKA 3RXAA 1O2GH 3FVFB 1O35A 1K1NA 2Y5FA 4K2YA 3KF2A 4DW2U 1P2QA 4HZHA 1NO9H 1O2HA 4Q7ZA 1N8OB 1UO6A 2I6QA 4DG4A 1ELTA 2VIDA 3BTGE 1B7XB 5E8EH 2CJIA 1EKBB 2H9HA 2BD9A 2QXIA 1FY5A 1TMBH 1JWTA 2ZHDA 9LPRA 2Z9JA 3MO3A 2AFQB 4D7GA 1CBWC 3NWUA 1A1RA 1HAGE 1GI6A 2ZZUH 1DPOA 3EA8A 1HDTH 4Q2KA 2Y82A 2ZDVH 4JCNA 1PYTC 5AHGH 6CHAC 1FIWA 4OS7A 1AFQB 2WPMS 4JZIA 3PTBA 1C2GA 1GVKB 3RXFA 1ZSJA 4MLFB 2ANWA 4MPUA 1TAWA 5GPIB 2PV9B 4IBLH 3KNXA 4O3TA 3U9AH 1EZUC 1TNHA 1DY9A 2Z9IA 1O3KA 5DGJA 5HM9A 2ZP0H 2ZU2A 1TABE 4Y6DA 6LPRA 2ZCHP 4R8TB 1KXFA 1ORFA 4X1QU 2C4FH 8GCHG 1G2MA 3P8GA 2TBSA 1QRWA 1YF4A 3FFGA 4MPVA 1SLVB 3DT0H 1C5OH 1LPKB 3KQEA 4UFFH 1Z71A 5T6FA 1YKTA 3PMJA 1MZDA 1C5ZB 3SV9A 1UTQA 2JETC 5T6DA 2QXJA 1TB6H 2HVXA 5DG6A 2YNBA 4GLYA 1SOTA 3RMNH 2NU2E 1ZYOA 1CHOF 3TK6A 2ULLA 2EA3A 3SOSA 1LCYA 1V2ST 1FY1A 2AGGX 2V6NA 1GBCA 4AG1A 2QCYA 3BIUH 2ZCKP 3SI3H 1ZHPA 4DURA 2ZQ1A 3M61U 3B9FH 3ATWA 1GBBA 1PPHE 5DP4A 1EOLA 1RIWB 1ARBA 1SI5H 1DXPA 1OWIA 1A3EH 2BDYA 3SGQE 2B5TB 3RXIA 3BTME 3A7WA 3IITA 2V3OH 4A6LA 1SC8U 1NFUA 2GZ7A 1CE5A 1YYY1 1Y5BT 2HGTH 2FWWA 3N7OA 3ATLA 1D3TB 1L4DA 1EQ9A 1P05A 1C5MD 2ZU5A 1N6XA 2P3TB 5I25A 4VGCB 1ZR0A 1A2CH 1VITG 2A31A 3U69H 1UMAH 1RTFB 1U6QA 3BTKE 4XOJA 4ZHLU 5JBBS 1IQFA 1SG8B 1SGFG 1YPKH 5A8YA 4WMFA 1GMCG 1S6HA 2Q6FA 1C2LA 1L1GA 3SNBA 3U8TH 1OP0A 5GDSH 1ZSKA 1WV7H 5PTPA 3TGKE 1TFXA 2XW9A 3A83A 4I8HA 5H4IB 1O33A 4O9VA 4OGYA 4Y0ZE 4I7YH 4BOHA 9ESTA 4WJG2 5EG4A 5FPSA 1O5AB 1ELBA 2TGPZ 2P59A 3RXQA 4ZKSU 3ZVBA 5FPTA 2OUAA 1F0TA 1GCTC 1GI0A 1INCA 1PQ5A 1GMHG 1YLCA 3KEEA 1J15A 1F92A 1EZQA 1P04A 3JZ1B 1Z7KA 1AVGH 3WY8A 4TY6A 4K1TA 1TPOA 4FUHA 2WYJA 3TJVA 1TBRH 1QBNA 4XE4A 1QQ4A 3RXRA 1UTMA 1IQNA 2GT8A 3STJA 4CR5A 4AYYB 1PFXC 3QK1A 1OYQA 4K69A 3RC4A 3MH6A 2PSYA 2NWNA 2QC2A 1GBJA 3UQVA 3UNRA 3NUMA 1AHTH 1TOMH 3IWMA 5C67A 1Q3XA 1C1NA 4X6NA 1DDJA 1BMNH 3L33A 4D8NA 3LGIA 2ALPA 4RN6A 1FIZA 4GSOA 1QCPA 3UY9A 3SV6A 2BDHA 3A8AA 1A7SA 2FOFA 3RDZA 3UR6A 1K1JA 5C2ZA 4OS2A 3RM0H 3PWBA 3SV8A 4ZMAH 3UWJH 1QFKH 1K21H 1ZSLA 1J17T 2XRCA 4X0WU 7KMEH 1O2NA 1ZZZA 2Z9KA 1TBQH 3CENA 3T29A 4DGJA 1GBKA 1DWCH 1UVSH 4IN1A 1K9OE 1P2IA 4KGAA 1SLXB 5EXLA 3RXBA 2ZFSA 2J92A 2QIQA 1NPMA 2HLCA 4ZHMU 3GCTF 4X8TH 2Y7ZA 4INHA 1CT4E 1UHBB 2BLOA 1MD8A 2WUCA 2KAIA 2BY7X 4BAQB 1GBAA 3SU2A 2B0FA 4YTAA 1MU8B 1GHVH 1YBWA 4BXWA 1FV9A 3EAJA 3MU8A 4X1PU 2K1QA 2OQUA 1O34A 1J14A 2YOLA 1HAZB 4OS5A 2PFEA 3SU0A 1QRZA 1XUGA 2G5NA 3FP8E 3UTUH 5F03A 3TH4H 1CQQA 1O2VA 2P94A 1Y3XA 4CRCA 1MKWK 1OX1A 2ZTZA 1WSSH 2R2WU 1BMLA 2WPLS 1EB1H 3GYLB 2XXLA 5C1YA 1M9UA 4IGDA 1IQJA 1SGFA 4DCDA 1UTNA 2I6SA 4YT7H 1GBEA 1MCTA 2BD3A 1C2KA 1ZGVA 1DLEA 1O3PB 2BLVA 1ABIH 1C2JA 4BTIB 2BD8A 3OTJE 1C2DA 3VPKA 5FX5A 2ZECA 3PWCA 1P57B 5EQQA 1OYTH 1HB0B 2SGPE 1P2JA 1HAHH 1KDQB 1GJ5H 3D62A 1L4ZA 1ELCA 1HAYB 3UOPA 1MCVA 1GJ9B 3MH5A 2OC1A 4X1SU 5A0AE 5EPNA 3LDXH 2FLRH 2WPHS 5AFYH 5G4BA 1QGFA 2GZ9A 4ISOA 3SJ9A 3P8NA 2FIRH 1TE0A 3DFLA 2O8MA 1DX5M 4Z6AH 2BQ6B 2AGEX 2AYWA 1VCWA 2W5EA 1QRXA 2OC0A 3A86A 3EA7A 1UTKA 1IQHA 1GI8B 1DUEA 3UNQA 1DUAA 2BHGA 3ZVCA 1K1LA 3Q3XA 3ZZ3A 3PTNA 2BDIA 1C1PA 1KIGH 4NIYA 4GPGA 3D65E 1EB2A 4NA8A 3SU6A 3SUGA 4RKOB 2ILNA 4FUCA 3D23A 4U32A 5E0HA 3DFJA 4I8JA 1OXGA 2ANYA 3ZZAA 1ID5H 4AFQA 1BT7A 3PROA 3T25A 1TYNA 3MNCA 4B1TA 1SLWB 1Y5AT 3HK6B 1CHOG 1VJ9U 5F8XA 8LPRA 4B2AA 4FU7A 4XFQA 6GCHF 1MQ5A 4UD9H 1PJPA 5A0BA 1NY22 1QA0A 5EPYA 4Y71A 1Q2WA 1UTJA 1ZRKA 2UUKB 1ZLRA 1H9LB 3EDXB 1QY6A 1ACBE 3AVZA 1BJUA 1T4VH 5DP7A 2V0BA 1V2MT 1TOCB 3Q00A 4D9RA 2BDBA 4U30A 2BB4A 1O3HA 3ITIA 1WTHD 3SI4H 1F0UA 3B8JA 2TPIZ 1EZXC 1QR3E 1LVBA 2DE9A 2AERH 2PSXA 3SV7A 2ZGBH 1SGYE 1WQVH 4ISHH 2WPIS 1FPHH 4DY7B 2GDDA 1HPGA 1NFXA 4X2VA 4BXSA 3EQ0H 1GL0E 3M35A 5DP9A 3NCLA 2ZHFH 5FCKA 2QAAA 2EEKA 2Z94A 4ASHA 3GY6A 3T62A 2UWLA 1YPHE 1MKWH 2VNTA 1F5KU 3SJOA 5K0HA 5TJXA 1ZJKA 2C8ZB 5SGAE 4B71A 1O3GA 2HPQH 4OS6A 1S0RA 2R3YA 4Z0KA 3VXEH 3PLBA 4THNH 4TYDA 3S7KB 1RRKA 3GCOA 1T8OA 2FM2A 4NSVA 4X2XA 5L6NH 2XWAA 1C2HA 1XUKA 3KHVA 7ESTE 4H6TA 4K1SA 3VGCB 1FJSA 2PGBB 1P9UA 2GX4A 3MU4A 1Z1JA 2G5VA 1AUTC 1D3DB 3LKWA 4FVBA 2PKSC 2PTCE 3TK9A 1LVYA 2BX3A 1C2EA 5EQRA 1GMCF 1GPZA 4IW4E 5A2MH 1SGDE 4ZHAA 2RG3A 3GDSA 3M5MA 3SJKA 1YM0A 1EP5A 1PQAA 3RXCA 1TRYA 3HGPA 3QUMP 2VB0A 4I31A 3RXDA 1AWFH 1PQ8A 2STBE 5FAHA 3A80A 3GCHB 4BAKB 1BMMH 1C1RA 4AFSA 3ATMA 2AS9A 2VWNA 1HUTH 2OC8A 1O32A 1XVOA 5C1UA 1OWHA 4KELA 4MPWA 1KTTB 3ENSB 3BG4B 3TH2H 3RLYH 5HM2A 4X8VH 1GMHF 2TGDA 3KGPA 2GVFA 1NU7B 2Y80A 2ZU3A 1TA2A 1S0QA 1AVXA 1EJMA 1MQ6A 1S5SA 1IQLA 1C1VH 1PPGE 1TALA 5JYIA 1F0SA 1HBTH 4ZKOU 1CHGA 2BQWB 1BTPA 4CRDA 2A4RA 2QF0A 3RXTA 3GCTG 1WCZA 1J9CH 1W7GH 1CA8B 1GG6B 1UVTH 3LC5A 4VGCC 2D26C 3ZZ8A 1SGIB 4ABFA 1BTUA 1TRNA 1P02A 2C93B 1GI5A 5E2PA 3E91A 3C27B 4AG2A 2XC5A 5LPRA 3SUEA 1ELVA 5ABWA 1ZTKA 3F6UH 3RC5A 2WV5A 1RD3B 3D49H 1P11E 4FUBA 1O36A 1SGRE 1LQDB 3HK3B 1K1MA 2VINA 1BRAA 2WUBA 1XKAC 2P93A 5F8ZA 1ZHMA 1GBTA 2ZWLH 4WH8A 4INLA 1NC6A 1KSNA 1V2UT 2Z3CA 2FLBH 2HALA 1GJAB 3URDA 1CVWH 4K5ZA 2Y81A 1DLKB 4A92A 1QIXB 2P95A 4QT8C 1GBFA 1KYNA 3GY4A 4BNRA 2VWOA 1AGJA 2Q1JA 1HLTH 1C4U2 1FPCH 1AVWA 3HATH 1BITA 2CHAB 3ZZCA 3GDUA 1C5SA 2ZDMA 5JBAS 2JH5D 1C1OA 5FBEA 3RXPA 2Z6BD 1CGJE 5HXFA 4YT6H 1ELEE 2OQ5A 1Y3VA 3TITA 1T32A 1C2FA 2R0KA 5HYOA 1O5GH 2VWLA 3RXSA 4I33A 5DJ7A 2PKAB 1YP9A 1LHFH 2VH6A 4UONA 5J4QA 2C8XB 1C5YB 1GHBG 2H6MA 1O2RA 2BY8X 3Q3YA 1UVUH 1LHEH 4WY3A 5I46H 2FS8A 3P95A 1AKSB 3IG6B 2ZU1A 3OSYA 4WH6A 3SUFA 6ESTA 2M5TA 1AIXH 3PO1B 1V2NT 2H1UA 3OYPA 3P92A 4GHTA 2TGAA 3OY6U 1NS3A 1BTYA 1P2NA 2FX4A 5ESTE 3SU5A 1S84A 3BV9B 3RXVA 1AZZA 1DS2E 4CBOA 3P70B 2VVVA 1AY6H 3RXUA 3E6PH 1EZSC 4ABHA 1SGNE 3QGJA 1O5DH 2F9BH 4YOGA 6GCHG 2A0QB 2HWLB 3E16B 2ANKH 1ELDE 2W26A 1BIOA 4F4OC 1XUJA 1FY3A 1ZMNA 4SGBE 4KKDA 1GHYH 4E7NA 4JYUH 5TCAA 3O8BA 4MNWA 3UREA 3VB6A 3RLWH 1GJ4H 3BEFB 4FUGA 1X7AC 3RXGA 1O2QA 3A8DA 3QTVH 1Y59T 2A2XH 2ZDKA 1WQSA 4CH8B 1ESBA 2AH4X 1T4UH 1GGDB 1OWJA 3K9XB 3A7ZA 1HAVB 4WVPE 2UUJB 4TPYA 2AMQA 3RXMA 3KCGH 1CSOE 4K8YA 1SQTA 1O2MA 3S9AA 1DITH 1NRNH 4AZ2B 1G3BA 3ZZ9A 5EODA 3LGTA 1GI1A 2W3IA 1TX7A 4AN7A 3S7HB 3KQBA 3HKIB 5E2OA 1N6YA 1LHGH 1LPGB 1NRSH 4ZXXH 4ZKRU 3PLPA 5A8ZA 2O8TA 4WMEA 5C20A 1C5NH 1LMWB 3MO9A 5CE1A 3KL6A 2OD3B 5EQSA 4LK4A 1UTLM 3A82A 3RXLA 1P2MA 1VITH 1GI2A 4TPIZ 1DWBH 2VIWA 7GCHF 2FI5E 5JPMH 1KY9A 1MBQA 4NIVA 4AFUA 2GMTC 5FX6A 2BDCA 1KXBA 4B2CA 2FP7B 2VGCB 2GCTB 1O2JA 1FY8E 1RJXB 1SGCA 3GOVB 1DFPA 5FBIA 5AF9H 4YLQH 1C1WH 1O2YA 2CXVA 3G01A 3M7TA 4ABDA 4I8LA 3ZZ6A 4NWKA 5GJ4B 2HNTF 3BIVH 1GI9B 2F9VA 5DK1A 2FTLE 2A4GA 1P0SH 2VJ1A 1FDPA 1BHXB 1C5WB 1FXYA 1C1QA 1C5XB 2BY5X 1TPSA 1SQOA 2PW8H 3MI4A 1O3NA 3L3TA 3M5OA 2TGTA 3Q76A 4IS5A 1IOEA 1UTOA 3HKJB 1P10A 1SFIA 1N1LA 5BRRE 1C1UH 2QXGA 4H4FA 3I77A 3ZVDA 4MNVA 4BAMB 2XBYA 3ZV9A 2DUCA 2OCVB 2SGQE 1GJDB 3B23B 1JRTA 3M5LA 2ODQA 1BA8B 4XBCA 4E05H 1EAWA 4YOJA 1DXWA 5IYTA 1O5BB 1OPHB 1YLDA 2ASUB 2O8UA 4Y0YE 1TNKA 3NK8A 2HRVA 2ZDAH 1YGCH 3DD2H 1EP6A 4WF8A 1K1PA 4YOIA 2FO9A 3T26A 4IC5A 3TU7H 1C4Y2 4E06H 2A4OA 3TIUA 1O5FH 1YPLH 2BDAA 1P12E 1AN1E 3CP7A 2ZFFH 1Z6EA 5JBTA 3K6ZA 4H42U 1Z1IA 4WWYA 2P8OB 2HNTC 1H4WA 1P03A 4KP0A 1HIAB 1O2UA 1S82A 4FUDA 4D7FA 1O2WA 1DM4B 1BRCE 1AFEH 5DP5A 3ZZDA 1ANEA 1HRTH 2W3KA 4DIIH 1THPB 2CF9H 3AW0A 2J34A 1O3JA 1A0HB 1CO7E 1FZZA 4K8BA 1XKBC 1V2RT 1ANCA 2P16A 3BTQE 1FAXA 1ZHRA 3MU0A 2QV1A 1AU8A 1L0ZA 4X8SH 1WTGH 4Y7BA 1F2SE 2B7DH 3I29A 1LQEA 2IPHA 2C8WB 1CBWB 2STAE 1Y3UA 4A5TS 1PYTD 6CHAB 4XBBA 1NT1A 5FPYA 1A0JA 1FMGA 2GCHG 4K1EA 1EUFA 1Q31A 1WBGB 3FAOA 3M37A 1CA0B 3W94A 3M3TA 3VFEA 2XCNA 3MOCA 2RA0A 1IHTH 4JYVH 4CREA 2F9PA 2A2QH 1P06A 4CHAB 3BG4C 1VCPA 1SGPE 1YCPM 1TGNA 4NA9H 1CGIE 4UE7H 2ZPRA 1KXAA 3SNEA 3F9FA 3LJOA 2VH0A 3VB5A 2VIVA 4Y8XA 1EOJA 1QL9A 1IQKA 5DO4H 2ALVA 2FMJA 4XDEA 1AMHA 4NCYA 3SGAE 2VWMA 1PPFE 4AX9H 4LXBH 1TNGA 4BANB 4NZQA 1JOUB 1MD7A 2SGDE 3RMLH 1ELFA 1MU6B 2BZAA 1GHBF 3FANA 2D8WA 1L2EA 2SFAA 1TMUH 5CHAC 5HGGA 1RTKA 1DWDH 1EPTB 1V2QT 7LPRA 2AMDA 2UUYA 2F9UA 3MHWU 1GJCB 4B2BA 1W10U 1K28D 2CGAA 4MQAA 1Y3WA 1W7XH 1SSXA 1CT0E 5EW1H 2BVSH 2ZFPH 1O5EH 3PM3A 3HGNA 3S69A 4Y76A 1MH0A 3V7TA 3MU5A 1B5GH 3DHKH 4X6OA 1HXFH 3NZIA 2HOBA 4WMDA 3LGWA 2GV7A 2OC7A 2ZIQH 4ZROA 3AW1A 1QL8A 4B76A 1YPGH 2B8OH 3MFJA 4O97A 1HXEH 1QQUA 3S0NA 1IQMA 2H9EH 2P3FH 2VIOA 1K1OA 3BSQA 3P8OA 3SQHE 2B9LA 2OTVA 1UHBA 1HAXB 1OWKA 3A84A 4JK5A 3O8DA 1ZPBA 1E37B 2BTCE 3JZ2B 1TNIA 3V3MA 1NROH 2FPZA 1P3EA 2XC4A 2H5CA 1AB9C 3KN2A 1MTNC 1T8LA 2O8LA 1EXFA 3ZZ4A 1HJAB 4X2YA 5FCRA 1RFNA 1TIOA 1P8VC 7GCHG 2G00A 3PO1C 4Q80A 2XBVA 4AOQA 4SGAE 3MMGA 3FP7E 5DP6A 1H8IH 1N8OC 5EXMA 1L1JA 1P09A 2FZZA 1QNJA 4JZ1A 3P17H 2G4TA 2NU4E 2ZGXH 1S83A 1GBHA 4TWYA 2ZFRH 1GHAG 1MTUA 3RXEA 3SU1A 1EAXA 5E0JA 3GCNA 1PQ7A 3PB1E 3TNSA 2BVXH 3MNSA 1C5LH 2OBOA 1O39A 1KDQA 1A3BH 3KQCA 4FU8A 1G3CA 1LO6A 4UFEH 1AFQC 4R0IA 3F68H 1SR5C 3RU4E 4GCHF 1MTWA 3M5NA 3NPSA 2D2DA 2Z9GA 2IJOB 2PTNA 5A8XA 3LOXA 1BB0B 2SGEE 2OXSA 2BD5A 4XBDA 3F1SB 1W2KH 3LONA 4FUFA 1J8AA 2G55A 4AGJA 1BCUH 2F9NA 4JMYA 1ETRH 1LKBA 4AORA 3UQOA 4MNYA 4IC6A 4ZAEA 1YPEH 4PROA 1DSUA 3CS7A 2ZPQA 1E0FD 1MBMA 1O0DH 3RP2A 2BYAX 1BJVA 4INKA 1XX9A 4O3UA 2A5IA 2P3UB 1JBUH 4KTSA 4HGCA 2G81E 5J4SA 1SHHB 1XXFA 2G52A 1GBIA 1ELAA 1TX6A 3M36A 3UUZA 3TH3H 3RU4D 4BTTB 1SFQB 3GISB 2ODYB 3GY8A 2NU3E 4FUIA 1O3EA 1RGQA 1NU9A 4NWLA 2QY0B 1O2KA 1RIWC 2LNCA 2OLGA 5C5OA 1TNLA 2FTMA 5A09A 5GIBA 1TA6A 3BTHE 4ABAA 3O8CA 2WYGA 1B0FA 1NRRH 4K3JA 4Y7AA 1GDNA 4FUJA 1NTPA 2VVCA 1YCPK 3FZDA 2ZDLA 1Z8JB 4AB9A 2FX6A 3SV2H 4ZUHA 5C5NA 5DPAA 3SQEE 1FNIA 1NFYA 3V13A 3TGJE 3LH1A 1BRBE 1HGTH 1XVMA 2TIOA 3DUXH 2BLWA 1V6DA 2GCTC 8ESTE 3ODFA 5ETXA 2FOCA 3UWIA 1GJBB 2PHBA 5EGMA 2BXUH 2ZQ2A 1A5HA 1J16A 2F3CE 1A4WH 2CF8H 5DP8A 1KLIH 3TLOA 4MNXA 1AQ7A 2ZU4A 1TRMA 3BF6H 1HV7A 1IAUA 3M7UA 1XUHA 1SL3A 1XXDA 2H2ZA 2VU8E 4A1XA 5LPEA 1W0ZU 4X6MA 2ZGJA 1A0LA 3SJ8A 1AE8H 3RC6A 1AWHB 1WAYB 1O3MA 2FOEA 1E38B 1XUIA 3SGBE 3W95A 1O2TA 3H5CB 2A45B 3ZZBA 1O37A 2AGIX 4B74A 1QJ7B 4HFPB 1W11U 3ODDA 4Y11E 3RMMH 5AFZH 1JIMA 1H1BA 2BQ7B 2VIPA 2ZC9H 3ZVFA 4CRBA 1MKXH 3MU1A 5CMXH 5TCCA 1D3QB 2J9NA 1NFWA 1JIRA 2XWBI 1YC0A 3VEQB 1ZTJA 2GCHF 3A8CA 4ABGA 1Z6JH 1AE5A 3GICB 3A7VA 3E1XB 1V3XA 4CRGA 1P3CA 3C1KA 1V2LT 1SBWA 1G30B 2D1JA 1GJ7B 5JB9S 2P8OC 1BUIA 2ZNKH 3M3VA 1C4V2 3RUOA 1GBLA 1THSH 4UEHH 1TWXB 3AAUA 4JZFH 3ZZ7A 2YNAA 4Q7XA 2ZPSA 2WV4A 1E35B 2R2MB 3GY7A 3SNDA 4M7GA 1GI7B 3LC3A 1FN8A 1HYLA 2OP9A 1O2ZA 3PYHA 1ABJH 1HAIH 5EXNA 1V2TT 1EATA 2V3HH 1H9IE 1MMJN 1BTZA 1LTOA 1K22H 1TNJA 2F9OA 1NRQH 1C9PA 2A32A 2ODPA 3ZZ5A 2J2UA 1O5CB 2PLXA 4BAHB 3MTYA 4F49A 1BQYA 1A5GH 1XMNB 3RXOA 5EOKA 3GY5A 5L30H 1UK2A 1CA0C 4WXVA 4CR9A 1GMDF 4CRAA 1YCPH 2JH6D 1MAYA 4CHAC 4X1NU 3VB3A 2XCFA 3E0NB 5LPFA 2ZI2H 2Z9LA 3BEUA 1OWEA 3R3GB 2FOBA 5EU8A 2RDLA 1O3AA 4NGAH 2GGVB 3T5FH 1VCQA 1DT2A 3UPEA 2PKSB 4DT7B 1OKXA 1UK3A 2PUXB 2GP9B 4IN2A 1D3PB 1E36B 1LDTT 1C1MA 1SVPA 5K7RA 2BMGB 4LZ1H 4GCHG 1HAPH 3BTEE 3SNCA 4MTBA 3T2NA 2O8WA 2A5AA 3L6PA 4ISNA 3K6YA 5GCHF 2PKAA 1EPTC 3SHCH 4X8UH 4A1TA 5F8TA 2ANMH 1TGSZ 1T8NA 2F83A 2FOAA 5DKMA 3KQDA 3MH7A 3QLPH 1AKSA 1FAKH 2FXRA 1GHZA 3LT3A 1VGCB 1KLTA 1P9SA 2H9TH 3BTDE 4FU9A 1ETTH 2SNWA 5T3HA 4WXIA 1GHAF 2BD7A 3K2UA 1V2KT 3PV4A 4AB8A 3A81A 2A7JA 2SGAA 1FLEE 2KAIB 4XSKU 3QZQA 1C5UA 1JXPA 4ABEA 2A7CA 2FESH 5JB8S 1EJNA 2GV6A 2PWXA 1UK4A 2XBXA 2CV3A 5IDKA 1G36A 1FUJA 2FI4E 2JKHA 2ZGCA 3F9EA 1NM6A 1AUJA 4NSYA 1A46H 1SGTA 1O2IA 1O3OA 1V2OT 2Y7XA 4H6SB 2Q6GA 2G4UA 1O31A 1EX3A 1ANBA 1F7ZA 1GBDA 1HJAC 5FHTA 5BPEA 4D76A 2W7UA 3ZVAA 3ZYEA 1G2LA 3S9BA 2ZO3H 3A7TA 4LOYH 4YO9A 1NRPH 2BXTH 2QN5T 4AGKA 2OINA 3E8LA 1TPAE 1CU1A 1Y8TA 3V12A 4D9QA 4Q7YA 3P6ZB 3SHAH 1HAVA 3QGNB 4Y10E 2BD2A 1PPZA 2BDGA 1ZPZA 4YESB 1D9IA 1O2LA 2C8YB 2PUQH 1RS0A 3Q3KA 3O8RA 2BOKA 1EAUA 1OOKB 3SNAA 1JMOH 3ZVEA 2GDEH 3BTTE 4YLUA 5A0CA 3TVJB 1O3BA 1VJAU 5C3NA 1BDAA 1C5QA 1H8DH 3OY5U 1G3DA 1S81A 1OS8A 2AMPA 4ZXYH 1FI8A 2GKVE 1AD8H 2NU1E 1GCDA 2GT7A 2ZTXA 3FZZA 2J95A 3FP6E 3VGCC 1YPJH 2EI7A
chains in the Genus database with same CATH superfamily
3H7TA 1QB9A 4U2WA 5L2ZH 1GI4A 2ZGHA 1K1IA 1W0JD 3GYMA 2FS9A 4BTUB 1O2XA 1GDQA 5C1XA 1HCGA 4X2WA 3NXPA 1ZRBA 2ZCLP 3OFND 2ZTYA 4NG9H 1SLUB 3URCA 4CBNA 3F0OA 4DJZB 1DE7H 1W0KD 1PPCE 2TRMA 2ZFQH 1BZXE 1QJ6B 3SN8A 1SMFE 4RKJB 4X6PA 3GCHC 1OP8A 1Y5UT 3LJJA 3ZV8A 1MTVA 3UNSA 1YPHC 2JJ2D 4MG3A 3QDZB 1C5TA 2BY6X 3QWCH 3A87A 1C9TA 5HIZA 1O3CA 1SGEE 8KME2 2Y5GA 1ZTLA 3LGVA 4UFDH 1HJ8A 1WUNH 5DP3A 3E0PB 1UVPA 2FODA 3TNTA 2XTTB 4NIWA 2C3SA 4IMZA 2W7SA 2WPJS 1QB1A 3AAVA 3AASA 3SW2B 5C0UA 1LVOA 4AYVB 1C5RA 2H5DA 5IK2D 5CDFE 1WYKA 3TGIE 4JK6A 2FEQH 1QL7A 1SHYA 2Z3DA 2QA9E 2V35A 4DOQA 3LH3A 2PGQB 1GG6C 5LH8A 4I8GA 2UWOA 2FOHA 3M7QA 2ZG0H 3R0FA 1OP2A 3EA9A 3MYWA 4MPXA 2JETB 2FYRA 4K60A 4RT1A 3A8BA 1GWAA 3OX7U 3BTWE 3F9GA 1HAOH 3CS0A 3GY3A 2THFB 1P2OA 1W14U 3VB7A 1DICA 1O3IA 3VXFH 1TGCA 3ZYDA 1EASA 1P2KA 2QGRA 1SOZA 2QXHA 2WV9A 4YM9A 4NFFA 3TJUA 3U8OH 4A7IB 1WU1A 1Z8GA 1BRUP 4RSPA 1F5RA 2FOGA 2VVUA 4Y8YA 1P01A 4NA7A 3QTOH 3RXJA 1GMDG 4ESTE 2BM2A 4JZDH 1Y3YA 1BBRK 1BTXA 3ZIAD 1OSSA 2ESTE 1DSTA 3SORA 1HIAA 1G3EA 1TQ0B 2Z7FE 4J1YA 2J98A 1AI8H 3A7XA 2GMTB 4RT0A 1V2JT 2KCYA 4M9FA 3ESTA 1ZGIA 4UFGH 1GBMA 2ZF0H 2CHAC 5B6OA 3BTFE 2XBWA 2J38A 4TY7A 2L74A 1UCYK 1BMAA 5EW2H 2ZA5A 3SU4A 3F9HA 3U1IB 4J2YB 3TJOA 1F0RA 4ZH8A 4XD7D 1LHDH 3P8FA 2IN2A 1W0YH 3ATKA 3GDVA 4O03A 1K2I1 1ZPCA 3A89A 1SB1H 5GCHG 3PMBB 1GJ8B 3MNXA 3MWIU 1A5IA 1QJ1B 4ISLA 5T1VA 4DVAU 4ABJA 1QURH 2UUFB 3T27A 2OBQA 1GCTB 4HTCH 2O9QA 2BY9X 2RCEA 2LPRA 1XM1A 4X1RU 1UVOA 2HNTE 3RMOH 3M3SA 1C1TA 1L1NA 1BOQA 4FUEA 1FONA 3F2HA 4FXGH 1TONA 2G51A 2QYIA 3PMHB 1TGTA 1PPBH 2SNVA 4A1VA 2G8TA 8GCHF 3LGUA 1DOJA 3PV2A 1T8MA 1YPMH 2EI8A 3ATIA 1C2MA 2ZKSA 1CGHA 1GJ6A 3SO3A 1ZMLA 1QZ8A 1Z8RA 2AEIH 2AHME 1GHXH 3GS9A 4CRFA 1E34B 1TGBA 1OHHD 4ZKNU 2IOTA 2BZ6H 3SJIA 1MKXK 3QN7A 3OU0A 1EJAA 4ISIH 2DE8A 4CH2B 1F5LA 1TMTH 3MNBA 3EYDA 1SPJA 3BG8A 1ZJDA 2WSSD 1LPZB 1O2OA 3KQ5A 3A7YA 3QO6A 1LVMA 1RTLA 1G32B 3MH4A 4KTCA 4KTUA 3UFAA 2WHXA 2A5KA 1D4PB 3RM2H 1IHSH 1EPTA 4TWWA 1T31A 2BD4A 1QB6A 1MZAA 3UOUA 3BN9A 1FY4A 5T6GA 1S85A 3A88A 2ZHQH 5F6MA 1BTWA 1O3FA 1BHXF 1ESAA 3RU4T 1G37A 3LPRA 2BX4A 2UWPA 4UDWH 1GGDC 3H7OA 1MAXA 2NU0E 1DY8A 1RXPA 4OS1A 1V2WT 1PPEE 2XNIA 2HPPH 1Z8IB 1DANH 3LIWA 1O2PA 1EAIA 1VITF 2BVRH 3UR9A 1TQ7B 4AFZA 2WPKS 4NFEA 1AZ8A 4OGXA 5E0GA 3Q77A 4GVUA 1OWDA 5GWZA 4IMQA 1C5PA 3FOAA 2J4IA 3RXHA 3EE0B 1ZMJA 2SGFE 4B73A 1DVAH 2GD4B 1HNEE 4GAWA 2BOHB 2AIPA 1VR1H 1VZQH 1BBRE 3F3BA 1QA7A 1FQ3A 1O38A 3SZNA 1IQGA 1O30A 3SBKA 1C1SA 2KM0A 5LGOA 1BBRH 4GUXA 1ETSH 3K65B 3STIA 3PMAB 1GI3A 1QHRB 3E3TA 1H8ED 1W3CA 1S6FA 5JDUB 1B0EA 3LU9B 2FYQA 3TJNA 1W13U 2WINI 4YZUA 2FDAA 1UCYE 4NZLA 1KLJH 1KXDA 1GVZA 4BAOB 3VB4A 5JBCS 3S9CA 3QZRA 1VGCC 2PR3A 3DA9B 2VGCC 3AK5A 2FI3E 1D6RA 2EI6A 1IQEA 5GXPA 1UCYH 3A85A 1XUFA 2A1DB 2R3UA 1DWEH 3MO6A 1V2VT 2QF3A 2R9PA 1G9IE 4OS4A 3QX5H 3UIRA 1AO5A 1SQAA 4GHQA 4B75A 1NN6A 4MDSA 1TPPA 2QF5A 2R0LA 2GTBA 2JH0D 4I32A 3KIDU 2A7HA 3PLKA 3U1JB 3F0PA 4JZEH 1UJ1A 2KCAA 3LGYA 5CHAB 1LHCH 3V0XA 1WOFA 1NBME 2VIQA 1QBOA 1NZQH 1C5VA 3U98H 5L2YH 3HPTB 1ARCA 3ZVGA 3ELAH 1TLDA 2Q6DA 2J94A 3SUDA 2OK5A 1BTHH 2Z3EA 1ESTA 5HMAA 4DIHH 1NESE 2BLQA 3I78A 3U28C 2CN0H 1D6WA 1TX8A 1LKAA 2EY4C 5EJZA 3BEIB 3E90B 3EGKH 3T28A 5FXLA 2LP6A 1O3DA 1SGQE 2GZ8A 1QBVH 2FOMB 1KXCA 1C2IA 3TPIZ 3RXKA 2ZFTA 3OEHD 1GHWH 2Y6TA 2EC9H 2ZHWH 2ZEBA 1A61H 4LZ4B 1FN6A 4ABBA 1W8BH 1EFRD 2Y5HA 2ZHEH 1GL1A 1ELGA 4U01A 1UTPA 1HJ9A 1HFDA 4JYTA 4I8KA 1O2SA 4E7RG 1KXEA 1ANDA 1TBZH 3SU3A 1GVLA 1V2PT 1IQIA 1THRH 5AVDA 1W12U 4Y79A 3TK5A 1JRSA 4MVNA 1CT2E 1GDUA 1QTFA 4Y8ZA 1NBMD 1ZOMA 1O3LA 1AB9B 1MTNB 3U8RH 2CMYA 5ESBA 2XC0A 4ABIA 2F91A 2RA3A 1KTSB 1MUEB 2C90B 4HI3A 1MTSA 3GY2A 3F2GA 2A4QA 4FVDA 2ZDNA 1H9HE 2AIQA 2XYAA 4NIXA 1T7CA 3NKKA 3RXAA 1O2GH 3FVFB 1O35A 1K1NA 2Y5FA 4K2YA 3KF2A 4DW2U 1P2QA 3FO8D 4HZHA 1NO9H 1O2HA 4Q7ZA 1N8OB 1UO6A 2CK3D 2I6QA 4DG4A 1ELTA 2VIDA 3BTGE 1B7XB 5E8EH 2CJIA 1EKBB 2H9HA 2BD9A 2QXIA 1FY5A 1TMBH 1JWTA 2ZHDA 9LPRA 2Z9JA 3MO3A 2AFQB 4D7GA 1CBWC 3NWUA 1A1RA 1HAGE 1GI6A 2ZZUH 1DPOA 3EA8A 1HDTH 4Q2KA 2Y82A 2ZDVH 4JCNA 1PYTC 5AHGH 6CHAC 1FIWA 4OS7A 1AFQB 5KGOA 2EQNA 2WPMS 4JZIA 3PTBA 1C2GA 1GVKB 3RXFA 1ZSJA 4Q63A 4MLFB 2ANWA 4MPUA 1TAWA 5GPIB 2PV9B 4IBLH 3KNXA 4O3TA 3U9AH 2YMSD 1EZUC 2YMSB 1TNHA 1DY9A 3FKSD 2Z9IA 1O3KA 3EE7A 5DGJA 5HM9A 2KCPA 2ZP0H 2ZU2A 1TABE 4Y6DA 6LPRA 2ZCHP 4R8TB 1KXFA 1ORFA 2KR7A 4X1QU 2C4FH 8GCHG 1G2MA 3P8GA 2TBSA 1QRWA 1YF4A 3FFGA 4MPVA 1SLVB 2JDID 3DT0H 1C5OH 1LPKB 3KQEA 1YLNA 4UFFH 1Z71A 5T6FA 1YKTA 3PMJA 1MZDA 1C5ZB 4RI0A 3SV9A 1UTQA 2JETC 5T6DA 2QXJA 1TB6H 2HVXA 5DG6A 2YNBA 4GLYA 1SOTA 3RMNH 2NU2E 1ZYOA 3H09A 1CHOF 3TK6A 2ULLA 2EA3A 3SOSA 1LCYA 1V2ST 1FY1A 2AGGX 2V6NA 1GBCA 4AG1A 2QCYA 3BIUH 2ZCKP 3SI3H 1SKYE 1ZHPA 4DURA 2ZQ1A 3M61U 2QF4A 3B9FH 3ATWA 1GBBA 1PPHE 5DP4A 1EOLA 3N7DA 1RIWB 1ARBA 1SI5H 1DXPA 1OWIA 1A3EH 1YY3A 2BDYA 3SGQE 2B5TB 3RXIA 3BTME 3A7WA 3IITA 2V3OH 4A6LA 1SC8U 1NFUA 2GZ7A 1CE5A 1YYY1 1Y5BT 2HGTH 2FWWA 3N7OA 3ATLA 1D3TB 1L4DA 1EQ9A 1P05A 1C5MD 2ZU5A 1N6XA 2P3TB 5I25A 4VGCB 1ZR0A 1A2CH 1VITG 2A31A 3U69H 1UMAH 1RTFB 1U6QA 3BTKE 4XOJA 4ZHLU 5JBBS 1IQFA 1SG8B 1SGFG 1YPKH 5A8YA 4HG6A 4WMFA 1GMCG 1S6HA 2Q6FA 1C2LA 1L1GA 3SNBA 3U8TH 3OAAD 1OP0A 5GDSH 1ZSKA 1WV7H 5PTPA 3TGKE 4F55A 1TFXA 2XW9A 3A83A 3DSOA 4I8HA 5H4IB 1O33A 4O9VA 4OGYA 4Y0ZE 4I7YH 4BOHA 9ESTA 4WJG2 5EG4A 5FPSA 1O5AB 1ELBA 2TGPZ 2P59A 3RXQA 4ZKSU 3ZVBA 5FPTA 2OUAA 1F0TA 1GCTC 1GI0A 1INCA 1PQ5A 1GMHG 1YLCA 3KEEA 1J15A 1F92A 1EZQA 1P04A 3JZ1B 1Z7KA 1AVGH 3WY8A 4TY6A 4K1TA 1TPOA 4FUHA 2WYJA 3TJVA 1TBRH 1QBNA 4XE4A 1QQ4A 3RXRA 1UTMA 1IQNA 2GT8A 3STJA 4CR5A 4AYYB 1PFXC 3QK1A 1OYQA 4K69A 3RC4A 3MH6A 2PSYA 2NWNA 2QC2A 1GBJA 3UQVA 3UNRA 3NUMA 1AHTH 1TOMH 2PP6A 2J5UA 3IWMA 5C67A 1Q3XA 1C1NA 4X6NA 1DDJA 1BMNH 2HVYB 3L33A 4D8NA 3LGIA 2ALPA 4RN6A 1FIZA 4GSOA 1QCPA 3UY9A 3SV6A 2BDHA 3A8AA 1A7SA 2FOFA 3RDZA 3UR6A 1K1JA 5C2ZA 4OS2A 3RM0H 3PWBA 3SV8A 2JIZD 3UWJH 4ZMAH 2V3MA 1QFKH 1K21H 1ZSLA 1J17T 2XRCA 4X0WU 7KMEH 1O2NA 1ZZZA 2Z9KA 1TBQH 3CENA 3T29A 4DGJA 1GBKA 1DWCH 1UVSH 4IN1A 1K9OE 1P2IA 4KGAA 1SLXB 5EXLA 3RXBA 2ZFSA 2J92A 2QIQA 1NPMA 2HLCA 4ZHMU 3GCTF 4X8TH 2Y7ZA 3DSGA 4INHA 3PRBA 1CT4E 1UHBB 2BLOA 1MD8A 2WUCA 2KAIA 2BY7X 4BAQB 1GBAA 3SU2A 2B0FA 4YTAA 1MU8B 1GHVH 1YBWA 4BXWA 1FV9A 3EAJA 3MU8A 1WXRA 4X1PU 2K1QA 2OQUA 1E79D 1J14A 1O34A 2YOLA 1HAZB 4OS5A 2PFEA 3SU0A 1QRZA 1XUGA 2G5NA 3FP8E 2L6OA 3UTUH 3WW7A 5F03A 3TH4H 1CQQA 1O2VA 2P94A 1Y3XA 4CRCA 3FN8A 1MKWK 1OX1A 2ZTZA 1WSSH 2R2WU 1BMLA 2WPLS 1EB1H 3GYLB 2XXLA 5C1YA 1M9UA 4IGDA 1IQJA 1SGFA 4DCDA 1UTNA 2I6SA 4YT7H 1GBEA 1MCTA 2BD3A 1C2KA 1ZGVA 1DLEA 1O3PB 2KX4A 2BLVA 1ABIH 1C2JA 4BTIB 2BD8A 4YXWD 3OTJE 1C2DA 3VPKA 5FX5A 2ZECA 3PWCA 1P57B 5EQQA 1OYTH 1HB0B 2SGPE 1P2JA 1HAHH 1KDQB 1GJ5H 3D62A 1L4ZA 1ELCA 1HAYB 3UOPA 1MCVA 1GJ9B 3MH5A 4ZCNA 2OC1A 4X1SU 5A0AE 5EPNA 3LDXH 2FLRH 2WPHS 5AFYH 5G4BA 1QGFA 2GZ9A 4ISOA 3SJ9A 3P8NA 2FIRH 1TE0A 3DFLA 2O8MA 1DX5M 4Z6AH 2BQ6B 2AGEX 2AYWA 1VCWA 2W5EA 1QRXA 2OC0A 3A86A 3EA7A 1UTKA 1IQHA 1GI8B 3F2FA 5DN6D 1DUEA 3SZEA 3UNQA 1DUAA 2BHGA 3ZVCA 1K1LA 3Q3XA 3ZZ3A 3PTNA 2BDIA 1C1PA 1KIGH 4NIYA 4GPGA 3D65E 1EB2A 4NA8A 3SU6A 3SUGA 2XOKD 4RKOB 5GNDA 2ILNA 4FUCA 3D23A 2K8IA 4U32A 5E0HA 3DFJA 4I8JA 1OXGA 2ANYA 3ZZAA 1ID5H 4AFQA 1BT7A 3PROA 3T25A 1TYNA 3MNCA 3OEED 1SLWB 4B1TA 1Y5AT 3HK6B 1CHOG 1VJ9U 5F8XA 8LPRA 4B2AA 4FU7A 4XFQA 6GCHF 1MQ5A 4FOUC 4UD9H 1PJPA 5A0BA 1NY22 1QA0A 5EPYA 4Y71A 1Q2WA 1UTJA 1ZRKA 2UUKB 1ZLRA 1H9LB 3EDXB 1QY6A 1ACBE 3AVZA 1BJUA 1T4VH 5DP7A 2V0BA 1V2MT 1TOCB 3Q00A 4D9RA 2BDBA 4U30A 2BB4A 1O3HA 3ITIA 1WTHD 3SI4H 1F0UA 3B8JA 2TPIZ 1EZXC 1QR3E 2F43B 1LVBA 2DE9A 2AERH 2PSXA 3SV7A 2ZGBH 1SGYE 1WQVH 4ISHH 2WPIS 1FPHH 4DY7B 2GDDA 1HPGA 1NFXA 4X2VA 4BXSA 3EQ0H 1GL0E 3M35A 5DP9A 3NCLA 2ZHFH 5FCKA 2QAAA 2EEKA 2Z94A 4ASHA 3GY6A 3T62A 2KCOA 2UWLA 1YPHE 1MKWH 2VNTA 1F5KU 3SJOA 1VKYA 5K0HA 5TJXA 1ZJKA 2C8ZB 5SGAE 4B71A 1O3GA 2HPQH 4OS6A 1S0RA 2R3YA 3PV5A 4Z0KA 3VXEH 1E1RD 3PLBA 4THNH 3WWBA 4TYDA 3S7KB 1RRKA 3GCOA 1T8OA 2FM2A 2W6ID 4NSVA 4X2XA 2XWAA 5L6NH 1C2HA 1XUKA 3KHVA 7ESTE 4H6TA 4P00A 4K1SA 3VGCB 1FJSA 2PGBB 1P9UA 2GX4A 3MU4A 1Z1JA 2G5VA 1AUTC 1D3DB 3LKWA 4FVBA 2PKSC 2PTCE 3TK9A 1LVYA 2BX3A 1C2EA 5EQRA 1GMCF 3UB0A 1GPZA 4IW4E 5A2MH 1SGDE 4ZHAA 2RG3A 3GDSA 3M5MA 3SJKA 1YM0A 1EP5A 1PQAA 3RXCA 5C17A 1TRYA 3HGPA 3QUMP 2VB0A 4I31A 3RXDA 3VG8A 1AWFH 1PQ8A 2STBE 5FAHA 3A80A 3GCHB 2HLDD 4BAKB 1BMMH 1C1RA 4AFSA 3ATMA 2AS9A 2VWNA 1HUTH 2OC8A 5EIYA 1O32A 1XVOA 5C1UA 1OWHA 4KELA 4MPWA 1KTTB 3MQKC 3ENSB 3BG4B 3TH2H 3RLYH 5HM2A 4X8VH 1GMHF 2TGDA 3KGPA 2GVFA 1NU7B 2Y80A 2ZU3A 1TA2A 1S0QA 1AVXA 1EJMA 1MQ6A 1S5SA 1IQLA 1C1VH 1PPGE 1TALA 5JYIA 3NRLA 1F0SA 1HBTH 4ZKOU 1CHGA 2BQWB 1BTPA 4CRDA 2A4RA 2QF0A 3RXTA 3GCTG 1WCZA 1J9CH 1W7GH 1CA8B 1GG6B 2VBCA 1UVTH 3LC5A 4VGCC 2D26C 3ZZ8A 1SGIB 4ABFA 1BTUA 1TRNA 1P02A 2JJ1D 2C93B 3CNRA 1GI5A 5E2PA 3E91A 3C27B 1YWUA 2XC5A 4AG2A 5LPRA 3SUEA 1ELVA 5ABWA 1ZTKA 3F6UH 3RC5A 2WV5A 1RD3B 3D49H 1P11E 4FUBA 1O36A 1SGRE 1LQDB 3HK3B 1K1MA 2VINA 1BRAA 2WUBA 1XKAC 2P93A 5F8ZA 1ZHMA 1GBTA 2ZWLH 4WH8A 4INLA 1NC6A 1KSNA 1V2UT 4B6EA 2Z3CA 2FLBH 2HALA 1GJAB 3URDA 1CVWH 4K5ZA 2Y81A 1DLKB 4A92A 1QIXB 2P95A 4QT8C 1GBFA 1KYNA 3GY4A 4BNRA 2VWOA 1AGJA 2Q1JA 1HLTH 1C4U2 1FPCH 4TT3D 1AVWA 3HATH 1BITA 2CHAB 3ZZCA 3GDUA 1C5SA 2ZDMA 5JBAS 4AC9A 2JH5D 1C1OA 5FBEA 3RXPA 2Z6BD 1CGJE 5HXFA 4YT6H 1ELEE 2OQ5A 1Y3VA 3TITA 1T32A 1C2FA 2R0KA 3OE7D 5HYOA 1O5GH 2VWLA 3RXSA 4I33A 5DJ7A 2PKAB 1YP9A 1LHFH 2VH6A 3SYJA 4UONA 5J4QA 2C8XB 1C5YB 1GHBG 2H6MA 1O2RA 2BY8X 3Q3YA 1UVUH 1LHEH 4WY3A 5I46H 2FS8A 3P95A 1AKSB 2V7QD 2ZU1A 3IG6B 3OSYA 4FETA 4WH6A 3SUFA 6ESTA 2M5TA 1AIXH 3PO1B 1V2NT 2H1UA 3OYPA 3P92A 4GHTA 2TGAA 3OY6U 1NS3A 1BTYA 1P2NA 2FX4A 5ESTE 3SU5A 1S84A 3BV9B 3RXVA 1AZZA 1DS2E 4CBOA 3P70B 2VVVA 1AY6H 3RXUA 3E6PH 2IJD1 1EZSC 4ABHA 1SGNE 3QGJA 1O5DH 2F9BH 4YOGA 6GCHG 2A0QB 2HWLB 3E16B 2ANKH 1ELDE 2W26A 1BIOA 4B6FA 4F4OC 1XUJA 1FY3A 1ZMNA 4SGBE 4KKDA 1GHYH 4ACAA 4E7NA 4JYUH 5TCAA 3O8BA 1E1QD 4MNWA 3UREA 3VB6A 3RLWH 1GJ4H 3BEFB 4FUGA 1X7AC 3RXGA 1O2QA 3A8DA 3QTVH 1Y59T 2A2XH 2ZDKA 1WQSA 4CH8B 1ESBA 2AH4X 1T4UH 1GGDB 1OWJA 4P02A 3K9XB 3A7ZA 1HAVB 4WVPE 2UUJB 4TPYA 2AMQA 3RXMA 3KCGH 1CSOE 4K8YA 1SQTA 1O2MA 3S9AA 1DITH 1NRNH 4AZ2B 1G3BA 3ZZ9A 5EODA 3LGTA 1GI1A 2W3IA 1TX7A 4XRNA 4AN7A 3S7HB 3KQBA 3HKIB 5E2OA 1N6YA 1LHGH 1LPGB 1NRSH 4ZXXH 4ZKRU 3PLPA 5A8ZA 2O8TA 4WMEA 5C20A 1C5NH 1LMWB 3MO9A 5CE1A 3KL6A 3DCLA 2OD3B 5EQSA 4LK4A 1UTLM 3A82A 3RXLA 1P2MA 1VITH 1GI2A 4TPIZ 1DWBH 2VIWA 7GCHF 2FI5E 5JPMH 1UW7A 1KY9A 1MBQA 4NIVA 4AFUA 2GMTC 5FX6A 2BDCA 1KXBA 4B2CA 4ASUD 4DT4A 2FP7B 2VGCB 2GCTB 1O2JA 1FY8E 1RJXB 1SGCA 3GOVB 1DFPA 5FBIA 5AF9H 4YLQH 1C1WH 1O2YA 1WDIA 2CXVA 3G01A 4I86A 3M7TA 4ABDA 4I8LA 3ZZ6A 4NWKA 5GJ4B 2HNTF 3BIVH 1GI9B 2F9VA 5DK1A 2FTLE 2A4GA 1P0SH 2VJ1A 2RDEA 1FDPA 1BHXB 1C5WB 1FXYA 1C1QA 1C5XB 2BY5X 1TPSA 1SQOA 2PW8H 3MI4A 5CHBA 1O3NA 3L3TA 3M5OA 2TGTA 3N99A 3Q76A 4IS5A 1IOEA 1UTOA 3HKJB 1P10A 1SFIA 1N1LA 3W1EA 5BRRE 4TSFD 5C94A 1C1UH 2QXGA 4H4FA 3I77A 3ZVDA 4MNVA 4BAMB 2XBYA 3ZV9A 2DUCA 2OCVB 2SGQE 1GJDB 3B23B 1JRTA 3M5LA 2ODQA 1BA8B 4XBCA 4E05H 1EAWA 4YOJA 1DXWA 5IYTA 1O5BB 1OPHB 1YLDA 2ASUB 2O8UA 4Y0YE 1TNKA 3NK8A 2HRVA 2ZDAH 1YGCH 3DD2H 1EP6A 4WF8A 1K1PA 4YOIA 2FO9A 3T26A 3KYGA 4IC5A 3TU7H 1C4Y2 4E06H 2A4OA 3TIUA 1O5FH 1YPLH 2BDAA 1P12E 1AN1E 3CP7A 2ZFFH 1Z6EA 5JBTA 3K6ZA 4H42U 1Z1IA 4WWYA 2P8OB 2HNTC 1H4WA 1P03A 4KP0A 1HIAB 1O2UA 1S82A 4FUDA 4D7FA 1O2WA 1DM4B 1BRCE 1AFEH 2J98B 5DP5A 3ZZDA 1ANEA 1HRTH 2W3KA 4DIIH 1THPB 2CF9H 3AW0A 2J34A 1O3JA 3PRDA 1A0HB 1CO7E 1FZZA 4K8BA 1XKBC 1V2RT 1ANCA 2P16A 3BTQE 1FAXA 1ZHRA 3MU0A 2QV1A 1AU8A 1L0ZA 4X8SH 1WTGH 4Y7BA 1F2SE 2B7DH 3I29A 1LQEA 2IPHA 2C8WB 1CBWB 2STAE 1Y3UA 4A5TS 1PYTD 6CHAB 4XBBA 1NT1A 5FPYA 1A0JA 1FMGA 2GCHG 4K1EA 1EUFA 1Q31A 1WBGB 3FAOA 3M37A 1CA0B 3W94A 3M3TA 3VFEA 2QE7D 2XCNA 3MOCA 2RA0A 1IHTH 4JYVH 4CREA 2F9PA 2A2QH 1P06A 4CHAB 3BG4C 1VCPA 1SGPE 1YCPM 5HKKD 1TGNA 4NA9H 1CGIE 4UE7H 2ZPRA 1KXAA 3SNEA 3F9FA 3LJOA 2VH0A 3VB5A 2VIVA 4Y8XA 1EOJA 1QL9A 1IQKA 5DO4H 2ALVA 2FMJA 4XDEA 1AMHA 4NCYA 3SGAE 2VWMA 1S6LA 1PPFE 4AX9H 4LXBH 5C0TA 1TNGA 4BANB 4NZQA 1JOUB 5HIYA 1MD7A 2SGDE 3RMLH 1ELFA 1MU6B 2BZAA 1GHBF 3FANA 2D8WA 1L2EA 2SFAA 1TMUH 5CHAC 5HGGA 1RTKA 1DWDH 1EPTB 1V2QT 7LPRA 2AMDA 2UUYA 2F9UA 3MHWU 1GJCB 4B2BA 1W10U 1K28D 5DSFA 2CGAA 4MQAA 1Y3WA 1W7XH 1SSXA 1CT0E 5EW1H 2BVSH 2ZFPH 1O5EH 3PM3A 3HGNA 3S69A 4Y76A 1MH0A 3V7TA 3MU5A 1B5GH 3DHKH 4X6OA 1HXFH 3NZIA 2HOBA 4WMDA 3LGWA 2GV7A 2OC7A 2ZIQH 4ZROA 3AW1A 1QL8A 4B76A 2XNDD 1YPGH 2B8OH 3MFJA 4O97A 1HXEH 1QQUA 3S0NA 1IQMA 2H9EH 2P3FH 2VIOA 1K1OA 3BSQA 3P8OA 3SQHE 2B9LA 2OTVA 1UHBA 1HAXB 1OWKA 3A84A 4JK5A 3O8DA 1ZPBA 1E37B 2BTCE 3JZ2B 1TNIA 3V3MA 1NROH 2FPZA 1P3EA 2XC4A 2H5CA 1AB9C 3KN2A 1MTNC 3UAIC 1T8LA 2O8LA 1EXFA 3ZZ4A 1HJAB 4X2YA 5FCRA 1RFNA 1TIOA 1P8VC 7GCHG 2G00A 3PO1C 4Q80A 2XBVA 4AOQA 4SGAE 3MMGA 3FP7E 5DP6A 1H8IH 1N8OC 5EXMA 1L1JA 1P09A 2FZZA 2LELA 1QNJA 4JZ1A 3P17H 2G4TA 2NU4E 2ZGXH 1S83A 1GBHA 4TWYA 2ZFRH 1GHAG 1MTUA 3RXEA 3SU1A 1EAXA 5E0JA 3GCNA 1PQ7A 3PB1E 3TNSA 2BVXH 3MNSA 1C5LH 1O39A 1KDQA 2OBOA 1A3BH 3KQCA 4FU8A 1G3CA 1LO6A 4UFEH 1AFQC 4R0IA 3DSPA 3F68H 1SR5C 3RU4E 4GCHF 1MTWA 3M5NA 3NPSA 2D2DA 2Z9GA 2IJOB 2PTNA 5A8XA 3LOXA 1BB0B 2SGEE 2OXSA 2BD5A 4XBDA 3F1SB 2YMSC 5KECA 1W2KH 3LONA 4FUFA 4ACBA 1J8AA 2G55A 4AGJA 1BCUH 2F9NA 4JMYA 1ETRH 1LKBA 4AORA 3UQOA 4MNYA 4IC6A 4ZAEA 1YPEH 4PROA 1DSUA 3CS7A 2ZPQA 1E0FD 1MBMA 1O0DH 3RP2A 2BYAX 4F48B 1BJVA 4INKA 1BMFD 1XX9A 4O3UA 2A5IA 2P3UB 3WWFA 1JBUH 4KTSA 4HGCA 2G81E 5J4SA 1SHHB 1XXFA 2G52A 1GBIA 5EJ1A 1ELAA 1TX6A 3M36A 3UUZA 3TH3H 3RU4D 4BTTB 1SFQB 3GISB 2ODYB 3GY8A 2NU3E 4FUIA 1O3EA 4OM9A 1RGQA 1NU9A 4NWLA 2QY0B 1O2KA 1RIWC 2LNCA 2OLGA 5C5OA 1TNLA 2FTMA 5A09A 5GIBA 1TA6A 3BTHE 4ABAA 3O8CA 2WYGA 2F4LA 1B0FA 1NRRH 4K3JA 4Y7AA 1GDNA 4FUJA 1NTPA 2VVCA 1YCPK 3FZDA 2ZDLA 1Z8JB 4AB9A 2FX6A 3SV2H 4ZUHA 5C5NA 5DPAA 3SQEE 1FNIA 1NFYA 3V13A 3TGJE 3LH1A 5FL7D 1BRBE 1HGTH 1XVMA 2TIOA 3DUXH 2BLWA 1V6DA 2GCTC 8ESTE 3ODFA 5ETXA 2GJGA 2FOCA 3UWIA 1GJBB 2PHBA 5EGMA 2BXUH 2ZQ2A 1A5HA 1J16A 2F3CE 1A4WH 2CF8H 5F53A 5DP8A 1KLIH 3TLOA 4MNXA 1AQ7A 2ZU4A 2WZQA 1TRMA 3BF6H 1HV7A 1IAUA 3M7UA 1XUHA 1SL3A 1XXDA 2H2ZA 2VU8E 4A1XA 5LPEA 1W0ZU 4X6MA 2ZGJA 1A0LA 3SJ8A 1AE8H 3RC6A 1AWHB 1WAYB 2IPQX 2RFKC 1O3MA 2FOEA 1E38B 1XUIA 3SGBE 3W95A 1O2TA 3H5CB 2A45B 2W6JD 3ZZBA 1O37A 2AGIX 4B74A 1QJ7B 4HFPB 1W11U 3ODDA 4Y11E 3RMMH 5AFZH 1JIMA 1H1BA 1KMHB 2BQ7B 2VIPA 2ZC9H 3ZVFA 4CRBA 1MKXH 3MU1A 5CMXH 2J97A 5TCCA 1D3QB 2J9NA 2KFWA 1NFWA 1JIRA 2KZ4A 2XWBI 1YC0A 3VEQB 1ZTJA 2GCHF 5EJLA 3A8CA 1MABB 4ABGA 1Z6JH 1AE5A 3GICB 3A7VA 3E1XB 1V3XA 5B6LA 4CRGA 1P3CA 3C1KA 1V2LT 1SBWA 1G30B 1K0HA 2D1JA 1GJ7B 5JB9S 2P8OC 1BUIA 2K0QA 2ZNKH 3M3VA 1C4V2 3RUOA 1GBLA 1THSH 4UEHH 1TWXB 3AAUA 4JZFH 3ZZ7A 2WPDD 2YNAA 4Q7XA 2ZPSA 2WV4A 1E35B 2R2MB 3GY7A 3SNDA 4M7GA 1GI7B 3LC3A 1FN8A 1HYLA 2OP9A 1O2ZA 3PYHA 1ABJH 1HAIH 5EXNA 1V2TT 1EATA 2V3HH 1H9IE 1MMJN 1BTZA 1LTOA 1K22H 1TNJA 2F9OA 1NRQH 1C9PA 2A32A 2ODPA 3ZZ5A 2J2UA 1O5CB 2PLXA 4BAHB 3MTYA 4F49A 1BQYA 1A5GH 1XMNB 3RXOA 5EOKA 3GY5A 5L30H 1UK2A 1CA0C 4WXVA 4CR9A 1GMDF 4CRAA 1YCPH 2JH6D 1MAYA 4CHAC 4X1NU 3VB3A 2XCFA 3E0NB 5KEDA 5LPFA 2ZI2H 2Z9LA 3BEUA 1OWEA 3R3GB 2FOBA 5EU8A 2RDLA 1O3AA 4NGAH 2GGVB 3T5FH 1VCQA 1DT2A 3UPEA 2PKSB 4DT7B 1OKXA 1UK3A 2PUXB 2GP9B 4IN2A 1D3PB 1E36B 1LDTT 1C1MA 1H8HD 1SVPA 5K7RA 2BMGB 1COWD 4LZ1H 4GCHG 1HAPH 3BTEE 3SNCA 4MTBA 3T2NA 2O8WA 2A5AA 3L6PA 4ISNA 3K6YA 5GCHF 2PKAA 1EPTC 3SHCH 4X8UH 4A1TA 5F8TA 2ANMH 2M2AA 1TGSZ 1T8NA 2F83A 2FOAA 1FX0B 5DKMA 3KQDA 3MH7A 3QLPH 1AKSA 1FAKH 2FXRA 1GHZA 3LT3A 1VGCB 1KLTA 1P9SA 2H9TH 3BTDE 4Z1MD 4FU9A 1ETTH 2SNWA 5T3HA 4WXIA 1GHAF 2BD7A 3K2UA 1V2KT 1SQRA 3PV4A 4AB8A 3A81A 2A7JA 2SGAA 1FLEE 2KAIB 4XSKU 3QZQA 1C5UA 1JXPA 4ABEA 2A7CA 2FESH 5JB8S 1EJNA 2GV6A 2PWXA 1UK4A 2XBXA 2CV3A 3OTPA 5IDKA 1G36A 1FUJA 2FI4E 2JKHA 4Q4LA 2ZGCA 3F9EA 1NM6A 1AUJA 4NSYA 1A46H 1SGTA 1O2IA 1O3OA 1V2OT 2Y7XA 4H6SB 2Q6GA 2G4UA 1O31A 1EX3A 1ANBA 1F7ZA 1GBDA 1HJAC 5FHTA 5BPEA 4D76A 2W7UA 3ZVAA 3ZYEA 1G2LA 3S9BA 2ZO3H 3A7TA 4LOYH 4YO9A 1NRPH 2BXTH 2QN5T 4AGKA 2OINA 3E8LA 1TPAE 1CU1A 1Y8TA 3V12A 4D9QA 4Q7YA 3P6ZB 3SHAH 1HAVA 3QGNB 4Y10E 3N7EA 2BD2A 1PPZA 2BDGA 1ZPZA 4YESB 1D9IA 1O2LA 2C8YB 2PUQH 1RS0A 3Q3KA 3O8RA 2BOKA 1EAUA 1OOKB 3SNAA 1JMOH 3ZVEA 2GDEH 3BTTE 3KYFA 4YLUA 5A0CA 3TVJB 1O3BA 1VJAU 5C3NA 1BDAA 1C5QA 1H8DH 3OY5U 1G3DA 1S81A 1OS8A 2AMPA 4ZXYH 1FI8A 2GKVE 1AD8H 2NU1E 1GCDA 2GT7A 2ZTXA 3FZZA 2J95A 3FP6E 3VGCC 1YPJH 2EI7A
chains in the Genus database with same CATH topology
3H7TA 1QB9A 4U2WA 5L2ZH 1GI4A 2ZGHA 1K1IA 3GYMA 2FS9A 4BTUB 1O2XA 1GDQA 5C1XA 1HCGA 4X2WA 3NXPA 1ZRBA 2ZCLP 2ZTYA 4NG9H 1SLUB 3URCA 4CBNA 4DJZB 1DE7H 1PPCE 2TRMA 2ZFQH 1BZXE 1QJ6B 3SN8A 1SMFE 4RKJB 4X6PA 3GCHC 1OP8A 1Y5UT 3LJJA 3ZV8A 1MTVA 3UNSA 1YPHC 4MG3A 3QDZB 1C5TA 2BY6X 3QWCH 3A87A 1C9TA 1O3CA 1SGEE 8KME2 2Y5GA 1ZTLA 3LGVA 4UFDH 1HJ8A 1WUNH 5DP3A 3E0PB 1UVPA 2FODA 3TNTA 2XTTB 4NIWA 2C3SA 4IMZA 2W7SA 2WPJS 1QB1A 3AAVA 3AASA 3SW2B 1LVOA 4AYVB 1C5RA 2H5DA 1WYKA 3TGIE 4JK6A 2FEQH 1QL7A 1SHYA 2Z3DA 2QA9E 2V35A 4DOQA 3LH3A 2PGQB 1GG6C 5LH8A 4I8GA 2UWOA 2FOHA 3M7QA 2ZG0H 3R0FA 1OP2A 3EA9A 3MYWA 4MPXA 2JETB 2FYRA 4K60A 3A8BA 1GWAA 3OX7U 3BTWE 3F9GA 1HAOH 3CS0A 3GY3A 2THFB 1P2OA 1W14U 3VB7A 1DICA 1O3IA 3VXFH 1TGCA 3ZYDA 1EASA 1P2KA 2QGRA 1SOZA 2QXHA 4YM9A 4NFFA 3TJUA 3U8OH 4A7IB 1WU1A 1Z8GA 1BRUP 4RSPA 1F5RA 2FOGA 2VVUA 4Y8YA 1P01A 4NA7A 3QTOH 3RXJA 1GMDG 4ESTE 2BM2A 4JZDH 1Y3YA 1BBRK 1BTXA 1OSSA 2ESTE 1DSTA 3SORA 1HIAA 1G3EA 1TQ0B 2Z7FE 4J1YA 1AI8H 3A7XA 2GMTB 1V2JT 3ESTA 1ZGIA 4UFGH 1GBMA 2ZF0H 2CHAC 5B6OA 3BTFE 2XBWA 2J38A 4TY7A 1UCYK 1BMAA 5EW2H 2ZA5A 3SU4A 3F9HA 3U1IB 4J2YB 3TJOA 1F0RA 4ZH8A 1LHDH 3P8FA 2IN2A 1W0YH 3ATKA 3GDVA 4O03A 1K2I1 1ZPCA 3A89A 1SB1H 5GCHG 3PMBB 1GJ8B 3MNXA 3MWIU 1A5IA 1QJ1B 4ISLA 4DVAU 4ABJA 1QURH 2UUFB 3T27A 2OBQA 1GCTB 4HTCH 2O9QA 2BY9X 2RCEA 2LPRA 1XM1A 4X1RU 1UVOA 2HNTE 3RMOH 3M3SA 1C1TA 1L1NA 1BOQA 4FUEA 1FONA 4FXGH 1TONA 2G51A 2QYIA 3PMHB 1TGTA 1PPBH 2SNVA 4A1VA 2G8TA 8GCHF 3LGUA 1DOJA 1T8MA 1YPMH 2EI8A 3ATIA 1C2MA 2ZKSA 1CGHA 1GJ6A 3SO3A 1ZMLA 1Z8RA 2AEIH 1GHXH 4CRFA 1E34B 1TGBA 4ZKNU 2BZ6H 2IOTA 3SJIA 1MKXK 3QN7A 3OU0A 1EJAA 4ISIH 2DE8A 4CH2B 1F5LA 1TMTH 3MNBA 3EYDA 1SPJA 3BG8A 1ZJDA 1LPZB 1O2OA 3A7YA 3QO6A 1LVMA 1RTLA 1G32B 3MH4A 4KTCA 4KTUA 3UFAA 2A5KA 1D4PB 3RM2H 1IHSH 1EPTA 4TWWA 1T31A 2BD4A 1QB6A 1MZAA 3UOUA 3BN9A 1FY4A 5T6GA 1S85A 3A88A 2ZHQH 5F6MA 1BTWA 1O3FA 1BHXF 1ESAA 3RU4T 1G37A 3LPRA 2BX4A 2UWPA 4UDWH 1GGDC 3H7OA 1MAXA 2NU0E 1DY8A 1RXPA 4OS1A 1V2WT 1PPEE 2XNIA 2HPPH 1Z8IB 1DANH 3LIWA 1O2PA 1EAIA 1VITF 2BVRH 3UR9A 1TQ7B 4AFZA 2WPKS 4NFEA 1AZ8A 4OGXA 5E0GA 3Q77A 4GVUA 1OWDA 5GWZA 4IMQA 1C5PA 2J4IA 3RXHA 3EE0B 1ZMJA 2SGFE 4B73A 1DVAH 2GD4B 1HNEE 4GAWA 2BOHB 2AIPA 1VR1H 1VZQH 1BBRE 1QA7A 1FQ3A 1O38A 3SZNA 1IQGA 1O30A 3SBKA 1C1SA 5LGOA 1BBRH 4GUXA 1ETSH 3K65B 3STIA 3PMAB 1GI3A 1QHRB 3E3TA 1W3CA 1S6FA 5JDUB 1B0EA 3LU9B 2FYQA 3TJNA 1W13U 2WINI 4YZUA 2FDAA 1UCYE 4NZLA 1KLJH 1KXDA 1GVZA 4BAOB 3VB4A 5JBCS 3S9CA 3QZRA 1VGCC 2PR3A 3DA9B 2VGCC 2FI3E 1D6RA 2EI6A 1IQEA 5GXPA 1UCYH 3A85A 1XUFA 2A1DB 2R3UA 1DWEH 3MO6A 1V2VT 2QF3A 2R9PA 1G9IE 4OS4A 3QX5H 3UIRA 1AO5A 1SQAA 4GHQA 4B75A 1NN6A 4MDSA 1TPPA 2R0LA 2GTBA 2JH0D 4I32A 3KIDU 2A7HA 3PLKA 3U1JB 4JZEH 1UJ1A 3LGYA 5CHAB 1LHCH 3V0XA 1WOFA 2VIQA 1QBOA 1NZQH 1C5VA 3U98H 5L2YH 3HPTB 1ARCA 3ZVGA 3ELAH 1TLDA 2Q6DA 2J94A 3SUDA 1BTHH 2Z3EA 1ESTA 5HMAA 4DIHH 1NESE 2BLQA 3I78A 2CN0H 1D6WA 1TX8A 1LKAA 3BEIB 3E90B 3EGKH 3T28A 5FXLA 1O3DA 1SGQE 2GZ8A 1QBVH 2FOMB 1KXCA 1C2IA 3TPIZ 3RXKA 2ZFTA 1GHWH 2Y6TA 2EC9H 2ZHWH 2ZEBA 1A61H 4LZ4B 1FN6A 4ABBA 1W8BH 2Y5HA 2ZHEH 1GL1A 1ELGA 4U01A 1UTPA 1HJ9A 1HFDA 4JYTA 4I8KA 1O2SA 4E7RG 1KXEA 1ANDA 1TBZH 3SU3A 1GVLA 1V2PT 1IQIA 1THRH 5AVDA 1W12U 4Y79A 3TK5A 1JRSA 4MVNA 1CT2E 1GDUA 1QTFA 4Y8ZA 1ZOMA 1O3LA 1AB9B 1MTNB 3U8RH 2CMYA 5ESBA 2XC0A 4ABIA 2F91A 2RA3A 1KTSB 1MUEB 2C90B 4HI3A 1MTSA 3GY2A 4FVDA 2A4QA 2ZDNA 1H9HE 2AIQA 2XYAA 4NIXA 1T7CA 3NKKA 3RXAA 1O2GH 3FVFB 1O35A 1K1NA 2Y5FA 4K2YA 3KF2A 4DW2U 1P2QA 4HZHA 1NO9H 1O2HA 4Q7ZA 1N8OB 1UO6A 2I6QA 4DG4A 1ELTA 2VIDA 3BTGE 1B7XB 5E8EH 2CJIA 1EKBB 2H9HA 2BD9A 2QXIA 1FY5A 1TMBH 1JWTA 2ZHDA 9LPRA 2Z9JA 3MO3A 2AFQB 4D7GA 1CBWC 3NWUA 1A1RA 1HAGE 1GI6A 2ZZUH 1DPOA 3EA8A 1HDTH 4Q2KA 2Y82A 2ZDVH 4JCNA 1PYTC 5AHGH 6CHAC 1FIWA 4OS7A 1AFQB 2WPMS 4JZIA 3PTBA 1C2GA 1GVKB 3RXFA 1ZSJA 4MLFB 2ANWA 4MPUA 1TAWA 5GPIB 2PV9B 4IBLH 3KNXA 4O3TA 3U9AH 1EZUC 1TNHA 1DY9A 2Z9IA 1O3KA 5DGJA 5HM9A 2ZP0H 2ZU2A 1TABE 4Y6DA 6LPRA 2ZCHP 4R8TB 1KXFA 1ORFA 4X1QU 2C4FH 8GCHG 1G2MA 3P8GA 2TBSA 1QRWA 1YF4A 3FFGA 4MPVA 1SLVB 3DT0H 1C5OH 1LPKB 3KQEA 4UFFH 1Z71A 5T6FA 1YKTA 3PMJA 1MZDA 1C5ZB 3SV9A 1UTQA 2JETC 5T6DA 2QXJA 1TB6H 2HVXA 5DG6A 2YNBA 4GLYA 1SOTA 3RMNH 2NU2E 1ZYOA 1CHOF 3TK6A 2ULLA 2EA3A 3SOSA 1LCYA 1V2ST 1FY1A 2AGGX 2V6NA 1GBCA 4AG1A 2QCYA 3BIUH 2ZCKP 3SI3H 1ZHPA 4DURA 2ZQ1A 3M61U 3B9FH 3ATWA 1GBBA 1PPHE 5DP4A 1EOLA 1RIWB 1ARBA 1SI5H 1DXPA 1OWIA 1A3EH 2BDYA 3SGQE 2B5TB 3RXIA 3BTME 3A7WA 3IITA 2V3OH 4A6LA 1SC8U 1NFUA 2GZ7A 1CE5A 1YYY1 1Y5BT 2HGTH 2FWWA 3N7OA 3ATLA 1D3TB 1L4DA 1EQ9A 1P05A 1C5MD 2ZU5A 1N6XA 2P3TB 5I25A 4VGCB 1ZR0A 1A2CH 1VITG 2A31A 3U69H 1UMAH 1RTFB 1U6QA 3BTKE 4XOJA 4ZHLU 5JBBS 1IQFA 1SG8B 1SGFG 1YPKH 5A8YA 4WMFA 1GMCG 1S6HA 2Q6FA 1C2LA 1L1GA 3SNBA 3U8TH 1OP0A 5GDSH 1ZSKA 1WV7H 5PTPA 3TGKE 1TFXA 2XW9A 3A83A 4I8HA 5H4IB 1O33A 4O9VA 4OGYA 4Y0ZE 4I7YH 4BOHA 9ESTA 4WJG2 5EG4A 5FPSA 1O5AB 1ELBA 2TGPZ 2P59A 3RXQA 4ZKSU 3ZVBA 5FPTA 2OUAA 1F0TA 1GCTC 1GI0A 1INCA 1PQ5A 1GMHG 1YLCA 3KEEA 1J15A 1F92A 1EZQA 1P04A 3JZ1B 1Z7KA 1AVGH 3WY8A 4TY6A 4K1TA 1TPOA 4FUHA 2WYJA 3TJVA 1TBRH 1QBNA 4XE4A 1QQ4A 3RXRA 1UTMA 1IQNA 2GT8A 3STJA 4CR5A 4AYYB 1PFXC 3QK1A 1OYQA 4K69A 3RC4A 3MH6A 2PSYA 2NWNA 2QC2A 1GBJA 3UQVA 3UNRA 3NUMA 1AHTH 1TOMH 3IWMA 5C67A 1Q3XA 1C1NA 4X6NA 1DDJA 1BMNH 3L33A 4D8NA 3LGIA 2ALPA 4RN6A 1FIZA 4GSOA 1QCPA 3UY9A 3SV6A 2BDHA 3A8AA 1A7SA 2FOFA 3RDZA 3UR6A 1K1JA 5C2ZA 4OS2A 3RM0H 3PWBA 3SV8A 4ZMAH 3UWJH 1QFKH 1K21H 1ZSLA 1J17T 2XRCA 4X0WU 7KMEH 1O2NA 1ZZZA 2Z9KA 1TBQH 3CENA 3T29A 4DGJA 1GBKA 1DWCH 1UVSH 4IN1A 1K9OE 1P2IA 4KGAA 1SLXB 5EXLA 3RXBA 2ZFSA 2J92A 2QIQA 1NPMA 2HLCA 4ZHMU 3GCTF 4X8TH 2Y7ZA 4INHA 1CT4E 1UHBB 2BLOA 1MD8A 2WUCA 2KAIA 2BY7X 4BAQB 1GBAA 3SU2A 2B0FA 4YTAA 1MU8B 1GHVH 1YBWA 4BXWA 1FV9A 3EAJA 3MU8A 4X1PU 2K1QA 2OQUA 1O34A 1J14A 2YOLA 1HAZB 4OS5A 2PFEA 3SU0A 1QRZA 1XUGA 2G5NA 3FP8E 3UTUH 5F03A 3TH4H 1CQQA 1O2VA 2P94A 1Y3XA 4CRCA 1MKWK 1OX1A 2ZTZA 1WSSH 2R2WU 1BMLA 2WPLS 1EB1H 3GYLB 2XXLA 5C1YA 1M9UA 4IGDA 1IQJA 1SGFA 4DCDA 1UTNA 2I6SA 4YT7H 1GBEA 1MCTA 2BD3A 1C2KA 1ZGVA 1DLEA 1O3PB 2BLVA 1ABIH 1C2JA 4BTIB 2BD8A 3OTJE 1C2DA 3VPKA 5FX5A 2ZECA 3PWCA 1P57B 5EQQA 1OYTH 1HB0B 2SGPE 1P2JA 1HAHH 1KDQB 1GJ5H 3D62A 1L4ZA 1ELCA 1HAYB 3UOPA 1MCVA 1GJ9B 3MH5A 2OC1A 4X1SU 5A0AE 5EPNA 3LDXH 2FLRH 2WPHS 5AFYH 5G4BA 1QGFA 2GZ9A 4ISOA 3SJ9A 3P8NA 2FIRH 1TE0A 3DFLA 2O8MA 1DX5M 4Z6AH 2BQ6B 2AGEX 2AYWA 1VCWA 2W5EA 1QRXA 2OC0A 3A86A 3EA7A 1UTKA 1IQHA 1GI8B 1DUEA 3UNQA 1DUAA 2BHGA 3ZVCA 1K1LA 3Q3XA 3ZZ3A 3PTNA 2BDIA 1C1PA 1KIGH 4NIYA 4GPGA 3D65E 1EB2A 4NA8A 3SU6A 3SUGA 4RKOB 2ILNA 4FUCA 3D23A 4U32A 5E0HA 3DFJA 4I8JA 1OXGA 2ANYA 3ZZAA 1ID5H 4AFQA 1BT7A 3PROA 3T25A 1TYNA 3MNCA 4B1TA 1SLWB 1Y5AT 3HK6B 1CHOG 1VJ9U 5F8XA 8LPRA 4B2AA 4FU7A 4XFQA 6GCHF 1MQ5A 4UD9H 1PJPA 5A0BA 1NY22 1QA0A 5EPYA 4Y71A 1Q2WA 1UTJA 1ZRKA 2UUKB 1ZLRA 1H9LB 3EDXB 1QY6A 1ACBE 3AVZA 1BJUA 1T4VH 5DP7A 2V0BA 1V2MT 1TOCB 3Q00A 4D9RA 2BDBA 4U30A 2BB4A 1O3HA 3ITIA 1WTHD 3SI4H 1F0UA 3B8JA 2TPIZ 1EZXC 1QR3E 1LVBA 2DE9A 2AERH 2PSXA 3SV7A 2ZGBH 1SGYE 1WQVH 4ISHH 2WPIS 1FPHH 4DY7B 2GDDA 1HPGA 1NFXA 4X2VA 4BXSA 3EQ0H 1GL0E 3M35A 5DP9A 3NCLA 2ZHFH 5FCKA 2QAAA 2EEKA 2Z94A 4ASHA 3GY6A 3T62A 2UWLA 1YPHE 1MKWH 2VNTA 1F5KU 3SJOA 5K0HA 5TJXA 1ZJKA 2C8ZB 5SGAE 4B71A 1O3GA 2HPQH 4OS6A 1S0RA 2R3YA 4Z0KA 3VXEH 3PLBA 4THNH 4TYDA 3S7KB 1RRKA 3GCOA 1T8OA 2FM2A 4NSVA 4X2XA 5L6NH 2XWAA 1C2HA 1XUKA 3KHVA 7ESTE 4H6TA 4K1SA 3VGCB 1FJSA 2PGBB 1P9UA 2GX4A 3MU4A 1Z1JA 2G5VA 1AUTC 1D3DB 3LKWA 4FVBA 2PKSC 2PTCE 3TK9A 1LVYA 2BX3A 1C2EA 5EQRA 1GMCF 1GPZA 4IW4E 5A2MH 1SGDE 4ZHAA 2RG3A 3GDSA 3M5MA 3SJKA 1YM0A 1EP5A 1PQAA 3RXCA 1TRYA 3HGPA 3QUMP 2VB0A 4I31A 3RXDA 1AWFH 1PQ8A 2STBE 5FAHA 3A80A 3GCHB 4BAKB 1BMMH 1C1RA 4AFSA 3ATMA 2AS9A 2VWNA 1HUTH 2OC8A 1O32A 1XVOA 5C1UA 1OWHA 4KELA 4MPWA 1KTTB 3ENSB 3BG4B 3TH2H 3RLYH</