1UCYH

Thrombin complexed with fibrinopeptide a alpha (residues 7-19). three complexes, one with epsilon-thrombin and two with alpha-thrombin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
150
structure length
150
Chain Sequence
IVEGQDAEVGLSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTVDDLLVRIGKHSRTRYERKVEKISMLDKIYIHPRYNWKENLDRDIALLKLKRPIELSDYIHPVCLPDKQTAAKLLHAGFKGRVTGWGNRRETWTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (serine protease/coagulation)
molecule keywords THROMBIN
publication title Bovine thrombin complexed with an uncleavable analog of residues 7-19 of fibrinogen A alpha: geometry of the catalytic triad and interactions of the P1', P2', and P3' substrate residues.
pubmed doi rcsb
total genus 18
structure length 150
sequence length 150
ec nomenclature ec 3.4.21.5: Thrombin.
pdb deposition date 1996-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ucyH00
2DE9A 3NZIA 2A4GA 1SGTA 1W0ZU 4X6NA 2BXTH 3L33A 3ZVAA 4ZHLU 1KLJH 2XBYA 1PJPA 1MTSA 1CT0E 1Z1JA 4Y10E 1C5WB 1P12E 3Q00A 3R3GB 2Z94A 1Z71A 1RXPA 1GJ7B 5ESTE 2VIPA 2HNTC 1TPPA 1GL1A 1T32A 2TGPZ 2ZDKA 2P8OC 2WPMS 4I8HA 1O2LA 1LPKB 5JBBS 4AORA 1TQ0B 1QY6A 2BLQA 2BDAA 2PWXA 2ZGBH 2SGQE 5DP7A 1ZPCA 2UUJB 3A7VA 1HAXB 1YBWA 1BTPA 4UFGH 2H9HA 4DGJA 1BMNH 2FOEA 1MD8A 1C5PA 4Y76A 3QK1A 1DXPA 1HXFH 1SC8U 5GDSH 2OC8A 2JETB 1LHFH 3SN8A 2ALVA 1GDUA 2ZEBA 2FOCA 1UO6A 1Z8GA 4I8LA 1SHYA 1QGFA 3PO1C 3T25A 1ARCA 2Q6DA 1O2PA 4XBDA 3NWUA 3M5NA 4Q80A 5TCCA 1AN1E 1FUJA 4XSKU 3SUGA 1FN8A 3TH2H 3GY6A 2FOGA 4XOJA 5JBTA 2BOHB 4X1SU 2G4TA 1N6XA 1DXWA 1WU1A 1GJBB 5J4QA 2BVRH 1O37A 1QA7A 1GBTA 3SNDA 2R0KA 1THPB 3SJ9A 5E0GA 1TGBA 2ASUB 1MCTA 1CA0C 1GBIA 4O3TA 5A0BA 1PPBH 2ANMH 4X2XA 2SNVA 3O8CA 2P3FH 4X8UH 2J9NA 1EB2A 1LO6A 3RMLH 3TJUA 1YCPM 3RXGA 4R8TB 4CRCA 3SUDA 2QV1A 3M3TA 1FQ3A 2BDHA 5J4SA 4X8TH 1TRYA 1O3LA 4KTCA 1QBVH 1SQOA 1C2IA 3A8BA 1S84A 3EGKH 5A0AE 1YM0A 4INKA 4X6MA 1LPZB 1T4VH 2B9LA 1MKWK 4LOYH 1BHXF 4ZAEA 4ZHAA 3FZZA 5C1YA 5B6OA 1QJ1B 2A2XH 5TCAA 4AFZA 2OP9A 3HKIB 1RTLA 1H9LB 2ZGCA 4WXIA 1TOMH 1W7XH 4HGCA 4K60A 3PROA 2A5IA 1O3KA 4ABJA 1C1SA 5EQSA 2FOFA 4ZKSU 4GHQA 2Q1JA 2ZDMA 2B5TB 3UR6A 1BTWA 2R2MB 2FPZA 1K2I1 2NU4E 2BDGA 4RKJB 1BRCE 2J4IA 3GCTG 1MZDA 1XUHA 3SOSA 4NIXA 2A45B 1ZYOA 1QQ4A 2BQWB 1A5HA 4AB8A 1V2ST 4A92A 5FXLA 1O2RA 1THRH 3U1JB 1VCQA 2R3YA 3A8AA 1RD3B 5GPIB 2RG3A 2Y80A 1LVBA 2RA3A 4NZQA 2ZI2H 1GJCB 5C2ZA 4AZ2B 4MNYA 2AFQB 1HCGA 1BJUA 4K1TA 5C3NA 1UTPA 1BRUP 1AHTH 2I6QA 4NWLA 4MPWA 5LH8A 2GCHG 2P8OB 3P8OA 1QB1A 2ODYB 4ZHMU 1QBOA 3HGPA 5EQQA 1K1OA 1VJ9U 1WQSA 1A0LA 5BPEA 3QX5H 3HKJB 1BTZA 2DUCA 4ISLA 2BZAA 5FAHA 1A2CH 3T26A 4DOQA 3EA7A 4GVUA 4D9RA 1DE7H 1ID5H 3KQEA 3ITIA 2ZO3H 2HPQH 2BD8A 2UUYA 3HPTB 4Y71A 5T6FA 1GHBF 5DP6A 2GDEH 4BAKB 1EJNA 2CF9H 3JZ1B 1J9CH 2IPHA 1O3AA 3TH3H 2PR3A 1AY6H 3SQHE 1KTTB 2VIVA 3RXBA 4I8JA 1OYTH 4CH2B 1ZGVA 1QJ6B 1DY8A 7KMEH 2FZZA 2ZFFH 2Z9IA 1C1OA 1TPSA 1ELEE 1TYNA 1ELTA 4ISNA 3RXKA 1C5TA 3TH4H 1PPZA 4HFPB 1O2MA 3T62A 3TPIZ 4K8BA 1ARBA 3E6PH 5HM9A 1YPJH 1LHEH 2BY5X 3P8GA 4B2AA 3E0PB 1IHTH 5EPNA 1UTQA 1CA0B 3C27B 4E05H 3SU2A 2BD5A 1HAOH 1HJAC 3S7HB 5C5NA 3P8FA 1ETSH 1ANCA 1JXPA 3P8NA 3GCNA 5HGGA 1HV7A 2ZZUH 1BA8B 2QXGA 3UOPA 3M7QA 5HM2A 2QAAA 1QURH 1NFYA 1O0DH 1O30A 3I77A 3IG6B 5AVDA 3GY3A 3DA9B 5GIBA 1VJAU 5IDKA 4MTBA 1MUEB 5EODA 2V3HH 2H5CA 4J2YB 1O5FH 1EAXA 1FPHH 2ZGJA 1OSSA 3DUXH 1AUJA 3MOCA 4K1EA 4K2YA 2ZPSA 2ZHWH 1DLEA 2BXUH 2ZGHA 1YPEH 1OWKA 1BUIA 2C90B 4E7NA 4OGYA 2TPIZ 4NWKA 3PWBA 2XTTB 3RXDA 1XKBC 1C5NH 1AFQC 4A6LA 3RM2H 3QTOH 2SFAA 4D8NA 3MNCA 1EATA 5CE1A 3RMOH 4OS4A 4A5TS 1KSNA 3GCOA 1TPAE 2HNTE 5AFYH 3OTJE 3RLWH 4LXBH 2BD7A 1UVSH 2B8OH 1Y5BT 2J95A 3MNSA 2ALPA 2Y7XA 1RIWC 3BEFB 3FP8E 4Y8XA 3U9AH 2ZWLH 3ZZ9A 2G5VA 2HGTH 3TU7H 1DUEA 1Y59T 1RJXB 2W7SA 1KLTA 4LK4A 2XBVA 4FUBA 1A3BH 1HRTH 3GY7A 2ZIQH 1SGIB 1P2JA 5E0HA 4X2VA 4WWYA 1TIOA 1YLCA 3F9GA 1O2QA 1T31A 4JK5A 3LPRA 2BD3A 5E0JA 2A7JA 5T6GA 4B2BA 1TOCB 1DANH 1MAYA 4K69A 4SGBE 1O2IA 4WMFA 1EOLA 2FESH 5L30H 2CV3A 3ZVCA 4IC6A 5TJXA 1O35A 1QA0A 1S0QA 2D1JA 2THFB 4HTCH 2G55A 1PFXC 4TPIZ 6GCHF 1TX7A 1D6WA 7GCHF 1O2WA 1P2QA 1P2KA 1S83A 2QF3A 1S6FA 2ZCKP 1A1RA 3N7OA 2BZ6H 2ZA5A 5HMAA 1C5MD 3BTEE 3UTUH 2P16A 1NU9A 2F9NA 3PTNA 3VEQB 2OLGA 3T2NA 1LCYA 2FI3E 3C1KA 1J14A 3FZDA 1O33A 1G30B 3SJ8A 2QN5T 1F5RA 3FFGA 3MH5A 4ABAA 3OYPA 3OSYA 1NU7B 2C8WB 1L1GA 1QNJA 2PHBA 2WPLS 2J38A 1C5LH 3MTYA 1CBWC 4NFFA 1ZHMA 4GLYA 2P3TB 3RU4T 3MWIU 3A7WA 1IQKA 2O8MA 1O5BB 3FANA 3BEUA 4U2WA 1BQYA 3RC5A 4KP0A 3KL6A 1D3QB 2OD3B 1LVMA 3GYLB 4B75A 3CENA 5AF9H 4NA8A 1N8OC 2IJOB 3LJOA 2UUFB 1H1BA 2OQUA 1SLWB 3SJOA 4X6PA 5EU8A 1AWFH 4X6OA 1SGYE 1O2ZA 3BTDE 2FOBA 4XFQA 3AAVA 3A84A 1O5CB 2PKSC 2BD2A 3DFLA 4AGKA 1O2GH 1ZR0A 2FTMA 2BMGB 2D8WA 1C1RA 4ABGA 1AFQB 1O3MA 4BAQB 1QRWA 2Y5FA 3KEEA 5LPRA 2FOAA 4BNRA 1P3CA 3D49H 2FIRH 4CRGA 1GMDG 1YKTA 4YZUA 1TX8A 1O3OA 1P3EA 1S81A 2H9TH 3RXQA 3A87A 1V2WT 2ZHQH 3MH6A 4RN6A 3W95A 1JOUB 1RIWB 1ABIH 5C20A 4NIVA 4DW2U 1Z6JH 1O5AB 2FLRH 2AMQA 3RC6A 4NGAH 2XRCA 1GDNA 4YT7H 1KXBA 1C1MA 1EOJA 3MO9A 1E35B 2Z3DA 3K65B 1MCVA 5T3HA 4XDEA 2AMPA 1MKWH 3V3MA 2ZKSA 3EDXB 1WV7H 5DP4A 1SGFG 1TGNA 1MTWA 2BLVA 3TVJB 3ZVFA 2PKAA 1XVOA 1GMHG 3Q76A 1YPMH 1AE5A 1C2HA 2PKAB 1TGCA 1MQ6A 1GI7B 1SLUB 1V2QT 4XE4A 3OU0A 1GVKB 1LMWB 1GCTC 2GMTB 1OWHA 2XBWA 1GI8B 3ATLA 3MMGA 3SORA 4AN7A 2PUQH 1SGFA 2W7UA 4FUCA 5DPAA 2EEKA 1C1UH 3LGYA 1P01A 4YLUA 2VWMA 2J34A 1DX5M 1ZSJA 1NM6A 1GJ4H 1UHBA 3QZQA 3BTKE 1ZTKA 3GDVA 1UHBB 2ZFSA 4UE7H 1PPHE 2ZP0H 3ZV9A 2SGEE 4FUFA 1W3CA 1MKXK 7LPRA 4ZROA 1W13U 1FLEE 3PMAB 1K1LA 1RFNA 1D3TB 4BOHA 2AYWA 3MO3A 2YNAA 3LIWA 3Q3XA 4KGAA 3SJIA 3KF2A 2RCEA 4DY7B 4DVAU 1HAYB 1HBTH 2ANYA 5HYOA 3U8RH 2AGEX 2XC0A 2BY9X 1ESTA 1AVXA 1D6RA 2F83A 5DP5A 2GZ8A 1O2YA 1IQMA 5F8TA 2BDCA 1HB0B 1C4U2 1SGNE 2F9VA 3PV4A 4B2CA 4MPXA 1ESAA 1THSH 3H5CB 1HYLA 1UTKA 2BTCE 1SVPA 1GI9B 3ZVGA 1ZZZA 1E0FD 3E0NB 1ETRH 1FIWA 2GT7A 4IGDA 1XMNB 1C5UA 2BX3A 3LU9B 3F6UH 1BJVA 1SFQB 1N1LA 5EXMA 1GHBG 2EC9H 2SNWA 1SGCA 2ZGXH 1GBDA 2BYAX 2V35A 1N8OB 1FY1A 2G5NA 1NRNH 2W3KA 1XKAC 4YOIA 4NSVA 1E34B 1ZLRA 4JCNA 2OXSA 3RM0H 4YO9A 1F0UA 2EI6A 1GWAA 1SPJA 2GT8A 2PKSB 4F49A 1TMUH 4Q7XA 2QC2A 4TWYA 1DOJA 2BVXH 2ZPQA 1F7ZA 1P11E 3ZZ5A 1LTOA 4X8VH 4IN2A 1GBCA 1TALA 4DT7B 5FCRA 3E1XB 1UVPA 1MQ5A 2VGCB 1F5KU 3QGJA 4Y11E 1Y3VA 4IN1A 1AZ8A 1BMAA 3A7ZA 2QYIA 2PV9B 4Q7ZA 1EPTC 1AE8H 1ZJDA 3BG4B 1DVAH 4UD9H 3RXAA 1AZZA 2VB0A 1O3FA 1YC0A 1V2RT 2O8LA 2FYQA 2C4FH 3GY4A 1ELCA 1PPEE 2HLCA 1BRBE 2QCYA 1T8MA 1KYNA 2RDLA 3M3VA 3PLPA 4NFEA 4IW4E 3ODDA 1BCUH 2ULLA 1IQFA 1TNIA 4AOQA 1V2LT 2AERH 1TFXA 3A7XA 5EPYA 2CXVA 3OY5U 4TYDA 2OC7A 2GTBA 2PW8H 1Y3XA 4ISIH 1NN6A 1DPOA 1EB1H 1Z8IB 1GCTB 5BRRE 4BAMB 3BIUH 3SGBE 4DCDA 3IITA 3LH3A 2J92A 1A7SA 5DGJA 2PSYA 3QZRA 1P03A 1NFXA 1C1WH 1GI4A 1P06A 1G2MA 1PQAA 3A83A 1EQ9A 1C5YB 3MNBA 2ESTE 3MH7A 2AH4X 1PQ5A 5FPYA 1GJ8B 1TGSZ 4X0WU 1G37A 4DG4A 3O8BA 2ZHFH 4GPGA 1VCWA 4WY3A 1FPCH 1SR5C 1EZSC 3P17H 2XW9A 3KQCA 4I8KA 1L1JA 2XYAA 4NIYA 4D9QA 1LPGB 2W5EA 5JPMH 3QUMP 1QTFA 4WXVA 3EYDA 1C2KA 4Y79A 4ABIA 1J15A 4FU8A 5DJ7A 2ZU1A 4IMQA 1ETTH 3MO6A 3RXUA 1DWDH 1Q3XA 3HK3B 4GAWA 3AVZA 1H8DH 3LGTA 1ORFA 2OTVA 1W0YH 2FP7B 1S6HA 3U8OH 3FP7E 3ZVEA 1O2NA 2FOMB 1KY9A 4U01A 1U6QA 1TNGA 4ZKNU 2D26C 5AHGH 1MBQA 1LQDB 3RXHA 3ZYEA 4I32A 4CREA 4TPYA 2XNIA 3SW2B 1GJDB 3MHWU 4AGJA 5FPSA 2J94A 1NRQH 1TNKA 2P3UB 5JBCS 1SBWA 2OBQA 2ANKH 4NA7A 1JIMA 2DE8A 3B8JA 2QA9E 1HJ9A 3RXPA 5JBAS 5LPFA 1ZOMA 3LT3A 2BQ6B 2A31A 4O97A 1ZHRA 1J16A 1MMJN 3UQVA 2CHAC 1T7CA 2QXIA 3B9FH 4FUIA 4ZXXH 1CHOG 3S69A 4FUHA 4I33A 1GBJA 4X8SH 1GHAF 3SV8A 1HAVA 2VVUA 4MVNA 3RMMH 2BHGA 1W10U 3P6ZB 1YGCH 1EPTA 4Z0KA 1C2GA 4K5ZA 4K8YA 3S7KB 1C5OH 4Y0ZE 3E3TA 5EXLA 3S9BA 1H9HE 2FYRA 3PO1B 1BTUA 1XM1A 4X2YA 5PTPA 1DM4B 5EG4A 1H9IE 1FY5A 2BDBA 2SGAA 4UONA 3SU6A 3Q3KA 1OKXA 4JZIA 1JBUH 3VB7A 1TNJA 3TNSA 1C5XB 1LVYA 1WTGH 1BT7A 1HAIH 1BITA 5A09A 1WQVH 3O8DA 4ZKOU 1DUAA 3EAJA 3ZZ4A 1GPZA 1UVOA 1GL0E 1C9PA 1GDQA 4INHA 1NTPA 4Z6AH 2VJ1A 2TRMA 1VGCC 2WV4A 4AFUA 3F9FA 1IQLA 1TX6A 4KTUA 1FNIA 1GG6C 3A8CA 3P70B 3SBKA 4MQAA 3E8LA 8LPRA 3TNTA 4WJG2 5A8ZA 1KXDA 1O38A 1FI8A 3BTME 1GBMA 2IOTA 2GV6A 2XWBI 4Y0YE 1C5RA 1VITG 1Y8TA 2R3UA 4KTSA 2GKVE 3SU3A 8KME2 1YPHC 3D23A 2NU3E 2OUAA 1NY22 3NK8A 4U32A 1C4Y2 1O2UA 3A81A 1P0SH 1LKBA 1UK3A 2VIOA 3E91A 1O2TA 2ZHDA 4UFFH 5EGMA 3TJNA 1V3XA 1GJAB 4JZ1A 2TGTA 3A82A 2GX4A 1WBGB 2GCTC 1GCDA 1UCYK 2O8UA 1O2JA 1VZQH 2F9PA 3E16B 3ESTA 1HXEH 2ODQA 4DJZB 1K1NA 5A0CA 1BZXE 4QT8C 1LVOA 3A88A 2FS8A 1ZGIA 1TQ7B 1NPMA 4ABEA 2ZHEH 2VVVA 1Z7KA 3GY2A 3QDZB 3HGNA 1F92A 3TITA 4FXGH 3EE0B 2RA0A 3I29A 4M7GA 1GGDC 5GCHF 4U30A 1C5SA 1PPCE 4A7IB 3PTBA 3TGJE 1W14U 1AGJA 1ZPZA 5IYTA 4LZ1H 3RC4A 1EZUC 1N6YA 1O2XA 4JZDH 2OBOA 2ZG0H 3U1IB 3QGNB 1SGEE 1ZTJA 1K9OE 1OWIA 1Q31A 3GISB 2VWOA 1DY9A 1L4ZA 5T6DA 4BAHB 1C2EA 1YCPK 1GJ6A 4D7GA 1DSUA 1K22H 3LGWA 1SMFE 4O9VA 3SI4H 1O5EH 1HPGA 1DWEH 1MKXH 1TGTA 4NSYA 4CR5A 2NU0E 1GHYH 1GBKA 1FMGA 2R0LA 3ZVBA 1O5DH 1SOTA 3UNRA 2C8YB 2H6MA 2CHAB 2WUCA 3LH1A 1AB9C 1D4PB 4YTAA 5EXNA 3P95A 3BTGE 2G81E 2ZU2A 4F4OC 3ENSB 5L6NH 1IOEA 2A1DB 3SI3H 5ABWA 2STBE 3MU5A 1MU6B 1GBBA 1W7GH 1LHCH 2TBSA 4WVPE 5A8YA 3CS0A 1V2PT 2HNTF 3LC5A 4Q7YA 3GCTF 1GMCG 1BMMH 1LHGH 2G8TA 1BTHH 1TB6H 1P57B 4GCHG 1UVUH 2FI5E 4AB9A 4ABHA 2BQ7B 2ODPA 2AMDA 5FHTA 2G52A 5FBIA 3LJJA 4FUGA 2IN2A 4I8GA 2YOLA 3SGQE 1O3EA 2GCHF 1SSXA 1C1PA 2ZNKH 5AFZH 1VGCB 2R9PA 1CQQA 2FXRA 5GXPA 2A7HA 1GG6B 1K1IA 3SU1A 1HJAB 1OWJA 3RXRA 2GZ7A 3MU0A 3PLBA 2FDAA 2EI7A 1ZTLA 5EOKA 3M35A 2ZU4A 1TWXB 1GHWH 2P93A 1C2DA 2UWPA 3PWCA 3FVFB 3TGKE 5DP9A 1K28D 4JYUH 1G3DA 2OCVB 4MPUA 1O3HA 3PM3A 3BG8A 4FUDA 3GCHC 3GY8A 1V2UT 1P2NA 3STJA 4A1XA 2P95A 2VINA 3UFAA 1A0JA 1O39A 2QIQA 3MYWA 5ESBA 4FU7A 1CGJE 1BOQA 1FY4A 4MNXA 5JB8S 3BTFE 1NROH 1A5GH 2FODA 4HI3A 1C4V2 1TAWA 4A1TA 4E06H 2ZTYA 1DSTA 1MTUA 3S9AA 4JMYA 3NKKA 1Q2WA 4AX9H 1GVZA 4WMEA 4ZH8A 1L4DA 1V2TT 3RXCA 2UWLA 3BTTE 5EW2H 3DFJA 1DWCH 3M3SA 1HIAA 1Y3WA 2FI4E 2SGFE 1PQ7A 2OQ5A 1SHHB 3ELAH 1KXAA 1GGDB 1O5GH 3LGUA 1QCPA 3SUFA 1AO5A 1BBRK 2BM2A 3SU4A 2QXHA 3SV6A 3A80A 3VPKA 1NRRH 4SGAE 2FS9A 3A89A 3URDA 3URCA 4K3JA 3LGIA 2G00A 1V2OT 1KLIH 4TY6A 2BOKA 1P9SA 2ZPRA 2ZF0H 1PPGE 3I78A 3RXLA 4H42U 2BDYA 2I6SA 9LPRA 3ZZCA 1EXFA 3GICB 1SLVB 1Y3UA 1WCZA 5H4IB 8ESTE 2YNBA 3BIVH 4CH8B 1WOFA 3HK6B 3V13A 1QBNA 4OS1A 1HNEE 4JYTA 3UOUA 3STIA 1B5GH 1FAKH 1TRMA 2Z9GA 4NG9H 3ZZ6A 1C2FA 1D3PB 3SQEE 2A5KA 1O2VA 4DURA 1GBEA 2OINA 3UUZA 1AB9B 3S9CA 1G32B 1EX3A 2QY0B 1QIXB 3SHCH 3JZ2B 1OXGA 4RSPA 4ZUHA 3D65E 3TIUA 5A2MH 1JMOH 1FXYA 1GJ9B 1J8AA 1MU8B 1H4WA 3A86A 1AIXH 1HAZB 2B0FA 3M5MA 3ZV8A 3GY5A 2A4OA 5DKMA 1CO7E 3M7TA 3AAUA 2Z9LA 8GCHF 1AU8A 2VNTA 3VB6A 4CRAA 1XXFA 1BHXB 2W26A 4OS5A 3A7YA 1UMAH 4BANB 1UK4A 2FTLE 1P09A 1C2JA 3DD2H 3OX7U 4K1SA 3V12A 4CRBA 1P05A 4I31A 4INLA 1BB0B 4H6TA 4CHAC 2R2WU 2PUXB 3RXSA 1FJSA 1MBMA 1GI0A 3GDSA 1YPHE 2FWWA 2BD9A 3M5OA 1SGDE 2FM2A 2HRVA 5JB9S 2XC5A 2Q6GA 1FONA 1V2KT 2J2UA 6ESTA 1W11U 1TNHA 2ZDAH 1EASA 1G3EA 1CBWB 4IC5A 2CN0H 3W94A 1CE5A 2KAIA 4JK6A 2Q6FA 3GYMA 4HZHA 4WH8A 1CT2E 4NZLA 1BBRE 3ODFA 2KAIB 1XVMA 4CBOA 2FLBH 1FIZA 2Z3CA 4FUJA 1WYKA 1Z6EA 1C5VA 4D7FA 3PMJA 1RS0A 1O3IA 5E2OA 4D76A 1FY8E 1P02A 3EA9A 1SGRE 3ZZ7A 1ELBA 2GZ9A 1NRSH 1DWBH 2PGBB 1L2EA 3LONA 1KXEA 4CRFA 2ZFPH 2HVXA 2BDIA 2B7DH 1NFWA 2AEIH 3NXPA 4B73A 2CMYA 2Z6BD 1V2VT 2VWLA 1RRKA 4OS7A 4BXSA 4ZKRU 3UWJH 1AKSA 3ZZAA 1JRTA 1F0TA 1WSSH 1CGHA 3E90B 1AKSB 2V3OH 1GHVH 2ZECA 3MI4A 4I7YH 1KTSB 1O3BA 1RTKA 2FOHA 2GD4B 3M7UA 4B71A 3EQ0H 5C1UA 1LHDH 1T4UH 1O3GA 1IQIA 2QXJA 1J17T 1E38B 1C1TA 1QB9A 3D62A 1K21H 3F9EA 2BY7X 1YYY1 2ZFRH 1HGTH 1QR3E 3SJKA 4YLQH 1D9IA 4ZXYH 2ZU3A 1FAXA 1EAWA 2Z9KA 4ASHA 1A0HB 3F9HA 3ZZ3A 4X2WA 2ZCLP 1UCYH 1T8LA 1O3DA 2NU2E 4CBNA 4AFQA 1O3CA 2W3IA 2TGAA 1YP9A 5FX6A 3S0NA 2BY8X 3KNXA 2A5AA 2A7CA 3SV9A 5C1XA 2ZQ1A 3KN2A 1SGQE 1UTLM 1Y5UT 1V2NT 1BMLA 1O3JA 3AASA 4R0IA 3Q77A 3TJOA 1JIRA 1YPLH 5FX5A 2F9BH 3ATMA 2A4QA 5GCHG 2AIQA 2UUKB 1GMDF 1BIOA 1NFUA 1TA6A 4TWWA 3SUEA 2VIWA 2O9QA 1VITH 3PLKA 1ZMJA 1EKBB 1TE0A 2PTCE 4PROA 1ANDA 2PGQB 1O2SA 3UY9A 1FY3A 1OWEA 1O2HA 5FCKA 3QLPH 1AD8H 1K1PA 1ELVA 3H7OA 3BV9B 2XCFA 1AUTC 4X1RU 1YCPH 2G51A 4CHAB 2H9EH 1S82A 3A7TA 1A5IA 1D3DB 2FEQH 1UJ1A 3FAOA 2ZDVH 4XBBA 2A2QH 1DDJA 1GMHF 1SFIA 3KQDA 1GI3A 1OP2A 3BSQA 1GI6A 1MTVA 3KIDU 1P2OA 1MTNC 3SO3A 4MG3A 2H1UA 2WYGA 1HAHH 3MH4A 1OYQA 3RP2A 3MU1A 2V0BA 2QF0A 5FBEA 4VGCC 4MNVA 1ZSLA 2C8XB 3BTHE 3QN7A 3SHAH 4CRDA 1JRSA 1S5SA 4XBCA 2ZQ2A 1ELAA 2JKHA 4AYVB 1SL3A 1KXCA 3K2UA 4O03A 6GCHG 4ZMAH 1HAGE 7GCHG 5G4BA 5HXFA 2BVSH 2C3SA 3SNCA 1TONA 2F9OA 2HPPH 1L0ZA 3RUOA 3HATH 1PPFE 3VXFH 5C67A 1P2MA 2AS9A 2SGPE 3CS7A 2CF8H 1DT2A 4WMDA 4FVBA 1EAIA 1V6DA 4ISOA 1HLTH 4Y6DA 2SGDE 1HAVB 3RU4D 4BTIB 1UTNA 3UWIA 4MPVA 1ELDE 2C93B 1IAUA 1RGQA 4X1PU 1EPTB 1SB1H 5F8XA 3UR9A 4DIHH 4AYYB 4MDSA 4AFSA 3LKWA 9ESTA 3P92A 3TJVA 3ZZ8A 4Y7AA 4ABBA 1SQAA 3IWMA 2O8TA 2STAE 3KQBA 2FX6A 1PYTC 3RU4E 1VCPA 1C5QA 1ANBA 2BB4A 1MZAA 1T8OA 4YESB 1AVGH 4FVDA 2XWAA 1QFKH 2JH6D 1TA2A 4ISHH 3NUMA 1O36A 5CMXH 1UVTH 1G36A 1DITH 3ZVDA 4B74A 1CGIE 5DG6A 3UNSA 1EAUA 4CR9A 1IHSH 2WUBA 1HDTH 3F68H 1VR1H 1XUJA 2K1QA 3TGIE 1NC6A 1AFEH 1EP6A 1QRZA 3ATWA 4Y8YA 3ZZDA 1ANEA 1SG8B 5K7RA 4JZFH 1KIGH 1GI1A 1NZQH 1AMHA 1WUNH 2GVFA 1TBZH 1BBRH 3RXOA 2F3CE 1TNLA 3WY8A 3MU4A 1OP8A 1O3NA 2WINI 4MNWA 3RXVA 1CU1A 4O3UA 1TBRH 3UREA 1GI5A 2OC0A 2FMJA 1O31A 2H5DA 1JWTA 2XBXA 1NESE 3RXFA 2Y5HA 5JDUB 4UFDH 1E36B 1OPHB 2NWNA 1QRXA 3AW0A 1YF4A 5E2PA 1CVWH 3GOVB 5GWZA 3ZZBA 2G4UA 4UEHH 5E8EH 1CHGA 1P04A 2GP9B 1O32A 3UNQA 3PB1E 4DIIH 1C2LA 5A8XA 1Y3YA 3K6YA 3QTVH 4B1TA 1IQHA 1TMTH 4ABFA 1EJMA 1KXFA 1W12U 1ZRBA 3M36A 1A61H 1O2KA 4BTUB 1G2LA 4GUXA 1G3BA 1TABE 1XUIA 1XUGA 1MTNB 4Y7BA 3QWCH 3U8TH 3L6PA 4OS2A 4LZ4B 1XUKA 1ZSKA 2LNCA 1CSOE 5EQRA 1G9IE 3ATKA 4VGCB 2EI8A 2GV7A 6CHAC 1HFDA 8GCHG 2P59A 1GJ5H 1S85A 2BX4A 3VGCC 2ZTXA 1SOZA 1GVLA 2UWOA 7ESTE 3KGPA 1P8VC 1OP0A 1K1MA 4WF8A 5JYIA 3NCLA 4Y8ZA 4ABDA 4WH6A 5DP8A 2VIDA 1C1QA 1C2MA 4BTTB 3TK6A 5K0HA 5DK1A 1HAPH 1QQUA 1C1VH 2XXLA 1K1JA 1INCA 5I46H 1TRNA 3A85A 2AGGX 3KCGH 3LDXH 5CHAC 3BF6H 5LPEA 4YOGA 1TLDA 1OWDA 1UTJA 1ELGA 1W8BH 3RMNH 1YPKH 1LDTT 1SI5H 3RXTA 4YM9A 2AIPA 1BDAA 2NU1E 1PQ8A 4UFEH 1EZXC 3UQOA 5FPTA 3SNEA 2PSXA 3T5FH 2CGAA 1AQ7A 1M9UA 1F2SE 1YPGH 3VXEH 3SNBA 4AG1A 1A46H 2GMTC 4H4FA 2P94A 2VH0A 1GBAA 1B0EA 3BTQE 3UIRA 4YT6H 1F0SA 3V7TA 4ESTE 2VVCA 3G01A 1ZHPA 1EJAA 3O8RA 1UCYE 1GI2A 4Q2KA 2OC1A 1ZRKA 2GGVB 2HOBA 3ZYDA 2Y82A 4BXWA 4H6SB 1NRPH 1O2OA 1XX9A 3SV7A 2ZU5A 3TK9A 1ZMLA 1SGPE 2ZDNA 2ZFTA 4MLFB 1Z8RA 1OX1A 1ZPBA 2HALA 3AW1A 1C5ZB 1ACBE 2O8WA 1CHOF 2ANWA 1FZZA 1AWHB 3U69H 2A4RA 1X7AC 1KDQA 1IQGA 1Y5AT 3B23B 3SU0A 2ZDLA 2QGRA 3V0XA 2Z7FE 1KDQB 2D2DA 5LGOA 2F91A 1O3PB 4OS6A 2JH0D 1S0RA 3ATIA 1FN6A 1Z8JB 1QJ7B 3PYHA 3RLYH 1MH0A 2Z9JA 3Q3YA 3NPSA 2GDDA 5ETXA 3RDZA 5L2ZH 1V2JT 1GBFA 2F9UA 3RXJA 2GCTB 1EUFA 2PFEA 4JYVH 4TY7A 3EA8A 4THNH 2BLWA 1AI8H 3BEIB 3LOXA 1EP5A 1SLXB 3K6ZA 4KELA 1P9UA 1XUFA 2XC4A 1GBLA 1C1NA 4E7RG 2WV5A 1HUTH 3RXIA 1E37B 4IMZA 4YOJA 1UTMA 1DS2E 1F5LA 3BN9A 5DO4H 1ELFA 3SGAE 1HIAB 1BRAA 3SZNA 2CJIA 1T8NA 2ILNA 1ZMNA 5F6MA 5EW1H 1XXDA 3SNAA 1ESBA 1GHXH 2VH6A 4OGXA 2Y6TA 1QL7A 3OY6U 2TGDA 1VITF 1B7XB 3MNXA 1RTFB 1O34A 3U98H 2A0QB 6CHAB 1LKAA 1DFPA 1NO9H 1IQJA 2ZTZA 1CA8B 1MAXA 3VGCB 2LPRA 3RXEA 4IBLH 1IQEA 1ABJH 2VGCC 1QL8A 2JETC 4X1NU 2ZC9H 4JZEH 1CT4E 2A32A 2ZFQH 1YLDA 3VFEA 2PLXA 4GHTA 5F03A 2WYJA 1TMBH 1PYTD 1TBQH 3BG4C 2XCNA 1GBHA 1P10A 3M61U 3PMBB 1G3CA 2VU8E 1A4WH 5CHAB 3QO6A 3UPEA 2AGIX 1QB6A 2VIQA 1A3EH 3TLOA 1NT1A 3R0FA 4FU9A 5C5OA 1SQTA 3DT0H 3PMHB 4IS5A 3MU8A 4A1VA 4BAOB 1BTYA 2FX4A 4FUEA 5L2YH 1MD7A 1TPOA 3VB4A 3H7TA 2BY6X 3MFJA 4NCYA 5SGAE 2WPJS 1DICA 2Y7ZA 2ZCHP 1P2IA 2WPHS 4J1YA 2PTNA 3A8DA 1QL9A 3VB3A 2H2ZA 1DLKB 1C9TA 3T29A 4NIWA 4B76A 2M5TA 2V6NA 2WPIS 3F1SB 1LQEA 1UK2A 5GJ4B 3K9XB 6LPRA 3DHKH 5DP3A 5I25A 1BTXA 4KKDA 3KHVA 5F8ZA 2JH5D 4UDWH 3FP6E 4RKOB 1UTOA 1L1NA 3T28A 1AVWA 1OOKB 4NA9H 2BD4A 2BLOA 1Z1IA 1F0RA 2HWLB 3M37A 3RXMA 1WTHD 3GDUA 4GSOA 4AG2A 1ZJKA 2Y5GA 3CP7A 3LGVA 1EZQA 1W2KH 3T27A 2C8ZB 2Y81A 2Z3EA 4X1QU 3GCHB 1GHAG 3VB5A 2VWNA 3TK5A 3BTWE 1FDPA 3LC3A 1GMCF 1GHZA 1IQNA 1HJ8A 1B0FA 3L3TA 2EA3A 3SV2H 4GCHF 1H8IH 2FO9A 2WPKS 3SU5A 1V2MT 3M5LA 1QHRB 1WAYB 2TIOA 1OS8A 1FV9A 1NS3A
chains in the Genus database with same CATH superfamily
2DE9A 3NZIA 2A4GA 1SGTA 1W0ZU 4X6NA 2BXTH 3L33A 3ZVAA 4ZHLU 1KLJH 2XBYA 1PJPA 1MTSA 1QZ8A 1CT0E 1Z1JA 4Y10E 1C5WB 1P12E 3Q00A 3R3GB 2Z94A 1Z71A 1RXPA 2F43B 1GJ7B 5ESTE 2VIPA 2HNTC 1TPPA 1GL1A 1T32A 2TGPZ 2ZDKA 2P8OC 2WPMS 4I8HA 1O2LA 1LPKB 5JBBS 4AORA 1TQ0B 1QY6A 2BLQA 2BDAA 2PWXA 2AHME 2SGQE 2ZGBH 1ZPCA 5DP7A 2UUJB 3A7VA 1HAXB 1YBWA 1BTPA 4UFGH 2H9HA 4DGJA 1BMNH 2FOEA 1MD8A 1C5PA 4Y76A 3QK1A 1DXPA 1HXFH 1SC8U 5GDSH 2OC8A 2JETB 5HKKD 1LHFH 3SN8A 2ALVA 1GDUA 2ZEBA 2FOCA 1UO6A 1Z8GA 4I8LA 1SHYA 1QGFA 3PO1C 3T25A 1ARCA 2Q6DA 1O2PA 4XBDA 3NWUA 3M5NA 4Q80A 5TCCA 1AN1E 1FUJA 4XSKU 3SUGA 1FN8A 3TH2H 3GY6A 2FOGA 4XOJA 5JBTA 2BOHB 4X1SU 2G4TA 1N6XA 1DXWA 1WU1A 1GJBB 5J4QA 2BVRH 1O37A 1QA7A 1GBTA 3SNDA 2R0KA 1THPB 3SJ9A 5E0GA 1TGBA 2ASUB 1MCTA 1CA0C 1GBIA 4O3TA 5A0BA 1PPBH 2ANMH 4X2XA 2SNVA 3O8CA 2P3FH 4X8UH 2J9NA 1EB2A 1LO6A 3RMLH 4XD7D 1YCPM 3RXGA 4R8TB 3TJUA 4ZCNA 4CRCA 3SUDA 3UAIC 2QV1A 3M3TA 1FQ3A 2BDHA 5J4SA 4X8TH 1TRYA 1O3LA 4KTCA 1QBVH 1SQOA 1C2IA 3A8BA 1S84A 3EGKH 5A0AE 1YM0A 1OHHD 4INKA 4X6MA 1LPZB 1T4VH 2B9LA 1MKWK 2KCPA 4LOYH 1BHXF 4ZAEA 4ZHAA 3FZZA 5C1YA 5B6OA 3FOAA 1QJ1B 3F0PA 2A2XH 5CDFE 5TCAA 4AFZA 5C94A 2OP9A 3HKIB 1RTLA 1H9LB 2ZGCA 4WXIA 1TOMH 1W7XH 4HGCA 4K60A 2HLDD 3PROA 2A5IA 1O3KA 4ABJA 1C1SA 5EQSA 2FOFA 4ZKSU 4GHQA 2Q1JA 2ZDMA 2B5TB 3UR6A 1BTWA 2R2MB 2FPZA 1K2I1 2NU4E 2BDGA 4RKJB 1BRCE 2J4IA 3GCTG 1MZDA 1XUHA 3SOSA 4NIXA 2A45B 1ZYOA 1QQ4A 2BQWB 1A5HA 4AB8A 1V2ST 4A92A 5FXLA 5B6LA 1O2RA 1THRH 3U1JB 1VCQA 3PV2A 2R3YA 3A8AA 1RD3B 2KFWA 5GPIB 2RG3A 2Y80A 1LVBA 2RA3A 4NZQA 2ZI2H 1GJCB 5C2ZA 1SKYE 4AZ2B 4MNYA 2AFQB 1HCGA 1BJUA 4K1TA 5C3NA 1UTPA 1BRUP 1AHTH 2I6QA 4NWLA 4MPWA 5LH8A 2GCHG 1H8HD 2P8OB 3P8OA 1QB1A 2ODYB 4ZHMU 1QBOA 3HGPA 5EQQA 1K1OA 1VJ9U 1WQSA 1A0LA 5BPEA 4DT4A 3QX5H 3HKJB 1BTZA 2DUCA 4ISLA 4Q63A 2BZAA 5FAHA 2PP6A 1A2CH 3T26A 1NBME 4DOQA 3EA7A 4GVUA 4D9RA 1DE7H 1ID5H 3KQEA 3ITIA 2ZO3H 2HPQH 2BD8A 2UUYA 3HPTB 4Y71A 5T6FA 1GHBF 5DP6A 4Z1MD 2GDEH 4BAKB 1EJNA 2CF9H 3JZ1B 1J9CH 2IPHA 1O3AA 3TH3H 2PR3A 1AY6H 3SQHE 1KTTB 2VIVA 3RXBA 4I8JA 1OYTH 4CH2B 1ZGVA 1QJ6B 1DY8A 7KMEH 2FZZA 2ZFFH 2Z9IA 1C1OA 1TPSA 1ELEE 1TYNA 1ELTA 4ISNA 3RXKA 1C5TA 3TH4H 1PPZA 4HFPB 1O2MA 3T62A 3TPIZ 4K8BA 1ARBA 3E6PH 5HM9A 1YPJH 1LHEH 2BY5X 3P8GA 3PRBA 4B2AA 3E0PB 1IHTH 5EPNA 5KGOA 1UTQA 1CA0B 3C27B 4E05H 3SU2A 2BD5A 5HIZA 1HAOH 1HJAC 2KCAA 3S7HB 5C5NA 3P8FA 1ETSH 2KM0A 1ANCA 1JXPA 3P8NA 3GCNA 5HGGA 1HV7A 2ZZUH 1BA8B 2QXGA 3UOPA 3M7QA 5HM2A 2QAAA 1QURH 1NFYA 2EQNA 1O0DH 1O30A 3I77A 3IG6B 5AVDA 3GY3A 3DA9B 5GIBA 1VJAU 5IDKA 4MTBA 1MUEB 5EODA 2V3HH 2H5CA 4J2YB 1O5FH 1EAXA 1FPHH 2ZGJA 1OSSA 3DUXH 1AUJA 3MOCA 4K1EA 4K2YA 2ZPSA 2ZHWH 1DLEA 2BXUH 3OTPA 2ZGHA 1VKYA 1YPEH 3N7DA 1OWKA 1BUIA 2C90B 4E7NA 4OGYA 2TPIZ 4NWKA 3PWBA 2XTTB 3RXDA 1XKBC 1C5NH 5EJZA 1AFQC 4A6LA 3RM2H 3QTOH 2SFAA 4D8NA 2WSSD 3MNCA 1EATA 4B6EA 5CE1A 3RMOH 4OS4A 4A5TS 1KSNA 3FKSD 1H8ED 3GCOA 1YWUA 1TPAE 2HNTE 5AFYH 3OTJE 3RLWH 4LXBH 2BD7A 1UVSH 2B8OH 1Y5BT 2J95A 3MNSA 2ALPA 2Y7XA 5C0UA 1RIWC 3BEFB 3FP8E 4Y8XA 3U9AH 2ZWLH 3ZZ9A 2G5VA 2HGTH 3TU7H 1DUEA 1Y59T 1RJXB 2W7SA 1KLTA 4LK4A 2XBVA 4FUBA 1A3BH 1HRTH 3GY7A 2ZIQH 3F2HA 1SGIB 1P2JA 5E0HA 4X2VA 4WWYA 1TIOA 1YLCA 3F9GA 1O2QA 1T31A 4JK5A 3F2GA 3LPRA 2BD3A 5E0JA 2A7JA 5T6GA 4B2BA 1TOCB 1DANH 1MAYA 4K69A 4SGBE 1O2IA 4WMFA 1EOLA 2FESH 5L30H 2CV3A 3ZVCA 4IC6A 5TJXA 1O35A 1QA0A 1S0QA 2D1JA 2THFB 4HTCH 2G55A 1PFXC 4TPIZ 6GCHF 1TX7A 1D6WA 7GCHF 1O2WA 1P2QA 1P2KA 1S83A 2QF3A 1S6FA 2ZCKP 1A1RA 3N7OA 2BZ6H 2ZA5A 5HMAA 1C5MD 3BTEE 3UTUH 2P16A 1NU9A 2F9NA 3PTNA 3VEQB 2OLGA 3T2NA 3CNRA 1LCYA 2FI3E 3C1KA 1J14A 3FZDA 1O33A 1G30B 3SJ8A 2QN5T 1F5RA 3FFGA 3MH5A 4ABAA 3OYPA 3OSYA 1NU7B 2C8WB 1L1GA 1QNJA 2PHBA 2RFKC 2WPLS 2J38A 1C5LH 3MTYA 1CBWC 4NFFA 1ZHMA 4GLYA 2P3TB 3RU4T 3MWIU 3PV5A 3A7WA 1IQKA 2O8MA 5HIYA 1O5BB 3FANA 3BEUA 4U2WA 1BQYA 3RC5A 4KP0A 3KL6A 1D3QB 2OD3B 1LVMA 3GYLB 4B75A 3CENA 5AF9H 4NA8A 1N8OC 2IJOB 3LJOA 2UUFB 1H1BA 2OQUA 1SLWB 3SJOA 4X6PA 5EU8A 1AWFH 4X6OA 1SGYE 1O2ZA 3BTDE 3KYFA 2FOBA 4XFQA 3AAVA 3A84A 1O5CB 2PKSC 5CHBA 2BD2A 3DFLA 4AGKA 1O2GH 1ZR0A 2FTMA 2BMGB 2D8WA 1C1RA 4ABGA 1AFQB 1O3MA 4BAQB 1QRWA 2Y5FA 3KEEA 5LPRA 2FOAA 4BNRA 1P3CA 3D49H 2FIRH 4CRGA 1GMDG 1YKTA 4YZUA 1TX8A 1O3OA 1P3EA 1S81A 2H9TH 3RXQA 3A87A 1V2WT 2ZHQH 3MH6A 4RN6A 3W95A 1JOUB 1RIWB 1ABIH 5C20A 4NIVA 4DW2U 1Z6JH 1O5AB 2FLRH 2AMQA 3RC6A 4NGAH 2XRCA 1GDNA 5T1VA 4YT7H 1KXBA 1C1MA 1EOJA 3MO9A 2KX4A 1E35B 2Z3DA 3K65B 1MCVA 5T3HA 4XDEA 2AMPA 1MKWH 3OEHD 3V3MA 2ZKSA 3EDXB 1WV7H 5DP4A 1SGFG 1TGNA 1MTWA 2BLVA 3TVJB 3ZVFA 2PKAA 1XVOA 1GMHG 1KMHB 3Q76A 1YPMH 1AE5A 1C2HA 2PKAB 1TGCA 1MQ6A 1GI7B 1SLUB 1V2QT 4XE4A 3OU0A 1GVKB 1LMWB 1GCTC 2GMTB 1OWHA 2XBWA 1GI8B 3ATLA 3MMGA 3SORA 4AN7A 2PUQH 1SGFA 2F4LA 2W7UA 4FUCA 5DPAA 2EEKA 4F55A 1C1UH 3LGYA 1P01A 4YLUA 2VWMA 2J34A 1DX5M 1ZSJA 1NM6A 1GJ4H 1UHBA 3QZQA 3BTKE 1ZTKA 3F2FA 3GDVA 1UHBB 2ZFSA 4UE7H 1PPHE 2ZP0H 4Q4LA 3ZV9A 2SGEE 4FUFA 1W3CA 1MKXK 2XNDD 7LPRA 3H09A 1W13U 4ZROA 1FLEE 3PMAB 1K1LA 1RFNA 1D3TB 4BOHA 2J97A 2AYWA 3MO3A 2L6OA 2YNAA 3LIWA 3Q3XA 4KGAA 3SJIA 3KF2A 2RCEA 4DY7B 4DVAU 1HAYB 1HBTH 2ANYA 5HYOA 3U8RH 2AGEX 2XC0A 2BY9X 1ESTA 1AVXA 1D6RA 2KZ4A 2F83A 5DP5A 2GZ8A 1O2YA 1IQMA 5F8TA 2BDCA 1HB0B 2WZQA 1C4U2 1SGNE 2F9VA 3PV4A 4B2CA 4MPXA 1ESAA 1THSH 3H5CB 1HYLA 1UTKA 2BTCE 1SVPA 1GI9B 3ZVGA 1ZZZA 1E0FD 3E0NB 1ETRH 1FIWA 2GT7A 4IGDA 1XMNB 1C5UA 2BX3A 3LU9B 3F6UH 1BJVA 1SFQB 1N1LA 5EXMA 1GHBG 2EC9H 2SNWA 1SGCA 2ZGXH 1GBDA 2BYAX 2V35A 1N8OB 1FY1A 2G5NA 1NRNH 2W3KA 1XKAC 4YOIA 4NSVA 1E34B 1ZLRA 4JCNA 2OXSA 3RM0H 4YO9A 1F0UA 2EI6A 1GWAA 1SPJA 2GT8A 2PKSB 4F49A 1TMUH 4Q7XA 2QC2A 4TWYA 1DOJA 2BVXH 2V7QD 2ZPQA 1F7ZA 1P11E 3ZZ5A 1LTOA 4X8VH 4IN2A 1E1QD 1GBCA 1TALA 4DT7B 5FCRA 3E1XB 1UVPA 1MQ5A 2VGCB 1F5KU 3QGJA 1YY3A 4Y11E 1Y3VA 4IN1A 1AZ8A 2K0QA 1BMAA 3A7ZA 2QYIA 2PV9B 4Q7ZA 1EPTC 1AE8H 1ZJDA 3PRDA 3BG4B 1DVAH 4UD9H 3RXAA 1AZZA 2VB0A 1O3FA 1YC0A 1V2RT 2O8LA 2FYQA 2C4FH 3GY4A 1ELCA 1PPEE 2HLCA 1BRBE 2QCYA 1T8MA 1KYNA 2RDLA 3M3VA 3FN8A 3PLPA 4NFEA 4IW4E 3ODDA 1BCUH 2ULLA 1IQFA 1TNIA 4AOQA 1V2LT 2AERH 1TFXA 3A7XA 5EPYA 2CXVA 3OY5U 4TYDA 2OC7A 2GTBA 2PW8H 1Y3XA 4ISIH 1NN6A 1W0KD 1DPOA 1EB1H 1Z8IB 1GCTB 5BRRE 4BAMB 3BIUH 3SGBE 4DCDA 3IITA 3LH3A 2J92A 1A7SA 1BMFD 5DGJA 2PSYA 3QZRA 1P03A 1NFXA 1C1WH 2YMSC 1GI4A 1P06A 1G2MA 1PQAA 2L74A 3A83A 2RDEA 1EQ9A 1C5YB 3MNBA 2ESTE 3MH7A 2AH4X 1PQ5A 5FPYA 1GJ8B 1TGSZ 4X0WU 1G37A 4DG4A 3O8BA 2ZHFH 4GPGA 1VCWA 4WY3A 1FPCH 1SR5C 1EZSC 3P17H 2XW9A 5IK2D 3KQCA 4I8KA 1L1JA 2XYAA 4NIYA 4D9QA 1LPGB 2W5EA 5JPMH 3QUMP 1QTFA 4WXVA 3EYDA 1C2KA 4Y79A 4ABIA 1J15A 4FU8A 5DJ7A 2ZU1A 4IMQA 1ETTH 3MO6A 3RXUA 1K0HA 1DWDH 1Q3XA 3HK3B 4GAWA 3AVZA 1H8DH 3LGTA 1ORFA 2OTVA 3VG8A 1W0YH 2FP7B 1S6HA 3U8OH 3FP7E 3ZVEA 1O2NA 2FOMB 1KY9A 4U01A 1U6QA 1TNGA 4ZKNU 2D26C 3DCLA 5AHGH 1MBQA 1LQDB 3RXHA 3ZYEA 4I32A 4CREA 4TPYA 2XNIA 3SW2B 1GJDB 3MHWU 4AGJA 5FPSA 2J94A 1NRQH 1TNKA 1NBMD 2P3UB 5JBCS 1SBWA 2OBQA 2ANKH 4NA7A 1JIMA 2DE8A 3B8JA 2QA9E 1HJ9A 3RXPA 5JBAS 5LPFA 1ZOMA 3LT3A 2BQ6B 2A31A 4O97A 1ZHRA 1J16A 1MMJN 4RT1A 3UQVA 2CHAC 1T7CA 2QXIA 3B9FH 4FUIA 4ZXXH 1CHOG 3S69A 4FUHA 4I33A 1GBJA 4X8SH 1GHAF 3SV8A 1HAVA 2VVUA 4MVNA 3RMMH 2BHGA 1W10U 3P6ZB 1YGCH 1EPTA 4Z0KA 1C2GA 4K5ZA 4K8YA 3S7KB 1C5OH 4Y0ZE 3E3TA 5EXLA 3S9BA 1H9HE 2FYRA 3PO1B 1BTUA 1XM1A 4X2YA 5PTPA 1DM4B 5EG4A 1H9IE 1FY5A 2BDBA 2SGAA 4UONA 3SU6A 3Q3KA 1OKXA 4JZIA 1JBUH 3VB7A 1TNJA 3TNSA 1C5XB 1LVYA 1WTGH 1BT7A 1HAIH 1BITA 5A09A 1WQVH 3O8DA 4ZKOU 1DUAA 3EAJA 3ZZ4A 1GPZA 1UVOA 1GL0E 1C9PA 1GDQA 4INHA 1NTPA 3OFND 4Z6AH 2VJ1A 2TRMA 1VGCC 2WV4A 4AFUA 3F9FA 1IQLA 1TX6A 4KTUA 1FNIA 1GG6C 3A8CA 3P70B 3SBKA 4MQAA 3E8LA 8LPRA 3TNTA 4WJG2 5A8ZA 4M9FA 1KXDA 1O38A 1FI8A 3BTME 1GBMA 2IOTA 2GV6A 2XWBI 4Y0YE 1C5RA 1VITG 2YMSB 1Y8TA 2R3UA 4KTSA 2GKVE 3SU3A 8KME2 1YPHC 3D23A 2NU3E 2OUAA 1NY22 3NK8A 4U32A 1C4Y2 1O2UA 3A81A 1P0SH 1LKBA 1UK3A 2VIOA 3E91A 1O2TA 2ZHDA 3F0OA 4UFFH 5EGMA 3TJNA 1V3XA 1GJAB 4JZ1A 2TGTA 3A82A 2GX4A 1WBGB 2GCTC 1GCDA 1UCYK 1O2JA 2O8UA 1VZQH 2F9PA 3E16B 3ESTA 1HXEH 2ODQA 4DJZB 1K1NA 5A0CA 1BZXE 4QT8C 3U28C 1LVOA 3A88A 2FS8A 1ZGIA 1TQ7B 1NPMA 4ABEA 2ZHEH 2VVVA 1Z7KA 3GY2A 3QDZB 3HGNA 1F92A 3TITA 4FXGH 3EE0B 2RA0A 3I29A 4M7GA 4TT3D 1GGDC 5GCHF 4U30A 3WWBA 1C5SA 1PPCE 4A7IB 3PTBA 3TGJE 1W14U 1AGJA 1ZPZA 5IYTA 4LZ1H 3DSOA 3RC4A 1EZUC 1N6YA 1O2XA 4JZDH 2OBOA 2ZG0H 3U1IB 3QGNB 1SGEE 1ZTJA 1K9OE 1OWIA 1Q31A 3GISB 2VWOA 1DY9A 1L4ZA 5T6DA 4BAHB 1C2EA 1YCPK 1GJ6A 4D7GA 1DSUA 1K22H 3LGWA 1SMFE 2QF4A 4O9VA 3SI4H 1O5EH 1HPGA 1DWEH 1MKXH 1TGTA 4NSYA 4CR5A 2NU0E 1GHYH 1GBKA 1FMGA 2R0LA 3ZVBA 1O5DH 1SOTA 3UNRA 2C8YB 2H6MA 4HG6A 2CHAB 2W6JD 2WUCA 3LH1A 1AB9C 1D4PB 4YTAA 5EXNA 3P95A 3BTGE 2G81E 2ZU2A 4F4OC 3ENSB 4ASUD 1IOEA 2A1DB 5L6NH 3SI3H 5ABWA 1WXRA 2STBE 3MU5A 1MU6B 1GBBA 1W7GH 2IPQX 1LHCH 2TBSA 4WVPE 5A8YA 5C0TA 3CS0A 1V2PT 2HNTF 3LC5A 4Q7YA 3GCTF 1GMCG 1BMMH 1LHGH 2G8TA 1BTHH 1TB6H 1P57B 3NRLA 4GCHG 1UVUH 2FI5E 4AB9A 4ABHA 2BQ7B 2YMSD 2ODPA 2AMDA 5FHTA 2G52A 5FBIA 3LJJA 4FUGA 2IN2A 4I8GA 2YOLA 3SGQE 1O3EA 2GCHF 1SSXA 1C1PA 2ZNKH 5AFZH 1VGCB 2R9PA 1CQQA 2FXRA 5GXPA 2A7HA 1GG6B 1K1IA 3SU1A 1HJAB 1E1RD 1OWJA 3RXRA 2GZ7A 3MU0A 3PLBA 2FDAA 2EI7A 1ZTLA 5EOKA 3M35A 2ZU4A 1TWXB 1GHWH 2P93A 1C2DA 2UWPA 4TSFD 3PWCA 3FVFB 3TGKE 5DP9A 1K28D 4JYUH 1G3DA 2OCVB 4MPUA 1O3HA 3PM3A 3BG8A 2OK5A 4FUDA 3GCHC 3GY8A 3AK5A 1V2UT 1P2NA 2JJ2D 3STJA 4A1XA 2P95A 5KEDA 2VINA 3UFAA 1A0JA 1O39A 2QIQA 3MYWA 5ESBA 4FU7A 1CGJE 1BOQA 1FY4A 4MNXA 5JB8S 3BTFE 1NROH 1A5GH 2FODA 4HI3A 1C4V2 1TAWA 4A1TA 4E06H 2ZTYA 1DSTA 1MTUA 2KR7A 1SQRA 3S9AA 4JMYA 3NKKA 1Q2WA 4AX9H 1GVZA 4WMEA 3UB0A 4ZH8A 1L4DA 1V2TT 3RXCA 2UWLA 3BTTE 5EW2H 3DFJA 1DWCH 3M3SA 1HIAA 1Y3WA 2FI4E 4B6FA 2SGFE 1PQ7A 2OQ5A 1SHHB 3ELAH 1KXAA 1GGDB 1O5GH 3LGUA 1QCPA 3SUFA 1AO5A 1BBRK 2BM2A 3SU4A 2QXHA 3SV6A 3A80A 3VPKA 1NRRH 4SGAE 2FS9A 3A89A 3URDA 3URCA 4K3JA 5GNDA 5EJLA 3LGIA 2G00A 1V2OT 1KLIH 4TY6A 2LP6A 2BOKA 1P9SA 3OAAD 2ZPRA 2ZF0H 1PPGE 3I78A 3RXLA 4H42U 2BDYA 2I6SA 9LPRA 3ZZCA 1EXFA 3GICB 1SLVB 1Y3UA 1WCZA 5H4IB 8ESTE 2YNBA 3BIVH 3EE7A 4CH8B 1WOFA 3HK6B 3V13A 1QBNA 3DSPA 4OS1A 1HNEE 4JYTA 3UOUA 3STIA 1B5GH 1FAKH 1TRMA 2Z9GA 4NG9H 3ZZ6A 1C2FA 1D3PB 3SQEE 2A5KA 1O2VA 4DURA 1GBEA 2OINA 3UUZA 1AB9B 3N99A 3S9CA 1G32B 1EX3A 2QY0B 1QIXB 3SHCH 3JZ2B 1OXGA 4RSPA 4ZUHA 1UW7A 3D65E 3TIUA 5A2MH 1JMOH 1FXYA 1GJ9B 1J8AA 1MU8B 1H4WA 3A86A 1AIXH 1HAZB 2B0FA 3M5MA 3ZV8A 3GY5A 2A4OA 5DKMA 1CO7E 3M7TA 3AAUA 2Z9LA 8GCHF 1AU8A 2VNTA 3VB6A 5EJ1A 4CRAA 1XXFA 1BHXB 2W26A 4OS5A 3A7YA 1UMAH 4BANB 1UK4A 2FTLE 1P09A 1C2JA 3DD2H 3OX7U 4K1SA 3V12A 4CRBA 1P05A 4I31A 4INLA 1BB0B 4H6TA 4CHAC 2R2WU 2PUXB 3RXSA 1FJSA 1MBMA 1GI0A 3GDSA 1YPHE 2FWWA 2BD9A 3M5OA 4I86A 1SGDE 2FM2A 2HRVA 5JB9S 2XC5A 2Q6GA 1FONA 1V2KT 2J2UA 6ESTA 1W11U 1TNHA 2ZDAH 1EASA 1G3EA 1CBWB 4IC5A 2CN0H 3W94A 1CE5A 2KAIA 4JK6A 4P00A 2Q6FA 3GYMA 4HZHA 4WH8A 1CT2E 4NZLA 1BBRE 2JDID 3ODFA 2KAIB 1XVMA 5KECA 1S6LA 4CBOA 2FLBH 1FIZA 2Z3CA 4FUJA 1WYKA 2W6ID 1Z6EA 4OM9A 1C5VA 4D7FA 3PMJA 1RS0A 1O3IA 5E2OA 4D76A 1FY8E 1P02A 3EA9A 1SGRE 3ZZ7A 1ELBA 2GZ9A 4XRNA 1NRSH 1DWBH 2PGBB 1L2EA 3LONA 1KXEA 4CRFA 2ZFPH 2HVXA 2BDIA 2B7DH 1NFWA 2AEIH 3NXPA 4B73A 2CMYA 2Z6BD 1V2VT 2VWLA 1RRKA 4OS7A 4BXSA 4ZKRU 3UWJH 1AKSA 3ZZAA 2JIZD 1JRTA 1F0TA 1WSSH 1CGHA 3E90B 1AKSB 2V3OH 1GHVH 2ZECA 3MI4A 4I7YH 1KTSB 1O3BA 1RTKA 3KQ5A 2FOHA 2GD4B 3KYGA 3M7UA 4B71A 3EQ0H 5C1UA 1LHDH 1T4UH 3OE7D 1O3GA 1IQIA 2QXJA 1J17T 1E38B 1C1TA 1QB9A 5DSFA 3D62A 1K21H 3F9EA 4ACBA 2BY7X 4ACAA 1YYY1 2ZFRH 1HGTH 1QR3E 3SJKA 4YLQH 1D9IA 4ZXYH 2ZU3A 1E79D 1FAXA 1EAWA 2Z9KA 4ASHA 1EFRD 1A0HB 3F9HA 3ZZ3A 4X2WA 2ZCLP 1UCYH 1T8LA 1O3DA 2NU2E 4CBNA 4AFQA 1O3CA 2W3IA 2TGAA 1YP9A 5FX6A 3S0NA 2BY8X 3KNXA 2A5AA 2A7CA 3SV9A 5C1XA 2ZQ1A 3KN2A 1SGQE 1UTLM 1Y5UT 1V2NT 1FX0B 1BMLA 1O3JA 3AASA 4R0IA 3Q77A 3TJOA 1JIRA 1YPLH 5FX5A 2F9BH 3ATMA 2KCOA 2A4QA 5GCHG 2AIQA 2UUKB 1GMDF 1BIOA 1NFUA 1TA6A 4TWWA 3SUEA 2VIWA 2O9QA 1VITH 3PLKA 1YLNA 1ZMJA 1EKBB 1TE0A 2PTCE 4PROA 1ANDA 2PGQB 1O2SA 3UY9A 1FY3A 1OWEA 1O2HA 5FCKA 3QLPH 1AD8H 1K1PA 1ELVA 3H7OA 3ZIAD 3BV9B 2XCFA 1AUTC 4X1RU 1YCPH 2G51A 4CHAB 2H9EH 1S82A 3A7TA 1A5IA 1D3DB 2FEQH 1UJ1A 3FAOA 2EY4C 4F48B 3DSGA 2ZDVH 4XBBA 2A2QH 1DDJA 1GMHF 1SFIA 3KQDA 1GI3A 1OP2A 3BSQA 1GI6A 1MTVA 3KIDU 1P2OA 1MTNC 3SO3A 4MG3A 2H1UA 2WYGA 1HAHH 1MABB 3MH4A 1OYQA 3RP2A 3MU1A 2K8IA 2V0BA 2QF0A 5FBEA 4VGCC 4MNVA 1ZSLA 2C8XB 3BTHE 3QN7A 3SHAH 4CRDA 1JRSA 1S5SA 4XBCA 2ZQ2A 1ELAA 2JKHA 4AYVB 1SL3A 1KXCA 3K2UA 4O03A 6GCHG 4ZMAH 1HAGE 7GCHG 5G4BA 5HXFA 1WDIA 2BVSH 2C3SA 3SNCA 1TONA 2F9OA 2HPPH 1L0ZA 3RUOA 1W0JD 3HATH 3OEED 1PPFE 3VXFH 4AC9A 5C67A 1P2MA 2AS9A 2SGPE 3CS7A 2CF8H 1DT2A 4WMDA 4FVBA 1EAIA 2GJGA 1V6DA 4ISOA 1HLTH 4Y6DA 2SGDE 1HAVB 3RU4D 4BTIB 1UTNA 5F53A 3UWIA 4MPVA 1ELDE 2C93B 1IAUA 1RGQA 3FO8D 4X1PU 1EPTB 1SB1H 4RI0A 5F8XA 3UR9A 4DIHH 4AYYB 4MDSA 4AFSA 3LKWA 3N7EA 3GS9A 9ESTA 3P92A 3TJVA 3ZZ8A 4Y7AA 4ABBA 1SQAA 3IWMA 2O8TA 2STAE 3KQBA 2FX6A 1PYTC 3RU4E 1VCPA 1C5QA 1ANBA 2HVYB 2BB4A 1MZAA 1T8OA 4YESB 1AVGH 4FVDA 2XWAA 1QFKH 2JH6D 1TA2A 4ISHH 3NUMA 1O36A 5CMXH 1UVTH 1G36A 1DITH 3ZVDA 4B74A 1CGIE 5DG6A 4FETA 3UNSA 2J5UA 1EAUA 4CR9A 1IHSH 2WUBA 1HDTH 3F68H 1VR1H 1XUJA 2K1QA 3TGIE 1NC6A 1AFEH 1EP6A 1QRZA 3ATWA 4Y8YA 3ZZDA 1ANEA 1SG8B 5K7RA 2WPDD 4JZFH 1KIGH 1GI1A 1NZQH 3F3BA 1AMHA 1WUNH 2GVFA 1TBZH 1BBRH 3RXOA 2XOKD 2F3CE 1TNLA 3WY8A 3MU4A 1OP8A 1O3NA 2WINI 4MNWA 3RXVA 1CU1A 4O3UA 1TBRH 2KCYA 1GI5A 2OC0A 3UREA 2FMJA 1O31A 2H5DA 1JWTA 2XBXA 1NESE 3RXFA 2Y5HA 5JDUB 4UFDH 1E36B 1OPHB 2NWNA 1QRXA 3AW0A 1YF4A 5E2PA 2WV9A 1CVWH 3GOVB 5GWZA 3ZZBA 2G4UA 4UEHH 5E8EH 1CHGA 1P04A 2GP9B 1O32A 3UNQA 3PB1E 4DIIH 1C2LA 5A8XA 1Y3YA 3K6YA 3QTVH 4YXWD 4B1TA 1IQHA 1TMTH 4ABFA 1EJMA 1KXFA 1W12U 1ZRBA 3M36A 1A61H 1O2KA 4BTUB 1G2LA 4GUXA 1G3BA 1TABE 1XUIA 1XUGA 1MTNB 4Y7BA 3QWCH 3U8TH 3L6PA 4OS2A 4LZ4B 1XUKA 1ZSKA 2V3MA 2LNCA 1CSOE 5EQRA 1G9IE 3ATKA 4VGCB 2EI8A 2M2AA 2GV7A 6CHAC 3SYJA 1HFDA 2QE7D 8GCHG 2P59A 1GJ5H 1S85A 2BX4A 3VGCC 2ZTXA 1SOZA 1GVLA 2UWOA 7ESTE 3KGPA 1P8VC 1OP0A 1K1MA 4WF8A 5JYIA 3NCLA 4Y8ZA 4ABDA 4WH6A 5DP8A 2VIDA 1C1QA 1C2MA 4BTTB 3TK6A 5K0HA 5DK1A 4FOUC 1HAPH 1QQUA 1C1VH 2XXLA 1K1JA 1INCA 5I46H 1TRNA 3A85A 2J98A 2AGGX 4P02A 3KCGH 3LDXH 5CHAC 3BF6H 5LPEA 4YOGA 1TLDA 1OWDA 1UTJA 2J98B 1ELGA 1W8BH 3RMNH 1YPKH 1LDTT 1SI5H 3RXTA 4YM9A 2AIPA 1BDAA 2NU1E 1PQ8A 4UFEH 1EZXC 3UQOA 3WWFA 5FPTA 3SNEA 2PSXA 3T5FH 2CGAA 1AQ7A 1M9UA 1F2SE 1YPGH 3VXEH 3SNBA 4AG1A 4RT0A 1A46H 2GMTC 4H4FA 2P94A 3SZEA 2VH0A 1GBAA 1B0EA 3BTQE 3UIRA 4YT6H 1F0SA 3V7TA 4ESTE 2VVCA 3G01A 1ZHPA 1EJAA 3O8RA 1UCYE 1GI2A 4Q2KA 2OC1A 1ZRKA 2GGVB 2HOBA 3ZYDA 2Y82A 4BXWA 4H6SB 1NRPH 1O2OA 1XX9A 3SV7A 2ZU5A 3TK9A 1ZMLA 1SGPE 2QF5A 2ZDNA 2ZFTA 4MLFB 1Z8RA 1OX1A 1ZPBA 2HALA 3AW1A 1C5ZB 1ACBE 2O8WA 5EIYA 1CHOF 2ANWA 1FZZA 1AWHB 3U69H 2A4RA 1X7AC 1KDQA 1IQGA 1Y5AT 3B23B 3SU0A 2ZDLA 2QGRA 2JJ1D 3V0XA 2Z7FE 1KDQB 2D2DA 5LGOA 2F91A 1O3PB 4OS6A 2JH0D 1S0RA 3ATIA 1FN6A 1Z8JB 1QJ7B 3PYHA 3RLYH 1MH0A 2Z9JA 3Q3YA 3NPSA 2GDDA 5ETXA 5FL7D 3RDZA 5L2ZH 1V2JT 1GBFA 2F9UA 3RXJA 2GCTB 1EUFA 2PFEA 4JYVH 4TY7A 3EA8A 4THNH 2BLWA 1AI8H 3BEIB 3LOXA 1EP5A 1SLXB 3K6ZA 4KELA 1COWD 1P9UA 1XUFA 2XC4A 1GBLA 1C1NA 4E7RG 2WV5A 1HUTH 3RXIA 1E37B 4IMZA 4YOJA 1UTMA 1DS2E 1F5LA 3BN9A 5DO4H 1ELFA 3SGAE 1HIAB 2VBCA 1BRAA 3SZNA 2CJIA 1T8NA 2ILNA 1ZMNA 5F6MA 5EW1H 1XXDA 3SNAA 1ESBA 1GHXH 2VH6A 4OGXA 2Y6TA 1QL7A 3OY6U 2TGDA 1VITF 1B7XB 3MNXA 1RTFB 1O34A 2IJD1 3U98H 2A0QB 6CHAB 1LKAA 1DFPA 1NO9H 1IQJA 2ZTZA 1CA8B 1MAXA 3VGCB 2LPRA 2WHXA 3RXEA 4IBLH 1IQEA 1ABJH 2VGCC 1QL8A 2JETC 4X1NU 2ZC9H 4JZEH 1CT4E 2A32A 2ZFQH 1YLDA 3VFEA 2PLXA 4GHTA 5F03A 2WYJA 1TMBH 1PYTD 1TBQH 3BG4C 3W1EA 2XCNA 1GBHA 1P10A 3M61U 3PMBB 1G3CA 2VU8E 1A4WH 5CHAB 3QO6A 3UPEA 2AGIX 1QB6A 2VIQA 1A3EH 3TLOA 1NT1A 3R0FA 4FU9A 5C5OA 1SQTA 3DT0H 3PMHB 4IS5A 3MU8A 4A1VA 4BAOB 2CK3D 1BTYA 2FX4A 4FUEA 5L2YH 1MD7A 1TPOA 3VB4A 3H7TA 2BY6X 3MFJA 4NCYA 5SGAE 2WPJS 1DICA 2Y7ZA 2ZCHP 1P2IA 2WPHS 4J1YA 2PTNA 3A8DA 1QL9A 3VB3A 2H2ZA 1DLKB 1C9TA 3T29A 4NIWA 4B76A 2M5TA 2V6NA 2WPIS 3F1SB 1LQEA 1UK2A 5GJ4B 3K9XB 6LPRA 3DHKH 5DP3A 5I25A 1BTXA 3WW7A 4KKDA 3MQKC 3KHVA 5F8ZA 2JH5D 4UDWH 3FP6E 4RKOB 1UTOA 1L1NA 3T28A 1AVWA 1OOKB 4NA9H 2BD4A 2BLOA 1Z1IA 1F0RA 2HWLB 3M37A 3RXMA 1WTHD 3GDUA 4GSOA 4AG2A 1ZJKA 2Y5GA 3CP7A 3LGVA 1EZQA 1W2KH 3T27A 2C8ZB 2Y81A 2Z3EA 4X1QU 3GCHB 1GHAG 3VB5A 2VWNA 3TK5A 3BTWE 5C17A 1FDPA 3LC3A 1GMCF 1GHZA 1IQNA 1HJ8A 1B0FA 3L3TA 2EA3A 3SV2H 4GCHF 1H8IH 2FO9A 2LELA 2WPKS 3SU5A 1V2MT 3M5LA 5DN6D 1QHRB 1WAYB 2TIOA 1OS8A 1FV9A 1NS3A
chains in the Genus database with same CATH topology
2DE9A 3NZIA 2A4GA 1SGTA 1W0ZU 4X6NA 2BXTH 3L33A 3ZVAA 4ZHLU 1KLJH 2XBYA 1PJPA 1MTSA 1CT0E 1Z1JA 4Y10E 1C5WB 1P12E 3Q00A 3R3GB 2Z94A 1Z71A 1RXPA 1GJ7B 5ESTE 2VIPA 2HNTC 1TPPA 1GL1A 1T32A 2TGPZ 2ZDKA 2P8OC 2WPMS 4I8HA 1O2LA 1LPKB 5JBBS 4AORA 1TQ0B 1QY6A 2BLQA 2BDAA 2PWXA 2ZGBH 2SGQE 5DP7A 1ZPCA 2UUJB 3A7VA 1HAXB 1YBWA 1BTPA 4UFGH 2H9HA 4DGJA 1BMNH 2FOEA 1MD8A 1C5PA 4Y76A 3QK1A 1DXPA 1HXFH 1SC8U 5GDSH 2OC8A 2JETB 1LHFH 3SN8A 2ALVA 1GDUA 2ZEBA 2FOCA 1UO6A 1Z8GA 4I8LA 1SHYA 1QGFA 3PO1C 3T25A 1ARCA 2Q6DA 1O2PA 4XBDA 3NWUA 3M5NA 4Q80A 5TCCA 1AN1E 1FUJA 4XSKU 3SUGA 1FN8A 3TH2H 3GY6A 2FOGA 4XOJA 5JBTA 2BOHB 4X1SU 2G4TA 1N6XA 1DXWA 1WU1A 1GJBB 5J4QA 2BVRH 1O37A 1QA7A 1GBTA 3SNDA 2R0KA 1THPB 3SJ9A 5E0GA 1TGBA 2ASUB 1MCTA 1CA0C 1GBIA 4O3TA 5A0BA 1PPBH 2ANMH 4X2XA 2SNVA 3O8CA 2P3FH 4X8UH 2J9NA 1EB2A 1LO6A 3RMLH 3TJUA 1YCPM 3RXGA 4R8TB 4CRCA 3SUDA 2QV1A 3M3TA 1FQ3A 2BDHA 5J4SA 4X8TH 1TRYA 1O3LA 4KTCA 1QBVH 1SQOA 1C2IA 3A8BA 1S84A 3EGKH 5A0AE 1YM0A 4INKA 4X6MA 1LPZB 1T4VH 2B9LA 1MKWK 4LOYH 1BHXF 4ZAEA 4ZHAA 3FZZA 5C1YA 5B6OA 1QJ1B 2A2XH 5TCAA 4AFZA 2OP9A 3HKIB 1RTLA 1H9LB 2ZGCA 4WXIA 1TOMH 1W7XH 4HGCA 4K60A 3PROA 2A5IA 1O3KA 4ABJA 1C1SA 5EQSA 2FOFA 4ZKSU 4GHQA 2Q1JA 2ZDMA 2B5TB 3UR6A 1BTWA 2R2MB 2FPZA 1K2I1 2NU4E 2BDGA 4RKJB 1BRCE 2J4IA 3GCTG 1MZDA 1XUHA 3SOSA 4NIXA 2A45B 1ZYOA 1QQ4A 2BQWB 1A5HA 4AB8A 1V2ST 4A92A 5FXLA 1O2RA 1THRH 3U1JB 1VCQA 2R3YA 3A8AA 1RD3B 5GPIB 2RG3A 2Y80A 1LVBA 2RA3A 4NZQA 2ZI2H 1GJCB 5C2ZA 4AZ2B 4MNYA 2AFQB 1HCGA 1BJUA 4K1TA 5C3NA 1UTPA 1BRUP 1AHTH 2I6QA 4NWLA 4MPWA 5LH8A 2GCHG 2P8OB 3P8OA 1QB1A 2ODYB 4ZHMU 1QBOA 3HGPA 5EQQA 1K1OA 1VJ9U 1WQSA 1A0LA 5BPEA 3QX5H 3HKJB 1BTZA 2DUCA 4ISLA 2BZAA 5FAHA 1A2CH 3T26A 4DOQA 3EA7A 4GVUA 4D9RA 1DE7H 1ID5H 3KQEA 3ITIA 2ZO3H 2HPQH 2BD8A 2UUYA 3HPTB 4Y71A 5T6FA 1GHBF 5DP6A 2GDEH 4BAKB 1EJNA 2CF9H 3JZ1B 1J9CH 2IPHA 1O3AA 3TH3H 2PR3A 1AY6H 3SQHE 1KTTB 2VIVA 3RXBA 4I8JA 1OYTH 4CH2B 1ZGVA 1QJ6B 1DY8A 7KMEH 2FZZA 2ZFFH 2Z9IA 1C1OA 1TPSA 1ELEE 1TYNA 1ELTA 4ISNA 3RXKA 1C5TA 3TH4H 1PPZA 4HFPB 1O2MA 3T62A 3TPIZ 4K8BA 1ARBA 3E6PH 5HM9A 1YPJH 1LHEH 2BY5X 3P8GA 4B2AA 3E0PB 1IHTH 5EPNA 1UTQA 1CA0B 3C27B 4E05H 3SU2A 2BD5A 1HAOH 1HJAC 3S7HB 5C5NA 3P8FA 1ETSH 1ANCA 1JXPA 3P8NA 3GCNA 5HGGA 1HV7A 2ZZUH 1BA8B 2QXGA 3UOPA 3M7QA 5HM2A 2QAAA 1QURH 1NFYA 1O0DH 1O30A 3I77A 3IG6B 5AVDA 3GY3A 3DA9B 5GIBA 1VJAU 5IDKA 4MTBA 1MUEB 5EODA 2V3HH 2H5CA 4J2YB 1O5FH 1EAXA 1FPHH 2ZGJA 1OSSA 3DUXH 1AUJA 3MOCA 4K1EA 4K2YA 2ZPSA 2ZHWH 1DLEA 2BXUH 2ZGHA 1YPEH 1OWKA 1BUIA 2C90B 4E7NA 4OGYA 2TPIZ 4NWKA 3PWBA 2XTTB 3RXDA 1XKBC 1C5NH 1AFQC 4A6LA 3RM2H 3QTOH 2SFAA 4D8NA 3MNCA 1EATA 5CE1A 3RMOH 4OS4A 4A5TS 1KSNA 3GCOA 1TPAE 2HNTE 5AFYH 3OTJE 3RLWH 4LXBH 2BD7A 1UVSH 2B8OH 1Y5BT 2J95A 3MNSA 2ALPA 2Y7XA 1RIWC 3BEFB 3FP8E 4Y8XA 3U9AH 2ZWLH 3ZZ9A 2G5VA 2HGTH 3TU7H 1DUEA 1Y59T 1RJXB 2W7SA 1KLTA 4LK4A 2XBVA 4FUBA 1A3BH 1HRTH 3GY7A 2ZIQH 1SGIB 1P2JA 5E0HA 4X2VA 4WWYA 1TIOA 1YLCA 3F9GA 1O2QA 1T31A 4JK5A 3LPRA 2BD3A 5E0JA 2A7JA 5T6GA 4B2BA 1TOCB 1DANH 1MAYA 4K69A 4SGBE 1O2IA 4WMFA 1EOLA 2FESH 5L30H 2CV3A 3ZVCA 4IC6A 5TJXA 1O35A 1QA0A 1S0QA 2D1JA 2THFB 4HTCH 2G55A 1PFXC 4TPIZ 6GCHF 1TX7A 1D6WA 7GCHF 1O2WA 1P2QA 1P2KA 1S83A 2QF3A 1S6FA 2ZCKP 1A1RA 3N7OA 2BZ6H 2ZA5A 5HMAA 1C5MD 3BTEE 3UTUH 2P16A 1NU9A 2F9NA 3PTNA 3VEQB 2OLGA 3T2NA 1LCYA 2FI3E 3C1KA 1J14A 3FZDA 1O33A 1G30B 3SJ8A 2QN5T 1F5RA 3FFGA 3MH5A 4ABAA 3OYPA 3OSYA 1NU7B 2C8WB 1L1GA 1QNJA 2PHBA 2WPLS 2J38A 1C5LH 3MTYA 1CBWC 4NFFA 1ZHMA 4GLYA 2P3TB 3RU4T 3MWIU 3A7WA 1IQKA 2O8MA 1O5BB 3FANA 3BEUA 4U2WA 1BQYA 3RC5A 4KP0A 3KL6A 1D3QB 2OD3B 1LVMA 3GYLB 4B75A 3CENA 5AF9H 4NA8A 1N8OC 2IJOB 3LJOA 2UUFB 1H1BA 2OQUA 1SLWB 3SJOA 4X6PA 5EU8A 1AWFH 4X6OA 1SGYE 1O2ZA 3BTDE 2FOBA 4XFQA 3AAVA 3A84A 1O5CB 2PKSC 2BD2A 3DFLA 4AGKA 1O2GH 1ZR0A 2FTMA 2BMGB 2D8WA 1C1RA 4ABGA 1AFQB 1O3MA 4BAQB 1QRWA 2Y5FA 3KEEA 5LPRA 2FOAA 4BNRA 1P3CA 3D49H 2FIRH 4CRGA 1GMDG 1YKTA 4YZUA 1TX8A 1O3OA 1P3EA 1S81A 2H9TH 3RXQA 3A87A 1V2WT 2ZHQH 3MH6A 4RN6A 3W95A 1JOUB 1RIWB 1ABIH 5C20A 4NIVA 4DW2U 1Z6JH 1O5AB 2FLRH 2AMQA 3RC6A 4NGAH 2XRCA 1GDNA 4YT7H 1KXBA 1C1MA 1EOJA 3MO9A 1E35B 2Z3DA 3K65B 1MCVA 5T3HA 4XDEA 2AMPA 1MKWH 3V3MA 2ZKSA 3EDXB 1WV7H 5DP4A 1SGFG 1TGNA 1MTWA 2BLVA 3TVJB 3ZVFA 2PKAA 1XVOA 1GMHG 3Q76A 1YPMH 1AE5A 1C2HA 2PKAB 1TGCA 1MQ6A 1GI7B 1SLUB 1V2QT 4XE4A 3OU0A 1GVKB 1LMWB 1GCTC 2GMTB 1OWHA 2XBWA 1GI8B 3ATLA 3MMGA 3SORA 4AN7A 2PUQH 1SGFA 2W7UA 4FUCA 5DPAA 2EEKA 1C1UH 3LGYA 1P01A 4YLUA 2VWMA 2J34A 1DX5M 1ZSJA 1NM6A 1GJ4H 1UHBA 3QZQA 3BTKE 1ZTKA 3GDVA 1UHBB 2ZFSA 4UE7H 1PPHE 2ZP0H 3ZV9A 2SGEE 4FUFA 1W3CA 1MKXK 7LPRA 4ZROA 1W13U 1FLEE 3PMAB 1K1LA 1RFNA 1D3TB 4BOHA 2AYWA 3MO3A 2YNAA 3LIWA 3Q3XA 4KGAA 3SJIA 3KF2A 2RCEA 4DY7B 4DVAU 1HAYB 1HBTH 2ANYA 5HYOA 3U8RH 2AGEX 2XC0A 2BY9X 1ESTA 1AVXA 1D6RA 2F83A 5DP5A 2GZ8A 1O2YA 1IQMA 5F8TA 2BDCA 1HB0B 1C4U2 1SGNE 2F9VA 3PV4A 4B2CA 4MPXA 1ESAA 1THSH 3H5CB 1HYLA 1UTKA 2BTCE 1SVPA 1GI9B 3ZVGA 1ZZZA 1E0FD 3E0NB 1ETRH 1FIWA 2GT7A 4IGDA 1XMNB 1C5UA 2BX3A 3LU9B 3F6UH 1BJVA 1SFQB 1N1LA 5EXMA 1GHBG 2EC9H 2SNWA 1SGCA 2ZGXH 1GBDA 2BYAX 2V35A 1N8OB 1FY1A 2G5NA 1NRNH 2W3KA 1XKAC 4YOIA 4NSVA 1E34B 1ZLRA 4JCNA 2OXSA 3RM0H 4YO9A 1F0UA 2EI6A 1GWAA 1SPJA 2GT8A 2PKSB 4F49A 1TMUH 4Q7XA 2QC2A 4TWYA 1DOJA 2BVXH 2ZPQA 1F7ZA 1P11E 3ZZ5A 1LTOA 4X8VH 4IN2A 1GBCA 1TALA 4DT7B 5FCRA 3E1XB 1UVPA 1MQ5A 2VGCB 1F5KU 3QGJA 4Y11E 1Y3VA 4IN1A 1AZ8A 1BMAA 3A7ZA 2QYIA 2PV9B 4Q7ZA 1EPTC 1AE8H 1ZJDA 3BG4B 1DVAH 4UD9H 3RXAA 1AZZA 2VB0A 1O3FA 1YC0A 1V2RT 2O8LA 2FYQA 2C4FH 3GY4A 1ELCA 1PPEE 2HLCA 1BRBE 2QCYA 1T8MA 1KYNA 2RDLA 3M3VA 3PLPA 4NFEA 4IW4E 3ODDA 1BCUH 2ULLA 1IQFA 1TNIA 4AOQA 1V2LT 2AERH 1TFXA 3A7XA 5EPYA 2CXVA 3OY5U 4TYDA 2OC7A 2GTBA 2PW8H 1Y3XA 4ISIH 1NN6A 1DPOA 1EB1H 1Z8IB 1GCTB 5BRRE 4BAMB 3BIUH 3SGBE 4DCDA 3IITA 3LH3A 2J92A 1A7SA 5DGJA 2PSYA 3QZRA 1P03A 1NFXA 1C1WH 1GI4A 1P06A 1G2MA 1PQAA 3A83A 1EQ9A 1C5YB 3MNBA 2ESTE 3MH7A 2AH4X 1PQ5A 5FPYA 1GJ8B 1TGSZ 4X0WU 1G37A 4DG4A 3O8BA 2ZHFH 4GPGA 1VCWA 4WY3A 1FPCH 1SR5C 1EZSC 3P17H 2XW9A 3KQCA 4I8KA 1L1JA 2XYAA 4NIYA 4D9QA 1LPGB 2W5EA 5JPMH 3QUMP 1QTFA 4WXVA 3EYDA 1C2KA 4Y79A 4ABIA 1J15A 4FU8A 5DJ7A 2ZU1A 4IMQA 1ETTH 3MO6A 3RXUA 1DWDH 1Q3XA 3HK3B 4GAWA 3AVZA 1H8DH 3LGTA 1ORFA 2OTVA 1W0YH 2FP7B 1S6HA 3U8OH 3FP7E 3ZVEA 1O2NA 2FOMB 1KY9A 4U01A 1U6QA 1TNGA 4ZKNU 2D26C 5AHGH 1MBQA 1LQDB 3RXHA 3ZYEA 4I32A 4CREA 4TPYA 2XNIA 3SW2B 1GJDB 3MHWU 4AGJA 5FPSA 2J94A 1NRQH 1TNKA 2P3UB 5JBCS 1SBWA 2OBQA 2ANKH 4NA7A 1JIMA 2DE8A 3B8JA 2QA9E 1HJ9A 3RXPA 5JBAS 5LPFA 1ZOMA 3LT3A 2BQ6B 2A31A 4O97A 1ZHRA 1J16A 1MMJN 3UQVA 2CHAC 1T7CA 2QXIA 3B9FH 4FUIA 4ZXXH 1CHOG 3S69A 4FUHA 4I33A 1GBJA 4X8SH 1GHAF 3SV8A 1HAVA 2VVUA 4MVNA 3RMMH 2BHGA 1W10U 3P6ZB 1YGCH 1EPTA 4Z0KA 1C2GA 4K5ZA 4K8YA 3S7KB 1C5OH 4Y0ZE 3E3TA 5EXLA 3S9BA 1H9HE 2FYRA 3PO1B 1BTUA 1XM1A 4X2YA 5PTPA 1DM4B 5EG4A 1H9IE 1FY5A 2BDBA 2SGAA 4UONA 3SU6A 3Q3KA 1OKXA 4JZIA 1JBUH 3VB7A 1TNJA 3TNSA 1C5XB 1LVYA 1WTGH 1BT7A 1HAIH 1BITA 5A09A 1WQVH 3O8DA 4ZKOU 1DUAA 3EAJA 3ZZ4A 1GPZA 1UVOA 1GL0E 1C9PA 1GDQA 4INHA 1NTPA 4Z6AH 2VJ1A 2TRMA 1VGCC 2WV4A 4AFUA 3F9FA 1IQLA 1TX6A 4KTUA 1FNIA 1GG6C 3A8CA 3P70B 3SBKA 4MQAA 3E8LA 8LPRA 3TNTA 4WJG2 5A8ZA 1KXDA 1O38A 1FI8A 3BTME 1GBMA 2IOTA 2GV6A 2XWBI 4Y0YE 1C5RA 1VITG 1Y8TA 2R3UA 4KTSA 2GKVE 3SU3A 8KME2 1YPHC 3D23A 2NU3E 2OUAA 1NY22 3NK8A 4U32A 1C4Y2 1O2UA 3A81A 1P0SH 1LKBA 1UK3A 2VIOA 3E91A 1O2TA 2ZHDA 4UFFH 5EGMA 3TJNA 1V3XA 1GJAB 4JZ1A 2TGTA 3A82A 2GX4A 1WBGB 2GCTC 1GCDA 1UCYK 2O8UA 1O2JA 1VZQH 2F9PA 3E16B 3ESTA 1HXEH 2ODQA 4DJZB 1K1NA 5A0CA 1BZXE 4QT8C 1LVOA 3A88A 2FS8A 1ZGIA 1TQ7B 1NPMA 4ABEA 2ZHEH 2VVVA 1Z7KA 3GY2A 3QDZB 3HGNA 1F92A 3TITA 4FXGH 3EE0B 2RA0A 3I29A 4M7GA 1GGDC 5GCHF 4U30A 1C5SA 1PPCE 4A7IB 3PTBA 3TGJE 1W14U 1AGJA 1ZPZA 5IYTA 4LZ1H 3RC4A 1EZUC 1N6YA 1O2XA 4JZDH 2OBOA 2ZG0H 3U1IB 3QGNB 1SGEE 1ZTJA 1K9OE 1OWIA 1Q31A 3GISB 2VWOA 1DY9A 1L4ZA 5T6DA 4BAHB 1C2EA 1YCPK 1GJ6A 4D7GA