4IMZA

Structural basis of substrate specificity and protease inhibition in norwalk virus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
183
structure length
173
Chain Sequence
DKAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLTGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQAGEGETAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Genome polyprotein
publication title Structural basis of substrate specificity and protease inhibition in norwalk virus.
pubmed doi rcsb
source organism Norovirus hu/1968/us
molecule tags Hydrolase/hydrolase inhibitor
total genus 41
structure length 173
sequence length 183
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4imzA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4imzA01
2SGDE 2SGEE 5EXNA 4B76A 3PB1E 5BPEA 1GHBG 2C93B 3T5FH 5C2ZA 1G2MA 1GJ5H 2FX6A 1P2MA 2NU0E 1IHSH 4INLA 4R8TB 2D26C 3SJIA 4AX9H 3LH3A 3A88A 4NFFA 4DJZB 5DPAA 1HFDA 2J9NA 2ZPSA 2EI7A 2W3KA 3TK5A 3TGJE 1KYNA 1G2LA 1TBRH 3SO3A 3ZYEA 2R3YA 1RFNA 2ZFQH 4CHAC 2P59A 3QO6A 3FP8E 2GT7A 1MTVA 5HM9A 4Q7ZA 2BXTH 5GPIB 1HPGA 4XBBA 2TIOA 4YLUA 4DG4A 2WV4A 6CHAB 3RU4E 1EQ9A 2FZZA 2PV9B 2SFAA 1CSOE 4FUFA 1L0ZA 2VINA 4DIHH 4F4OC 1XUGA 3OU0A 4I31A 3I78A 2BOHB 1SQTA 2WINI 1DXPA 1GHWH 1ABIH 2Z9LA 3TJVA 1TNIA 3OY6U 3VXFH 3UQVA 3VB3A 3MO3A 1F0UA 2FLBH 5EOKA 3ATMA 3MYWA 1GBBA 2GCHF 1O39A 3A86A 3DFLA 3U1JB 2JH0D 3F9HA 1DUAA 1IQLA 1PQAA 1GHAG 5SGAE 2O8WA 3S9AA 4IN2A 3SGBE 1W10U 2ODQA 1AN1E 2G4UA 2PFEA 2B9LA 1EJMA 1WSSH 5FBIA 3UREA 5EPYA 2A4OA 1ZTLA 4IMZA 4I7YH 1SC8U 1QJ7B 2FS8A 2ZHFH 4WXIA 5E8EH 3R0FA 3TNTA 3KQCA 1FMGA 1GHXH 4NIXA 2DE9A 4ESTE 1SGCA 3A7VA 1GJ9B 3GY6A 2FODA 1GBHA 3SNEA 3MU8A 2FI5E 1MAXA 2O8LA 3L6PA 1AB9B 5C20A 2ASUB 2G52A 3DUXH 2W7SA 2ZU1A 4FUHA 3P8FA 2ZDAH 1HXFH 1RRKA 1TWXB 4CRGA 1ZHMA 2XBXA 3OTJE 3A8BA 3M35A 1KXBA 3MH4A 3TITA 1MTWA 3UOPA 3Q3YA 1SR5C 1Z8JB 1SGDE 5EG4A 1T8LA 3CS0A 1V2MT 4IS5A 1ESBA 2O9QA 3M37A 2A0QB 4MVNA 4AB9A 1P04A 4O9VA 1V2QT 3RM2H 2A4RA 1A4WH 2BY8X 3MO9A 4X1SU 3O8RA 1DSTA 1TYNA 1ARCA 1A61H 2QXJA 1O0DH 2Y5FA 3SGAE 3BEIB 4KTSA 1GJAB 5JB9S 1BTPA 5HGGA 2XBWA 5JBCS 1CU1A 1PJPA 4XDEA 3VPKA 1YCPK 1NFXA 3TPIZ 4ABBA 2BXUH 3GICB 2H9HA 2VVVA 1HAXB 2ANYA 4K69A 3ZZ6A 1KXDA 3RU4T 2AGIX 3RXKA 1CHGA 3PO1B 2C90B 1TNJA 1THPB 1QB9A 1WTGH 2FS9A 4ZKRU 2M5TA 4MLFB 3K6YA 1K1MA 4GHQA 4D9RA 4XSKU 1PPCE 2BVRH 4GSOA 4ISIH 1H1BA 2R2MB 1GHZA 3I77A 1O3BA 5FPSA 3UY9A 1O31A 2NWNA 1BMMH 5LPRA 1HAGE 1TGCA 3PWCA 5GXPA 1RS0A 1ARBA 4ABAA 4Y0YE 4ZAEA 4SGBE 5F6MA 1QCPA 1HRTH 5TCAA 3LOXA 1ELDE 5FAHA 1GCDA 2ZPRA 2JH6D 4GUXA 1TONA 1O3JA 3D65E 1JWTA 4AFZA 5I46H 3MNCA 2W26A 1GI3A 1EPTB 3M5MA 4PROA 1KLJH 3IWMA 4UFDH 3NPSA 1Y5UT 3P17H 1XVMA 3AAVA 3KF2A 1K1NA 3A7YA 1FNIA 2QF3A 3PMHB 1MBMA 4AN7A 3U8RH 2G81E 5E0GA 2JETB 4E06H 1E37B 2XNIA 3M5LA 3AVZA 1OWIA 4A1VA 1UK2A 1ZGVA 4YTAA 4BAQB 3A81A 4J1YA 1JMOH 2FMJA 1LHCH 3SI3H 7ESTE 1MQ6A 2FDAA 2ZCHP 1MU8B 4ABEA 3Q00A 3BTEE 1H4WA 2VIPA 3LJOA 1HAHH 1QBNA 1SGYE 2FTMA 4NWLA 1Y3XA 1PYTC 3UNQA 1XKBC 4I32A 3ZV9A 4RN6A 4AYVB 5EQRA 1O2SA 3MMGA 2PKAB 2PSYA 4J2YB 1C2FA 3SU2A 4WMEA 3KEEA 1GDNA 1PPZA 2TGTA 1AZZA 1EX3A 1P02A 1ZOMA 1DS2E 1MU6B 1O2NA 4MPWA 1GPZA 1S6HA 1D9IA 2ZECA 1OWJA 3K9XB 4LOYH 3RXTA 3TVJB 1KSNA 4RKOB 3DA9B 1J8AA 3H5CB 3MH6A 1GJCB 2CJIA 3SU6A 3FVFB 4X8UH 4H4FA 1JRTA 1CGHA 4INHA 5K7RA 1C2JA 1HAIH 1BTHH 1O2UA 4INKA 3ELAH 1N6XA 3ZVDA 3UTUH 1FN8A 2BDBA 2J38A 1QB6A 3NK8A 1FQ3A 4CRAA 1L1NA 1TA6A 2B7DH 3PLPA 1Y3WA 2BY5X 2QXIA 3MH7A 1ZMJA 1P2OA 3QN7A 1ZTJA 1O5BB 4VGCB 4Z6AH 1O2PA 3T26A 4JZIA 2FO9A 3HGNA 2GZ7A 4Q7XA 1GJ4H 1C5TA 4MPUA 2GMTB 3NZIA 4BAKB 1QY6A 1WAYB 1P9SA 1GMHG 2ILNA 2PR3A 1BMLA 1Y3VA 5DKMA 1TAWA 2R0LA 4A5TS 1WYKA 3URCA 2P95A 3HK6B 4OS6A 5AVDA 2H6MA 3SU0A 3ZVEA 8GCHG 1O36A 4CR5A 1AVGH 1FONA 1SHYA 2GD4B 4YO9A 4ZXXH 3BG4B 4MDSA 3ZVAA 3RC4A 2V6NA 1EB1H 1OYQA 1GJBB 4DURA 1ZPCA 1MMJN 3SV8A 2CHAC 4IMQA 3E0PB 3PYHA 4YM9A 2CXVA 1GGDC 2PKSC 4FUBA 2AYWA 2Z9KA 2Z3EA 3TK6A 4B1TA 5A0BA 4XBCA 5A0CA 2ZU3A 2Y6TA 3SUEA 4JYTA 3BIUH 1NN6A 1NO9H 1C5NH 3RXUA 1MH0A 4Y7BA 3DD2H 1GL1A 1X7AC 3UR9A 3ZZAA 4X1PU 1GG6B 1VZQH 3A7XA 1ZZZA 3EAJA 2OC0A 3S0NA 3GYLB 4XOJA 2FESH 1VITG 3ATIA 2XYAA 1W13U 3OX7U 4HGCA 4BTUB 2OCVB 5EXLA 1L4DA 5C1UA 2GX4A 1Y5AT 1A5HA 1GHVH 3FFGA 3A83A 1WUNH 1W3CA 1YLDA 1ZHPA 1MKWH 2AFQB 4O97A 1TABE 3CS7A 2VB0A 3STIA 4BXSA 1BCUH 1AD8H 2ZGHA 4UFGH 9ESTA 2OD3B 2VGCB 1G9IE 1TX8A 2ZP0H 2ULLA 1W2KH 3C1KA 3F9EA 1Y3UA 4B2CA 1MTNB 2BZAA 3A82A 1CT2E 1GHBF 5DG6A 1FAKH 1V2LT 3QZQA 2EA3A 3M5OA 1LVBA 4ABJA 6CHAC 1TRMA 1XX9A 1AWHB 4IGDA 3MNXA 1HDTH 1Z8GA 2BLOA 2BQ7B 1JXPA 1E0FD 1GI8B 3UR6A 2QN5T 3LC3A 4OS5A 4Y11E 5CMXH 4NGAH 1BITA 4MNXA 4Y0ZE 2ZU2A 2RA3A 1WBGB 3VGCB 3SNBA 2NU1E 1SGPE 1DPOA 1YF4A 3A8CA 1EPTA 1P11E 5A8YA 2ALVA 3BTQE 2P8OC 2ZHWH 2OC7A 1C4V2 3JZ2B 4KKDA 1LMWB 3RLWH 2ZFTA 3UPEA 1GWAA 1E38B 4AFQA 1A0JA 5LPEA 3HKJB 1EASA 1O2QA 1V2WT 3NWUA 5GIBA 4FU7A 3URDA 2PTNA 4WWYA 1XM1A 2SGFE 1P2QA 1H8IH 1PPBH 1KXFA 1CA0C 1S82A 2FLRH 2H5CA 4TY6A 3NCLA 3RMLH 4B74A 4GAWA 3T25A 1DWEH 1BBRK 1GHAF 4MTBA 2Z3DA 2VWOA 4KGAA 3S7KB 2UWOA 4X1QU 1RTFB 1SL3A 2A31A 2BZ6H 4Y10E 1Z1IA 1XXFA 1IHTH 2OINA 1VITH 1Z6EA 1F5KU 1PQ8A 4CRDA 4XE4A 1ABJH 1Z71A 4CR9A 1AB9C 4UD9H 4BAMB 1ZGIA 2EI8A 3EA7A 1NRQH 2ESTE 1YM0A 1A46H 2BDCA 4XFQA 2C8WB 1MTUA 1UTNA 1W11U 4DOQA 4JZEH 1V2VT 1SGFG 5F8TA 1UCYH 2ZTYA 1QA0A 2WPHS 3VEQB 1N1LA 2IJOB 1GVZA 2BX3A 2BVSH 1BRBE 1RIWC 1BIOA 1BTYA 1DLKB 1QBVH 2ZU5A 3E1XB 3TU7H 5J4SA 4JZ1A 3HGPA 3BTGE 1TE0A 1P01A 2AGEX 3RXQA 1LHEH 5JBAS 1NU7B 1J9CH 5DP7A 1P10A 2PUXB 1BTWA 1O34A 2IOTA 3V12A 2AMDA 3BEUA 1HJAB 1P3CA 4X8TH 2EI6A 1MZAA 4BANB 1KXCA 4CH2B 2ZQ1A 1UMAH 4ZKOU 1FV9A 1NRPH 1BOQA 1P2IA 1LTOA 4R0IA 3ATLA 1S0RA 4Y8XA 1QJ6B 3KGPA 4X2XA 4MNYA 4Y76A 1O30A 1EJNA 1VGCB 1WOFA 1EZUC 1GI5A 3F68H 4ZH8A 1XVOA 5AF9H 1FY4A 1GMDG 4YESB 3PO1C 4JZFH 1ZTKA 3M3SA 2GGVB 3U1IB 1NROH 2NU4E 3U98H 1O5AB 1XUIA 7KMEH 3BTTE 3ZZCA 2KAIA 4WF8A 3O8BA 4UONA 4ISHH 1YGCH 9LPRA 4WXVA 5DP8A 1AWFH 3EA8A 1G37A 1TNKA 3UOUA 3KQBA 1SGIB 2SGPE 1QFKH 3E90B 2I6QA 1C5QA 1SLWB 1G32B 3A8DA 2CMYA 2BD7A 1GBLA 1IQNA 2Z9GA 3QLPH 1YPHC 1K21H 1PPHE 1D3QB 3ESTA 2R9PA 1UJ1A 1LDTT 4X0WU 2GP9B 2QC2A 1KTSB 3P8NA 3RUOA 1HUTH 3BTKE 3RXFA 5DP4A 2ZFPH 4I33A 6ESTA 1SB1H 1SPJA 1YLCA 3T29A 2C8ZB 4FUJA 3A7WA 5DO4H 1ELFA 4CRFA 1PPEE 2JETC 1QURH 3KQEA 3LGIA 4WY3A 4NZQA 2CV3A 2ZWLH 1FI8A 1DWDH 1VCQA 5ABWA 1FAXA 3FAOA 1QGFA 4ZXYH 1ORFA 1UVOA 3GISB 1ELCA 1BBRE 1BTZA 2J94A 5LH8A 3SW2B 1LQDB 3S7HB 2ZPQA 3D23A 5EQSA 4MQAA 5K0HA 1JIMA 1DXWA 4JZDH 1BRUP 1HCGA 2QY0B 1FUJA 1IQHA 2A7CA 1W12U 1TGBA 4WVPE 2ZU4A 1NS3A 8KME2 1EP5A 1GI2A 1P2KA 2BMGB 1OXGA 1XUJA 4GCHG 4AFUA 4IBLH 1KIGH 2OBQA 4NIYA 1C5UA 3RC5A 1DANH 5AFYH 3U69H 1GBIA 5ESBA 5GJ4B 4DGJA 4OS2A 1GBCA 2OUAA 3A87A 2FEQH 3LU9B 1UVSH 3CENA 1D4PB 4K60A 1FY5A 4TWYA 1H9LB 4DT7B 3T28A 3RXSA 1RJXB 4X6OA 2A5KA 4A6LA 3SNAA 2VIVA 4JK6A 5EW2H 1ZMNA 2FYQA 3RXMA 1GI0A 3P8OA 1NT1A 1DFPA 1K22H 2QYIA 3SUGA 2BB4A 2GDDA 3CP7A 3AASA 2GCTB 4D7FA 1KLTA 3GDSA 1QRZA 1QL8A 3QUMP 3SUFA 1BB0B 1VJ9U 4ABDA 1YPLH 3K2UA 1MQ5A 1E36B 4H42U 1LPZB 1P2NA 2HNTE 1K2I1 2YOLA 2GMTC 3B9FH 4Y8YA 1L2EA 3RXIA 4NA7A 1V2PT 1Y3YA 1WQSA 2V35A 4JCNA 4NA9H 1ZHRA 3KNXA 1OP0A 1P09A 1XMNB 1EAXA 1G3CA 2V3HH 4U32A 1BUIA 1OP2A 1UVPA 2AMQA 2P16A 3VB4A 3PM3A 3MNBA 1T32A 3GY3A 3MU1A 4MPVA 1AKSA 4O3UA 5C1XA 1D3DB 4JYVH 4NSVA 3PLKA 4ABGA 1W0ZU 1YPHE 1GMHF 1H8DH 1TOMH 3T27A 1YCPM 2A5IA 4HI3A 2QA9E 3IITA 1YP9A 4TPYA 5PTPA 1BHXB 1O3HA 5HYOA 4D9QA 8GCHF 1D6RA 2GTBA 2WPIS 2K1QA 5DP6A 1SLUB 1F7ZA 2XBYA 1HJ8A 3GY7A 1YYY1 3SQHE 4HTCH 1A5IA 4I8JA 1GG6C 4FUGA 3V7TA 4CRBA 3BTFE 4GHTA 2CN0H 1DX5M 1SQAA 1TGSZ 3HK3B 3T2NA 3LT3A 3ENSB 1AFQB 3GOVB 2Z9JA 5FX6A 1JBUH 1LPGB 5FHTA 4K1TA 2PTCE 1Y59T 4Q7YA 1ELGA 2ZHQH 1P06A 2ZCLP 1GMCG 1O3PB 2WYJA 4I8GA 1C1WH 1T8MA 1QB1A 4YLQH 1N8OB 1SGEE 3BTME 1SGTA 1SGRE 1D3PB 1YBWA 3SNCA 1ELTA 1EATA 4YOIA 1VITF 2VIDA 2JKHA 2FOCA 3PLBA 1IQGA 3GY5A 2C8XB 1MTNC 5JBBS 1XKAC 2ODYB 1SOZA 1F92A 5CHAC 2HPPH 2F91A 7GCHG 4BAOB 1O2MA 5H4IB 5J4QA 5FXLA 2P3TB 1SFQB 4CHAB 1W7GH 4D8NA 2BTCE 3VXEH 2ZGCA 1LCYA 1KXAA 2BDHA 3ZVFA 5C3NA 2ZA5A 3EYDA 8ESTE 3M7UA 1DWBH 2FM2A 2FOMB 1QL7A 1HJ9A 3NUMA 4O3TA 1O3GA 1OS8A 2A7JA 4K8YA 4NG9H 5A2MH 1HB0B 1AUJA 1BMAA 4X8SH 3RLYH 2VJ1A 1SHHB 3RXRA 1C5LH 1KXEA 1O2LA 1EP6A 2B8OH 4K3JA 3F1SB 4I8LA 5AHGH 1FIWA 4Y71A 3SV6A 1C2MA 3TGKE 1DE7H 1TMTH 4ZHMU 3ZVGA 2FXRA 2SNWA 3S9BA 5F03A 4KTUA 1TNLA 3PTBA 1DOJA 3BTHE 3GYMA 3RXEA 3ZZ8A 1QBOA 1V6DA 1C1MA 2FOGA 1GBAA 4WJG2 3TH2H 1MBQA 1AFEH 1DT2A 5T6DA 3FP6E 5L2ZH 3N7OA 1UVUH 4A1TA 1P9UA 4DY7B 1ANDA 3FZDA 2VWLA 2XC0A 4LZ4B 1VCPA 4OGXA 4CH8B 1PQ7A 4OS4A 4DIIH 3P70B 1L1JA 3RXHA 1JRSA 4UE7H 3RMMH 1TPPA 1TBZH 1WU1A 1ZSLA 2A5AA 1O2HA 1HBTH 1IQKA 5A0AE 3LONA 2ZDKA 1EOJA 1ZYOA 2QGRA 4BTTB 1K9OE 2D1JA 1DWCH 1IOEA 3RDZA 1DY9A 3SQEE 1F5RA 5GWZA 1NRNH 1NRRH 1Q31A 3RXAA 1AU8A 3I29A 3EE0B 4B2BA 1ZJKA 2ZKSA 1TB6H 1BRCE 5DGJA 4A7IB 1IQFA 1QRWA 1SSXA 1J17T 1KTTB 2H9EH 1GCTC 2OC8A 1O3IA 1BT7A 5EXMA 1OWHA 3SI4H 2Z6BD 2KAIB 2ANWA 3RC6A 4MNVA 6GCHG 3F6UH 5C67A 2R2WU 2Q6GA 1HLTH 1BJUA 2G51A 1HAVA 1FDPA 2NU3E 3V13A 4GPGA 4UDWH 3RXBA 2BD4A 4X6MA 2ZG0H 5JBTA 1EJAA 4B75A 3M61U 1SGQE 4B2AA 2SGAA 1C5YB 2WYGA 2WPKS 2AEIH 3Q3KA 3L33A 1SLVB 1TQ7B 3VB7A 4E05H 2Q6FA 1CQQA 1S6FA 2Y82A 4LXBH 1AVXA 4X6PA 3U9AH 1SVPA 2J34A 2QCYA 3UNRA 1Q2WA 1M9UA 1MKWK 1O3OA 1OOKB 2THFB 3SV9A 5GCHG 2G4TA 1QHRB 1S84A 5FBEA 1C1OA 1V2JT 2VIQA 1T8OA 4DVAU 2WUCA 1GMDF 1GI9B 1LHDH 1AUTC 3C27B 5IYTA 1O5CB 4NWKA 1O3CA 2BDAA 2J4IA 5BRRE 4X2YA 4FUIA 1F5LA 3TJOA 2Y7XA 2ZCKP 1PYTD 4JYUH 4Y8ZA 1GJ8B 3GCTG 4Z0KA 4JMYA 1ANCA 2A4GA 1LHFH 1GI4A 2ZFSA 3BIVH 2FI4E 2WUBA 1J16A 4NZLA 4QT8C 2OXSA 2O8UA 4KP0A 3GDUA 2VVUA 3A89A 3P95A 1VJAU 3BTWE 3ODDA 4I8KA 1GL0E 3UWIA 2EEKA 1DICA 1GJDB 4ASHA 3F9FA 3UWJH 2OTVA 1A1RA 1HXEH 1HAZB 1TX7A 4GLYA 2BD5A 4OS7A 5EQQA 4CBOA 1HGTH 3EGKH 3U8TH 3GCOA 2B0FA 1Z8IB 3LGVA 4AG2A 2PHBA 3SJ9A 1FXYA 3ZVCA 2D8WA 2GT8A 4YOJA 1H9HE 1TNHA 2XWAA 1GJ7B 4XBDA 1GI1A 1WQVH 2ZGXH 4H6SB 2F3CE 1XUFA 2RDLA 1L4ZA 2XTTB 3BG8A 2VU8E 2ZO3H 2O8TA 3RXLA 2OC1A 5E0HA 2Y5GA 2AS9A 2ZDMA 1GBEA 5JDUB 1TGTA 3OYPA 2ZQ2A 1YKTA 3UNSA 1QA7A 1C4U2 1DLEA 1NM6A 2V3OH 3VB6A 2RCEA 1SI5H 3PMJA 1DVAH 5AFZH 4B73A 2GZ8A 3E3TA 2XW9A 1YPJH 3SN8A 1AMHA 4AFSA 1HAOH 3MNSA 4O03A 5ETXA 4GCHF 2DE8A 3LGYA 1ETTH 3P92A 4X8VH 1AGJA 3WY8A 1P05A 2H5DA 1MKXH 2AERH 3G01A 1VCWA 1C5OH 2ZNKH 1RGQA 1C1VH 1FIZA 2QAAA 1AKSB 4KELA 3Q77A 1LVYA 2STBE 5F8XA 3U8OH 3FZZA 3V3MA 1UCYK 1CBWB 2AIPA 3GY4A 1THSH 2F9PA 1MD7A 2CGAA 4WMDA 1AI8H 2A4QA 3E16B 2A45B 1V2OT 2I6SA 1QIXB 1C2KA 2J92A 3OY5U 2G5VA 1UK3A 1O3EA 4ABHA 2QXGA 2Q1JA 1ESTA 3MFJA 3ODFA 1V2UT 5C5NA 2BHGA 4D76A 1TGNA 1MAYA 2FOEA 2P94A 2G5NA 1K1LA 1HV7A 1O2KA 1NTPA 1BMNH 2D2DA 2OP9A 2QF0A 2P3FH 3V0XA 1LHGH 1OKXA 4WH8A 5TCCA 1AIXH 4FUCA 4A92A 5EGMA 1CE5A 1F0SA 1NFUA 2OBOA 1A3BH 2XRCA 1CT0E 3Q76A 3SUDA 3K65B 1A2CH 1NC6A 2HVXA 3GDVA 2ZC9H 1C5PA 1PQ5A 1P57B 3LH1A 2CHAB 1GBJA 1GVLA 3ZV8A 1BDAA 1O35A 1FPCH 1O3LA 1ZPZA 2AGGX 4MNWA 1ZRKA 1LPKB 3ZZ9A 1SQOA 1ZJDA 3KN2A 2ZHDA 2Y81A 2HRVA 2ZTXA 4NIWA 2STAE 1LVMA 5A8ZA 3F9GA 1OP8A 2BQWB 1SMFE 2CF8H 1V2RT 3T62A 1C2LA 1LKBA 3RXPA 3M7TA 2BYAX 1TQ0B 1GBKA 1P8VC 4CRCA 4A1XA 2VH0A 4H6TA 4TYDA 1N8OC 3HKIB 3MO6A 3ZZ7A 3VFEA 1ANBA 3TLOA 2GV7A 4TWWA 1HIAB 4B71A 5T3HA 1CGIE 1DSUA 1O2RA 4AB8A 1UTJA 3TJUA 1Z8RA 2IN2A 3R3GB 1GI7B 1EPTC 3TH4H 1GMCF 1D3TB 1UHBB 2BM2A 3S69A 1TPSA 1RTKA 1F2SE 2VIOA 1W8BH 1TMUH 1WV7H 1BZXE 1S81A 1O5EH 3GCNA 4LK4A 1C9PA 2WPLS 1J14A 4K5ZA 3ZVBA 3BSQA 5L30H 1YPKH 1Z7KA 2XCNA 1B5GH 1CA8B 1SG8B 4MG3A 1T4VH 3H7TA 3SU3A 1BTXA 1O2WA 5A8XA 2IPHA 1C1TA 1EZXC 3ZZDA 5EU8A 4HFPB 3UFAA 4FXGH 2ZZUH 7GCHF 1UTMA 5DJ7A 3RMNH 2Y5HA 5TJXA 2PGQB 1O3KA 4CBNA 4F49A 1RTLA 2H9TH 1OYTH 5HM2A 1NFWA 3RU4D 1O32A 1WTHD 4BAHB 1VR1H 3EQ0H 1ID5H 1K1OA 1EB2A 3LGUA 1TX6A 5I25A 1UCYE 1TRNA 2FP7B 2PW8H 3AW1A 2P8OB 2J95A 4FU8A 3LIWA 1CHOG 3QWCH 1EAWA 4GVUA 3KIDU 1S5SA 5GDSH 1IQEA 4AORA 2Z9IA 1OWEA 1G36A 4WMFA 4YZUA 4X2WA 4I8HA 2V0BA 3W94A 5DP5A 3ZZBA 1AY6H 3S9CA 1UTLM 1O3MA 2Q6DA 1MUEB 1EOLA 3SV7A 1HAPH 1CA0B 5EPNA 2BD2A 2BLVA 3KQDA 1B0FA 3O8CA 3FP7E 3GCHB 3JZ1B 2TRMA 1AQ7A 3TIUA 2F83A 3SZNA 1MTSA 3SHCH 4X6NA 2ZGBH 2WPJS 4U01A 1ETSH 3ZYDA 4VGCC 2HWLB 2XXLA 3O8DA 3QX5H 3RXDA 1C9TA 3LKWA 2F9UA 8LPRA 1C5MD 1T8NA 1OWKA 1L1GA 2Z3CA 2GVFA 2BY7X 1NZQH 1TIOA 1LO6A 3ZZ5A 1HAVB 1G3DA 1C1UH 1FLEE 4X1NU 1CGJE 1BJVA 3MU5A 3MH5A 2BDIA 3GY8A 4NFEA 2ZGJA 1C2HA 3PMBB 3MHWU 3BG4C 2ZF0H 5ESTE 2LPRA 1RIWB 2VH6A 2GV6A 1O5GH 1SGNE 3SGQE 2ODPA 5HXFA 1WCZA 3A7TA 2Y80A 1O33A 1C4Y2 2FOAA 1UTOA 3LDXH 1UTQA 3DHKH 1EXFA 3NXPA 1AVWA 4ABIA 1AHTH 2XC4A 2VVCA 3E0NB 1O3FA 3L3TA 4ZHAA 3STJA 1DUEA 1W0YH 1W14U 6GCHF 2RA0A 3EA9A 1UO6A 3LGTA 2P3UB 3SU4A 1F0TA 1FJSA 1S83A 1EKBB 1TOCB 1E35B 1SLXB 3OSYA 4Y79A 1YCPH 2BD3A 1ACBE 2BD8A 4AZ2B 1O5DH 3HATH 3ZZ3A 3PWBA 2JH5D 4E7RG 4E7NA 1C5XB 2W7UA 3MU4A 2NU2E 2F9NA 3D62A 1EZQA 2W3IA 1CO7E 2VGCC 1EAIA 4K2YA 1O2XA 2CF9H 1P2JA 5GCHF 1KDQA 5FCRA 2BY9X 2WPMS 1YC0A 5CE1A 2BDYA 2A1DB 4Y7AA 4ABFA 2Z7FE 3M36A 1YPEH 2OQ5A 4AG1A 3SHAH 3LGWA 7LPRA 1NU9A 4NA8A 1K28D 1G3BA 4MPXA 2P93A 1Z6JH 4FUDA 3MU0A 1SFIA 3GCTF 3M3TA 5E0JA 1HIAA 2ZFFH 1QR3E 1PFXC 4CREA 2ZEBA 3A84A 2A32A 4BOHA 4ISLA 3VGCC 1P12E 1EUFA 1OWDA 1C5RA 1TBQH 1MD8A 4X1RU 1UHBA 2GCHG 2SGQE 1CVWH 2FWWA 3LC5A 1IQJA 5T6FA 1J15A 1N6YA 4OGYA 5EODA 4K1SA 1MZDA 2C4FH 1AE8H 1BHXF 1O2TA 1ESAA 2AIQA 2XBVA 3MI4A 4UFFH 5L2YH 1C2IA 2BD9A 1T4UH 1PPGE 2C3SA 2FOFA 3DFJA 3BN9A 2R3UA 1C1QA 3H7OA 4Q80A 1GDQA 2TPIZ 1OSSA 3M3VA 3AW0A 1C2GA 1QJ1B 2XC5A 4FUEA 4ISOA 2AH4X 4KTCA 3SV2H 1TPOA 2FI3E 2TGDA 1O2IA 4ZKSU 1YPGH 3B23B 3ATWA 1ELBA 3UIRA 1UVTH 1UTKA 1V2NT 4U30A 2XCFA 5T6GA 1P0SH 1THRH 2PUQH 1AE5A 2F9OA 3QGJA 3W95A 4DCDA 1ZLRA 1V2TT 2OLGA 5HMAA 1P3EA 3M7QA 4UFEH 2HNTF 1HAYB 1TNGA 2QV1A 5E2OA 4LZ1H 1QQUA 4ZKNU 1V2KT 5C5OA 2ZDVH 1FY3A 1O38A 2BX4A 4RKJB 1FY1A 3TNSA 4Q2KA 3SJ8A 3A7ZA 1CT4E 1CBWC 3TJNA 3ATKA 4IC5A 1NRSH 1C1NA 2HGTH 3A80A 5EW1H 5A09A 2ZDLA 1T7CA 1C1PA 1C1RA 2SNVA 3E91A 1GBMA 1TALA 1NY22 1B0EA 4NCYA 5FCKA 2UWPA 2UWLA 4UEHH 3SOSA 1A0LA 2F9VA 4K8BA 1GHYH 1O2OA 3QK1A 4FVBA 5LPFA 2HOBA 1TMBH 1C2DA 1BQYA 1O3DA 3SNDA 1HJAC 3P6ZB 2A7HA 3E6PH 1GBFA 4WH6A 3SORA 1ZSKA 2QIQA 1QRXA 1G3EA 3BTDE 5DK1A 2PSXA 3RP2A 1JIRA 1O37A 2HALA 1FY8E 1VGCC 1C2EA 3P8GA 1V3XA 4IW4E 4TY7A 3MWIU 3HPTB 1AO5A 1O2ZA 1GBDA 1LQEA 1O2GH 2UUJB 2G8TA 1T31A 1DDJA 5JB8S 1V2ST 4JK5A 3VB5A 2BY6X 4BXWA 4YOGA 1QTFA 2FX4A 1W7XH 3BV9B 1E34B 2LNCA 4FVDA 2FOHA 1C5ZB 2O8MA 1GDUA 2UUKB 3M5NA 4ZUHA 1ETRH 2ZIQH 1EAUA 1EZSC 3A8AA 1K1JA 1FN6A 2EC9H 1HYLA 3FANA 1Z1JA 4AYYB 1K1IA 4AGKA 2F9BH 4FU9A 3ITIA 1ELVA 1O5FH 1GBTA 1K1PA 4ZHLU 1IQMA 1ELEE 2C8YB 3PROA 5E2PA 5DP9A 2H2ZA 1BTUA 2VWMA 2Y7ZA 3SU1A 3MOCA 2Z94A 2HPQH 2ALPA 2H1UA 4IC6A 5B6OA 1XXDA 1A7SA 2PWXA 2VIWA 1XUHA 4D7GA 2A2XH 1B7XB 3RXJA 3MTYA 5CHAB 1IAUA 2GDEH 1ZMLA 1D6WA 3PV4A 3BF6H 3QTVH 6LPRA 5LGOA 5G4BA 2FTLE 1UTPA 1FZZA 2UUFB 1NESE 4NIVA 2HLCA 2A2QH 1TFXA 5C1YA 3RXVA 4IN1A 2ZHEH 3DT0H 4Y6DA 3PMAB 1INCA 3RM0H 2TGAA 1RXPA 1TPAE 3KCGH 4YT7H 2UUYA 2QXHA 4NSYA 4RSPA 2W5EA 1S0QA 1GVKB 1GI6A 4OS1A 1QNJA 5FX5A 1P03A 4DW2U 1C5SA 2FIRH 1OX1A 3QGNB 1BRAA 1Y5BT 3Q3XA 3RXCA 3LJJA 2XWBI 1MKXK 2PGBB 2FOBA 2BLWA 2BVXH 4X2VA 1SBWA 1DITH 2DUCA 3RXOA 2OQUA 1JOUB 3EDXB 1SGFA 1CHOF 1ELAA 5JPMH 1SOTA 1UK4A 2AMPA 3GCHC 1NPMA 1BA8B 4M7GA 2ZTZA 2BOKA 2ZDNA 3TH3H 1H9IE 2G55A 2YNBA 1LKAA 1G30B 1QQ4A 1DM4B 1YPMH 1C1SA 2GCTC 2FPZA 5FPYA 1BBRH 1U6QA 1TLDA 4TPIZ 2PKAA 3IG6B 1KY9A 4BTIB 1GJ6A 1MCVA 2PLXA 3PTNA 1C5WB 1A0HB 3UUZA 2BDGA 2G00A 2FYRA 1KLIH 4YT6H 2ZI2H 3A85A 5JYIA 5L6NH 3AAUA 3D49H 3SBKA 1O2YA 2WV5A 3B8JA 1C5VA 2RG3A 3LPRA 2ZFRH 2GKVE 2R0KA 3RMOH 3E8LA 3BEFB 2ANMH 3QTOH 1HNEE 1ZR0A 3NKKA 4THNH 5DP3A 4ISNA 4AGJA 3SU5A 1ZRBA 5IDKA 2TBSA 2B5TB 1ZPBA 2TGPZ 5FPTA 2J2UA 1Y8TA 1MCTA 1ANEA 3QDZB 1PPFE 1RD3B 2BQ6B 1GCTB 1TA2A 5F8ZA 4U2WA 1GGDB 2PKSB 3TGIE 3TK9A 1O3AA 1A5GH 4AOQA 2ANKH 1TRYA 1O2VA 1QL9A 4ZMAH 1KDQB 3QZRA 2VWNA 1FPHH 1OPHB 3SJOA 1O2JA 2VNTA 1Q3XA 1AFQC 2GZ9A 3UQOA 3RXGA 3ZZ4A 4BNRA 1F0RA 3K6ZA 1S85A 1AZ8A 3KHVA 3KL6A 1NFYA 1ZSJA 2BLQA 1O3NA 4SGAE 4ZROA 1XUKA 4HZHA 1IQIA 3SJKA 2YNAA 1DY8A 3GY2A 1LVOA 1A3EH 2HNTC 4K1EA
chains in the Genus database with same CATH superfamily
2SGDE 2SGEE 5EXNA 4B76A 3PB1E 5BPEA 1GHBG 2C93B 3UAIC 3T5FH 5C2ZA 1G2MA 1GJ5H 2J5UA 2FX6A 1P2MA 2NU0E 1IHSH 4INLA 4R8TB 2D26C 3SJIA 4AX9H 3LH3A 3A88A 4NFFA 4DJZB 5DPAA 1HFDA 2J9NA 2ZPSA 2EI7A 3SYJA 2W3KA 3TK5A 3TGJE 1KYNA 1G2LA 1TBRH 3SO3A 3ZYEA 2R3YA 1RFNA 2ZFQH 4CHAC 2P59A 3QO6A 3FP8E 2GT7A 1MTVA 1W0KD 4Q7ZA 5HM9A 2BXTH 5GPIB 1HPGA 4XBBA 2TIOA 4YLUA 4DG4A 2WV4A 6CHAB 3RU4E 1EQ9A 2FZZA 2PV9B 2SFAA 1CSOE 4FUFA 1L0ZA 2VINA 4DIHH 4F4OC 1XUGA 3OU0A 4I31A 3I78A 2BOHB 1SQTA 2WINI 1DXPA 1GHWH 1ABIH 2Z9LA 3TJVA 1TNIA 3OY6U 3VXFH 3UQVA 3VB3A 3MO3A 1F0UA 2FLBH 5EOKA 3ATMA 3MYWA 1GBBA 2GCHF 1O39A 3A86A 3DFLA 3U1JB 2JH0D 3F9HA 1DUAA 1IQLA 1PQAA 2QE7D 4B6EA 1GHAG 4Q63A 5SGAE 2O8WA 3S9AA 4IN2A 3SGBE 1W10U 2ODQA 1AN1E 2G4UA 2PFEA 2B9LA 1EJMA 1WSSH 5FBIA 3UREA 5EPYA 2A4OA 1ZTLA 4IMZA 4I7YH 1SC8U 1QJ7B 2FS8A 2ZHFH 4WXIA 5E8EH 3R0FA 3TNTA 3KQCA 1FMGA 1GHXH 4NIXA 2DE9A 4ESTE 1SGCA 3A7VA 1GJ9B 3GY6A 2FODA 1GBHA 3SNEA 3MU8A 2FI5E 1MAXA 2O8LA 3L6PA 1AB9B 5C20A 2ASUB 2G52A 3DUXH 2W7SA 2ZU1A 4FUHA 3P8FA 2ZDAH 1HXFH 3F2HA 1RRKA 1TWXB 4CRGA 1ZHMA 2XBXA 3OTJE 3A8BA 3M35A 1KXBA 3MH4A 3TITA 1MTWA 3UOPA 3Q3YA 1SR5C 1Z8JB 1SGDE 5EG4A 1T8LA 3CS0A 1V2MT 4IS5A 3F0PA 1ESBA 2O9QA 3M37A 2A0QB 4MVNA 4AB9A 1P04A 4O9VA 1V2QT 3RM2H 2A4RA 1A4WH 2BY8X 3MO9A 4X1SU 3O8RA 1DSTA 1TYNA 1ARCA 1A61H 2QXJA 1O0DH 2Y5FA 3SGAE 3BEIB 4KTSA 1GJAB 5JB9S 1BTPA 5HGGA 2XBWA 5JBCS 1CU1A 1PJPA 4XDEA 3VPKA 1YCPK 1NFXA 3TPIZ 4ABBA 2BXUH 3GICB 2H9HA 2VVVA 1HAXB 2ANYA 4K69A 3ZZ6A 1KXDA 3RU4T 2AGIX 3RXKA 1CHGA 3PO1B 2C90B 1TNJA 3KYGA 1THPB 1QB9A 1WTGH 2FS9A 4ZKRU 2M5TA 4MLFB 3K6YA 1K1MA 4GHQA 4D9RA 2J98A 4XSKU 1PPCE 2BVRH 4GSOA 4ISIH 1H1BA 2R2MB 1GHZA 3I77A 2V3MA 1O3BA 5FPSA 2K8IA 4XRNA 3UY9A 1O31A 2NWNA 1BMMH 5LPRA 1HAGE 1TGCA 3PWCA 5GXPA 2L6OA 1RS0A 1ARBA 4ABAA 4Y0YE 4ZAEA 4SGBE 5F6MA 1QCPA 1HRTH 2AHME 5TCAA 3LOXA 1ELDE 5FAHA 1GCDA 2ZPRA 2JH6D 4GUXA 1TONA 1O3JA 3D65E 1JWTA 4AFZA 5I46H 3MNCA 2W26A 1GI3A 1EPTB 3M5MA 4PROA 1KLJH 3IWMA 4UFDH 5HIYA 3NPSA 1Y5UT 3P17H 1XVMA 3AAVA 3KF2A 1K1NA 1S6LA 1UW7A 1FNIA 2QF3A 3A7YA 3PMHB 1MBMA 4AN7A 3U8RH 2G81E 5E0GA 2JETB 4E06H 1E37B 2XNIA 3M5LA 3AVZA 1OWIA 4A1VA 1UK2A 1ZGVA 4YTAA 4BAQB 3A81A 4J1YA 1K0HA 1JMOH 2FMJA 1LHCH 3SI3H 7ESTE 1MQ6A 2FDAA 2ZCHP 1MU8B 4ABEA 3Q00A 3FO8D 3BTEE 1H4WA 2VIPA 3LJOA 1HAHH 1QBNA 1SGYE 2FTMA 4NWLA 1Y3XA 4P02A 1PYTC 3UNQA 1XKBC 4I32A 3ZV9A 4RN6A 4AYVB 5EQRA 1O2SA 3MMGA 2PKAB 2PSYA 4J2YB 1C2FA 1YLNA 3SU2A 4WMEA 3KEEA 1GDNA 1PPZA 2TGTA 1AZZA 1EX3A 1P02A 1ZOMA 1DS2E 1MU6B 1O2NA 4MPWA 1GPZA 1S6HA 1D9IA 2ZECA 1OWJA 3K9XB 3FN8A 2F43B 4LOYH 3RXTA 3TVJB 1KSNA 4RKOB 3DA9B 4ACBA 1J8AA 3H5CB 3MH6A 1GJCB 3PV5A 2CJIA 3SU6A 3FVFB 4X8UH 4H4FA 1JRTA 1CGHA 4INHA 5K7RA 1C2JA 1HAIH 1BTHH 1O2UA 2JJ1D 4INKA 3ELAH 1N6XA 3ZVDA 3UTUH 1FN8A 2BDBA 2J38A 1QB6A 3NK8A 1FQ3A 4CRAA 1L1NA 1TA6A 2B7DH 3PLPA 1Y3WA 2BY5X 2QXIA 3MH7A 1ZMJA 1P2OA 3QN7A 1ZTJA 1O5BB 4VGCB 4Z6AH 1O2PA 4ZCNA 3T26A 4JZIA 2FO9A 3HGNA 2GZ7A 4Q7XA 1GJ4H 1C5TA 4MPUA 2GMTB 3NZIA 4BAKB 1QY6A 1WAYB 1P9SA 1GMHG 2ILNA 2PR3A 1BMLA 1Y3VA 5DKMA 2LP6A 1TAWA 2R0LA 2YMSC 4A5TS 1WYKA 3URCA 2P95A 3HK6B 4OS6A 5AVDA 2H6MA 3SU0A 3ZVEA 8GCHG 1O36A 4CR5A 1AVGH 1WDIA 1FONA 1SHYA 2GD4B 2XNDD 4YO9A 4ZXXH 3BG4B 4MDSA 3ZVAA 3RC4A 2V6NA 1EB1H 1OYQA 1GJBB 4DURA 1ZPCA 1MMJN 3SV8A 2CHAC 4IMQA 3E0PB 3PYHA 4YM9A 2CXVA 1GGDC 2PKSC 4FUBA 2AYWA 2WPDD 2Z9KA 2Z3EA 3TK6A 4B1TA 5A0BA 4XBCA 5A0CA 2ZU3A 2Y6TA 3SUEA 4YXWD 4JYTA 3BIUH 1NN6A 1NO9H 1C5NH 3RXUA 1MH0A 4Y7BA 3DD2H 1GL1A 3PRBA 1X7AC 3UR9A 3ZZAA 4X1PU 1GG6B 1VZQH 3A7XA 1ZZZA 3EAJA 2OC0A 4AC9A 3S0NA 3GYLB 4XOJA 2FESH 1VITG 3ATIA 2XYAA 1W13U 3OX7U 4HGCA 4BTUB 2OCVB 5EXLA 1L4DA 2WZQA 2GX4A 1Y5AT 1A5HA 5C1UA 1GHVH 3FFGA 3A83A 1WUNH 1W3CA 1YLDA 1ZHPA 1MKWH 2AFQB 4O97A 1TABE 3CS7A 2VB0A 3STIA 4BXSA 1BCUH 2JJ2D 1AD8H 2ZGHA 4UFGH 9ESTA 2OD3B 2VGCB 1G9IE 1TX8A 2ZP0H 2ULLA 1W2KH 3C1KA 3F9EA 1Y3UA 3KYFA 4B2CA 1MTNB 2BZAA 3A82A 1CT2E 1GHBF 5DG6A 1FAKH 2KM0A 1V2LT 3QZQA 2EA3A 3M5OA 1LVBA 4ABJA 6CHAC 1TRMA 1XX9A 1AWHB 4IGDA 3MNXA 1HDTH 1Z8GA 2BLOA 2BQ7B 1JXPA 1E0FD 1GI8B 3UR6A 2QN5T 3LC3A 4OS5A 4Y11E 3WWFA 5CMXH 4NGAH 1BITA 4MNXA 4Y0ZE 2ZU2A 2RA3A 1EFRD 1WBGB 3VGCB 3SNBA 2NU1E 1SGPE 1DPOA 2JDID 1YF4A 3A8CA 1EPTA 1P11E 5A8YA 2ALVA 3BTQE 2P8OC 2ZHWH 2OC7A 1C4V2 3JZ2B 4KKDA 1LMWB 3RLWH 2ZFTA 3UPEA 1GWAA 1E38B 3H09A 4AFQA 1A0JA 5LPEA 3HKJB 1EASA 1O2QA 1V2WT 3NWUA 5GIBA 4FU7A 3URDA 2PTNA 4WWYA 1XM1A 2SGFE 1P2QA 1H8IH 1PPBH 1KXFA 1CA0C 1S82A 2FLRH 2H5CA 5C0TA 4TY6A 3NCLA 3RMLH 4B74A 4GAWA 3T25A 1DWEH 1BBRK 1GHAF 1YWUA 3CNRA 4MTBA 2Z3DA 2VWOA 4KGAA 3S7KB 5KECA 2UWOA 4X1QU 3DCLA 1RTFB 1SL3A 2A31A 2BZ6H 4Y10E 1Z1IA 1XXFA 1IHTH 2OINA 1VITH 1Z6EA 1F5KU 1PQ8A 4CRDA 4XE4A 1ABJH 1Z71A 4CR9A 1AB9C 4UD9H 4BAMB 1ZGIA 2EI8A 3EA7A 1NRQH 2ESTE 1YM0A 1A46H 2BDCA 4XFQA 2C8WB 1MTUA 1UTNA 1W11U 4DOQA 4JZEH 3FOAA 1V2VT 3FKSD 1SGFG 5F8TA 1UCYH 2ZTYA 1QA0A 2WPHS 3VEQB 1N1LA 2IJOB 1GVZA 3WW7A 2BX3A 2BVSH 1BRBE 1RIWC 1BIOA 1BTYA 1DLKB 1QBVH 2ZU5A 3E1XB 3TU7H 5J4SA 4JZ1A 3HGPA 3BTGE 1TE0A 1P01A 2AGEX 3RXQA 1LHEH 5JBAS 2J98B 1NU7B 1J9CH 5DP7A 1P10A 5EJLA 2PUXB 1BTWA 1O34A 2IOTA 3V12A 2LELA 2AMDA 3BEUA 1HJAB 1P3CA 4X8TH 2EI6A 1MZAA 4BANB 1KXCA 4CH2B 2ZQ1A 1UMAH 4ZKOU 1FV9A 1NRPH 1BOQA 1P2IA 1LTOA 4R0IA 3ATLA 1S0RA 4Y8XA 1QJ6B 3KGPA 4X2XA 4MNYA 4Y76A 2WHXA 1O30A 1EJNA 1VGCB 1WOFA 1EZUC 2GJGA 1GI5A 3F68H 4ZH8A 1XVOA 5AF9H 1FY4A 1GMDG 4YESB 3PO1C 4JZFH 1ZTKA 3M3SA 3OAAD 2GGVB 4XD7D 3U1IB 1NROH 2HLDD 2NU4E 3U98H 1O5AB 1XUIA 7KMEH 3BTTE 3ZZCA 2KAIA 4WF8A 3O8BA 4UONA 4ISHH 1YGCH 9LPRA 4WXVA 5DP8A 1AWFH 3EA8A 1G37A 1TNKA 3UOUA 3KQBA 1SGIB 2SGPE 1QFKH 3E90B 2I6QA 1C5QA 3F2FA 1SLWB 1G32B 3A8DA 2CMYA 5DN6D 2BD7A 1GBLA 1IQNA 2Z9GA 3QLPH 1YPHC 1K21H 1PPHE 1D3QB 3ESTA 2R9PA 1UJ1A 1LDTT 4X0WU 2GP9B 2QC2A 1KTSB 3P8NA 3RUOA 1HUTH 3BTKE 3RXFA 5DP4A 4DT4A 2ZFPH 4I33A 6ESTA 1SB1H 1SPJA 1YLCA 3T29A 5F53A 2C8ZB 4FUJA 3A7WA 5DO4H 1ELFA 4CRFA 1PPEE 2JETC 1QURH 3KQEA 3LGIA 4WY3A 4NZQA 2CV3A 2ZWLH 1FI8A 1DWDH 1VCQA 5ABWA 1FAXA 3FAOA 1QGFA 4ZXYH 1NBME 1ORFA 1UVOA 3GISB 1ELCA 1BBRE 1BTZA 2J94A 5LH8A 3SW2B 1LQDB 3S7HB 2ZPQA 3D23A 5EQSA 4MQAA 5K0HA 4RT0A 1JIMA 1DXWA 4JZDH 1BRUP 1HCGA 2QY0B 1NBMD 1FUJA 1IQHA 2A7CA 1W12U 1TGBA 4WVPE 2ZU4A 1NS3A 8KME2 1EP5A 1GI2A 1P2KA 2BMGB 1OXGA 1XUJA 4GCHG 4AFUA 3OEED 4IBLH 1KIGH 2OBQA 4NIYA 1C5UA 3RC5A 1DANH 5AFYH 3U69H 1GBIA 5ESBA 5GJ4B 4DGJA 4OS2A 1GBCA 2OUAA 3A87A 2FEQH 3LU9B 1UVSH 3CENA 1D4PB 4K60A 1FY5A 4TWYA 1H9LB 4DT7B 3DSOA 3T28A 3RXSA 1RJXB 4X6OA 2A5KA 4A6LA 3SNAA 2VIVA 4JK6A 5EW2H 1ZMNA 2FYQA 3RXMA 1GI0A 3P8OA 2KFWA 1NT1A 1DFPA 1K22H 2QYIA 3SUGA 2BB4A 2GDDA 3CP7A 3AASA 2GCTB 4D7FA 1KLTA 3GDSA 1QRZA 1QL8A 3QUMP 3OE7D 1BB0B 3SUFA 1VJ9U 4ABDA 1YPLH 3K2UA 2HVYB 1MQ5A 1E36B 4H42U 1LPZB 1P2NA 2HNTE 1K2I1 2YOLA 2GMTC 3B9FH 4Q4LA 4Y8YA 1L2EA 3RXIA 4NA7A 1V2PT 1Y3YA 1WQSA 2V35A 4JCNA 4ASUD 4NA9H 1ZHRA 3KNXA 1OP0A 1P09A 1XMNB 1EAXA 1G3CA 2V3HH 4U32A 1BUIA 1OP2A 1UVPA 2AMQA 2P16A 3VB4A 3PM3A 3MNBA 1T32A 3GY3A 3MU1A 4MPVA 1AKSA 4O3UA 5C1XA 1D3DB 4JYVH 4NSVA 3PLKA 4M9FA 4ABGA 1W0ZU 1YPHE 1GMHF 1H8DH 1TOMH 3T27A 1YCPM 2A5IA 4HI3A 2QA9E 3IITA 1YP9A 4TPYA 5PTPA 1BHXB 1O3HA 4OM9A 5HYOA 4D9QA 8GCHF 1D6RA 2GTBA 2WPIS 2K1QA 5DP6A 1SLUB 1F7ZA 2XBYA 1HJ8A 3GY7A 1YYY1 3SQHE 4HTCH 1A5IA 4I8JA 1H8ED 2QF4A 1GG6C 4FUGA 3V7TA 4CRBA 3BTFE 4GHTA 2CN0H 1DX5M 1SQAA 1TGSZ 3HK3B 3T2NA 3LT3A 3ENSB 1AFQB 3GOVB 2Z9JA 5FX6A 1JBUH 1LPGB 5FHTA 4K1TA 2PTCE 1Y59T 4Q7YA 1ELGA 2ZHQH 1P06A 2ZCLP 1GMCG 1O3PB 2WYJA 4I8GA 1C1WH 2KZ4A 1T8MA 1QB1A 4YLQH 1N8OB 1SGEE 3PV2A 3BTME 1SGTA 1SGRE 1D3PB 1YBWA 3SNCA 1ELTA 1EATA 2EQNA 1VITF 4YOIA 2VIDA 2JKHA 2FOCA 3PLBA 1IQGA 3GY5A 2C8XB 1MTNC 5JBBS 1XKAC 2ODYB 1SOZA 1F92A 5CHAC 2HPPH 2F91A 3EE7A 7GCHG 4BAOB 1O2MA 5H4IB 5J4QA 5FXLA 2P3TB 1SFQB 4CHAB 1W7GH 2WV9A 4D8NA 2BTCE 3VXEH 2ZGCA 1LCYA 1KXAA 2EY4C 2BDHA 3ZVFA 5C3NA 2ZA5A 3EYDA 8ESTE 3F2GA 3M7UA 1DWBH 2FM2A 2FOMB 1QL7A 1HJ9A 3NUMA 4O3TA 1O3GA 1OS8A 2A7JA 4K8YA 4NG9H 5A2MH 1HB0B 1AUJA 1BMAA 4X8SH 3RLYH 2VJ1A 1SHHB 3RXRA 1C5LH 2W6ID 1KXEA 1O2LA 1EP6A 1H8HD 2B8OH 4K3JA 3F1SB 4I8LA 5AHGH 1FIWA 4Y71A 3SV6A 1C2MA 3TGKE 1DE7H 1TMTH 4ZHMU 3ZVGA 2FXRA 2SNWA 3S9BA 5F03A 4KTUA 5C0UA 1TNLA 3PTBA 1DOJA 3BTHE 3GYMA 3RXEA 3ZZ8A 1QBOA 1V6DA 1C1MA 2FOGA 1GBAA 4WJG2 3TH2H 1MBQA 1AFEH 1DT2A 5T6DA 3FP6E 5L2ZH 3N7OA 1UVUH 4A1TA 1P9UA 4DY7B 1ANDA 3FZDA 2VWLA 2XC0A 4LZ4B 1VCPA 2KCOA 4OGXA 4CH8B 4B6FA 1PQ7A 4OS4A 4DIIH 3P70B 1L1JA 3RXHA 1JRSA 4UE7H 3RMMH 1TPPA 1TBZH 1WU1A 1ZSLA 2A5AA 1O2HA 1HBTH 1IQKA 5A0AE 3LONA 2VBCA 2ZDKA 1EOJA 1ZYOA 2QGRA 4BTTB 1K9OE 2D1JA 1DWCH 1IOEA 3RDZA 1DY9A 3SQEE 1F5RA 5GWZA 1NRNH 1NRRH 1Q31A 3RXAA 1AU8A 3I29A 3EE0B 4B2BA 1ZJKA 2ZKSA 1TB6H 1BRCE 5DGJA 4A7IB 1IQFA 1QRWA 1SSXA 1J17T 1KTTB 2H9EH 1GCTC 2OC8A 1O3IA 1BT7A 5EXMA 5T1VA 1OWHA 3SI4H 2Z6BD 2KAIB 2ANWA 3RC6A 4MNVA 6GCHG 3F6UH 5C67A 2R2WU 2Q6GA 1HLTH 1BJUA 2G51A 1HAVA 1FDPA 2NU3E 3V13A 4GPGA 4UDWH 3RXBA 2BD4A 4X6MA 2ZG0H 5JBTA 1EJAA 4B75A 3M61U 1SGQE 4P00A 4B2AA 2SGAA 1C5YB 2WYGA 2WPKS 3UB0A 2AEIH 3Q3KA 3L33A 1SLVB 5EJZA 1TQ7B 3VB7A 4E05H 2Q6FA 1CQQA 1S6FA 2Y82A 4LXBH 1AVXA 4X6PA 3U9AH 1SVPA 2J34A 2QCYA 3UNRA 1Q2WA 4FETA 1M9UA 1MKWK 1O3OA 1OOKB 2THFB 3SV9A 3AK5A 5CHBA 5GCHG 2G4TA 1QHRB 1S84A 5FBEA 1C1OA 1V2JT 2VIQA 1T8OA 4DVAU 3KQ5A 2WUCA 1GMDF 1GI9B 1LHDH 1AUTC 3C27B 5IYTA 1O5CB 4NWKA 1O3CA 2BDAA 2J4IA 5BRRE 4X2YA 4FUIA 1F5LA 3TJOA 2Y7XA 5B6LA 2ZCKP 1PYTD 4JYUH 4Y8ZA 1GJ8B 3GCTG 4Z0KA 4JMYA 1ANCA 2A4GA 1LHFH 1GI4A 2ZFSA 3BIVH 2FI4E 2F4LA 2WUBA 1J16A 4NZLA 2OK5A 4QT8C 2OXSA 2O8UA 4KP0A 3GDUA 2VVUA 3A89A 3P95A 1VJAU 1W0JD 3BTWE 3ODDA 4I8KA 1GL0E 3UWIA 2EEKA 1DICA 1GJDB 4ASHA 3F9FA 3UWJH 2OTVA 1A1RA 1HXEH 1HAZB 1TX7A 4GLYA 2BD5A 4OS7A 5EQQA 4CBOA 1HGTH 3EGKH 3U8TH 3GCOA 2B0FA 1Z8IB 3LGVA 3WWBA 3OTPA 4AG2A 2PHBA 3SJ9A 1FXYA 3ZVCA 2D8WA 2GT8A 4YOJA 1H9HE 1TNHA 2XWAA 1GJ7B 4XBDA 1GI1A 1WQVH 2ZGXH 4H6SB 2F3CE 1XUFA 2RDLA 1L4ZA 2XTTB 5CDFE 3BG8A 2VU8E 2ZO3H 2O8TA 3RXLA 2IJD1 2OC1A 5E0HA 2Y5GA 2AS9A 2KX4A 2ZDMA 1GBEA 5JDUB 1TGTA 3OYPA 2ZQ2A 1YKTA 3UNSA 1QA7A 1C4U2 1DLEA 1NM6A 2V3OH 3VB6A 2RCEA 4TSFD 1SI5H 3PMJA 1DVAH 5AFZH 4B73A 2GZ8A 5KGOA 3VG8A 3E3TA 2XW9A 1YPJH 3SN8A 1AMHA 4AFSA 1HAOH 3MNSA 2YMSD 4O03A 5ETXA 3MQKC 4GCHF 2DE8A 3LGYA 1ETTH 3P92A 4X8VH 1AGJA 3WY8A 1P05A 2H5DA 3NRLA 1MKXH 2AERH 3G01A 1VCWA 1C5OH 2ZNKH 1RGQA 1C1VH 1FIZA 2W6JD 2QAAA 1AKSB 4KELA 3N7DA 3Q77A 1LVYA 2STBE 5F8XA 3U8OH 2KR7A 3FZZA 3V3MA 1UCYK 1CBWB 2AIPA 3GY4A 1THSH 2F9PA 1MD7A 2CGAA 4WMDA 1AI8H 2A4QA 3E16B 2A45B 1V2OT 2I6SA 1QIXB 1C2KA 2J92A 3OY5U 2G5VA 1UK3A 1O3EA 4ABHA 2QXGA 2Q1JA 5FL7D 1ESTA 3ZIAD 3MFJA 2CK3D 3ODFA 1V2UT 5C5NA 2BHGA 4D76A 1TGNA 1MAYA 2FOEA 2P94A 2G5NA 1K1LA 1HV7A 1O2KA 1NTPA 1BMNH 2D2DA 2L74A 2OP9A 2QF0A 2P3FH 3V0XA 1LHGH 1OKXA 4WH8A 5TCCA 1AIXH 4FUCA 4A92A 5EGMA 1CE5A 1F0SA 1NFUA 2OBOA 1A3BH 2XRCA 1CT0E 3Q76A 4RT1A 3SUDA 3K65B 1A2CH 1NC6A 2HVXA 3GDVA 2ZC9H 1C5PA 1PQ5A 1P57B 3LH1A 2CHAB 1GBJA 1GVLA 3ZV8A 1BDAA 1O35A 1FPCH 1O3LA 1ZPZA 2AGGX 4MNWA 1ZRKA 1LPKB 3ZZ9A 1SQOA 1ZJDA 3KN2A 2ZHDA 2Y81A 5HKKD 2HRVA 2ZTXA 4NIWA 2STAE 1LVMA 5A8ZA 3F9GA 1SKYE 1OP8A 2BQWB 1SMFE 2CF8H 1V2RT 3T62A 1C2LA 1LKBA 3RXPA 3M7TA 2BYAX 1TQ0B 1GBKA 1P8VC 4CRCA 4A1XA 2VH0A 4H6TA 4TYDA 1N8OC 3HKIB 3MO6A 3ZZ7A 3VFEA 1ANBA 3TLOA 2GV7A 4TWWA 1HIAB 4B71A 5T3HA 1CGIE 1DSUA 1COWD 1O2RA 4AB8A 1UTJA 3TJUA 1Z8RA 2IN2A 3R3GB 1GI7B 5HIZA 1EPTC 3TH4H 1GMCF 1D3TB 1UHBB 2BM2A 3S69A 1TPSA 1RTKA 1F2SE 2VIOA 1W8BH 1TMUH 1WV7H 4HG6A 1BZXE 1S81A 1O5EH 3GCNA 4LK4A 1C9PA 2WPLS 1J14A 4K5ZA 3ZVBA 3BSQA 5L30H 1YPKH 1Z7KA 2XCNA 1B5GH 1CA8B 1SG8B 4MG3A 1T4VH 3H7TA 3SU3A 1BTXA 1O2WA 5A8XA 2IPHA 1C1TA 1EZXC 3ZZDA 5EU8A 4HFPB 3UFAA 4FXGH 2ZZUH 7GCHF 1UTMA 5DJ7A 3RMNH 2Y5HA 5TJXA 5EJ1A 2PGQB 1O3KA 4CBNA 4F49A 1RTLA 2RFKC 2H9TH 1OYTH 5HM2A 1NFWA 3RU4D 1O32A 1WTHD 4BAHB 1VR1H 3EQ0H 1ID5H 1K1OA 1EB2A 3LGUA 1TX6A 5I25A 1UCYE 1TRNA 2FP7B 2PW8H 3AW1A 2P8OB 2J95A 4FU8A 3LIWA 1CHOG 3QWCH 1EAWA 4GVUA 3KIDU 1S5SA 2K0QA 5GDSH 1IQEA 4AORA 2Z9IA 5IK2D 1OWEA 1G36A 5GNDA 4WMFA 4YZUA 4X2WA 4I8HA 2V0BA 3W94A 5DP5A 3ZZBA 1AY6H 3S9CA 1UTLM 1O3MA 2Q6DA 1MUEB 1EOLA 3SV7A 1HAPH 1CA0B 5EPNA 2BD2A 2BLVA 3KQDA 1B0FA 3O8CA 3FP7E 3GCHB 3JZ1B 2TRMA 1AQ7A 3TIUA 2F83A 3SZNA 1MTSA 3SHCH 4X6NA 2ZGBH 2WPJS 4U01A 1ETSH 3ZYDA 5C94A 4VGCC 2HWLB 2XXLA 3O8DA 3QX5H 3RXDA 1C9TA 1SQRA 3LKWA 2F9UA 8LPRA 1C5MD 1T8NA 1OWKA 1L1GA 3N7EA 2Z3CA 2GVFA 2BY7X 1NZQH 1TIOA 1LO6A 3ZZ5A 1HAVB 1G3DA 1C1UH 1FLEE 4X1NU 1CGJE 3OEHD 1BJVA 3MU5A 3MH5A 2BDIA 3GY8A 4NFEA 2ZGJA 1C2HA 3PMBB 3MHWU 3BG4C 2ZF0H 5ESTE 2LPRA 2RDEA 1RIWB 2JIZD 2VH6A 2GV6A 1O5GH 1SGNE 3SGQE 2KCPA 2ODPA 5HXFA 1WCZA 3A7TA 2Y80A 1O33A 1C4Y2 2FOAA 1UTOA 3LDXH 1UTQA 3DHKH 1EXFA 3NXPA 1AVWA 4ABIA 1AHTH 3PRDA 2XC4A 2VVCA 3E0NB 1O3FA 3DSGA 3L3TA 4ZHAA 3SZEA 3STJA 1BMFD 1DUEA 1W0YH 1W14U 6GCHF 2RA0A 3EA9A 1UO6A 3LGTA 2P3UB 3SU4A 1F0TA 1FJSA 1S83A 1EKBB 1TOCB 1E35B 1SLXB 3OSYA 4Y79A 1YCPH 2BD3A 1ACBE 2BD8A 4AZ2B 1O5DH 3HATH 3ZZ3A 3PWBA 2JH5D 4E7RG 4E7NA 1C5XB 2W7UA 3MU4A 2NU2E 2F9NA 3D62A 1EZQA 2W3IA 1CO7E 2VGCC 1EAIA 4K2YA 3W1EA 1O2XA 2CF9H 1P2JA 5GCHF 1KDQA 5FCRA 2BY9X 2WPMS 1YC0A 5CE1A 2BDYA 2A1DB 4Y7AA 4ABFA 2Z7FE 4FOUC 3M36A 1YPEH 2OQ5A 4AG1A 3SHAH 3LGWA 7LPRA 1NU9A 4NA8A 1K28D 1G3BA 4MPXA 2P93A 1Z6JH 4FUDA 3MU0A 1SFIA 3GCTF 3M3TA 5E0JA 3GS9A 3U28C 1HIAA 2ZFFH 1QR3E 1PFXC 4CREA 2ZEBA 3A84A 2A32A 4BOHA 4ISLA 3VGCC 5C17A 1P12E 1EUFA 1OWDA 1C5RA 1TBQH 1MD8A 3OFND 4X1RU 1UHBA 2GCHG 2SGQE 1CVWH 2FWWA 1FX0B 3LC5A 1IQJA 5T6FA 1J15A 1N6YA 4OGYA 5EODA 4K1SA 1MZDA 2KCYA 2C4FH 2V7QD 1AE8H 1BHXF 1O2TA 1ESAA 2AIQA 2XBVA 3MI4A 4UFFH 5L2YH 3F3BA 1C2IA 2BD9A 1T4UH 1PPGE 2C3SA 2FOFA 3DFJA 3BN9A 2R3UA 1C1QA 3H7OA 4Q80A 1GDQA 2TPIZ 1OSSA 3M3VA 3AW0A 1C2GA 1QJ1B 2XC5A 4FUEA 4ISOA 2AH4X 4KTCA 3SV2H 1TPOA 2FI3E 2TGDA 1O2IA 4ZKSU 1YPGH 3B23B 3ATWA 1ELBA 3UIRA 1UVTH 1E1QD 1UTKA 1V2NT 4U30A 2XCFA 5T6GA 1P0SH 1THRH 2PUQH 1AE5A 2F9OA 3QGJA 3W95A 4DCDA 3F0OA 1ZLRA 4RI0A 1V2TT 2OLGA 5HMAA 1P3EA 3M7QA 4UFEH 2HNTF 1HAYB 1TNGA 2QV1A 5E2OA 4LZ1H 1QQUA 4ZKNU 1V2KT 5C5OA 2ZDVH 1FY3A 1O38A 2BX4A 4RKJB 1FY1A 3TNSA 4Q2KA 3SJ8A 3A7ZA 1CT4E 1CBWC 3TJNA 3ATKA 4IC5A 1NRSH 1C1NA 2HGTH 3A80A 5EIYA 5EW1H 5A09A 2ZDLA 1T7CA 1C1PA 1C1RA 2SNVA 3E91A 2IPQX 1GBMA 1TALA 1NY22 1B0EA 4NCYA 5FCKA 2UWPA 2UWLA 4UEHH 3SOSA 1A0LA 2F9VA 4K8BA 1GHYH 1O2OA 3QK1A 4FVBA 2XOKD 4Z1MD 5LPFA 2HOBA 1TMBH 1C2DA 1BQYA 2WSSD 1O3DA 3SNDA 1HJAC 3P6ZB 2A7HA 3E6PH 1GBFA 4WH6A 3SORA 1ZSKA 1WXRA 2QIQA 1QRXA 1G3EA 3BTDE 5DK1A 2PSXA 3RP2A 1JIRA 1O37A 2HALA 1FY8E 1VGCC 1C2EA 3P8GA 1V3XA 4IW4E 4TY7A 3MWIU 3HPTB 1AO5A 1O2ZA 1GBDA 1LQEA 1O2GH 2UUJB 2G8TA 1T31A 1DDJA 5JB8S 5KEDA 1V2ST 5DSFA 4JK5A 3VB5A 2BY6X 2QF5A 4BXWA 4YOGA 1QTFA 2FX4A 1W7XH 3BV9B 1E34B 2LNCA 4FVDA 2FOHA 1C5ZB 2O8MA 1GDUA 2UUKB 3M5NA 4ZUHA 1ETRH 2ZIQH 1EAUA 1EZSC 3A8AA 1K1JA 1FN6A 2EC9H 1HYLA 3FANA 1Z1JA 4AYYB 1K1IA 4AGKA 2F9BH 4FU9A 3ITIA 1ELVA 1O5FH 1GBTA 1K1PA 4ZHLU 1IQMA 1ELEE 2C8YB 3PROA 5E2PA 5DP9A 2H2ZA 1MABB 4F55A 1BTUA 2VWMA 2Y7ZA 3SU1A 3MOCA 2Z94A 2HPQH 2ALPA 2H1UA 4IC6A 5B6OA 1XXDA 1A7SA 2KCAA 2PWXA 2VIWA 1XUHA 4D7GA 2A2XH 1B7XB 3RXJA 3MTYA 5CHAB 1IAUA 2M2AA 2GDEH 1ZMLA 1D6WA 3PV4A 1OHHD 3BF6H 3QTVH 6LPRA 5LGOA 5G4BA 2FTLE 1UTPA 1FZZA 2UUFB 1NESE 4NIVA 2HLCA 2A2QH 1TFXA 5C1YA 3RXVA 4IN1A 2ZHEH 1E1RD 3DT0H 4Y6DA 3PMAB 1INCA 3RM0H 2TGAA 1RXPA 1TPAE 1QZ8A 3KCGH 3N99A 2UUYA 4YT7H 2QXHA 4NSYA 4RSPA 2W5EA 3DSPA 4ACAA 1S0QA 1GVKB 1GI6A 4OS1A 1QNJA 5FX5A 1P03A 4DW2U 1C5SA 2FIRH 1OX1A 3QGNB 1BRAA 1Y5BT 3Q3XA 3RXCA 3LJJA 2XWBI 1MKXK 2PGBB 2FOBA 2BLWA 2BVXH 4X2VA 4I86A 1SBWA 1DITH 2DUCA 3RXOA 2OQUA 1JOUB 3EDXB 1SGFA 1CHOF 1ELAA 5JPMH 1SOTA 1UK4A 1KMHB 2AMPA 3GCHC 1NPMA 1BA8B 4M7GA 2ZTZA 2BOKA 2ZDNA 3TH3H 1H9IE 2G55A 2YNBA 1LKAA 1G30B 1QQ4A 1DM4B 1YPMH 1C1SA 2GCTC 2FPZA 5FPYA 1BBRH 1U6QA 1TLDA 4TPIZ 2PKAA 3IG6B 1KY9A 4BTIB 1GJ6A 1MCVA 2PLXA 3PTNA 1C5WB 1A0HB 1E79D 3UUZA 2BDGA 4TT3D 2G00A 2FYRA 1KLIH 4YT6H 4F48B 2ZI2H 3A85A 5JYIA 5L6NH 3AAUA 3D49H 1VKYA 3SBKA 1O2YA 2WV5A 3B8JA 1C5VA 2RG3A 3LPRA 2ZFRH 2GKVE 2R0KA 2YMSB 3RMOH 3E8LA 3BEFB 2ANMH 3QTOH 1HNEE 1ZR0A 3NKKA 4THNH 5DP3A 4ISNA 4AGJA 3SU5A 1ZRBA 5IDKA 2TBSA 2B5TB 1ZPBA 2TGPZ 5FPTA 2J2UA 1Y8TA 1MCTA 1ANEA 3QDZB 1PPFE 1RD3B 2BQ6B 1GCTB 1TA2A 5F8ZA 4U2WA 1GGDB 2PKSB 2J97A 3TGIE 3TK9A 1O3AA 1A5GH 4AOQA 2ANKH 1TRYA 1O2VA 1QL9A 4ZMAH 1KDQB 3QZRA 2VWNA 1FPHH 1OPHB 3SJOA 1O2JA 2PP6A 2VNTA 1Q3XA 1AFQC 2GZ9A 3UQOA 3RXGA 3ZZ4A 4BNRA 1F0RA 3K6ZA 1S85A 1AZ8A 3KHVA 3KL6A 1NFYA 1ZSJA 2BLQA 1O3NA 4SGAE 4ZROA 1XUKA 4HZHA 1IQIA 3SJKA 2YNAA 1DY8A 3GY2A 1LVOA 1A3EH 1YY3A 2HNTC 4K1EA
chains in the Genus database with same CATH topology
2SGDE 2SGEE 5EXNA 4B76A 3PB1E 5BPEA 1GHBG 2C93B 3T5FH 5C2ZA 1G2MA 1GJ5H 2FX6A 1P2MA 2NU0E 1IHSH 4INLA 4R8TB 2D26C 3SJIA 4AX9H 3LH3A 3A88A 4NFFA 4DJZB 5DPAA 1HFDA 2J9NA 2ZPSA 2EI7A 2W3KA 3TK5A 3TGJE 1KYNA 1G2LA 1TBRH 3SO3A 3ZYEA 2R3YA 1RFNA 2ZFQH 4CHAC 2P59A 3QO6A 3FP8E 2GT7A 1MTVA 5HM9A 4Q7ZA 2BXTH 5GPIB 1HPGA 4XBBA 2TIOA 4YLUA 4DG4A 2WV4A 6CHAB 3RU4E 1EQ9A 2FZZA 2PV9B 2SFAA 1CSOE 4FUFA 1L0ZA 2VINA 4DIHH 4F4OC 1XUGA 3OU0A 4I31A 3I78A 2BOHB 1SQTA 2WINI 1DXPA 1GHWH 1ABIH 2Z9LA 3TJVA 1TNIA 3OY6U 3VXFH 3UQVA 3VB3A 3MO3A 1F0UA 2FLBH 5EOKA 3ATMA 3MYWA 1GBBA 2GCHF 1O39A 3A86A 3DFLA 3U1JB 2JH0D 3F9HA 1DUAA 1IQLA 1PQAA 1GHAG 5SGAE 2O8WA 3S9AA 4IN2A 3SGBE 1W10U 2ODQA 1AN1E 2G4UA 2PFEA 2B9LA 1EJMA 1WSSH 5FBIA 3UREA 5EPYA 2A4OA 1ZTLA 4IMZA 4I7YH 1SC8U 1QJ7B 2FS8A 2ZHFH 4WXIA 5E8EH 3R0FA 3TNTA 3KQCA 1FMGA 1GHXH 4NIXA 2DE9A 4ESTE 1SGCA 3A7VA 1GJ9B 3GY6A 2FODA 1GBHA 3SNEA 3MU8A 2FI5E 1MAXA 2O8LA 3L6PA 1AB9B 5C20A 2ASUB 2G52A 3DUXH 2W7SA 2ZU1A 4FUHA 3P8FA 2ZDAH 1HXFH 1RRKA 1TWXB 4CRGA 1ZHMA 2XBXA 3OTJE 3A8BA 3M35A 1KXBA 3MH4A 3TITA 1MTWA 3UOPA 3Q3YA 1SR5C 1Z8JB 1SGDE 5EG4A 1T8LA 3CS0A 1V2MT 4IS5A 1ESBA 2O9QA 3M37A 2A0QB 4MVNA 4AB9A 1P04A 4O9VA 1V2QT 3RM2H 2A4RA 1A4WH 2BY8X 3MO9A 4X1SU 3O8RA 1DSTA 1TYNA 1ARCA 1A61H 2QXJA 1O0DH 2Y5FA 3SGAE 3BEIB 4KTSA 1GJAB 5JB9S 1BTPA 5HGGA 2XBWA 5JBCS 1CU1A 1PJPA 4XDEA 3VPKA 1YCPK 1NFXA 3TPIZ 4ABBA 2BXUH 3GICB 2H9HA 2VVVA 1HAXB 2ANYA 4K69A 3ZZ6A 1KXDA 3RU4T 2AGIX 3RXKA 1CHGA 3PO1B 2C90B 1TNJA 1THPB 1QB9A 1WTGH 2FS9A 4ZKRU 2M5TA 4MLFB 3K6YA 1K1MA 4GHQA 4D9RA 4XSKU 1PPCE 2BVRH 4GSOA 4ISIH 1H1BA 2R2MB 1GHZA 3I77A 1O3BA 5FPSA 3UY9A 1O31A 2NWNA 1BMMH 5LPRA 1HAGE 1TGCA 3PWCA 5GXPA 1RS0A 1ARBA 4ABAA 4Y0YE 4ZAEA 4SGBE 5F6MA 1QCPA 1HRTH 5TCAA 3LOXA 1ELDE 5FAHA 1GCDA 2ZPRA 2JH6D 4GUXA 1TONA 1O3JA 3D65E 1JWTA 4AFZA 5I46H 3MNCA 2W26A 1GI3A 1EPTB 3M5MA 4PROA 1KLJH 3IWMA 4UFDH 3NPSA 1Y5UT 3P17H 1XVMA 3AAVA 3KF2A 1K1NA 3A7YA 1FNIA 2QF3A 3PMHB 1MBMA 4AN7A 3U8RH 2G81E 5E0GA 2JETB 4E06H 1E37B 2XNIA 3M5LA 3AVZA 1OWIA 4A1VA 1UK2A 1ZGVA 4YTAA 4BAQB 3A81A 4J1YA 1JMOH 2FMJA 1LHCH 3SI3H 7ESTE 1MQ6A 2FDAA 2ZCHP 1MU8B 4ABEA 3Q00A 3BTEE 1H4WA 2VIPA 3LJOA 1HAHH 1QBNA 1SGYE 2FTMA 4NWLA 1Y3XA 1PYTC 3UNQA 1XKBC 4I32A 3ZV9A 4RN6A 4AYVB 5EQRA 1O2SA 3MMGA 2PKAB 2PSYA 4J2YB 1C2FA 3SU2A 4WMEA 3KEEA 1GDNA 1PPZA 2TGTA 1AZZA 1EX3A 1P02A 1ZOMA 1DS2E 1MU6B 1O2NA 4MPWA 1GPZA 1S6HA 1D9IA 2ZECA 1OWJA 3K9XB 4LOYH 3RXTA 3TVJB 1KSNA 4RKOB 3DA9B 1J8AA 3H5CB 3MH6A 1GJCB 2CJIA 3SU6A 3FVFB 4X8UH 4H4FA 1JRTA 1CGHA 4INHA 5K7RA 1C2JA 1HAIH 1BTHH 1O2UA 4INKA 3ELAH 1N6XA 3ZVDA 3UTUH 1FN8A 2BDBA 2J38A 1QB6A 3NK8A 1FQ3A 4CRAA 1L1NA 1TA6A 2B7DH 3PLPA 1Y3WA 2BY5X 2QXIA 3MH7A 1ZMJA 1P2OA 3QN7A 1ZTJA 1O5BB 4VGCB 4Z6AH 1O2PA 3T26A 4JZIA 2FO9A 3HGNA 2GZ7A 4Q7XA 1GJ4H 1C5TA 4MPUA 2GMTB 3NZIA 4BAKB 1QY6A 1WAYB 1P9SA 1GMHG 2ILNA 2PR3A 1BMLA 1Y3VA 5DKMA 1TAWA 2R0LA 4A5TS 1WYKA 3URCA 2P95A 3HK6B 4OS6A 5AVDA 2H6MA 3SU0A 3ZVEA 8GCHG 1O36A 4CR5A 1AVGH 1FONA 1SHYA 2GD4B 4YO9A 4ZXXH 3BG4B 4MDSA 3ZVAA 3RC4A 2V6NA 1EB1H 1OYQA 1GJBB 4DURA 1ZPCA 1MMJN 3SV8A 2CHAC 4IMQA 3E0PB 3PYHA 4YM9A 2CXVA 1GGDC 2PKSC 4FUBA 2AYWA 2Z9KA 2Z3EA 3TK6A 4B1TA 5A0BA 4XBCA 5A0CA 2ZU3A 2Y6TA 3SUEA 4JYTA 3BIUH 1NN6A 1NO9H 1C5NH 3RXUA 1MH0A 4Y7BA 3DD2H 1GL1A 1X7AC 3UR9A 3ZZAA 4X1PU 1GG6B 1VZQH 3A7XA 1ZZZA 3EAJA 2OC0A 3S0NA 3GYLB 4XOJA 2FESH 1VITG 3ATIA 2XYAA 1W13U 3OX7U 4HGCA 4BTUB 2OCVB 5EXLA 1L4DA 5C1UA 2GX4A 1Y5AT 1A5HA 1GHVH 3FFGA 3A83A 1WUNH 1W3CA 1YLDA 1ZHPA 1MKWH 2AFQB 4O97A 1TABE 3CS7A 2VB0A 3STIA 4BXSA 1BCUH 1AD8H 2ZGHA 4UFGH 9ESTA 2OD3B 2VGCB 1G9IE 1TX8A 2ZP0H 2ULLA 1W2KH 3C1KA 3F9EA 1Y3UA 4B2CA 1MTNB 2BZAA 3A82A 1CT2E 1GHBF 5DG6A 1FAKH 1V2LT 3QZQA 2EA3A 3M5OA 1LVBA 4ABJA 6CHAC 1TRMA 1XX9A 1AWHB 4IGDA 3MNXA 1HDTH 1Z8GA 2BLOA 2BQ7B 1JXPA 1E0FD 1GI8B 3UR6A 2QN5T 3LC3A 4OS5A 4Y11E 5CMXH 4NGAH 1BITA 4MNXA 4Y0ZE 2ZU2A 2RA3A 1WBGB 3VGCB 3SNBA 2NU1E 1SGPE 1DPOA 1YF4A 3A8CA 1EPTA 1P11E 5A8YA 2ALVA 3BTQE 2P8OC 2ZHWH 2OC7A 1C4V2 3JZ2B 4KKDA 1LMWB 3RLWH 2ZFTA 3UPEA 1GWAA 1E38B 4AFQA 1A0JA 5LPEA 3HKJB 1EASA 1O2QA 1V2WT 3NWUA 5GIBA 4FU7A 3URDA 2PTNA 4WWYA 1XM1A 2SGFE 1P2QA 1H8IH 1PPBH 1KXFA 1CA0C 1S82A 2FLRH 2H5CA 4TY6A 3NCLA 3RMLH 4B74A 4GAWA 3T25A 1DWEH 1BBRK 1GHAF 4MTBA 2Z3DA 2VWOA 4KGAA 3S7KB 2UWOA 4X1QU 1RTFB 1SL3A 2A31A 2BZ6H 4Y10E 1Z1IA 1XXFA 1IHTH 2OINA 1VITH 1Z6EA 1F5KU 1PQ8A 4CRDA 4XE4A 1ABJH 1Z71A 4CR9A 1AB9C 4UD9H 4BAMB 1ZGIA 2EI8A 3EA7A 1NRQH 2ESTE 1YM0A 1A46H 2BDCA 4XFQA 2C8WB 1MTUA 1UTNA 1W11U 4DOQA 4JZEH 1V2VT 1SGFG 5F8TA 1UCYH 2ZTYA 1QA0A 2WPHS 3VEQB 1N1LA 2IJOB 1GVZA 2BX3A 2BVSH 1BRBE 1RIWC 1BIOA 1BTYA 1DLKB 1QBVH 2ZU5A 3E1XB 3TU7H 5J4SA 4JZ1A 3HGPA 3BTGE 1TE0A 1P01A 2AGEX 3RXQA 1LHEH 5JBAS 1NU7B 1J9CH 5DP7A 1P10A 2PUXB 1BTWA 1O34A 2IOTA 3V12A 2AMDA 3BEUA 1HJAB 1P3CA 4X8TH 2EI6A 1MZAA 4BANB 1KXCA 4CH2B 2ZQ1A 1UMAH 4ZKOU 1FV9A 1NRPH 1BOQA 1P2IA 1LTOA 4R0IA 3ATLA 1S0RA 4Y8XA 1QJ6B 3KGPA 4X2XA 4MNYA 4Y76A 1O30A 1EJNA 1VGCB 1WOFA 1EZUC 1GI5A 3F68H 4ZH8A 1XVOA 5AF9H 1FY4A 1GMDG 4YESB 3PO1C 4JZFH 1ZTKA 3M3SA 2GGVB 3U1IB 1NROH 2NU4E 3U98H 1O5AB 1XUIA 7KMEH 3BTTE 3ZZCA 2KAIA 4WF8A 3O8BA 4UONA 4ISHH 1YGCH 9LPRA 4WXVA 5DP8A 1AWFH 3EA8A 1G37A 1TNKA 3UOUA 3KQBA 1SGIB 2SGPE 1QFKH 3E90B 2I6QA 1C5QA 1SLWB 1G32B 3A8DA 2CMYA 2BD7A 1GBLA 1IQNA 2Z9GA 3QLPH 1YPHC 1K21H 1PPHE 1D3QB 3ESTA 2R9PA 1UJ1A 1LDTT 4X0WU 2GP9B 2QC2A 1KTSB 3P8NA 3RUOA 1HUTH 3BTKE 3RXFA 5DP4A 2ZFPH 4I33A 6ESTA 1SB1H 1SPJA 1YLCA 3T29A 2C8ZB 4FUJA 3A7WA 5DO4H 1ELFA 4CRFA 1PPEE 2JETC 1QURH 3KQEA 3LGIA 4WY3A 4NZQA 2CV3A 2ZWLH 1FI8A 1DWDH 1VCQA 5ABWA 1FAXA 3FAOA 1QGFA 4ZXYH 1ORFA 1UVOA 3GISB 1ELCA 1BBRE 1BTZA 2J94A 5LH8A 3SW2B 1LQDB 3S7HB 2ZPQA 3D23A 5EQSA 4MQAA 5K0HA 1JIMA 1DXWA 4JZDH 1BRUP 1HCGA 2QY0B 1FUJA 1IQHA 2A7CA 1W12U 1TGBA 4WVPE 2ZU4A 1NS3A 8KME2 1EP5A 1GI2A 1P2KA 2BMGB 1OXGA 1XUJA 4GCHG 4AFUA 4IBLH 1KIGH 2OBQA 4NIYA 1C5UA 3RC5A 1DANH 5AFYH 3U69H 1GBIA 5ESBA 5GJ4B 4DGJA 4OS2A 1GBCA 2OUAA 3A87A 2FEQH 3LU9B 1UVSH 3CENA 1D4PB 4K60A 1FY5A 4TWYA 1H9LB 4DT7B 3T28A 3RXSA 1RJXB 4X6OA 2A5KA 4A6LA 3SNAA 2VIVA 4JK6A 5EW2H 1ZMNA 2FYQA 3RXMA 1GI0A 3P8OA 1NT1A 1DFPA 1K22H 2QYIA 3SUGA 2BB4A 2GDDA 3CP7A 3AASA 2GCTB 4D7FA 1KLTA 3GDSA 1QRZA 1QL8A 3QUMP 3SUFA 1BB0B 1VJ9U 4ABDA 1YPLH 3K2UA 1MQ5A 1E36B 4H42U 1LPZB 1P2NA 2HNTE 1K2I1 2YOLA 2GMTC 3B9FH 4Y8YA 1L2EA 3RXIA 4NA7A 1V2PT 1Y3YA 1WQSA 2V35A 4JCNA 4NA9H 1ZHRA 3KNXA 1OP0A 1P09A 1XMNB 1EAXA 1G3CA 2V3HH 4U32A 1BUIA 1OP2A 1UVPA 2AMQA 2P16A 3VB4A 3PM3A 3MNBA 1T32A 3GY3A 3MU1A 4MPVA 1AKSA 4O3UA 5C1XA 1D3DB 4JYVH 4NSVA 3PLKA 4ABGA 1W0ZU 1YPHE 1GMHF 1H8DH 1TOMH 3T27A 1YCPM 2A5IA 4HI3A 2QA9E 3IITA 1YP9A 4TPYA 5PTPA 1BHXB 1O3HA 5HYOA 4D9QA 8GCHF 1D6RA 2GTBA 2WPIS 2K1QA 5DP6A 1SLUB 1F7ZA 2XBYA 1HJ8A 3GY7A 1YYY1 3SQHE 4HTCH 1A5IA 4I8JA 1GG6C 4FUGA 3V7TA 4CRBA 3BTFE 4GHTA 2CN0H 1DX5M 1SQAA 1TGSZ 3HK3B 3T2NA 3LT3A 3ENSB 1AFQB 3GOVB 2Z9JA 5FX6A 1JBUH 1LPGB 5FHTA 4K1TA 2PTCE 1Y59T 4Q7YA 1ELGA 2ZHQH 1P06A 2ZCLP 1GMCG 1O3PB 2WYJA 4I8GA 1C1WH 1T8MA 1QB1A 4YLQH 1N8OB 1SGEE 3BTME 1SGTA 1SGRE 1D3PB 1YBWA 3SNCA 1ELTA 1EATA 4YOIA 1VITF 2VIDA 2JKHA 2FOCA 3PLBA 1IQGA 3GY5A 2C8XB 1MTNC 5JBBS 1XKAC 2ODYB 1SOZA 1F92A 5CHAC 2HPPH 2F91A 7GCHG 4BAOB 1O2MA 5H4IB 5J4QA 5FXLA 2P3TB 1SFQB 4CHAB 1W7GH 4D8NA 2BTCE 3VXEH 2ZGCA 1LCYA 1KXAA 2BDHA 3ZVFA 5C3NA 2ZA5A 3EYDA 8ESTE 3M7UA 1DWBH 2FM2A 2FOMB 1QL7A 1HJ9A 3NUMA 4O3TA 1O3GA 1OS8A 2A7JA 4K8YA 4NG9H 5A2MH 1HB0B 1AUJA 1BMAA 4X8SH 3RLYH 2VJ1A 1SHHB 3RXRA 1C5LH 1KXEA 1O2LA 1EP6A 2B8OH 4K3JA 3F1SB 4I8LA 5AHGH 1FIWA 4Y71A 3SV6A 1C2MA 3TGKE 1DE7H 1TMTH 4ZHMU 3ZVGA 2FXRA 2SNWA 3S9BA 5F03A 4KTUA 1TNLA 3PTBA 1DOJA 3BTHE 3GYMA 3RXEA 3ZZ8A 1QBOA 1V6DA 1C1MA 2FOGA 1GBAA 4WJG2 3TH2H 1MBQA 1AFEH 1DT2A 5T6DA 3FP6E 5L2ZH 3N7OA 1UVUH 4A1TA 1P9UA 4DY7B 1ANDA 3FZDA 2VWLA 2XC0A 4LZ4B 1VCPA 4OGXA 4CH8B 1PQ7A 4OS4A 4DIIH 3P70B 1L1JA 3RXHA 1JRSA 4UE7H 3RMMH 1TPPA