4IMZA

Structural basis of substrate specificity and protease inhibition in norwalk virus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
183
structure length
173
Chain Sequence
DKAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLTGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQAGEGETAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of substrate specificity and protease inhibition in norwalk virus.
pubmed doi rcsb
source organism Norovirus hu/1968/us
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Genome polyprotein
total genus 41
structure length 173
sequence length 183
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4imzA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4imzA01
3KF2A 5BRRE 1THPB 3QGJA 1BRAA 2ZPQA 4TY6A 1RIWB 3EAJA 3BG4B 2BZAA 1JIRA 2J4IA 1S85A 3S9CA 8KME2 1O2XA 2O8WA 2OCVB 2ASUB 1C1SA 2OBQA 1DS2E 3V3MA 2OLGA 5L2YH 1ZPBA 4SGBE 1L2EA 3DHKH 4I32A 3QK1A 1J15A 1HUTH 2H9HA 1HJAB 1C5UA 1BTWA 1DANH 2A5KA 1OWEA 3LGWA 1RRKA 3EA7A 2A0QB 4AG1A 1KXDA 4AYVB 3B8JA 1P3CA 1ESTA 1SPJA 2VIPA 4NFEA 1DM4B 1O5GH 4D7GA 3V7TA 2PR3A 3RP2A 1UTNA 2SGQE 1LHGH 2QN5T 3MO6A 3BG4C 1EJNA 1BITA 1MTNC 2EI6A 4CRBA 1UHBA 4FUFA 2HNTC 1YP9A 5FPTA 1XUGA 1DLEA 4DIIH 1AVWA 1G2LA 3ENSB 1FDPA 4FXGH 4GVUA 4A1TA 5EQQA 3PMBB 1XXDA 3MNXA 4ABBA 1SQTA 3SJKA 1IQHA 4ABIA 1OP2A 4NCYA 1QURH 3M5MA 3RXEA 3SHAH 2BY7X 1GCDA 3MHWU 1D6RA 4O9VA 1C4V2 2H9EH 2CV3A 4J1YA 4A6LA 1HNEE 4BXWA 1WTHD 2Y7ZA 3MOCA 1BTHH 3PTBA 1GHAG 5AHGH 1TX7A 2YNBA 4U2WA 3OY5U 1MH0A 1MAYA 1NT1A 4ISHH 3IWMA 2UUJB 1EPTC 2DE8A 5HGGA 4VGCC 6GCHF 5A8XA 1AUJA 4ABDA 3A85A 4KTUA 1GMDG 1SOZA 3SZNA 5DGJA 3RDZA 3UR6A 1UTMA 1BTXA 1C4U2 2VWOA 2BLQA 2BXUH 3KGPA 1XMNB 4X8UH 5GDSH 3LU9B 3RMNH 1GVLA 3SQEE 2GV7A 1EZSC 1QJ7B 1L4ZA 1TPSA 4CRAA 1F92A 2G81E 4X2XA 1NU9A 3NK8A 4FUCA 4MPVA 1GGDB 1C2MA 1D3DB 5A0CA 2GMTC 3CS7A 2UWPA 1NRSH 3S9AA 1QB1A 2WPJS 3A7XA 4D76A 1BJUA 4ABGA 2ODPA 2PKSB 1C2JA 1O3JA 4A1VA 1HAIH 1H8DH 4DT7B 4NZLA 1C5OH 3NXPA 1Q31A 2ZHFH 1TA6A 4DY7B 4FU7A 2H5CA 2XBXA 1NPMA 5GPIB 1MKXK 3RU4E 2AIQA 1ARCA 1ZHMA 1BRUP 1FPHH 1K21H 1IQNA 1XM1A 1ANBA 5EODA 1O3DA 4XFQA 3TH3H 3E8LA 3RXLA 2FM2A 4OGXA 4UFEH 3BN9A 1PQ7A 2ZTYA 1K1PA 1FMGA 1NRQH 3HGNA 4I8GA 1E0FD 2P8OC 1O3BA 1BT7A 3TGIE 1WV7H 5EXMA 3V12A 2XXLA 1K9OE 1T8LA 5E2PA 1A46H 2A7CA 1TX6A 1DXWA 1EB1H 1O2MA 3SV9A 4ABHA 1P2JA 2Y81A 4YLUA 4K60A 4ZHLU 2R3YA 1CGJE 1Y5UT 5AFZH 4D7FA 2VH6A 1CA8B 1GG6B 1N6YA 4OS5A 1BMNH 1YGCH 2F9PA 2ZNKH 3SNAA 1TRMA 1T8MA 3A8DA 1OWDA 2JH6D 1Y3YA 3HK6B 3URDA 3P70B 1GI2A 1F2SE 2TGDA 3TK6A 2W3KA 1ARBA 4JZ1A 1SHYA 4FUJA 2FYQA 5DKMA 1AGJA 1DOJA 2AFQB 4XDEA 2ZPRA 2J34A 3PLPA 1N8OC 1BA8B 2QGRA 3MO9A 4YT6H 2GX4A 4KKDA 3RMMH 1O2UA 1T8NA 1UTKA 5DP8A 4TYDA 2PHBA 2VINA 5FHTA 1EPTB 4E06H 3SI3H 2CHAB 1F0UA 1SLVB 3A83A 1WAYB 2ZCKP 4NGAH 4Y79A 2WV4A 1XKAC 2QXHA 1SGQE 3BTWE 4CH2B 5DPAA 1SC8U 1K22H 1QRXA 2ZECA 3KQDA 1G2MA 1OOKB 4FUBA 1EB2A 2QCYA 3SV7A 1CT4E 5EU8A 1L1JA 3PMJA 3ODDA 3VB5A 1IQJA 1TOCB 1O2NA 1S0QA 1GPZA 4AZ2B 1WUNH 2GP9B 4ZUHA 1W3CA 2HPPH 1PPCE 5JBBS 1Y3UA 5AVDA 3TNTA 2STBE 2Y5GA 4CREA 1NFYA 3F1SB 3MFJA 3U9AH 1P57B 1ZTLA 3BTHE 3PWCA 4CHAB 1XKBC 1CA0B 4ASHA 1Z8IB 2QYIA 2V0BA 2ALVA 1K1LA 3PMHB 4YOIA 2GCTC 3D65E 3GYLB 3VEQB 5ABWA 1MKWH 2UWOA 2BDBA 1FONA 2P8OB 1GJ7B 5FBIA 1ZR0A 4RKJB 4M7GA 1PPGE 1AZZA 2IJOB 3BTKE 3RXHA 3ATLA 2WPLS 2A2XH 4INKA 4MPXA 1AB9C 1SGPE 1J14A 4FU9A 1W7XH 2D1JA 1TAWA 2DUCA 3K6YA 4FUDA 1AN1E 2ZGJA 1HRTH 3F9EA 4O3UA 1Y5BT 2PUQH 1H9IE 1C1TA 4TWWA 1OYQA 1HJ8A 1P3EA 1WOFA 3BSQA 2C90B 1HBTH 2PKSC 3Q77A 1INCA 1ETTH 1O5EH 4Q7XA 3F9FA 1EZUC 3MU8A 3U1IB 1C2KA 1VZQH 2ZG0H 1C5YB 1VITF 1Z1IA 5CHAC 2ZIQH 4BANB 4MNYA 1JBUH 1O3OA 4D9RA 5JB8S 3EA9A 1RGQA 2GTBA 3KCGH 2XCNA 3RU4D 4J2YB 1A7SA 1OS8A 1QIXB 1EOJA 2FZZA 3A89A 1J8AA 3KQBA 3RXRA 1HAOH 1UMAH 5JBAS 2BLOA 2RA3A 1W14U 2PSXA 1V2QT 1BJVA 2GKVE 1G36A 1KTTB 2BDGA 4WXVA 3E3TA 5JB9S 1CT2E 2GMTB 2HNTE 2BX3A 1XX9A 1RD3B 3SU2A 1OWJA 3LGYA 3RM0H 3RLYH 1NESE 5FAHA 4Q80A 1C2HA 5E0GA 1S81A 3BV9B 3SGQE 4YM9A 2M5TA 1GBAA 1C5VA 3RMOH 1BBRK 3Q00A 1ZRBA 2PGBB 1O3NA 1O3PB 1C2GA 2G55A 4XSKU 4BAKB 2QF0A 2AGEX 1NFUA 3ZZ4A 1O2JA 4X8SH 2HNTF 1GMDF 1W12U 4Y8XA 4MTBA 3P8FA 2J92A 1O2OA 3I78A 1A5IA 2C3SA 1E37B 1DY8A 1DWDH 5EQSA 1THRH 2ZFSA 1WBGB 4JYVH 4R0IA 4K8YA 5LPRA 2OD3B 1BBRE 4YESB 2GZ7A 1FV9A 1KLIH 4MNWA 3U8OH 1AVGH 3BF6H 1C9TA 1AB9B 1IHSH 3HK3B 1ACBE 1A0LA 2BZ6H 1V6DA 1WYKA 1O2VA 2F9NA 1O2KA 4Z6AH 3S0NA 1TRYA 2XNIA 3VGCC 3SGAE 3SU0A 4NWLA 3P17H 5K7RA 4DGJA 3U98H 2ZZUH 2P94A 1TGSZ 3PROA 1P9UA 2PUXB 3MYWA 4X2VA 3JZ1B 3QZQA 4Z0KA 1YPKH 1BOQA 5DP5A 4AFUA 1PPZA 1P9SA 1GBLA 5FX6A 1TMTH 1TBRH 2EI8A 2LPRA 2XW9A 3GY5A 4B76A 2J94A 1LO6A 3EQ0H 3F6UH 4B74A 3BTDE 4BAOB 1EKBB 5A09A 5DJ7A 1WQVH 4MQAA 4NIWA 1HJAC 4YZUA 5BPEA 4Q2KA 3GCOA 2QA9E 1BIOA 3OYPA 3LH1A 1HXEH 5C2ZA 1ZSKA 1CT0E 2HOBA 2RCEA 2GV6A 5E2OA 2THFB 2AIPA 3SV8A 1LMWB 1MBMA 2O8TA 2F83A 2A4OA 2D8WA 4GPGA 1NRPH 4R8TB 3MNSA 3CS0A 1GJ6A 2Z9LA 3PO1B 4I33A 1YF4A 4INLA 3GCHB 6GCHG 1HYLA 2V3HH 1LPGB 1UHBB 2W3IA 1TNJA 2ANWA 1K28D 2W5EA 8GCHG 1P12E 2ZPSA 4UEHH 2BVRH 1ABJH 1S82A 2HALA 2PSYA 4ZXYH 3UQOA 1RTFB 3AVZA 3A7VA 1J9CH 1D3TB 1TQ7B 2VIQA 1AD8H 1T8OA 1UTJA 3E0PB 3DFLA 4IMQA 1EJMA 3RXUA 1IQMA 2J95A 3LC3A 1HAZB 3KL6A 5CMXH 2FX4A 1PPBH 3UR9A 1YPGH 2BY9X 2AERH 2W7SA 1DXPA 3BTQE 1W0ZU 2RG3A 3BIUH 2A2QH 1K1JA 3STIA 4X2YA 5AFYH 2Z6BD 3RXQA 1O3IA 1O5DH 1P2MA 1O31A 1A2CH 3F68H 1JIMA 1V2TT 1G3EA 2R2MB 3M7QA 4BTUB 2J9NA 4B73A 1GDNA 5JPMH 1O3MA 4ABFA 1GMHG 1P03A 3RLWH 1KXEA 3K65B 2HWLB 3W95A 3ATMA 3O8BA 1TGCA 2A5AA 5ESTE 2A7HA 1GL1A 2BTCE 2BX4A 5F8TA 1O34A 3R0FA 4Y71A 3GOVB 4XBDA 5FBEA 2WUBA 2XBVA 1QHRB 3SJOA 2FEQH 5A0AE 2Z9JA 2ZFTA 2IPHA 4B1TA 4AB8A 2J2UA 4JZIA 2R2WU 1TB6H 3KQCA 4LK4A 2A31A 3A7ZA 1TX8A 1GJ5H 1MTVA 1E35B 1ELVA 1SGEE 3DT0H 2Q6DA 1BHXB 4YO9A 1S83A 1HV7A 2AMQA 1GBHA 4ABAA 3ESTA 1F5LA 4B2CA 2FOFA 2OC8A 4IW4E 1OXGA 1TNHA 2GT8A 1O2ZA 1GVKB 2FLBH 4X1NU 2Y82A 3TJNA 4OS2A 1DDJA 3LGUA 1BBRH 2G4TA 2TGTA 1FQ3A 2G4UA 3UTUH 4B71A 5FCRA 5HXFA 1BRCE 2P16A 1UCYK 1ZYOA 2QF3A 3SORA 1AUTC 1GJBB 1FN6A 5GIBA 3W94A 3HATH 4IC5A 5G4BA 3LKWA 1LVYA 3OX7U 3TK9A 3VPKA 5T6FA 4CBOA 1NROH 1V2MT 2C8YB 2OINA 3N7OA 1TQ0B 1A3BH 2BOHB 2ZWLH 1FY1A 5PTPA 1BMAA 3BTEE 2BQ7B 4BAHB 1GHZA 1KSNA 3A86A 1HIAB 3GDVA 1KXAA 1VGCB 1C1WH 1HIAA 5EW1H 4VGCB 5TCAA 3BEUA 4NIVA 3L6PA 3OU0A 2A4QA 1ZTKA 1ZPZA 3MU0A 3PM3A 1SSXA 2BVXH 2C8ZB 3QTVH 4ZAEA 3MTYA 2VWLA 3RXTA 4JZEH 4X1QU 3ZZ7A 1C5PA 1GBTA 4E7NA 2P95A 4MPUA 4BAMB 5H4IB 4ABEA 1FPCH 1Z71A 2UUFB 4K8BA 4JZDH 2ZDNA 2ZDMA 5GCHF 2ILNA 1O2HA 2FXRA 4BNRA 1GI3A 1UO6A 3I29A 1NC6A 1O0DH 1GBFA 1XUHA 5C3NA 4TY7A 1OWHA 1GCTB 1CSOE 1HB0B 4MLFB 6CHAC 8LPRA 1O33A 2Q6FA 2FP7B 2ZFPH 2PKAA 2G51A 3PLBA 1ZJKA 2OC0A 5EXNA 1PFXC 4I31A 1JRTA 1Z6EA 7GCHG 1DT2A 3D49H 3GCHC 2D26C 1WU1A 1UVSH 3A80A 2ZF0H 1HAGE 1SFQB 2PW8H 1VJ9U 2F9OA 2PLXA 1RXPA 3RXCA 2YNAA 2F91A 4I8KA 3FZDA 3UNQA 1F0SA 4BXSA 3GY3A 1FY4A 3FAOA 1RS0A 4NZQA 2AGIX 1UJ1A 2PKAB 3RXKA 2F3CE 1QL7A 3ZVBA 4YOJA 4IN2A 1F5KU 1TMBH 1ZJDA 1MKWK 2VNTA 3V13A 1NU7B 2VJ1A 1C5XB 4NA8A 3Q76A 1A1RA 1QBNA 1M9UA 1OYTH 5LPEA 1ESAA 2FI5E 1O5BB 3BEFB 1IOEA 4DIHH 3A87A 3FZZA 3SUDA 3F9GA 4YLQH 3VXFH 3RC5A 5FX5A 3PMAB 1LKAA 1UVUH 4OS1A 2BD8A 3ATKA 2Q6GA 3TU7H 3ZZBA 2NU2E 1GWAA 2GT7A 1G9IE 5L6NH 1P05A 4WXIA 5T3HA 1V2KT 1TIOA 2Z9GA 1MU6B 4ZROA 2ANYA 4XBBA 3M36A 1GHVH 2BD3A 1GGDC 2JH5D 4QT8C 4Y7BA 5HMAA 2OC1A 1RJXB 3SOSA 3QTOH 1BHXF 1O3LA 1OX1A 2QIQA 3P8GA 4X1SU 1C5RA 3E91A 1AY6H 3E1XB 1GBCA 5DK1A 1DUAA 3A8AA 1AVXA 2BQ6B 3R3GB 1GBMA 1O2TA 2QXJA 1V2RT 1SGRE 5C1XA 3GY7A 3NKKA 2ZDLA 3MH6A 1FLEE 2P3UB 4KELA 1V3XA 2Z3DA 1EAUA 2Y6TA 1SLWB 2D2DA 5C5OA 1W8BH 3OTJE 1V2UT 1LVMA 1T4VH 2VWNA 3ZZ3A 5K0HA 1CU1A 3VB3A 2Y5HA 5FXLA 2JKHA 1MTWA 2BYAX 4GAWA 1RTKA 2ZDAH 2GD4B 4ZHAA 4NG9H 2FS9A 1MQ6A 1EZQA 4AGJA 3SV6A 2VVVA 3TJOA 4B2AA 3UOPA 1CVWH 1FJSA 1EATA 1LHEH 2PTNA 1O35A 5GWZA 3T26A 2G8TA 3ITIA 4WH8A 3ZZCA 2EI7A 3MI4A 1C2LA 1CHOG 1TLDA 2TGAA 3M37A 5L30H 1GDUA 1P10A 2CGAA 5C1UA 1DITH 4NIXA 1D3QB 2ESTE 1W10U 2ZCHP 1C5LH 1O3KA 1GJ9B 2VVUA 4FVDA 3A88A 1OPHB 1TNKA 4Q7ZA 1G3CA 4E05H 1HAPH 3AAUA 1T7CA 3D62A 1DLKB 3K2UA 3KIDU 2SGDE 3TH4H 1NRRH 4BAQB 5L2ZH 1HGTH 3ZZDA 2QC2A 1IQKA 3SO3A 3TVJB 4HTCH 1QRWA 3BTME 3K9XB 4K1EA 2Y7XA 3JZ2B 1K2I1 3OSYA 4JCNA 1DPOA 2VWMA 2GCTB 4K1TA 2QAAA 2ANKH 5EG4A 1UK4A 5IYTA 1C2EA 1O2PA 2V35A 3VXEH 1QBOA 1HXFH 5TCCA 6ESTA 1PJPA 3UWJH 2ZGCA 2OQUA 2BLVA 1XVOA 1UVPA 4Y0ZE 2ZGHA 4ZKSU 3RXDA 3U1JB 1RIWC 5EPNA 4ZHMU 1O3HA 2FOBA 4O97A 3G01A 1CBWC 3A82A 1ZMNA 4XOJA 1W0YH 1GBJA 1GMCG 1YBWA 2XTTB 2V3OH 5GXPA 2XBWA 1BTYA 1F0RA 3A84A 4E7RG 1C5ZB 1SGFG 2ZTZA 1IQFA 1CBWB 1DFPA 1ORFA 2SFAA 3LOXA 1N8OB 1ZZZA 1H8IH 1WSSH 2J38A 2JH0D 1K1OA 1L1GA 1SGNE 1TONA 1AFEH 2WYGA 3VFEA 3SNDA 4X6NA 1AI8H 1BMMH 3H7TA 3FP7E 1DVAH 2R3UA 2P93A 4I8HA 2A5IA 3PWBA 4CR9A 4FUHA 4BTIB 4Y7AA 2WPHS 3SV2H 1TRNA 1GHXH 1TBQH 1HFDA 3SI4H 3ODFA 1P8VC 1TE0A 2BM2A 3M3TA 1QQUA 4DVAU 1IQIA 1BUIA 2R0LA 3RXAA 1A61H 1S0RA 1UK3A 1SLUB 3LDXH 2ZP0H 3RC6A 3MU5A 2OUAA 4IC6A 5DP6A 1SHHB 1H1BA 5I25A 4NSYA 3ZVDA 1LPZB 1C2FA 4UDWH 1SOTA 1HCGA 1SQAA 1QGFA 2VIDA 2ZTXA 3GCNA 4O3TA 3ZV8A 1NZQH 2A1DB 2BVSH 3ZZ6A 1C1NA 2BDAA 2FESH 1O5FH 1QR3E 4JK5A 1ESBA 3CENA 1Z8GA 3MWIU 2TGPZ 3QUMP 4AFSA 5F8XA 3GY2A 3Q3XA 3SNEA 2TPIZ 1Z8JB 1DSTA 1EASA 1IAUA 4GHTA 5ESBA 1DWCH 4MNVA 4INHA 1QTFA 3T5FH 3VB6A 1H9LB 2AH4X 3BEIB 2PGQB 2GVFA 3HKJB 4JYUH 1A4WH 1F0TA 1Z6JH 2TRMA 1LHDH 1ZLRA 1XUJA 1G3DA 2R9PA 1VR1H 1TMUH 1TYNA 2UUYA 3ZVEA 2FDAA 1TFXA 4TPYA 2FMJA 2EC9H 1Z8RA 4Y8ZA 3NCLA 1QJ1B 3SUGA 1L4DA 1C9PA 1D4PB 3IG6B 1PYTC 2ZO3H 4UONA 2HGTH 3SBKA 2FPZA 2XWAA 1IQEA 3U8RH 1QRZA 2PTCE 2LNCA 2ZU5A 2ZC9H 1G37A 4CR5A 1YLDA 4A7IB 1VJAU 3FVFB 3CP7A 1EUFA 1NRNH 1BMLA 1O2SA 4AGKA 3OY6U 1ELTA 4NWKA 1O2QA 1WQSA 4X8TH 1MCVA 1LKBA 5ETXA 1EAIA 1P2KA 1FN8A 1BTZA 2F9UA 1TGTA 3M5OA 1UTPA 1B0FA 1O30A 2YOLA 4ISLA 2BB4A 4WVPE 3F9HA 1GJDB 1DE7H 2HRVA 1TNGA 1Y3VA 3MNCA 3UY9A 4AYYB 4AOQA 2AMPA 3ZVFA 2VIVA 5EW2H 3MMGA 3VB7A 2PV9B 3PO1C 1QCPA 2ZFRH 3QDZB 1TGBA 5FCKA 1U6QA 2F9VA 1QNJA 1AHTH 1LVOA 1MMJN 2EA3A 5LPFA 3M61U 1YPEH 2CF8H 1RTLA 3MH7A 3Q3KA 1ZOMA 2OQ5A 5CHAB 1EXFA 1C4Y2 2WPIS 1AE5A 4UD9H 2B0FA 1BTUA 3M7UA 4CRCA 2FOHA 2AMDA 1HAXB 3RXFA 3S9BA 1GBKA 3URCA 3EE0B 1TNIA 3C1KA 1KXCA 4AFQA 3MU1A 4OS6A 1B7XB 3RXBA 3SQHE 3SN8A 1O2LA 2BY6X 1DUEA 1GI1A 3QLPH 4Y0YE 4OS4A 2VU8E 1LTOA 1O2YA 4DJZB 2ZFFH 1PQ5A 1P2QA 2Q1JA 4X1PU 1QL9A 5HM9A 1ZSJA 5GJ4B 3HKIB 4X2WA 2I6QA 2GDDA 1DY9A 4OS7A 3U69H 1GJCB 1HPGA 1JWTA 1PQAA 1B5GH 1V2NT 4DG4A 4DW2U 1A5HA 1FY3A 1KLTA 2HPQH 3WY8A 1SR5C 1S6FA 1AU8A 4LXBH 1MU8B 1H4WA 1QL8A 3SJ8A 1Y5AT 2KAIB 3MH5A 1ZRKA 2ZHDA 2CMYA 1YCPM 3A7TA 3LPRA 1XVMA 3LGVA 1OP0A 2FOEA 1QFKH 1GI0A 5E0JA 3EA8A 4DCDA 1PPFE 3GDSA 3E16B 3T25A 1HJ9A 1A0HB 1JOUB 5DP3A 3ZZ9A 5B6OA 1P2IA 3SUEA 1C5SA 3T2NA 1MD7A 3T27A 3M5NA 2Z3EA 3T28A 1V2JT 4MVNA 3SHCH 3SU3A 3FFGA 3LT3A 4X6MA 2P3FH 4FUGA 4B2BA 2Z7FE 1ETSH 2ODYB 5F6MA 1KXBA 2B8OH 3PTNA 4RKOB 4HZHA 2Z9KA 2XYAA 2K1QA 2H9TH 3DA9B 1LHFH 1T31A 3KQEA 2FOMB 4KTSA 3T29A 2PWXA 2CN0H 4ABJA 1EZXC 1OKXA 4AN7A 1ANEA 1W13U 2Z9IA 3P8OA 1BTPA 4NSVA 1GJ8B 1MUEB 1UVOA 4THNH 1O5CB 2A7JA 5SGAE 1EJAA 4KTCA 1GMHF 2ZHQH 2FOGA 1GCTC 6CHAB 1Y8TA 2G5NA 1LCYA 3QN7A 1FIWA 2A32A 4I8JA 3RC4A 1FY8E 3LJJA 4WMFA 3UOUA 9LPRA 4TWYA 1O32A 5DG6A 1LHCH 1VGCC 1KY9A 3UWIA 3NZIA 3A7WA 3LGTA 4RN6A 4A5TS 1GBDA 1TALA 5HM2A 5IDKA 2A45B 1AQ7A 3GISB 3SJ9A 1D3PB 3ZV9A 1PPHE 4Y76A 4Y6DA 3ATWA 3TH2H 1KDQA 1C5NH 2HVXA 3RXGA 1TPPA 2G5VA 1SMFE 1FAKH 4ISNA 1XUKA 4CRGA 1AO5A 1GI4A 1CGHA 1GG6C 1EQ9A 1NFXA 3P92A 4K1SA 1P02A 3RXVA 1W7GH 1VCWA 3DFJA 5TJXA 4AFZA 2O8LA 2WV5A 3NPSA 1AIXH 3IITA 3HGPA 2BD7A 4LZ1H 4YOGA 5I46H 1BCUH 4BOHA 1SGDE 5C67A 1THSH 8GCHF 3SNBA 1PQ8A 1O5AB 2ZQ1A 2OXSA 3MNBA 5EGMA 1FI8A 1GL0E 4H4FA 1FNIA 2P3TB 3BTTE 3FP6E 2FLRH 1QJ6B 1A0JA 3TITA 4ISIH 1C1VH 2H5DA 1ELCA 2BD2A 1FAXA 1LPKB 3PLKA 1ELAA 5JDUB 4H42U 1W11U 3A7YA 2VIWA 2FTLE 1UCYE 4ZMAH 4KP0A 3S7HB 1C5MD 3M35A 4U01A 4WF8A 3A8CA 4KGAA 3ATIA 2QY0B 2Z3CA 2H6MA 2C8WB 1D6WA 1C1RA 1TPAE 4UFFH 2I6SA 4ZKOU 3P95A 2BXTH 2V6NA 3I77A 3RUOA 1N1LA 5LGOA 1GHWH 2BDCA 2C93B 2FTMA 5F8ZA 2P59A 1QB9A 2VGCB 1O38A 1YM0A 2FODA 1SGCA 2BD5A 1O2RA 2R0KA 1YPHC 1TPOA 1CHGA 1ZPCA 3E90B 3ZYEA 5A8ZA 1SGTA 3FANA 5F03A 3AW1A 3GY4A 3RXIA 2WPKS 3QO6A 5DP9A 1ZSLA 7KMEH 3EGKH 2ZFQH 1YCPH 1O37A 3FP8E 5C20A 1KTSB 1SGYE 4HI3A 5JYIA 1CA0C 2GGVB 4CHAC 4ZH8A 1SL3A 1J17T 1GJAB 1NS3A 3AASA 3QGNB 1V2WT 2ZU4A 1GI9B 1FZZA 4HFPB 2XWBI 4NA9H 4XBCA 1AKSA 1P01A 3E0NB 1AKSB 2ZI2H 3TIUA 4JZFH 1S84A 1Y3WA 3S7KB 3SW2B 4K2YA 1YC0A 3GYMA 1Z7KA 2W7UA 1DICA 1SGFA 4CH8B 1NTPA 3HPTB 3M3VA 1UK2A 3PB1E 1MZAA 2TIOA 2FWWA 3BG8A 1L0ZA 4D9QA 2BLWA 1XXFA 3LJOA 5EXLA 1P2NA 2QXIA 5FPSA 1EOLA 2OBOA 2ODQA 1AMHA 3ELAH 2Z94A 3ZVAA 1DSUA 1GMCF 4HGCA 2ZKSA 1OWKA 2STAE 3M3SA 3ZZ5A 4F4OC 1YCPK 3UREA 2FI4E 4ZKNU 3TGKE 4UFGH 2AS9A 3KEEA 5J4QA 1C2IA 3EDXB 4JK6A 1OSSA 3QZRA 2ZQ2A 1C1MA 3LGIA 1QB6A 2VGCC 2BY5X 1KIGH 5HYOA 3TGJE 1HAHH 1Z1JA 1E38B 1ZHPA 2NU0E 2FOAA 3C27B 1VITG 1GJ4H 2AYWA 2Y5FA 4NIYA 3K6ZA 1UTLM 1G3BA 1QQ4A 1F7ZA 2H2ZA 3A81A 1P06A 1A3EH 1LDTT 1GBIA 3L3TA 4X8VH 3STJA 4JYTA 2JETB 4UFDH 1C1UH 1QBVH 1ELBA 4SGAE 1K1IA 1GBEA 3LC5A 1UTOA 1HAYB 2SGAA 3VGCB 5EPYA 2EEKA 2OTVA 5E0HA 3RXMA 4ZKRU 1QY6A 1GDQA 1TA2A 1V2ST 4X6OA 3O8DA 4Y11E 2BDIA 1MBQA 2PFEA 2ZU1A 3LONA 1NN6A 2AEIH 1EPTA 3EYDA 4WMDA 2ZHEH 1TNLA 2G00A 2ALPA 1T4UH 1TOMH 1YLCA 1ZMLA 1NM6A 4NFFA 1GHYH 3MH4A 4TPIZ 2BDYA 1B0EA 3DD2H 1MTUA 5J4SA 1SVPA 1TWXB 1VITH 1OWIA 2HLCA 1MTSA 3BIVH 3BTFE 4AG2A 4IN1A 4MNXA 1CGIE 1SQOA 1L1NA 3SGBE 1YPMH 3NUMA 1Q2WA 1AWHB 1TBZH 2NU4E 4Q7YA 5JBTA 1EP5A 2XBYA 1ID5H 1IHTH 2DE9A 2ULLA 6LPRA 2ZCLP 1RFNA 3PYHA 3B9FH 1MCTA 1P11E 1O2GH 3L33A 2A4GA 5A2MH 4AX9H 5DO4H 2WUCA 1S6HA 4F49A 1BB0B 3TJUA 5A8YA 2F9BH 8ESTE 3PV4A 1O3CA 1EAXA 7LPRA 1HLTH 1NY22 4GHQA 2BHGA 2XC5A 2XC0A 1DWEH 1AWFH 1MTNB 1ABIH 1SBWA 2FX6A 1P2OA 3ZVCA 2ZDVH 1GI8B 2GZ9A 2ZU3A 3UIRA 4YTAA 2BQWB 1MKXH 2JETC 4K69A 2ZEBA 4FU8A 1YPJH 1CHOF 1CQQA 1C1QA 4IS5A 1A5GH 1X7AC 1V2PT 1Y59T 1KDQB 5EOKA 4GCHF 1YKTA 2NWNA 5C1YA 5T6DA 1JMOH 1C1PA 1LVBA 3RXSA 1LQEA 4GUXA 1JRSA 2QXGA 1MQ5A 4O03A 1Q3XA 3P6ZB 3RXPA 2KAIA 3GDUA 2RDLA 4CRDA 1UCYH 1YPLH 1ZGVA 4IBLH 1C5QA 2ZU2A 2B7DH 3M5LA 3ZZ8A 4Y10E 3RXJA 4B75A 1KXFA 4WMEA 1BRBE 3MU4A 2WINI 1LQDB 3BTGE 1C5TA 5JBCS 3U8TH 2VVCA 2SGPE 1ELFA 1NO9H 2GCHF 1GVZA 5LH8A 1QA7A 2SNWA 1SLXB 3Q3YA 4A1XA 1BDAA 2FO9A 3V0XA 9ESTA 1GHBF 2ZDKA 1ANDA 2B9LA 1XUFA 3TJVA 2A4RA 2AGGX 1AZ8A 3SNCA 2ANMH 1H9HE 2SGFE 4CBNA 4RSPA 1O3FA 5C5NA 3UUZA 3QX5H 1SI5H 2BD9A 1P04A 2GDEH 4U32A 3ZZAA 3KN2A 5E8EH 1F5RA 2WYJA 2OP9A 2NU3E 2XC4A 2FOCA 2VIOA 1ZGIA 2ZA5A 4NA7A 1O3EA 3UFAA 2FYRA 2CHAC 3O8RA 2Y80A 2BOKA 4UE7H 4I7YH 2BMGB 3A8BA 3VB4A 1D9IA 4FUIA 2C8XB 1AE8H 2B5TB 1TABE 2BD4A 1TGNA 3QWCH 2XRCA 3SUFA 1UVTH 1WCZA 4U30A 3GCTG 1FUJA 4K3JA 3RMLH 2GCHG 3H5CB 2FI3E 3SU4A 3ZYDA 3RU4T 3GICB 1HAVB 4WY3A 1C1OA 2C4FH 1N6XA 1E34B 1EP6A 1K1NA 1IQLA 2BY8X 3GY6A 4MDSA 3GY8A 1SFIA 3SU1A 4ZXXH 1K1MA 1XUIA 4CRFA 3M7TA 4FUEA 4H6TA 1S5SA 1SGIB 1ETRH 3AAVA 3GCTF 2UWLA 2SGEE 3UNSA 1V2LT 2ZHWH 2FS8A 4D8NA 1WTGH 3UNRA 1UTQA 1BZXE 3S69A 1C5WB 1T32A 4MG3A 1AFQB 2WPMS 1PYTD 5DP4A 1Y3XA 3TNSA 1IQGA 1HAVA 3SJIA 2O8MA 1MZDA 4H6SB 4DOQA 1ELEE 2ZGXH 2VH0A 2SNVA 1FIZA 4IMZA 5T6GA 4X6PA 4LOYH 7GCHF 3SU5A 1QA0A 1J16A 2IOTA 4GSOA 1EAWA 1SB1H 1KLJH 1GHBG 1GI7B 1FY5A 2H1UA 4YT7H 2G52A 1V2OT 2O8UA 1DWBH 1P09A 1V2VT 2RA0A 3TLOA 2OC7A 3UQVA 1ZTJA 5GCHG 3P8NA 4ESTE 3E6PH 5EQRA 2CXVA 1MAXA 4MPWA 1O3AA 4DURA 5A0BA 3O8CA 4WJG2 1HDTH 1KYNA 4PROA 4X1RU 5FPYA 4WWYA 2O9QA 1G30B 4XE4A 5AF9H 1AFQC 2FIRH 4K5ZA 3LH3A 2CF9H 3MO3A 1JXPA 2W26A 4X0WU 1ZMJA 3SU6A 2ZGBH 2IN2A 1OP8A 2CJIA 2GZ8A 3TPIZ 1SG8B 1EX3A 1ZHRA 1P0SH 1E36B 3D23A 4AB9A 1DX5M 1PPEE 3NWUA 2QV1A 4GCHG 4I8LA 1GHAF 4AORA 3KNXA 2BDHA 5CE1A 1O3GA 1W2KH 1ANCA 2NU1E 1C2DA 3UPEA 4OGYA 1VCPA 4ISOA 3ZVGA 3AW0A 3B23B 3TK5A 3RXOA 4BTTB 1MD8A 3T62A 1YYY1 3RM2H 2TBSA 1GI5A 1G32B 2UUKB 7ESTE 1ELGA 1O2IA 3DUXH 4Y8YA 1O36A 4FVBA 1GBBA 1CE5A 3LIWA 4JMYA 1GI6A 1O2WA 2VB0A 1O39A 1BQYA 3KHVA 4IGDA 3H7OA 1FXYA 5DP7A 1ELDE 4A92A 1NFWA 4WH6A 2XCFA 4LZ4B 4GLYA 1VCQA 1YPHE 1CO7E
chains in the Genus database with same CATH superfamily
3KF2A 5BRRE 1THPB 3QGJA 1BRAA 2ZPQA 4TY6A 1RIWB 3EAJA 3BG4B 2BZAA 1JIRA 2J4IA 1S85A 3S9CA 8KME2 1O2XA 3DSOA 2O8WA 2OCVB 2ASUB 1C1SA 2OBQA 1DS2E 3V3MA 2OLGA 5L2YH 1ZPBA 4SGBE 1L2EA 3DHKH 4I32A 3QK1A 1J15A 1HUTH 2H9HA 1HJAB 1C5UA 1BTWA 1DANH 2A5KA 1OWEA 3LGWA 1RRKA 3EA7A 2A0QB 4AG1A 4OM9A 1KXDA 4AYVB 3B8JA 1P3CA 1ESTA 1SPJA 2VIPA 4NFEA 1DM4B 1O5GH 4D7GA 3V7TA 2PR3A 2F43B 3RP2A 1UTNA 2SGQE 1LHGH 2QN5T 3MO6A 3BG4C 1EJNA 1BITA 1MTNC 2EI6A 4CRBA 1UHBA 4FUFA 2HNTC 1YP9A 5FPTA 1XUGA 1DLEA 4DIIH 1AVWA 1G2LA 3ENSB 1FDPA 4FXGH 4GVUA 4A1TA 5EQQA 3PMBB 1XXDA 3MNXA 4ABBA 1SQTA 3SJKA 1IQHA 1SQRA 4ABIA 1OP2A 4NCYA 5FL7D 1QURH 3M5MA 3RXEA 3SHAH 2BY7X 1GCDA 3MHWU 1D6RA 3OTPA 4O9VA 1C4V2 2H9EH 2CV3A 4J1YA 4A6LA 1HNEE 4BXWA 1WTHD 2Y7ZA 3MOCA 1BTHH 3PTBA 1GHAG 5AHGH 1TX7A 4DT4A 2YNBA 4U2WA 3OY5U 1MH0A 1MAYA 1NT1A 4ISHH 3IWMA 2UUJB 1EPTC 2DE8A 5HGGA 4VGCC 2V7QD 5A8XA 1AUJA 6GCHF 4ABDA 3A85A 4KTUA 1GMDG 1SOZA 3SZNA 5DGJA 3RDZA 3UR6A 1UTMA 1BTXA 1C4U2 4F48B 2VWOA 2BLQA 2BXUH 3KGPA 1XMNB 4X8UH 5GDSH 3LU9B 3RMNH 1GVLA 3SQEE 2GV7A 1EZSC 1QJ7B 1L4ZA 1TPSA 4CRAA 1F92A 2G81E 4X2XA 1NU9A 3NK8A 4FUCA 4MPVA 1GGDB 5C0UA 1C2MA 1D3DB 5A0CA 2GMTC 3CS7A 2UWPA 1NRSH 3S9AA 1QB1A 2WPJS 3A7XA 4D76A 1BJUA 4ABGA 2ODPA 2PKSB 1C2JA 1O3JA 4A1VA 1HAIH 1H8DH 4DT7B 4NZLA 1C5OH 3NXPA 1WXRA 1Q31A 2ZHFH 1TA6A 1FX0B 4DY7B 4FU7A 4I86A 2H5CA 2XBXA 1NPMA 4XRNA 5GPIB 1MKXK 3RU4E 2AIQA 1ARCA 1ZHMA 1BRUP 1FPHH 1K21H 1IQNA 1XM1A 1ANBA 2XNDD 1O3DA 5EODA 4XFQA 3TH3H 3E8LA 3RXLA 2FM2A 4OGXA 4UFEH 3BN9A 1PQ7A 2ZTYA 1K1PA 1FMGA 4M9FA 1NRQH 3HGNA 4I8GA 1E0FD 2P8OC 1O3BA 1BT7A 3TGIE 1WV7H 5EXMA 2CK3D 3V12A 2XXLA 4ACBA 1K9OE 1T8LA 5E2PA 1A46H 2A7CA 1TX6A 1DXWA 1EB1H 1O2MA 3SV9A 4ABHA 1P2JA 2Y81A 4YLUA 4K60A 4ZHLU 2R3YA 1CGJE 1Y5UT 2QE7D 5AFZH 4D7FA 2VH6A 1CA8B 1GG6B 1N6YA 4OS5A 1BMNH 1YGCH 2RFKC 2F9PA 2ZNKH 3SNAA 1TRMA 1T8MA 3A8DA 1OWDA 2JH6D 1Y3YA 3HK6B 3URDA 3P70B 5DSFA 1GI2A 1F2SE 2TGDA 3TK6A 2W3KA 1ARBA 4JZ1A 5CHBA 1SHYA 4FUJA 2FYQA 2HVYB 4Z1MD 5DKMA 1AGJA 1DOJA 2AFQB 4XDEA 2ZPRA 2J34A 3PLPA 1N8OC 1BA8B 2QGRA 3MO9A 4YT6H 2GX4A 4KKDA 2M2AA 3RMMH 1O2UA 1T8NA 1UTKA 5DP8A 4TYDA 2PHBA 2VINA 5FHTA 1EPTB 4E06H 3SI3H 2CHAB 1NBME 1F0UA 1SLVB 3A83A 1WAYB 2PP6A 2ZCKP 4NGAH 2WV4A 4Y79A 1XKAC 2QXHA 1SGQE 2JJ2D 3BTWE 4CH2B 5DPAA 1SC8U 1K22H 1QRXA 2ZECA 3KQDA 1G2MA 1OOKB 4FUBA 1EB2A 2QCYA 3SV7A 1W0JD 1CT4E 5EU8A 1L1JA 3PMJA 3ODDA 3VB5A 1IQJA 1TOCB 1O2NA 1S0QA 1GPZA 4AZ2B 1WUNH 2GP9B 4ZUHA 1W3CA 2HPPH 1PPCE 5JBBS 1Y3UA 3UAIC 5AVDA 3TNTA 2STBE 2Y5GA 4CREA 1NFYA 3F1SB 3MFJA 3U9AH 1P57B 1ZTLA 3BTHE 3PWCA 4CHAB 1XKBC 1CA0B 4ASHA 5EJLA 1Z8IB 2QYIA 2V0BA 2ALVA 1K1LA 3PMHB 4YOIA 2GCTC 3D65E 3GYLB 3VEQB 5ABWA 1MABB 2KCAA 1MKWH 2UWOA 2BDBA 1FONA 2P8OB 1GJ7B 5FBIA 1ZR0A 4RKJB 4M7GA 1PPGE 1AZZA 2IJOB 3BTKE 3RXHA 3ATLA 2WPLS 2A2XH 4INKA 4MPXA 5KGOA 1AB9C 5HIYA 1SGPE 1J14A 4FU9A 1W7XH 2D1JA 5C0TA 1TAWA 2DUCA 3K6YA 4FUDA 1AN1E 2ZGJA 1HRTH 3F9EA 4O3UA 1Y5BT 2PUQH 1H9IE 1C1TA 4TWWA 1OYQA 1HJ8A 1P3EA 1WOFA 3BSQA 3F0OA 2C90B 1HBTH 2PKSC 3Q77A 1INCA 1ETTH 4TT3D 1O5EH 5C94A 4Q7XA 3F9FA 1EZUC 3MU8A 3U1IB 1C2KA 5KECA 1VZQH 2ZG0H 1C5YB 1VITF 1Z1IA 5CHAC 2ZIQH 4BANB 4MNYA 1JBUH 1O3OA 4D9RA 5JB8S 3EA9A 1RGQA 2GTBA 3KCGH 2XCNA 3RU4D 4J2YB 1A7SA 1OS8A 1QIXB 1EOJA 2FZZA 3A89A 1J8AA 3KQBA 3RXRA 1HAOH 1UMAH 5JBAS 2BLOA 2RA3A 1W14U 5C17A 2PSXA 1V2QT 1BJVA 2GKVE 1G36A 1KTTB 2BDGA 4WXVA 2J5UA 3E3TA 5JB9S 1CT2E 2GMTB 2HNTE 2BX3A 1XX9A 1RD3B 3SU2A 1OWJA 3LGYA 3RM0H 3RLYH 1NESE 5FAHA 4Q80A 1C2HA 5E0GA 1S81A 3BV9B 3SGQE 4YM9A 2M5TA 1GBAA 1C5VA 3RMOH 1BBRK 3Q00A 1ZRBA 2PGBB 5EIYA 1O3NA 1O3PB 1C2GA 2G55A 4XSKU 4BAKB 2QF0A 2AGEX 1NFUA 3ZZ4A 1O2JA 4X8SH 2HNTF 1GMDF 1W12U 4Y8XA 4MTBA 1BMFD 3P8FA 2J92A 5GNDA 1O2OA 3I78A 3H09A 1A5IA 2C3SA 1E37B 1DY8A 1DWDH 5EQSA 1THRH 2ZFSA 1WBGB 4JYVH 4R0IA 4K8YA 5LPRA 2OD3B 3F3BA 1BBRE 4YESB 2GZ7A 1FV9A 1KLIH 4MNWA 3U8OH 4HG6A 1AVGH 3BF6H 1C9TA 1AB9B 1IHSH 3HK3B 1ACBE 1A0LA 2BZ6H 1V6DA 1WYKA 1O2VA 2F9NA 1O2KA 4Z6AH 3DSGA 3S0NA 1TRYA 2XNIA 3VGCC 3SGAE 3SU0A 4NWLA 3P17H 5K7RA 4DGJA 2KM0A 3U98H 2ZZUH 2P94A 1TGSZ 3PROA 1P9UA 2PUXB 3SYJA 3MYWA 4X2VA 3JZ1B 3QZQA 4Z0KA 1YPKH 1BOQA 5DP5A 4AFUA 1PPZA 1H8HD 3FN8A 1P9SA 1GBLA 5FX6A 1TMTH 1TBRH 2EI8A 2LPRA 2XW9A 3GY5A 4B76A 2J94A 1LO6A 3EQ0H 3F6UH 4B74A 3UB0A 3AK5A 3BTDE 4BAOB 1EKBB 5A09A 5DJ7A 1WQVH 4FETA 4MQAA 1HJAC 1SKYE 4NIWA 4YZUA 5BPEA 4Q2KA 3GCOA 2QA9E 1BIOA 3OYPA 3LH1A 1HXEH 5C2ZA 1ZSKA 1CT0E 2HOBA 2RCEA 2GV6A 5E2OA 2THFB 2AIPA 3SV8A 1LMWB 1MBMA 2O8TA 2F83A 2A4OA 2D8WA 4GPGA 1NRPH 4R8TB 3MNSA 3CS0A 1GJ6A 2Z9LA 3PO1B 4I33A 1YF4A 4INLA 3GCHB 6GCHG 1HYLA 2J97A 2V3HH 1LPGB 2WPDD 1UHBB 2W3IA 1TNJA 2ANWA 1K28D 2W5EA 3PV2A 2W6JD 8GCHG 1P12E 2ZPSA 5KEDA 4UEHH 2BVRH 1ABJH 1S82A 2HALA 1W0KD 2PSYA 4ZXYH 3UQOA 1RTFB 3AVZA 3A7VA 1J9CH 1D3TB 1TQ7B 2VIQA 1AD8H 1T8OA 1UTJA 4B6EA 3E0PB 3DFLA 4IMQA 1EJMA 3RXUA 1IQMA 2J95A 3LC3A 1HAZB 3KL6A 5CMXH 2FX4A 1PPBH 3UR9A 1YPGH 2BY9X 3W1EA 2AERH 2W7SA 1DXPA 3BTQE 1W0ZU 2RG3A 3BIUH 2A2QH 1K1JA 3STIA 4X2YA 3F0PA 5AFYH 2Z6BD 3RXQA 1O3IA 1O5DH 1P2MA 1O31A 1A2CH 3F68H 1JIMA 1V2TT 1G3EA 2R2MB 3M7QA 4BTUB 2J9NA 4B73A 1GDNA 5JPMH 1O3MA 4ABFA 1GMHG 1P03A 3RLWH 1KXEA 3K65B 2HWLB 3W95A 3ATMA 3O8BA 1TGCA 2A5AA 5ESTE 2A7HA 1GL1A 2BTCE 2BX4A 4Q4LA 5F8TA 1O34A 3R0FA 4Y71A 3GOVB 4XBDA 5FBEA 2WUBA 2XBVA 1QHRB 3SJOA 2FEQH 5A0AE 2Z9JA 2ZFTA 2IPHA 4B1TA 4AB8A 2J2UA 4JZIA 2R2WU 1TB6H 3KQCA 4LK4A 2A31A 3A7ZA 1TX8A 1GJ5H 1MTVA 1E35B 1E79D 1ELVA 1SGEE 3DT0H 2Q6DA 1BHXB 4YO9A 1S83A 1HV7A 2AMQA 1GBHA 4ABAA 3ESTA 1F5LA 3EE7A 3OE7D 4B2CA 2FOFA 3VG8A 2OC8A 4IW4E 1OXGA 1TNHA 2GT8A 1O2ZA 1GVKB 2FLBH 4X1NU 2Y82A 3TJNA 3PRDA 4OS2A 1DDJA 3LGUA 1BBRH 2G4TA 2TGTA 1FQ3A 2LP6A 2G4UA 3UTUH 4B71A 5FCRA 5HXFA 1BRCE 2P16A 1UCYK 1ZYOA 2QF3A 3SORA 1AUTC 1GJBB 1FN6A 5GIBA 3W94A 3HATH 4IC5A 5G4BA 3LKWA 1LVYA 3OX7U 3TK9A 3VPKA 5T6FA 4CBOA 1NROH 1V2MT 2C8YB 3KYFA 2OINA 3N7OA 1TQ0B 1A3BH 2BOHB 2ZWLH 1FY1A 5PTPA 1BMAA 3BTEE 2BQ7B 4BAHB 1GHZA 1KSNA 3A86A 1HIAB 3GDVA 1KXAA 1VGCB 1C1WH 1HIAA 5EW1H 4VGCB 5TCAA 3BEUA 4NIVA 1YY3A 3L6PA 3OU0A 2A4QA 1ZTKA 1ZPZA 3MU0A 3PM3A 1SSXA 2BVXH 2YMSB 2C8ZB 3QTVH 4ZAEA 3MTYA 2VWLA 3DCLA 3RXTA 4JZEH 4X1QU 3ZZ7A 1C5PA 1GBTA 4E7NA 2P95A 4MPUA 4BAMB 5H4IB 4ABEA 1FPCH 1Z71A 2UUFB 4K8BA 4JZDH 2ZDNA 2ZDMA 4P02A 5GCHF 2ILNA 1O2HA 1K0HA 2FXRA 4BNRA 1GI3A 1UO6A 3I29A 1NC6A 1O0DH 1GBFA 1XUHA 5C3NA 4TY7A 1OWHA 2OK5A 1GCTB 1CSOE 1HB0B 4MLFB 6CHAC 8LPRA 1O33A 2Q6FA 2FP7B 2ZFPH 3OAAD 2PKAA 5IK2D 2G51A 3PLBA 1ZJKA 2OC0A 3GS9A 5EXNA 4RT1A 1PFXC 4I31A 1JRTA 1Z6EA 7GCHG 1DT2A 3D49H 3GCHC 2D26C 1WU1A 1UVSH 3A80A 2ZF0H 1EFRD 1HAGE 1SFQB 2PW8H 1VJ9U 5CDFE 2F9OA 2PLXA 1RXPA 3RXCA 2YNAA 2F91A 4I8KA 3FZDA 3UNQA 2KFWA 1F0SA 4BXSA 3GY3A 1FY4A 3FAOA 4ZCNA 1RS0A 2YMSD 4NZQA 2AGIX 1UJ1A 2PKAB 3RXKA 2F3CE 1QL7A 3ZVBA 4YOJA 3DSPA 4IN2A 1F5KU 1TMBH 1ZJDA 1MKWK 2VNTA 3V13A 1NU7B 2VJ1A 1C5XB 4NA8A 3Q76A 1A1RA 1QBNA 1M9UA 1OYTH 2KX4A 5LPEA 1ESAA 2FI5E 1O5BB 3BEFB 1IOEA 4DIHH 3A87A 3FZZA 3SUDA 3F9GA 4YLQH 3WWBA 3VXFH 3RC5A 5FX5A 3PMAB 1LKAA 1UVUH 4OS1A 2BD8A 3ATKA 2Q6GA 2LELA 3TU7H 3ZZBA 2NU2E 1GWAA 2GT7A 1G9IE 5L6NH 1P05A 4WXIA 2KCYA 5T3HA 1V2KT 1TIOA 2Z9GA 1MU6B 4ZROA 2ANYA 4XBBA 3M36A 1GHVH 2BD3A 1GGDC 2JH5D 4QT8C 4Y7BA 5HMAA 2OC1A 1RJXB 3SOSA 3QTOH 1NBMD 1BHXF 1O3LA 1OX1A 2QIQA 3P8GA 4X1SU 3WW7A 1C5RA 3E91A 1AY6H 3E1XB 1GBCA 5DK1A 1DUAA 3A8AA 1AVXA 2BQ6B 3R3GB 1GBMA 1O2TA 2QXJA 1V2RT 1SGRE 5C1XA 3GY7A 3NKKA 2ZDLA 3MH6A 1FLEE 2P3UB 4KELA 1V3XA 2Z3DA 1EAUA 2Y6TA 1SLWB 2D2DA 5C5OA 1W8BH 3OTJE 1V2UT 1LVMA 2EY4C 1T4VH 2VWNA 3ZZ3A 5K0HA 2KZ4A 1CU1A 3VB3A 2Y5HA 5FXLA 2JKHA 1MTWA 2BYAX 2QF4A 4GAWA 1RTKA 2ZDAH 2GD4B 4ZHAA 4NG9H 2FS9A 1MQ6A 1EZQA 1UW7A 4TSFD 2VVVA 3TJOA 4AGJA 4B2AA 3SV6A 3UOPA 1CVWH 1FJSA 1EATA 1LHEH 2PTNA 1O35A 5GWZA 3T26A 2G8TA 3ITIA 4WH8A 3ZZCA 2EI7A 3F2FA 3MI4A 1C2LA 1CHOG 1TLDA 2TGAA 3M37A 5L30H 1GDUA 1P10A 2CGAA 5C1UA 1DITH 4NIXA 1D3QB 2ESTE 1W10U 2ZCHP 3OEHD 1C5LH 1O3KA 1GJ9B 2VVUA 4RT0A 4FVDA 3A88A 1OPHB 1TNKA 4Q7ZA 1G3CA 4E05H 1HAPH 3AAUA 1T7CA 3D62A 1DLKB 3K2UA 3KIDU 2SGDE 3TH4H 1NRRH 4BAQB 5L2ZH 1HGTH 3ZZDA 2QC2A 1IQKA 3SO3A 3TVJB 4HTCH 1QRWA 3BTME 3K9XB 4K1EA 2Y7XA 3JZ2B 1K2I1 3OSYA 4JCNA 1DPOA 2VWMA 2W6ID 2GCTB 4K1TA 2QAAA 2ANKH 5EG4A 1UK4A 5IYTA 1C2EA 1O2PA 2V35A 3VXEH 1QBOA 1HXFH 5TCCA 6ESTA 1PJPA 3UWJH 2ZGCA 2OQUA 2BLVA 1XVOA 1UVPA 4Y0ZE 2ZGHA 4ZKSU 3RXDA 3U1JB 1RIWC 5EPNA 4ZHMU 1O3HA 2FOBA 4O97A 3G01A 1CBWC 3A82A 1ZMNA 4XOJA 1W0YH 1GBJA 1GMCG 1YBWA 2XTTB 2V3OH 4AC9A 2XBWA 5GXPA 1BTYA 1F0RA 3A84A 4E7RG 1C5ZB 1SGFG 2ZTZA 1IQFA 1CBWB 1DFPA 1ORFA 2SFAA 3LOXA 1N8OB 1ZZZA 1H8IH 1WSSH 2J38A 2JH0D 1K1OA 1L1GA 1SGNE 1TONA 1AFEH 2WYGA 3VFEA 3SNDA 4X6NA 1AI8H 1BMMH 3H7TA 3FP7E 1DVAH 2R3UA 2P93A 5DN6D 4I8HA 2A5IA 3PWBA 4CR9A 4FUHA 2V3MA 4BTIB 4Y7AA 2WPHS 1WDIA 3SV2H 1TRNA 1GHXH 1S6LA 1TBQH 1HFDA 3SI4H 3ODFA 1P8VC 2WHXA 1TE0A 2BM2A 3M3TA 1QQUA 4DVAU 4ACAA 1IQIA 1BUIA 4XD7D 2R0LA 3RXAA 1A61H 1S0RA 1UK3A 1SLUB 3LDXH 2ZP0H 3RC6A 3MU5A 2OUAA 4IC6A 5DP6A 1SHHB 1H1BA 5I25A 4NSYA 2WSSD 1LPZB 3ZVDA 1C2FA 4UDWH 1SOTA 1HCGA 1SQAA 5EJ1A 1QGFA 2VIDA 2ZTXA 3GCNA 4O3TA 3ZV8A 3MQKC 1NZQH 2A1DB 1H8ED 2BVSH 1C1NA 2BDAA 3ZZ6A 2FESH 1O5FH 1QR3E 4JK5A 1ESBA 3CENA 1Z8GA 3MWIU 2TGPZ 3QUMP 4AFSA 5F8XA 3GY2A 3Q3XA 3SNEA 2TPIZ 1Z8JB 1DSTA 3F2GA 1EASA 1IAUA 4GHTA 5ESBA 1DWCH 4MNVA 4INHA 1QTFA 3T5FH 3VB6A 1H9LB 2AH4X 3BEIB 2PGQB 2GVFA 3HKJB 4JYUH 1A4WH 1F0TA 1Z6JH 2TRMA 1LHDH 1ZLRA 1XUJA 1G3DA 2R9PA 1VR1H 4YXWD 1TMUH 1TYNA 2UUYA 3ZVEA 2FDAA 1TFXA 4TPYA 2FMJA 2EC9H 1Z8RA 4Y8ZA 3NCLA 1QJ1B 3SUGA 1L4DA 1C9PA 1D4PB 3IG6B 1PYTC 2ZO3H 4UONA 2HGTH 3SBKA 2FPZA 2XWAA 1IQEA 3U8RH 1QRZA 2PTCE 2LNCA 2ZU5A 2ZC9H 1G37A 4CR5A 1YLDA 4A7IB 4ASUD 1VJAU 3FVFB 3CP7A 1EUFA 1NRNH 1BMLA 1O2SA 4AGKA 3OY6U 1ELTA 4NWKA 1O2QA 1WQSA 4X8TH 1MCVA 1LKBA 5ETXA 1EAIA 1P2KA 1FN8A 1BTZA 2F9UA 1TGTA 3M5OA 1UTPA 1B0FA 1O30A 2YOLA 4ISLA 2BB4A 4WVPE 3NRLA 3F9HA 1GJDB 1DE7H 2HRVA 1TNGA 1Y3VA 3MNCA 3UY9A 4AYYB 4AOQA 2AMPA 3ZVFA 2VIVA 5EW2H 3MMGA 3VB7A 2PV9B 3PO1C 1QCPA 2ZFRH 3QDZB 1TGBA 5FCKA 1U6QA 2F9VA 1QNJA 1AHTH 1LVOA 1MMJN 2EA3A 5LPFA 3M61U 1YPEH 2CF8H 1RTLA 3MH7A 3Q3KA 1ZOMA 2OQ5A 5CHAB 1EXFA 1C4Y2 2WPIS 1AE5A 4UD9H 2B0FA 1BTUA 3M7UA 4CRCA 2FOHA 2AMDA 1HAXB 3RXFA 3S9BA 1GBKA 3URCA 3EE0B 1TNIA 3C1KA 1KXCA 4AFQA 3MU1A 4OS6A 1B7XB 3RXBA 3SQHE 3SN8A 1O2LA 2BY6X 1DUEA 1GI1A 3QLPH 4Y0YE 4OS4A 2AHME 2VU8E 1LTOA 1O2YA 4DJZB 2ZFFH 1PQ5A 1P2QA 1YWUA 2Q1JA 4X1PU 1QL9A 5HM9A 1ZSJA 5GJ4B 3HKIB 4X2WA 2I6QA 2GDDA 3FOAA 1DY9A 4OS7A 3U69H 1GJCB 1HPGA 1JWTA 2KR7A 1PQAA 1B5GH 1V2NT 4DG4A 4DW2U 1A5HA 1FY3A 1KLTA 2HPQH 3WY8A 1SR5C 1S6FA 1AU8A 4LXBH 1MU8B 1H4WA 1QL8A 3SJ8A 1Y5AT 2KAIB 3MH5A 1ZRKA 2ZHDA 2CMYA 1YCPM 3A7TA 3LPRA 1XVMA 3LGVA 1OP0A 2FOEA 1QFKH 1GI0A 2K0QA 5E0JA 3EA8A 4DCDA 1PPFE 3GDSA 3E16B 3T25A 1HJ9A 1A0HB 1JOUB 5DP3A 3ZZ9A 2XOKD 5B6OA 1P2IA 3SUEA 2L6OA 1C5SA 3T2NA 3CNRA 1MD7A 3T27A 3M5NA 2Z3EA 3T28A 1V2JT 4MVNA 3SHCH 3SU3A 3FFGA 3LT3A 4X6MA 2P3FH 4FUGA 4B2BA 5EJZA 2RDEA 1VKYA 2Z7FE 1ETSH 2ODYB 2GJGA 5F6MA 1KXBA 2B8OH 3PTNA 4RKOB 4HZHA 2Z9KA 2XYAA 2K1QA 2H9TH 3DA9B 1LHFH 1T31A 3KQEA 2FOMB 4KTSA 3T29A 2PWXA 2WV9A 2CN0H 4ABJA 1EZXC 1OKXA 4AN7A 1ANEA 1W13U 2Z9IA 3P8OA 1BTPA 4NSVA 1GJ8B 1MUEB 1UVOA 4THNH 1O5CB 2A7JA 2QF5A 5SGAE 1EJAA 4KTCA 2WZQA 1GMHF 2ZHQH 2FOGA 1GCTC 6CHAB 1Y8TA 2G5NA 1LCYA 3QN7A 1FIWA 2A32A 4I8JA 3RC4A 3ZIAD 1FY8E 3LJJA 4WMFA 3UOUA 9LPRA 4TWYA 1O32A 2JDID 5DG6A 1LHCH 1VGCC 1KY9A 3UWIA 3NZIA 3A7WA 3LGTA 4RN6A 4A5TS 1GBDA 1TALA 5HM2A 5IDKA 2A45B 1AQ7A 3GISB 3SJ9A 1D3PB 3ZV9A 1PPHE 4Y76A 4Y6DA 3ATWA 3TH2H 1KDQA 1C5NH 2HVXA 3RXGA 1TPPA 2G5VA 1SMFE 1FAKH 4ISNA 1XUKA 4CRGA 1AO5A 1GI4A 1CGHA 1GG6C 1EQ9A 1NFXA 3P92A 4K1SA 1P02A 2KCOA 1W7GH 1VCWA 3DFJA 5TJXA 3RXVA 2O8LA 2WV5A 3NPSA 4AFZA 1AIXH 3IITA 3HGPA 2BD7A 4LZ1H 4YOGA 5I46H 1BCUH 4BOHA 1SGDE 5C67A 1THSH 8GCHF 3SNBA 1PQ8A 1O5AB 2ZQ1A 2OXSA 3MNBA 5EGMA 1FI8A 1GL0E 4H4FA 1FNIA 2P3TB 3BTTE 3FP6E 2FLRH 1QJ6B 1A0JA 3TITA 4ISIH 1C1VH 2H5DA 1ELCA 2BD2A 1FAXA 4P00A 1LPKB 3PLKA 1ELAA 5JDUB 4H42U 1W11U 3A7YA 2VIWA 2FTLE 1UCYE 4ZMAH 1OHHD 4KP0A 3S7HB 1C5MD 2J98A 3M35A 4U01A 4WF8A 3A8CA 4KGAA 3ATIA 3F2HA 2QY0B 2Z3CA 2H6MA 2C8WB 1D6WA 1C1RA 1TPAE 4UFFH 2I6SA 4ZKOU 3P95A 2BXTH 2V6NA 3I77A 3RUOA 1N1LA 5LGOA 2L74A 1GHWH 2BDCA 2C93B 2FTMA 5F8ZA 2P59A 1QB9A 2VGCB 3U28C 1O38A 1YM0A 2FODA 1SGCA 4Q63A 2BD5A 1O2RA 2R0KA 1YPHC 1TPOA 1CHGA 1ZPCA 3E90B 3ZYEA 5A8ZA 1SGTA 3FANA 5F03A 3AW1A 3GY4A 2IJD1 2WPKS 3RXIA 3QO6A 5DP9A 1ZSLA 7KMEH 3EGKH 2ZFQH 1YCPH 1O37A 3FP8E 5C20A 1KTSB 1SGYE 4HI3A 5JYIA 1CA0C 2GGVB 4CHAC 4ZH8A 1SL3A 1J17T 1YLNA 1GJAB 1NS3A 3AASA 3QGNB 1V2WT 2ZU4A 1GI9B 1FZZA 4HFPB 2XWBI 4NA9H 3FO8D 4XBCA 1AKSA 1P01A 3E0NB 1AKSB 2ZI2H 3TIUA 4JZFH 1S84A 1Y3WA 3S7KB 3SW2B 4K2YA 1YC0A 3GYMA 1Z7KA 2W7UA 1DICA 5B6LA 1SGFA 4CH8B 1NTPA 3HPTB 3M3VA 1UK2A 3PB1E 1MZAA 2TIOA 2FWWA 3BG8A 1L0ZA 3N7EA 2BLWA 4D9QA 1XXFA 3LJOA 5EXLA 1P2NA 2QXIA 5FPSA 1EOLA 2OBOA 2ODQA 1AMHA 3ELAH 2Z94A 3ZVAA 1DSUA 1GMCF 4HGCA 2ZKSA 1OWKA 2STAE 3M3SA 3ZZ5A 4F4OC 1YCPK 3FKSD 3UREA 2FI4E 4ZKNU 3TGKE 4UFGH 2AS9A 3KEEA 5J4QA 1C2IA 3EDXB 4JK6A 1OSSA 3QZRA 2ZQ2A 1C1MA 3LGIA 1QB6A 2VGCC 2BY5X 1KIGH 5HYOA 5T1VA 3WWFA 3TGJE 1HAHH 1Z1JA 1E38B 1ZHPA 2NU0E 2FOAA 1KMHB 3C27B 1VITG 1GJ4H 2AYWA 2Y5FA 4NIYA 3K6ZA 1UTLM 1G3BA 1QQ4A 1F7ZA 2H2ZA 3A81A 1P06A 1A3EH 1LDTT 1GBIA 3L3TA 4X8VH 3STJA 4JYTA 2JETB 4UFDH 1C1UH 1QBVH 1ELBA 2K8IA 4SGAE 1K1IA 1GBEA 3LC5A 1UTOA 1HAYB 2SGAA 3VGCB 5EPYA 2EEKA 2OTVA 5E0HA 3RXMA 4ZKRU 1QY6A 1GDQA 1TA2A 1V2ST 4X6OA 3O8DA 3OFND 4Y11E 2BDIA 1MBQA 2PFEA 2ZU1A 3LONA 1NN6A 2AEIH 1EPTA 3EYDA 4WMDA 2ZHEH 1TNLA 2G00A 2ALPA 1T4UH 1TOMH 1YLCA 1ZMLA 1NM6A 4NFFA 1GHYH 3MH4A 4TPIZ 2BDYA 1B0EA 3DD2H 1MTUA 5J4SA 2HLDD 1SVPA 1TWXB 1VITH 1OWIA 2HLCA 1MTSA 3BIVH 3BTFE 4AG2A 4IN1A 4MNXA 1CGIE 1SQOA 1L1NA 3SGBE 1YPMH 3NUMA 1Q2WA 1AWHB 1TBZH 2NU4E 4Q7YA 5JBTA 1EP5A 2XBYA 1ID5H 1IHTH 2DE9A 2ULLA 6LPRA 2ZCLP 1RFNA 3PYHA 3B9FH 1MCTA 4F55A 1P11E 1O2GH 3L33A 2A4GA 5A2MH 4AX9H 5DO4H 2WUCA 1S6HA 4F49A 5HIZA 1BB0B 3TJUA 5A8YA 2F9BH 8ESTE 3PV4A 1O3CA 1EAXA 7LPRA 1HLTH 1NY22 4GHQA 2BHGA 2XC5A 2XC0A 1DWEH 1AWFH 1MTNB 2J98B 1ABIH 1SBWA 2FX6A 1P2OA 3ZVCA 2ZDVH 1GI8B 2GZ9A 2ZU3A 3UIRA 4YTAA 2BQWB 1E1RD 2F4LA 1MKXH 2JETC 4K69A 2ZEBA 4FU8A 1YPJH 1CHOF 1CQQA 1C1QA 4IS5A 1A5GH 1X7AC 1V2PT 1Y59T 1KDQB 5EOKA 4GCHF 1YKTA 2NWNA 5C1YA 5T6DA 1JMOH 1C1PA 1LVBA 3RXSA 1LQEA 4GUXA 1JRSA 1COWD 2QXGA 1MQ5A 4O03A 1Q3XA 3P6ZB 3RXPA 2KAIA 3GDUA 2RDLA 4CRDA 1UCYH 1YPLH 1ZGVA 4IBLH 1C5QA 3OEED 2ZU2A 2B7DH 3M5LA 3ZZ8A 4Y10E 3N7DA 3RXJA 4B75A 1KXFA 4WMEA 1BRBE 3MU4A 2WINI 1LQDB 3BTGE 2IPQX 1C5TA 5JBCS 3U8TH 2VVCA 2SGPE 2VBCA 1ELFA 1NO9H 2GCHF 1GVZA 3KQ5A 5LH8A 1QA7A 2SNWA 1QZ8A 1SLXB 3Q3YA 4A1XA 1BDAA 2FO9A 3V0XA 9ESTA 1GHBF 2ZDKA 1ANDA 2B9LA 1XUFA 3TJVA 2A4RA 2AGGX 1AZ8A 3SNCA 2ANMH 1H9HE 2SGFE 4CBNA 4RSPA 1O3FA 5C5NA 3UUZA 3QX5H 1SI5H 2BD9A 1P04A 2GDEH 4U32A 3ZZAA 3KN2A 3PRBA 5E8EH 1F5RA 2WYJA 2YMSC 2OP9A 2NU3E 2XC4A 2FOCA 2VIOA 1ZGIA 2ZA5A 4NA7A 1O3EA 3UFAA 2FYRA 2CHAC 3O8RA 2Y80A 2BOKA 4UE7H 4I7YH 2BMGB 3A8BA 3VB4A 2KCPA 1D9IA 4FUIA 2C8XB 2JIZD 1AE8H 2B5TB 1TABE 2BD4A 1TGNA 3QWCH 2XRCA 3SUFA 1UVTH 1WCZA 4U30A 3GCTG 1FUJA 4K3JA 3RMLH 2GCHG 3H5CB 2FI3E 3SU4A 2JJ1D 3ZYDA 3RU4T 3GICB 1HAVB 4WY3A 1C1OA 2C4FH 1N6XA 1E34B 1EP6A 1K1NA 5F53A 1IQLA 2BY8X 3GY6A 4MDSA 3GY8A 1SFIA 3SU1A 4ZXXH 1K1MA 1XUIA 4CRFA 3M7TA 4FUEA 4RI0A 4H6TA 1S5SA 1SGIB 1ETRH 3AAVA 3GCTF 2UWLA 2SGEE 3UNSA 1V2LT 2ZHWH 2FS8A 4D8NA 1WTGH 3UNRA 1UTQA 1BZXE 3S69A 1C5WB 1T32A 3PV5A 4MG3A 5HKKD 1AFQB 2WPMS 1PYTD 5DP4A 1Y3XA 3TNSA 1IQGA 1HAVA 3SJIA 2O8MA 1MZDA 4H6SB 4DOQA 1ELEE 2ZGXH 2SNVA 2VH0A 1FIZA 4IMZA 5T6GA 2EQNA 4X6PA 4LOYH 7GCHF 3SU5A 1QA0A 1J16A 2IOTA 4GSOA 1EAWA 1SB1H 1KLJH 1GHBG 1GI7B 1FY5A 2H1UA 4YT7H 2G52A 1V2OT 2O8UA 1DWBH 1P09A 1V2VT 2RA0A 3TLOA 2OC7A 3UQVA 1ZTJA 5GCHG 3P8NA 4B6FA 4ESTE 3E6PH 5EQRA 2CXVA 1MAXA 4MPWA 1O3AA 4DURA 5A0BA 3O8CA 4WJG2 1HDTH 1KYNA 4PROA 4X1RU 5FPYA 4WWYA 2O9QA 1G30B 4XE4A 4FOUC 5AF9H 1AFQC 2FIRH 4K5ZA 3LH3A 2CF9H 3MO3A 1JXPA 2W26A 4X0WU 1ZMJA 3SU6A 2ZGBH 2IN2A 1OP8A 2CJIA 2GZ8A 3TPIZ 1SG8B 1EX3A 1ZHRA 1P0SH 1E36B 3D23A 4AB9A 1DX5M 1PPEE 3NWUA 2QV1A 4GCHG 4I8LA 1GHAF 4AORA 3KNXA 2BDHA 5CE1A 1O3GA 1W2KH 3SZEA 1ANCA 2NU1E 1C2DA 3UPEA 4OGYA 1VCPA 4ISOA 3ZVGA 3AW0A 3B23B 3TK5A 3RXOA 4BTTB 1MD8A 3T62A 1YYY1 3RM2H 2TBSA 1GI5A 1G32B 3KYGA 2UUKB 7ESTE 3N99A 1ELGA 1O2IA 3DUXH 4Y8YA 1O36A 4FVBA 1GBBA 1CE5A 3LIWA 4JMYA 1GI6A 1O2WA 2VB0A 1O39A 1BQYA 3KHVA 4IGDA 3H7OA 1FXYA 5DP7A 1ELDE 4A92A 1NFWA 4WH6A 2XCFA 4LZ4B 1E1QD 4GLYA 1VCQA 1YPHE 1CO7E
chains in the Genus database with same CATH topology
3KF2A 5BRRE 1THPB 3QGJA 1BRAA 2ZPQA 4TY6A 1RIWB 3EAJA 3BG4B 2BZAA 1JIRA 2J4IA 1S85A 3S9CA 8KME2 1O2XA 2O8WA 2OCVB 2ASUB 1C1SA 2OBQA 1DS2E 3V3MA 2OLGA 5L2YH 1ZPBA 4SGBE 1L2EA 3DHKH 4I32A 3QK1A 1J15A 1HUTH 2H9HA 1HJAB 1C5UA 1BTWA 1DANH 2A5KA 1OWEA 3LGWA 1RRKA 3EA7A 2A0QB 4AG1A 1KXDA 4AYVB 3B8JA 1P3CA 1ESTA 1SPJA 2VIPA 4NFEA 1DM4B 1O5GH 4D7GA 3V7TA 2PR3A 3RP2A 1UTNA 2SGQE 1LHGH 2QN5T 3MO6A 3BG4C 1EJNA 1BITA 1MTNC 2EI6A 4CRBA 1UHBA 4FUFA 2HNTC 1YP9A 5FPTA 1XUGA 1DLEA 4DIIH 1AVWA 1G2LA 3ENSB 1FDPA 4FXGH 4GVUA 4A1TA 5EQQA 3PMBB 1XXDA 3MNXA 4ABBA 1SQTA 3SJKA 1IQHA 4ABIA 1OP2A 4NCYA 1QURH 3M5MA 3RXEA 3SHAH 2BY7X 1GCDA 3MHWU 1D6RA 4O9VA 1C4V2 2H9EH 2CV3A 4J1YA 4A6LA 1HNEE 4BXWA 1WTHD 2Y7ZA 3MOCA 1BTHH 3PTBA 1GHAG 5AHGH 1TX7A 2YNBA 4U2WA 3OY5U 1MH0A 1MAYA 1NT1A 4ISHH 3IWMA 2UUJB 1EPTC 2DE8A 5HGGA 4VGCC 6GCHF 5A8XA 1AUJA 4ABDA 3A85A 4KTUA 1GMDG 1SOZA 3SZNA 5DGJA 3RDZA 3UR6A 1UTMA 1BTXA 1C4U2 2VWOA 2BLQA 2BXUH 3KGPA 1XMNB 4X8UH 5GDSH 3LU9B 3RMNH 1GVLA 3SQEE 2GV7A 1EZSC 1QJ7B 1L4ZA 1TPSA 4CRAA 1F92A 2G81E 4X2XA 1NU9A 3NK8A 4FUCA 4MPVA 1GGDB 1C2MA 1D3DB 5A0CA 2GMTC 3CS7A 2UWPA 1NRSH 3S9AA 1QB1A 2WPJS 3A7XA 4D76A 1BJUA 4ABGA 2ODPA 2PKSB 1C2JA 1O3JA 4A1VA 1HAIH 1H8DH 4DT7B 4NZLA 1C5OH 3NXPA 1Q31A 2ZHFH 1TA6A 4DY7B 4FU7A 2H5CA 2XBXA 1NPMA 5GPIB 1MKXK 3RU4E 2AIQA 1ARCA 1ZHMA 1BRUP 1FPHH 1K21H 1IQNA 1XM1A 1ANBA 5EODA 1O3DA 4XFQA 3TH3H 3E8LA 3RXLA 2FM2A 4OGXA 4UFEH 3BN9A 1PQ7A 2ZTYA 1K1PA 1FMGA 1NRQH 3HGNA 4I8GA 1E0FD 2P8OC 1O3BA 1BT7A 3TGIE 1WV7H 5EXMA 3V12A 2XXLA 1K9OE 1T8LA 5E2PA 1A46H 2A7CA 1TX6A 1DXWA 1EB1H 1O2MA 3SV9A 4ABHA 1P2JA 2Y81A 4YLUA 4K60A 4ZHLU 2R3YA 1CGJE 1Y5UT 5AFZH 4D7FA 2VH6A 1CA8B 1GG6B 1N6YA 4OS5A 1BMNH 1YGCH 2F9PA 2ZNKH 3SNAA 1TRMA 1T8MA 3A8DA 1OWDA 2JH6D 1Y3YA 3HK6B 3URDA 3P70B 1GI2A 1F2SE 2TGDA 3TK6A 2W3KA 1ARBA 4JZ1A 1SHYA 4FUJA 2FYQA 5DKMA 1AGJA 1DOJA 2AFQB 4XDEA 2ZPRA 2J34A 3PLPA 1N8OC 1BA8B 2QGRA 3MO9A 4YT6H 2GX4A 4KKDA 3RMMH 1O2UA 1T8NA 1UTKA 5DP8A 4TYDA 2PHBA 2VINA 5FHTA 1EPTB 4E06H 3SI3H 2CHAB 1F0UA 1SLVB 3A83A 1WAYB 2ZCKP 4NGAH 4Y79A 2WV4A 1XKAC 2QXHA 1SGQE 3BTWE 4CH2B 5DPAA 1SC8U 1K22H 1QRXA 2ZECA 3KQDA 1G2MA 1OOKB 4FUBA 1EB2A 2QCYA 3SV7A 1CT4E 5EU8A 1L1JA 3PMJA 3ODDA 3VB5A 1IQJA 1TOCB 1O2NA 1S0QA 1GPZA 4AZ2B 1WUNH 2GP9B 4ZUHA 1W3CA 2HPPH 1PPCE 5JBBS 1Y3UA 5AVDA 3TNTA 2STBE 2Y5GA 4CREA 1NFYA 3F1SB 3MFJA 3U9AH 1P57B 1ZTLA 3BTHE 3PWCA 4CHAB 1XKBC 1CA0B 4ASHA 1Z8IB 2QYIA 2V0BA 2ALVA 1K1LA 3PMHB 4YOIA 2GCTC 3D65E 3GYLB 3VEQB 5ABWA 1MKWH 2UWOA 2BDBA 1FONA 2P8OB 1GJ7B 5FBIA 1ZR0A 4RKJB 4M7GA 1PPGE 1AZZA 2IJOB 3BTKE 3RXHA 3ATLA 2WPLS 2A2XH 4INKA 4MPXA 1AB9C 1SGPE 1J14A 4FU9A 1W7XH 2D1JA 1TAWA 2DUCA 3K6YA 4FUDA 1AN1E 2ZGJA 1HRTH 3F9EA 4O3UA 1Y5BT 2PUQH 1H9IE 1C1TA 4TWWA 1OYQA 1HJ8A 1P3EA 1WOFA 3BSQA 2C90B 1HBTH 2PKSC 3Q77A 1INCA 1ETTH 1O5EH 4Q7XA 3F9FA 1EZUC 3MU8A 3U1IB 1C2KA 1VZQH 2ZG0H 1C5YB 1VITF 1Z1IA 5CHAC 2ZIQH 4BANB 4MNYA 1JBUH 1O3OA 4D9RA 5JB8S 3EA9A 1RGQA 2GTBA 3KCGH 2XCNA 3RU4D 4J2YB 1A7SA 1OS8A 1QIXB 1EOJA 2FZZA 3A89A 1J8AA 3KQBA 3RXRA 1HAOH 1UMAH 5JBAS 2BLOA 2RA3A 1W14U 2PSXA 1V2QT 1BJVA 2GKVE 1G36A 1KTTB 2BDGA 4WXVA 3E3TA 5JB9S 1CT2E 2GMTB 2HNTE 2BX3A 1XX9A 1RD3B 3SU2A 1OWJA 3LGYA 3RM0H 3RLYH 1NESE 5FAHA 4Q80A 1C2HA 5E0GA 1S81A 3BV9B 3SGQE 4YM9A 2M5TA 1GBAA 1C5VA 3RMOH 1BBRK 3Q00A 1ZRBA 2PGBB 1O3NA 1O3PB 1C2GA 2G55A 4XSKU 4BAKB 2QF0A 2AGEX 1NFUA 3ZZ4A 1O2JA 4X8SH 2HNTF 1GMDF 1W12U 4Y8XA 4MTBA 3P8FA 2J92A 1O2OA 3I78A 1A5IA 2C3SA 1E37B 1DY8A 1DWDH 5EQSA 1THRH 2ZFSA 1WBGB 4JYVH 4R0IA 4K8YA 5LPRA 2OD3B 1BBRE 4YESB 2GZ7A 1FV9A 1KLIH 4MNWA 3U8OH 1AVGH 3BF6H 1C9TA 1AB9B 1IHSH 3HK3B 1ACBE 1A0LA 2BZ6H 1V6DA 1WYKA 1O2VA 2F9NA 1O2KA 4Z6AH 3S0NA 1TRYA 2XNIA 3VGCC 3SGAE 3SU0A 4NWLA 3P17H 5K7RA 4DGJA 3U98H 2ZZUH 2P94A 1TGSZ 3PROA 1P9UA 2PUXB 3MYWA 4X2VA 3JZ1B 3QZQA 4Z0KA 1YPKH 1BOQA 5DP5A 4AFUA 1PPZA 1P9SA 1GBLA 5FX6A 1TMTH 1TBRH 2EI8A 2LPRA 2XW9A 3GY5A 4B76A 2J94A 1LO6A 3EQ0H 3F6UH 4B74A 3BTDE 4BAOB 1EKBB 5A09A 5DJ7A 1WQVH 4MQAA 4NIWA 1HJAC 4YZUA 5BPEA 4Q2KA 3GCOA 2QA9E 1BIOA 3OYPA 3LH1A 1HXEH 5C2ZA 1ZSKA 1CT0E 2HOBA 2RCEA 2GV6A 5E2OA 2THFB 2AIPA 3SV8A 1LMWB 1MBMA 2O8TA 2F83A 2A4OA 2D8WA 4GPGA 1NRPH 4R8TB 3MNSA 3CS0A 1GJ6A 2Z9LA 3PO1B 4I33A 1YF4A 4INLA 3GCHB 6GCHG 1HYLA 2V3HH 1LPGB 1UHBB 2W3IA 1TNJA 2ANWA 1K28D 2W5EA 8GCHG 1P12E 2ZPSA 4UEHH 2BVRH 1ABJH 1S82A 2HALA 2PSYA 4ZXYH 3UQOA 1RTFB 3AVZA 3A7VA 1J9CH 1D3TB 1TQ7B 2VIQA 1AD8H 1T8OA 1UTJA 3E0PB 3DFLA 4IMQA 1EJMA 3RXUA 1IQMA 2J95A 3LC3A 1HAZB 3KL6A 5CMXH 2FX4A 1PPBH 3UR9A 1YPGH 2BY9X 2AERH 2W7SA 1DXPA 3BTQE 1W0ZU 2RG3A 3BIUH 2A2QH 1K1JA 3STIA 4X2YA 5AFYH 2Z6BD 3RXQA 1O3IA 1O5DH 1P2MA 1O31A 1A2CH 3F68H 1JIMA 1V2TT 1G3EA 2R2MB 3M7QA 4BTUB 2J9NA 4B73A 1GDNA 5JPMH 1O3MA 4ABFA 1GMHG 1P03A 3RLWH 1KXEA 3K65B 2HWLB 3W95A 3ATMA 3O8BA 1TGCA 2A5AA 5ESTE 2A7HA 1GL1A 2BTCE 2BX4A 5F8TA 1O34A 3R0FA 4Y71A 3GOVB 4XBDA 5FBEA 2WUBA 2XBVA 1QHRB 3SJOA 2FEQH 5A0AE 2Z9JA 2ZFTA 2IPHA 4B1TA 4AB8A 2J2UA 4JZIA 2R2WU 1TB6H 3KQCA 4LK4A 2A31A 3A7ZA 1TX8A 1GJ5H 1MTVA 1E35B 1ELVA 1SGEE 3DT0H 2Q6DA 1BHXB 4YO9A 1S83A 1HV7A 2AMQA 1GBHA 4ABAA 3ESTA 1F5LA 4B2CA 2FOFA 2OC8A 4IW4E 1OXGA 1TNHA 2GT8A 1O2ZA 1GVKB 2FLBH 4X1NU 2Y82A 3TJNA 4OS2A 1DDJA 3LGUA 1BBRH 2G4TA 2TGTA 1FQ3A 2G4UA 3UTUH 4B71A 5FCRA 5HXFA 1BRCE 2P16A 1UCYK 1ZYOA 2QF3A 3SORA 1AUTC 1GJBB 1FN6A 5GIBA 3W94A 3HATH 4IC5A 5G4BA 3LKWA 1LVYA 3OX7U 3TK9A 3VPKA 5T6FA 4CBOA 1NROH 1V2MT 2C8YB 2OINA 3N7OA 1TQ0B 1A3BH 2BOHB 2ZWLH 1FY1A 5PTPA 1BMAA 3BTEE 2BQ7B 4BAHB 1GHZA 1KSNA 3A86A 1HIAB 3GDVA 1KXAA 1VGCB 1C1WH 1HIAA 5EW1H 4VGCB 5TCAA 3BEUA 4NIVA 3L6PA 3OU0A 2A4QA 1ZTKA 1ZPZA 3MU0A 3PM3A 1SSXA 2BVXH 2C8ZB 3QTVH 4ZAEA 3MTYA 2VWLA 3RXTA 4JZEH 4X1QU 3ZZ7A 1C5PA 1GBTA 4E7NA 2P95A 4MPUA 4BAMB 5H4IB 4ABEA 1FPCH 1Z71A 2UUFB 4K8BA 4JZDH 2ZDNA 2ZDMA 5GCHF 2ILNA 1O2HA 2FXRA 4BNRA 1GI3A 1UO6A 3I29A 1NC6A 1O0DH 1GBFA 1XUHA 5C3NA 4TY7A 1OWHA 1GCTB 1CSOE 1HB0B 4MLFB 6CHAC 8LPRA 1O33A 2Q6FA 2FP7B 2ZFPH 2PKAA 2G51A 3PLBA 1ZJKA 2OC0A 5EXNA 1PFXC 4I31A 1JRTA 1Z6EA 7GCHG 1DT2A 3D49H 3GCHC 2D26C 1WU1A 1UVSH 3A80A 2ZF0H 1HAGE 1SFQB 2PW8H 1VJ9U 2F9OA 2PLXA 1RXPA 3RXCA 2YNAA 2F91A 4I8KA 3FZDA 3UNQA 1F0SA 4BXSA 3GY3A 1FY4A 3FAOA 1RS0A 4NZQA 2AGIX 1UJ1A 2PKAB 3RXKA 2F3CE 1QL7A 3ZVBA 4YOJA 4IN2A 1F5KU 1TMBH 1ZJDA 1MKWK 2VNTA 3V13A 1NU7B 2VJ1A 1C5XB 4NA8A 3Q76A 1A1RA 1QBNA 1M9UA 1OYTH 5LPEA 1ESAA 2FI5E 1O5BB 3BEFB 1IOEA 4DIHH 3A87A 3FZZA 3SUDA 3F9GA 4YLQH 3VXFH 3RC5A 5FX5A 3PMAB 1LKAA 1UVUH 4OS1A 2BD8A 3ATKA 2Q6GA 3TU7H 3ZZBA 2NU2E 1GWAA 2GT7A 1G9IE 5L6NH 1P05A 4WXIA 5T3HA 1V2KT 1TIOA 2Z9GA 1MU6B 4ZROA 2ANYA 4XBBA 3M36A 1GHVH 2BD3A 1GGDC 2JH5D 4QT8C 4Y7BA 5HMAA 2OC1A 1RJXB 3SOSA 3QTOH 1BHXF 1O3LA 1OX1A 2QIQA 3P8GA 4X1SU 1C5RA 3E91A 1AY6H 3E1XB 1GBCA 5DK1A 1DUAA 3A8AA 1AVXA 2BQ6B 3R3GB 1GBMA 1O2TA 2QXJA 1V2RT 1SGRE 5C1XA 3GY7A 3NKKA 2ZDLA 3MH6A 1FLEE 2P3UB 4KELA 1V3XA 2Z3DA 1EAUA 2Y6TA 1SLWB 2D2DA 5C5OA 1W8BH 3OTJE 1V2UT 1LVMA 1T4VH 2VWNA 3ZZ3A 5K0HA 1CU1A 3VB3A 2Y5HA 5FXLA 2JKHA 1MTWA 2BYAX 4GAWA 1RTKA 2ZDAH 2GD4B 4ZHAA 4NG9H 2FS9A 1MQ6A 1EZQA 4AGJA 3SV6A 2VVVA 3TJOA 4B2AA 3UOPA 1CVWH 1FJSA 1EATA 1LHEH 2PTNA 1O35A 5GWZA 3T26A 2G8TA 3ITIA 4WH8A 3ZZCA 2EI7A 3MI4A 1C2LA 1CHOG 1TLDA 2TGAA 3M37A 5L30H 1GDUA 1P10A 2CGAA 5C1UA 1DITH 4NIXA 1D3QB 2ESTE 1W10U 2ZCHP 1C5LH 1O3KA 1GJ9B 2VVUA 4FVDA 3A88A 1OPHB 1TNKA 4Q7ZA 1G3CA 4E05H 1HAPH 3AAUA 1T7CA 3D62A 1DLKB 3K2UA 3KIDU 2SGDE 3TH4H 1NRRH 4BAQB 5L2ZH 1HGTH 3ZZDA 2QC2A 1IQKA 3SO3A 3TVJB 4HTCH 1QRWA 3BTME 3K9XB 4K1EA 2Y7XA 3JZ2B 1K2I1 3OSYA 4JCNA 1DPOA 2VWMA 2GCTB 4K1TA 2QAAA 2ANKH 5EG4A 1UK4A 5IYTA 1C2EA 1O2PA 2V35A 3VXEH 1QBOA 1HXFH 5TCCA 6ESTA 1PJPA 3UWJH 2ZGCA 2OQUA 2BLVA 1XVOA 1UVPA 4Y0ZE 2ZGHA 4ZKSU 3RXDA 3U1JB 1RIWC 5EPNA 4ZHMU 1O3HA 2FOBA 4O97A 3G01A 1CBWC 3A82A 1ZMNA 4XOJA 1W0YH 1GBJA 1GMCG 1YBWA 2XTTB 2V3OH 5GXPA 2XBWA 1BTYA 1F0RA 3A84A 4E7RG 1C5ZB 1SGFG 2ZTZA 1IQFA 1CBWB 1DFPA 1ORFA 2SFAA