4IMZA

Structural basis of substrate specificity and protease inhibition in norwalk virus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
183
structure length
173
Chain Sequence
DKAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLTGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQAGEGETAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Genome polyprotein
publication title Structural basis of substrate specificity and protease inhibition in norwalk virus.
pubmed doi rcsb
source organism Norovirus hu/1968/us
total genus 41
structure length 173
sequence length 183
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4imzA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4imzA01
1CGHA 1ORFA 2OUAA 1AB9C 5H4IB 3T26A 1WAYB 2BY9X 3RMLH 1ESTA 1UCYE 3GY6A 2F3CE 1FN6A 1SQTA 2GMTC 2GCTB 1O2PA 4UEHH 4DIIH 4OS6A 1CA8B 2ZO3H 3F9GA 1MD7A 3KGPA 3LC3A 4WMFA 1DITH 3Q3YA 2O8WA 3MO6A 1NFWA 1P11E 3DHKH 5GIBA 3RXOA 4E05H 2JH6D 1YP9A 2EA3A 3KHVA 1AE8H 2ZU1A 3VEQB 1NRRH 2R2WU 3D23A 1OP8A 2ZHEH 3ZZ5A 1TNKA 1B7XB 1V6DA 3ELAH 4ISHH 1GJ4H 1OX1A 5DGJA 3FP6E 1SFIA 4KGAA 1LQDB 5JBTA 5ESTE 1UCYK 2ZA5A 2STAE 2I6SA 3L3TA 1SL3A 5AFZH 1DT2A 1TGCA 5JBAS 2OC0A 1TMTH 3UY9A 4XBBA 3SU1A 2CXVA 2ZP0H 5A0BA 1EXFA 4NSYA 2F9OA 6LPRA 2VWLA 1EAXA 2SNVA 1NESE 2ZGHA 3RXCA 3SI3H 1O5GH 3PO1B 1TQ7B 2JETB 4FUHA 4Y8ZA 3LGTA 4JMYA 1P2KA 4AYVB 3GY7A 3SU5A 4WMEA 5EQQA 3MMGA 1YC0A 1SSXA 1AFQB 3A87A 1AUJA 4RKOB 4O3UA 1MBMA 5C1UA 1KLTA 2BZ6H 1T8NA 3TIUA 4ABAA 1RGQA 2FP7B 1WQSA 1MMJN 4NIVA 3DA9B 3M5MA 3TJOA 3OU0A 1MH0A 2BB4A 2STBE 5JYIA 1XXFA 3LJOA 4GUXA 1UHBB 2KAIB 1AWFH 3S0NA 4GSOA 5B6OA 1C1OA 1MKXK 1Z8GA 1GWAA 1TONA 4DJZB 1IQKA 1HAVA 2BOHB 4H4FA 3QX5H 1HAOH 1QHRB 1XM1A 2ZTZA 4OS7A 3GYMA 4U01A 2W7UA 4KTCA 5A0CA 2C90B 3OYPA 4NZLA 2BQ7B 1FIZA 1FPHH 1W3CA 5FAHA 2FLRH 1C5NH 1P9SA 2H5CA 3ZV8A 3HATH 1T32A 1EATA 2ILNA 3KNXA 2ALPA 3UOUA 1Q3XA 3TGJE 1P04A 1C5OH 1ELCA 1GI1A 1E0FD 2WPJS 3ZVGA 1HFDA 1RTFB 3EA9A 3S9BA 1F2SE 1ZTLA 3U69H 4JZFH 5FHTA 2BD8A 2DE8A 1UVSH 4LK4A 2DE9A 1ZJDA 3SV9A 3TU7H 1DSTA 4FUFA 4MNVA 5E2OA 1ZTJA 3PROA 4UE7H 3MWIU 3VXFH 1T8OA 1Y3WA 5K0HA 2ZZUH 1YM0A 1ZGIA 1IQJA 1B0FA 2XRCA 1C1MA 3SJIA 1J9CH 1C2LA 4ZHLU 3A83A 2TGAA 1CGJE 1KTTB 2FI4E 1O3BA 1G3DA 2BM2A 1G36A 3ZZ8A 4XDEA 2QAAA 3KCGH 4F4OC 1PYTD 1AHTH 2C8ZB 1FZZA 3RC4A 1BZXE 2GT7A 2NU3E 1MQ6A 2OTVA 1O5BB 1T4VH 4UDWH 1DDJA 4ZUHA 1L1GA 1HAIH 1EUFA 1S0RA 2VVVA 4JYUH 1TPAE 3S69A 1TFXA 4AFSA 2ZDMA 1TMBH 1YPLH 2HALA 4JK6A 5LPRA 1ARCA 3AW0A 2JH5D 5DP5A 2J4IA 4WJG2 1TGTA 1C5QA 1GG6C 1O2KA 2FM2A 3MU4A 4RSPA 1K22H 1CVWH 4ABDA 1MTNB 4DY7B 2OD3B 3EAJA 1EPTC 2VWNA 1YBWA 2Z9GA 1TNLA 4I32A 5DJ7A 1Q2WA 1JWTA 1NRSH 5ETXA 1HB0B 3O8CA 1ETSH 3CS7A 2J92A 2UUFB 1BDAA 3SU4A 3SZNA 4A6LA 1C4V2 1W12U 5TCCA 1BMMH 1OP2A 1O2HA 4H42U 5C5OA 1IOEA 1PPCE 1QB6A 3RLYH 2PR3A 1SQOA 1F0RA 4BAQB 1CO7E 4CR9A 4K3JA 3RMNH 2A31A 3ODDA 3SU6A 3AAVA 4JK5A 1IHTH 3A82A 4CR5A 3T27A 4HGCA 4NZQA 1P2QA 3BTME 1WYKA 2WPLS 1HIAA 4B1TA 2H5DA 1PQAA 1DPOA 3PV4A 2VIQA 1RTLA 2LPRA 3RC6A 2VIDA 3C27B 4CRFA 1ZZZA 2H9TH 3FZZA 4JZDH 1H9IE 1TNIA 1EB1H 2IN2A 1ABJH 1ZR0A 3EYDA 3QZRA 1WSSH 4HI3A 5EXMA 1THPB 4NWKA 3T62A 2THFB 3DD2H 1KXCA 4X1RU 1FMGA 3E6PH 8KME2 1PPEE 1TQ0B 3VB4A 2R3UA 1MZDA 2VU8E 1HAYB 1V2VT 2AS9A 4FUDA 5DP3A 1EQ9A 2QGRA 2PTNA 1P0SH 1ANEA 1BTYA 1XUFA 2XXLA 1O2XA 2BD9A 4NA9H 1DVAH 1GJ5H 4B73A 3OTJE 2BLVA 2QXIA 1EJNA 4CRDA 3SV6A 1QQ4A 1O2ZA 2PTCE 1SB1H 1AFQC 3GYLB 1BTWA 1SOZA 3EGKH 2CHAB 1QJ1B 1KTSB 2WV5A 2PW8H 1AKSA 1P2OA 3PMHB 5FX6A 2ODPA 1BA8B 1H9LB 3BF6H 3UUZA 1TX6A 3BN9A 4XE4A 1O3FA 2UWPA 1LCYA 3RXJA 3VB6A 3URCA 3B23B 1CT0E 3GY4A 1FV9A 1XUIA 1EP5A 1SPJA 1YPKH 4K5ZA 4DT7B 1TABE 1FNIA 3GCTF 3L33A 4GVUA 4OGXA 1RXPA 3AASA 3IWMA 2QXGA 1K1PA 2FDAA 1IQMA 1Q31A 4LXBH 3RXSA 3NXPA 5ABWA 3EE0B 4BAKB 8LPRA 4I8JA 3TH2H 1C1NA 4INLA 1FY5A 2AMPA 5L2ZH 9LPRA 2F9VA 5GCHF 1WTHD 2TIOA 3GCHC 1CE5A 1HAPH 3WY8A 2AMQA 2Q1JA 4VGCB 1SC8U 1ZHMA 4CH2B 1C5XB 3SU0A 1TPOA 3I77A 1LPZB 2OCVB 1QL8A 1P3EA 3EDXB 3ITIA 1K1OA 4X8VH 2D26C 5CHAB 3H7TA 1BUIA 2H2ZA 2Z7FE 1UTMA 2PWXA 3GDSA 1Z8JB 2C93B 3VGCC 1GGDB 3M35A 2ZGJA 3B8JA 2ZFTA 4MPWA 3U9AH 6ESTA 3ATKA 1GJAB 3TJVA 1GBLA 4CHAB 3RDZA 2P16A 4IC5A 2PSYA 2PV9B 1GJCB 1V2RT 1O2RA 5LPEA 1RRKA 1Y5AT 4TYDA 2UUJB 3GISB 2ZDLA 1P09A 5C1XA 3P95A 2CGAA 1GVLA 1SLVB 4FU7A 4E7RG 2ZI2H 4XFQA 3P6ZB 1P2JA 1L1NA 1JRSA 1LO6A 1EZUC 1O3LA 1SHHB 3RXHA 3RLWH 3ZYEA 1EJAA 1D6RA 1C5RA 2G4TA 1UTNA 2OQUA 3STIA 3EA7A 1JMOH 1EAUA 2BXUH 1UK3A 1GHYH 5DG6A 4NGAH 4CH8B 2BDBA 1NFXA 1MU8B 1ZRKA 1Y59T 2XTTB 4YT7H 1H8IH 4DG4A 1DM4B 5IDKA 3GCTG 5A2MH 2BY5X 2QA9E 3ZYDA 1LHFH 1OS8A 2HGTH 1SVPA 1JRTA 1F5KU 4YZUA 1UJ1A 2SGQE 5EW2H 2ZU4A 3STJA 1NFUA 3BTTE 2VWOA 2RA0A 2BDCA 2FOGA 2V3HH 3BG4B 4J1YA 1UVPA 1GJBB 3ZZ4A 3A8DA 4DCDA 1DLKB 1L4DA 1H9HE 4K1EA 2YOLA 1AGJA 2BX4A 1BRUP 1K1JA 5GCHG 2C8WB 4AZ2B 1K1NA 1IHSH 3SGBE 1C5ZB 1W7XH 5T6DA 1MCTA 8GCHF 3TPIZ 2HPPH 1VGCC 2BY7X 3SGQE 2SGPE 1LVMA 2GTBA 2WYJA 2ZU5A 4YO9A 2ZDAH 3KQCA 2RG3A 2P95A 4DURA 3M7UA 3HK6B 1GBDA 1O3OA 1PFXC 4OS5A 4FUCA 3QTVH 4R8TB 1O32A 1C2DA 1UCYH 3BIUH 3GDUA 1TRMA 5IYTA 3TITA 1EX3A 1Y3VA 1FAKH 1L2EA 1OWIA 2AFQB 2KAIA 3SQHE 2QXHA 2A4OA 2ODYB 2BDIA 1SGIB 2V0BA 4WY3A 1OWDA 4Y7AA 1O30A 4H6SB 1ZSLA 2FS8A 5A8ZA 2C4FH 2OXSA 4ABJA 1UMAH 2ZGXH 1DS2E 4XBCA 4X2YA 2AGIX 4DGJA 3KQDA 2P3UB 1EKBB 1GHBF 3S9CA 2ASUB 1FY1A 1DY9A 3UNQA 2O8UA 1ZYOA 4WH6A 2J34A 3OX7U 1G3CA 1WQVH 1AUTC 5EG4A 1NT1A 2VVUA 2HLCA 1ZGVA 1N1LA 3KIDU 2WINI 3BTHE 3M3TA 2XCFA 5F8ZA 2VIWA 1NS3A 2HNTC 4YLQH 4ZH8A 3MNXA 3ZZDA 1EP6A 1D3TB 1P3CA 1F5LA 1F0TA 2ZFFH 1O0DH 3RXDA 2VWMA 5FPTA 1GMCF 1AIXH 3FP7E 3PLPA 1EB2A 2Y82A 3SUFA 1IQEA 1GHAG 4AORA 1HV7A 1CQQA 3T28A 3ZZAA 4CREA 1YPGH 1SGQE 4GCHF 8GCHG 4I8HA 3SHCH 1UTOA 2ZEBA 2PKAB 3V13A 1O3HA 4MLFB 5FBIA 4K8BA 2CN0H 1LKBA 2A7HA 4GPGA 1A1RA 2FMJA 2BTCE 3ZVFA 1V2LT 3VB7A 1EZQA 3B9FH 5DO4H 1WOFA 2ZDNA 2BLQA 2CJIA 1GJ7B 1UTLM 4VGCC 1VR1H 3ODFA 4ZHAA 1GCTC 3S7KB 5HYOA 4YESB 3IG6B 4UFDH 3K9XB 3MFJA 4K69A 3M61U 8ESTE 3MOCA 1K1MA 1NRNH 4AN7A 4JYVH 4I7YH 1PQ8A 3SU2A 1TGNA 6CHAB 1HGTH 4FXGH 1HJAB 1AWHB 2HNTF 2QIQA 1MUEB 3MU5A 1H8DH 3CP7A 2ZPQA 2ZIQH 2GDEH 3A86A 1N6XA 1XXDA 2C3SA 2Y6TA 1GHBG 1XUGA 1LTOA 2BOKA 4NWLA 1NM6A 2VNTA 1QBNA 2WPHS 1ANCA 1ESAA 1O2VA 2CV3A 5AFYH 3QLPH 2P8OB 3E90B 2NU0E 3HKIB 3ZVDA 1A0HB 3ATMA 1VITH 1LPGB 2SFAA 2WUBA 3ZZ6A 1BMLA 1QBOA 1O37A 2Y5FA 2A2QH 2HOBA 1RIWB 1SHYA 2B8OH 3R0FA 1DUAA 3SORA 1BOQA 1H1BA 1W0YH 1GJ6A 4IMZA 3RXLA 2TBSA 1GBAA 1C4Y2 1KXBA 3QZQA 2RDLA 3E0NB 3P17H 1LKAA 4CRBA 3L6PA 3UTUH 1Y8TA 4TPIZ 1GMCG 3NUMA 1O3AA 1TPPA 1ESBA 2OP9A 1A4WH 1S82A 2BX3A 3V0XA 1E36B 2A4QA 2J9NA 4ISIH 1GBMA 1CT4E 2GDDA 1Z6JH 1S81A 2XC5A 3TH4H 2ZFQH 1SGFA 4ZKNU 1EOJA 2Z6BD 3Q00A 4GCHG 4NIWA 2Y7XA 1ZMJA 4XBDA 2AYWA 2NU4E 1N8OB 5EQSA 1ZHRA 1QCPA 1NC6A 1ID5H 2B9LA 2QF0A 4A7IB 4PROA 2ULLA 4TWWA 2IPHA 1SGTA 4KELA 1A0JA 1O2QA 1GBCA 2FOAA 3AVZA 1MTVA 4WXIA 1VCWA 4MVNA 1ELAA 3FFGA 1CA0B 1THSH 3V7TA 4RN6A 4FVBA 1UO6A 4ZKSU 2WPIS 4D8NA 4CRAA 5DP7A 3U1JB 1G2MA 1BBRE 3SJKA 2BD2A 2P3FH 4ISLA 1S84A 2G00A 3UREA 1O2OA 1TX8A 3UQOA 2Y81A 2G5VA 3M7TA 3BSQA 1YLDA 1RFNA 1C2KA 1ELBA 4X1NU 1A5HA 1PQ7A 2Q6FA 5EGMA 1EAIA 4IN2A 1OWHA 2O8MA 4B2AA 3FVFB 3LIWA 1QIXB 5GJ4B 1OKXA 4M7GA 1ARBA 1TE0A 5GWZA 4LZ4B 1DWCH 2FO9A 1CGIE 1GHVH 2G4UA 4O97A 4SGBE 2V3OH 4TY7A 4YT6H 1EAWA 5SGAE 3D65E 2BDHA 1GMHF 3I29A 2BD4A 1GJ9B 1GMDF 3A7TA 3UNSA 1C5UA 1O2SA 1SGEE 5G4BA 3R3GB 1C2MA 4BAMB 1AQ7A 1YPEH 4FUBA 3EQ0H 2G8TA 1G3BA 4NIXA 2PFEA 3BG8A 2FODA 4ISOA 1ZSKA 2TGDA 2Y5GA 2WPMS 4ZHMU 3TH3H 1YPMH 1C1UH 4DOQA 3QGNB 4K8YA 1O3NA 4Z0KA 1K1LA 4MG3A 3C1KA 1O3IA 1FPCH 2ZFRH 3SN8A 4BTUB 1BCUH 1T31A 3P8OA 3KF2A 4BAOB 1V2WT 2ZQ1A 1WUNH 4NFFA 1ZMLA 1F0SA 4KKDA 1QRXA 2FEQH 1MU6B 1S83A 4X6PA 1HPGA 1YPHE 2BD3A 1O5CB 4UONA 1HJ9A 4NG9H 1BHXB 1HUTH 2GCTC 1Z1JA 1UTJA 3SUDA 2H1UA 1T8MA 3F9FA 1BMAA 4AYYB 1NRQH 2XBYA 2ZQ2A 2ZWLH 1FY8E 2CF9H 1SFQB 2J2UA 1GI0A 2XWAA 2ZKSA 2RCEA 2VH0A 3KN2A 1QJ6B 2OQ5A 2H9EH 2W26A 4IC6A 4Y71A 2VIOA 1LHEH 3PWCA 2Q6DA 4B2BA 2PKSB 2BDGA 2P3TB 1O38A 2ESTE 1KY9A 3RXVA 1BTUA 2ZHQH 3ZVAA 3KQBA 3DUXH 3LPRA 2HWLB 5LPFA 2BMGB 4AGJA 1RS0A 3SNEA 1P01A 2AIQA 1BT7A 3FANA 3LGVA 1O3MA 1PQ5A 5E0GA 4JZIA 1W11U 1GJDB 1NPMA 2AGGX 2JKHA 2FI5E 2R9PA 4AGKA 1L4ZA 5F8TA 2BLWA 1G37A 2ANMH 3KL6A 1GMHG 1GMDG 1K21H 2OC7A 1E37B 2G5NA 2ZU3A 3PO1C 4Y8XA 6CHAC 5K7RA 1HJAC 2VGCB 1BITA 3S7HB 2JETC 1HAHH 4X2VA 1O2JA 4O03A 3U98H 1AZ8A 3HKJB 5F6MA 3M3VA 5HMAA 1J14A 3RXIA 4ZAEA 1FONA 1TNHA 3M3SA 3PLKA 4AB9A 3A7XA 1CT2E 1PPZA 4Y76A 3KQEA 1ELEE 2BD5A 2EI6A 3GY5A 2ANYA 1MTUA 3TJNA 2FYRA 7ESTE 1NU7B 3URDA 4DIHH 4TPYA 4CBOA 3SQEE 2BVRH 2F83A 2LNCA 1OP0A 2ZFSA 3P70B 1GVKB 1UVUH 1IQNA 1C2JA 2F9NA 4I8LA 2ZC9H 3Q3KA 4A1XA 2YNBA 2ZTXA 3MH7A 3QTOH 1C9TA 1V2MT 1BJVA 1KIGH 1PPBH 1MKWH 2BD7A 3KEEA 4FUJA 1OXGA 2BDAA 1DY8A 1G9IE 3PYHA 2DUCA 2XBWA 4KTUA 3U8RH 2GMTB 1T4UH 1DWBH 2A45B 1V2UT 1GBJA 3K6YA 3RXMA 3K2UA 1CBWB 3MU1A 1GHZA 1XVOA 1BTZA 1L1JA 3P92A 1ANBA 3RXKA 3NKKA 5DP9A 1P8VC 5E2PA 2K1QA 3K65B 3MU0A 1HDTH 1XX9A 3SNAA 4IMQA 3LT3A 5EQRA 3RC5A 2ANWA 1O3GA 1UTPA 2HPQH 1ZLRA 3MNBA 5GPIB 1GJ8B 1O3DA 4BAHB 1PYTC 2R0KA 2ZNKH 3MH4A 1SQAA 4Y0YE 4BNRA 1LVBA 2W7SA 3E1XB 1P2NA 1IQGA 4X0WU 3ZVBA 1B5GH 2R0LA 1P9UA 3TNTA 1Y3YA 1FY4A 1TNJA 1DOJA 2B5TB 2FIRH 4YTAA 1ZPCA 2FOCA 2J95A 3SUEA 2PGQB 1T7CA 1C2EA 3MO9A 2GV6A 1BTXA 3O8DA 1XKBC 4INHA 2BYAX 1HYLA 1WCZA 3ZZ9A 2XWBI 4H6TA 1KLJH 3P8FA 1GI3A 3Q76A 3A89A 1V2PT 4IS5A 5JBCS 3UWIA 5I25A 1O3CA 1BRBE 2PGBB 2OLGA 4MNXA 3LGUA 1GDNA 5L2YH 2PHBA 1LDTT 1OWJA 4AOQA 1QGFA 1BRCE 1P06A 1O31A 4NA7A 1GI4A 6GCHF 3Q3XA 1TX7A 1GBEA 2AIPA 1HXEH 3RM2H 3SU3A 3AAUA 1INCA 5HGGA 1P2IA 7GCHF 2FX4A 1MTNC 3QWCH 2XC0A 2FZZA 3ZV9A 1MKWK 4Q7ZA 1O2GH 3RUOA 2PKAA 3SNDA 3U8OH 3ZZBA 3NWUA 1NO9H 3RMMH 2Q6GA 1J16A 1BB0B 4WVPE 1ABIH 4DVAU 1ETTH 4WWYA 2QY0B 3BTFE 4KTSA 4BANB 2VJ1A 4U32A 4X2XA 1AE5A 1GDUA 1W0ZU 1A2CH 1AU8A 2VIVA 1TWXB 4FVDA 4UD9H 4BOHA 5DPAA 1RJXB 2Z3CA 2O9QA 3RXPA 3ZVEA 3H5CB 4F49A 1DUEA 5PTPA 3FAOA 4SGAE 2FWWA 2O8LA 2ZF0H 1XUJA 3TJUA 3LOXA 3BTGE 5L30H 1BIOA 1TA6A 1SGCA 7KMEH 3UWJH 2FOHA 1CHOF 3VB3A 2WPKS 2OINA 3LDXH 1C1WH 3VFEA 1AO5A 4Q7XA 3F1SB 1KDQB 4IBLH 1JOUB 3GCOA 2UWLA 3BTKE 1SI5H 4HFPB 1MTWA 1DWEH 1HRTH 1C5VA 1GBTA 1NY22 3BTDE 4TY6A 4A1VA 1C1QA 1C2HA 1WU1A 1O2YA 2XYAA 4NA8A 2Z9LA 1UHBA 3RP2A 1Y3XA 1RTKA 4NSVA 1SG8B 1SGDE 1W7GH 4A1TA 4IN1A 3VXEH 3RMOH 3ZZ7A 2CMYA 3HK3B 2AGEX 1O3PB 1TPSA 1F92A 3BIVH 1F7ZA 3U1IB 3UFAA 1D3DB 1S85A 5F8XA 2TGTA 2EEKA 3HGNA 4AFZA 1A0LA 2ODQA 1ELVA 2ZCLP 2EI7A 3UR6A 1VITF 5JBBS 2F91A 1A5IA 4B74A 4Y0ZE 2AMDA 3LC5A 5FPSA 3E3TA 1DLEA 4CRGA 2D1JA 1YPHC 3T25A 1UVTH 2FI3E 9ESTA 1EZXC 1P02A 3HPTB 3V3MA 3LGWA 4GHTA 4AB8A 4INKA 6GCHG 2CHAC 1GG6B 1ELGA 2A2XH 4Y8YA 1A7SA 7GCHG 1EPTB 2ZPRA 3RM0H 4ABFA 3A7WA 3BV9B 1HCGA 1QB1A 1P05A 2FX6A 1MAYA 4I8KA 5EXLA 4NIYA 4WF8A 5TJXA 3TLOA 1NU9A 3M7QA 1ZPZA 2PSXA 2WYGA 3NZIA 4K2YA 2I6QA 3RU4T 3LKWA 2UUKB 1GHXH 3PMJA 3T5FH 4A5TS 3UNRA 5AVDA 3LH3A 1YGCH 1P03A 3AW1A 3E0PB 1JIMA 2Z3EA 3ENSB 1HAZB 1BTHH 2IOTA 4ABGA 4FU8A 2QF3A 2BQWB 1NROH 2SNWA 1P12E 5I46H 1CHOG 2OBOA 1HJ8A 3F68H 5FCRA 1OYTH 1O2WA 3MO3A 5C67A 1AI8H 1P10A 1TLDA 2M5TA 2Y80A 1ZJKA 1W13U 1CBWC 5HM9A 1QA0A 2ZCHP 1DANH 1DFPA 3M5LA 1O36A 4BXWA 1F5RA 1C4U2 1O5DH 2NU2E 4NFEA 2FYQA 5DP8A 5A8YA 3BTQE 1SR5C 5CHAC 2PUXB 1A3BH 3TK5A 2P59A 3P8GA 1S6HA 5BPEA 4LZ1H 2TPIZ 4ZXYH 3SJ9A 2OC8A 2D2DA 4X6MA 1FDPA 1SGRE 1GGDC 3NK8A 1O5FH 2FTMA 4RKJB 3RXRA 4XSKU 3MI4A 1PJPA 4WMDA 4YOIA 5C5NA 5HXFA 1MZAA 2QV1A 1Y5UT 1LHGH 1VITG 2G51A 3SJOA 4CHAC 1XMNB 1TAWA 1DX5M 2ZU2A 1NN6A 1TA2A 1GBKA 1XKAC 1CHGA 1AY6H 2FOMB 1NFYA 1C2IA 4ABHA 1BJUA 1D3QB 1ELFA 1MD8A 1NTPA 1AVWA 1BBRH 3TK9A 1GCDA 1C5TA 2XBVA 1WTGH 3QO6A 2ZHWH 1IQLA 4ZKRU 5T3HA 2EI8A 1PPGE 4FU9A 4HTCH 5FPYA 1EOLA 5AHGH 2VIPA 1GHWH 4ZKOU 3UQVA 4JZ1A 3PTBA 3BEIB 1C1VH 4Y10E 4K1TA 1YCPM 5GXPA 1V2TT 1VJ9U 3SV7A 2SGFE 3SGAE 2A7CA 3SO3A 1Y5BT 1BTPA 1LVYA 3SHAH 1SGFG 1O2LA 1J15A 4FUIA 1QA7A 1AFEH 4ZROA 3GCNA 1TOCB 2B7DH 4TWYA 1DICA 1O2MA 1GBIA 2AERH 3BG4C 3RU4E 3LONA 3MH5A 3SNCA 2BZAA 2WV4A 5DKMA 1VZQH 1AVGH 3M5NA 3QGJA 1DWDH 3MTYA 1AMHA 5C1YA 3ZZCA 4IGDA 1VCPA 2A5AA 2Z9IA 3GCHB 3S9AA 2FESH 4KP0A 4B75A 3SJ8A 3O8RA 3Q77A 4OS2A 1YCPH 4ESTE 1O2UA 2P94A 3PTNA 2CF8H 1SLXB 2G55A 2UUYA 1YYY1 2Z3DA 1HLTH 1NRPH 1KXDA 4FUEA 1ETRH 1GBFA 1IAUA 1E38B 5F03A 2BLOA 2ZTYA 1K9OE 1GBBA 2VINA 3SV2H 3VGCB 1YLCA 1QNJA 1UK2A 3F6UH 1D4PB 3A81A 4Q2KA 1C1PA 1QRZA 3OSYA 3DFJA 2XNIA 3A7ZA 3A84A 2J38A 3IITA 4D7GA 2HVXA 1Z71A 1BMNH 1Z8IB 1V2NT 2BQ6B 1DXPA 1AN1E 5JPMH 1HXFH 1G3EA 1C1RA 3NCLA 5DK1A 5EPYA 3RXQA 1BBRK 1ZTKA 3P8NA 1C2GA 1QR3E 2GZ8A 2A4RA 3RXGA 1LMWB 1TNGA 1SLWB 2W5EA 3NPSA 3MNCA 4MNWA 1GL1A 1BQYA 1S6FA 1QFKH 4MPUA 2UWOA 1DE7H 4X6OA 1C2FA 2FTLE 1TMUH 3GY8A 2Y5HA 4DW2U 3W95A 3MH6A 4A92A 1W8BH 4X8SH 1V2OT 3RU4D 1FXYA 1GDQA 1Z1IA 4MQAA 3QN7A 4Y6DA 2NWNA 2A5IA 3G01A 1OPHB 5BRRE 3TGIE 1ZMNA 2ANKH 3M37A 3VB5A 2RA3A 1O2TA 1C5YB 3ESTA 1QJ7B 4MNYA 1GI9B 2O8TA 3MYWA 5T6GA 1KLIH 3T2NA 5CMXH 5DP6A 1C1TA 1JIRA 1CU1A 1UK4A 1SGNE 5HM2A 5A0AE 1C5LH 1TYNA 1GBHA 1YCPK 2BY6X 1MCVA 1HAVB 1FIWA 5EW1H 2F9PA 4ZXXH 5E0JA 1JBUH 2ZDKA 4GLYA 5A09A 1VGCB 3LU9B 4AFUA 4ASHA 1GL0E 4BTTB 1KYNA 2TRMA 1X7AC 2HRVA 2BVXH 4UFEH 1QL7A 5EPNA 1FLEE 2P93A 5EODA 7LPRA 1LQEA 2HNTE 3FP8E 1C5WB 2R3YA 3LH1A 4AG2A 2ZG0H 4AFQA 2BVSH 2Z9JA 4WXVA 4HZHA 1SMFE 3D62A 4NCYA 2TGPZ 2W3IA 3SNBA 1C1SA 5J4SA 2QXJA 1TGBA 5L6NH 1S0QA 1NZQH 2GGVB 3MNSA 3LGIA 4WH8A 5TCAA 4BTIB 4YLUA 1RD3B 4YM9A 3SV8A 4U30A 1MBQA 3BTWE 2BDYA 1FN8A 2XCNA 3UOPA 5FBEA 4OGYA 1TOMH 3TVJB 2SGDE 4B2CA 3GY2A 3T29A 4I33A 1XUHA 4ABBA 4GHQA 1OWKA 1SOTA 3ATIA 4D9QA 2XBXA 3A80A 5CE1A 1ACBE 1W10U 4E06H 1JXPA 5C2ZA 1ELTA 5JDUB 1Z7KA 3E8LA 2P8OC 1V3XA 2F9UA 3MHWU 4D76A 1A46H 1THRH 2BHGA 2QCYA 3A8CA 4THNH 3VPKA 1V2KT 4ABIA 1WV7H 1B0EA 5EXNA 4D7FA 1RIWC 1TIOA 1ZSJA 1YKTA 3HGPA 1ZRBA 5JB9S 1A3EH 1S5SA 1TRYA 1PPHE 1QY6A 1K1IA 1UVOA 4ISNA 1KXEA 3OY6U 3RXUA 2C8YB 1VJAU 1BRAA 3A85A 1AB9B 1N6YA 2GKVE 5FCKA 1P57B 1KDQA 2EC9H 1U6QA 2SGEE 5A8XA 1FQ3A 1QRWA 3A88A 3MU8A 3V12A 2AEIH 1L0ZA 4OS4A 3M36A 1HBTH 1K28D 2XC4A 1VCQA 3SBKA 5E8EH 4YOGA 1A5GH 3SUGA 2JH0D 1GI7B 2A4GA 1N8OC 1SGYE 3O8BA 1TBZH 4ABEA 4R0IA 3W94A 4X6NA 2GV7A 1ZHPA 2Y7ZA 4JZEH 3RXTA 2V35A 1HNEE 1KXAA 5J4QA 3UR9A 1LHCH 1KXFA 4O9VA 4I8GA 4ZMAH 1G30B 2FXRA 2B0FA 3CENA 3E16B 3EA8A 1O39A 2PLXA 1P2MA 1CA0C 2QN5T 3ZVCA 5LH8A 2Z9KA 3I78A 2BXTH 2ZGBH 2A5KA 4JYTA 1QURH 1ZPBA 1K2I1 1GCTB 3PM3A 4FUGA 4MPVA 1F0UA 3LJJA 2GD4B 2V6NA 5T6FA 2GX4A 4K60A 1MAXA 3PWBA 1QTFA 1O5AB 4Y11E 3LGYA 1OOKB 2IJOB 1H4WA 4E7NA 4XOJA 3SI4H 1ELDE 1EPTA 1SGPE 2FLBH 2D8WA 1C9PA 1HIAB 2A7JA 1O3EA 2GZ9A 1CSOE 3RXBA 2FOFA 4O3TA 3CS0A 1O35A 2H6MA 2H9HA 2AH4X 1O5EH 1D9IA 1TBQH 2FS9A 1HAGE 1TALA 1AZZA 3A7YA 4I31A 2OBQA 3RXAA 1GI8B 2ZCKP 1AD8H 1O3KA 1XUKA 1EJMA 4B76A 3U8TH 4X1PU 1FAXA 4Z6AH 5FX5A 3JZ2B 2ZFPH 5JB8S 1GPZA 1GVZA 4MPXA 4MTBA 1FUJA 3F9HA 4K1SA 1G32B 1Z6EA 1V2ST 1TBRH 1LHDH 2GVFA 2G81E 1O2NA 2FPZA 3FZDA 3ZZ3A 5EOKA 4MDSA 4X8UH 1KSNA 2GT8A 2GZ7A 1E34B 2GCHF 1EASA 2OC1A 3PB1E 4B71A 5LGOA 3H7OA 1YF4A 1T8LA 1QBVH 3SW2B 1C5SA 4QT8C 1Y3UA 5GDSH 3QUMP 1IQFA 3TGKE 1C5MD 4J2YB 2A0QB 1TGSZ 2BY8X 2GP9B 1TB6H 3GOVB 1AKSB 3PMAB 1E35B 1WBGB 1OWEA 2A32A 4OS1A 1QQUA 3DFLA 3D49H 3ATLA 2SGAA 1YPJH 4X2WA 2G52A 1EZSC 1SBWA 1D3PB 2ZECA 2ZPSA 1FY3A 4AX9H 4BXSA 3PLBA 2VB0A 5C20A 1O2IA 1GHAF 2NU1E 1GI6A 1G2LA 1W14U 1ANDA 5ESBA 4YOJA 1J17T 2ZGCA 5AF9H 2J94A 2F9BH 2PKSC 1O34A 2YNAA 3UPEA 1LPKB 2QC2A 3A7VA 4Q80A 3TNSA 3F9EA 1A61H 1QB9A 2A1DB 1FJSA 2VH6A 1ZOMA 1PPFE 2ZHFH 1SLUB 3SOSA 1QL9A 3GY3A 3QDZB 2FOEA 1OYQA 2ZHDA 3RXFA 1HAXB 2QYIA 1FI8A 3M5OA 3BEUA 2ZDVH 3GDVA 5FXLA 3K6ZA 4U2WA 1OSSA 5DP4A 3E91A 4X8TH 1W2KH 3TK6A 4GAWA 2XW9A 1MTSA 4Y7BA 3A8BA 1DSUA 3RXEA 5C3NA 1C5PA 1TRNA 2VGCC 3A8AA 1XVMA 1V2JT 2C8XB 2R2MB 3BTEE 5EU8A 4CBNA 3OY5U 2FOBA 3ATWA 3UIRA 3BEFB 3PMBB 4LOYH 4JCNA 1AVXA 1IQIA 1BHXF 4X1SU 1J8AA 1GI5A 2VVCA 1D6WA 3JZ1B 2Z94A 4IW4E 4Y79A 2WUCA 3DT0H 1GI2A 3N7OA 4X1QU 1M9UA 4AG1A 1O33A 2GCHG 1MQ5A 4UFGH 4CRCA 1DXWA 4UFFH 5E0HA 1MKXH 1LVOA 3GICB 1O3JA 4Q7YA 1Z8RA 1UTKA 2PUQH 2ALVA 1V2QT 3QK1A 2W3KA 4D9RA 1UTQA 1IQHA
chains in the Genus database with same CATH superfamily
1CGHA 1ORFA 2OUAA 1AB9C 5H4IB 3T26A 1WAYB 2BY9X 3RMLH 1ESTA 1UCYE 3GY6A 2F3CE 1FN6A 1SQTA 2GMTC 2GCTB 1O2PA 4UEHH 4DIIH 4OS6A 1CA8B 2ZO3H 3F9GA 1MD7A 3KGPA 3LC3A 4WMFA 1DITH 3Q3YA 2O8WA 3MO6A 1NFWA 1P11E 3DHKH 5GIBA 3RXOA 4E05H 2JH6D 1YP9A 2EA3A 3KHVA 1AE8H 2ZU1A 3VEQB 1NRRH 2R2WU 3D23A 1MABB 1OP8A 2ZHEH 3ZZ5A 1TNKA 1B7XB 1V6DA 3ELAH 4ISHH 1GJ4H 1OX1A 5DGJA 3FP6E 1SFIA 4KGAA 1LQDB 5JBTA 3NRLA 5ESTE 1UCYK 2ZA5A 2STAE 2I6SA 3L3TA 1SL3A 5AFZH 1DT2A 1TGCA 5JBAS 2OC0A 1TMTH 3UY9A 4XBBA 3SU1A 2CXVA 2ZP0H 5A0BA 1EXFA 4NSYA 2F9OA 6LPRA 2VWLA 1EAXA 2SNVA 1NESE 2ZGHA 3RXCA 3SI3H 1O5GH 3PO1B 1H8HD 2IPQX 1TQ7B 2JETB 4FUHA 4Y8ZA 3LGTA 4JMYA 1P2KA 4RI0A 4AYVB 3GY7A 3SU5A 4WMEA 5EQQA 3MMGA 1YC0A 1SSXA 1AFQB 3A87A 1AUJA 4RKOB 4O3UA 1MBMA 5C1UA 1KLTA 2BZ6H 1T8NA 3TIUA 4ABAA 1RGQA 2FP7B 1WQSA 1MMJN 4NIVA 3N7EA 3DA9B 3M5MA 3TJOA 3OU0A 1MH0A 2BB4A 2STBE 5JYIA 1XXFA 3LJOA 4GUXA 1UHBB 2KAIB 1AWFH 3S0NA 4GSOA 5B6OA 1C1OA 1MKXK 1Z8GA 1GWAA 1TONA 4DJZB 1KMHB 1IQKA 1HAVA 2BOHB 4H4FA 3QX5H 1HAOH 1QHRB 1XM1A 2ZTZA 4OS7A 3GYMA 4U01A 2W7UA 4KTCA 5A0CA 2C90B 3OYPA 4NZLA 2BQ7B 1FIZA 1FPHH 1W3CA 5FAHA 2FLRH 1C5NH 1P9SA 2H5CA 2QF4A 3ZV8A 3HATH 2WHXA 1T32A 1EATA 3F2HA 2ILNA 3KNXA 2XNDD 2ALPA 3UOUA 1Q3XA 3WWBA 3TGJE 1P04A 1C5OH 1ELCA 1GI1A 1E0FD 2WPJS 3ZVGA 1HFDA 1RTFB 3EA9A 3S9BA 1F2SE 1ZTLA 3U69H 4JZFH 5FHTA 2BD8A 2DE8A 1UVSH 4LK4A 2L74A 2DE9A 1ZJDA 3SV9A 3TU7H 1DSTA 1E1RD 4FUFA 4MNVA 5E2OA 1ZTJA 3FOAA 3PROA 4UE7H 3MWIU 3VXFH 1T8OA 1Y3WA 5K0HA 2ZZUH 1YM0A 1ZGIA 1IQJA 1B0FA 2XRCA 1C1MA 3SJIA 1J9CH 1C2LA 4ZHLU 3A83A 2TGAA 1CGJE 1KTTB 2FI4E 1O3BA 1G3DA 2K0QA 2BM2A 1G36A 3ZZ8A 4XDEA 2QAAA 3KCGH 4F4OC 1PYTD 1AHTH 2C8ZB 1FZZA 3RC4A 1BZXE 2GT7A 2NU3E 1MQ6A 2OTVA 1O5BB 1T4VH 4UDWH 1DDJA 4ZUHA 1L1GA 1HAIH 1EUFA 1S0RA 2VVVA 4JYUH 1TPAE 3S69A 1TFXA 4AFSA 2ZDMA 1TMBH 2KCYA 1YPLH 2HALA 4JK6A 5LPRA 1ARCA 3AW0A 2JH5D 5DP5A 2J4IA 4WJG2 1TGTA 1C5QA 1GG6C 1O2KA 2FM2A 3MU4A 4RSPA 1K22H 1CVWH 4ABDA 1MTNB 4DY7B 2OD3B 3EAJA 1EPTC 2VWNA 5HIZA 1YBWA 2Z9GA 1TNLA 4I32A 5DJ7A 1Q2WA 1JWTA 1NRSH 2KR7A 5ETXA 1HB0B 2WV9A 3O8CA 1ETSH 3CS7A 2J92A 3PV5A 5KGOA 2UUFB 1BDAA 3SU4A 3SZNA 4A6LA 1C4V2 1W12U 5TCCA 1BMMH 1OP2A 1O2HA 4H42U 2VBCA 5C5OA 1IOEA 1PPCE 1QB6A 3RLYH 2PR3A 1SQOA 1F0RA 4BAQB 1CO7E 4CR9A 4K3JA 3RMNH 2A31A 5EJ1A 3ODDA 3SU6A 3AAVA 4JK5A 1IHTH 3A82A 4CR5A 3T27A 4HGCA 4NZQA 1P2QA 3BTME 1WYKA 2WPLS 1HIAA 4B1TA 2H5DA 1PQAA 1DPOA 3PV4A 2VIQA 1RTLA 2LPRA 3RC6A 2VIDA 3C27B 4CRFA 1ZZZA 2H9TH 3SZEA 3FZZA 4JZDH 1H9IE 1TNIA 1EB1H 2IN2A 1ABJH 1ZR0A 3EYDA 3QZRA 1WSSH 4HI3A 5EXMA 1THPB 4NWKA 3T62A 2F4LA 2THFB 3DD2H 1KXCA 4X1RU 1FMGA 1UW7A 3E6PH 8KME2 1PPEE 1TQ0B 3VB4A 2R3UA 1MZDA 2VU8E 1HAYB 1V2VT 4FOUC 4B6EA 2AS9A 4FUDA 5DP3A 1EQ9A 2QE7D 2QGRA 2PTNA 1P0SH 1ANEA 1BTYA 1XUFA 2XXLA 1O2XA 2BD9A 4NA9H 1DVAH 1GJ5H 4B73A 3OTJE 2PP6A 2BLVA 2QXIA 1EJNA 4CRDA 3SV6A 1QQ4A 1O2ZA 2PTCE 1SB1H 1AFQC 3GYLB 1BTWA 1SOZA 3EGKH 2CHAB 5T1VA 1QJ1B 1KTSB 2WV5A 2PW8H 1AKSA 1P2OA 3PMHB 5FX6A 2ODPA 1BA8B 1H9LB 3OEHD 3BF6H 3UUZA 1TX6A 3BN9A 4XE4A 1O3FA 2UWPA 3PRBA 1LCYA 3RXJA 3VB6A 3DSPA 3URCA 3B23B 4ZCNA 1CT0E 1YWUA 3GY4A 1FV9A 1XUIA 3FKSD 1EP5A 1SPJA 1YPKH 4K5ZA 4DT7B 1TABE 1FNIA 3GCTF 3L33A 4GVUA 4OGXA 1RXPA 3AASA 3IWMA 2QXGA 1K1PA 2FDAA 1IQMA 1Q31A 4LXBH 3RXSA 3NXPA 5ABWA 3EE0B 3KQ5A 4BAKB 8LPRA 4I8JA 3TH2H 1C1NA 4INLA 1FY5A 2AMPA 5L2ZH 9LPRA 2F9VA 5GCHF 1WTHD 2K8IA 2TIOA 3GCHC 1CE5A 1HAPH 3WY8A 2AMQA 2Q1JA 4VGCB 3PV2A 1SC8U 2RDEA 1ZHMA 4CH2B 1C5XB 3SU0A 1TPOA 3I77A 1LPZB 2OCVB 1QL8A 1P3EA 3EDXB 3ITIA 1K1OA 4X8VH 2D26C 5CHAB 3H7TA 1BUIA 2H2ZA 5F53A 2Z7FE 1UTMA 2PWXA 3GDSA 1Z8JB 2C93B 3WW7A 3VGCC 1GGDB 3M35A 2ZGJA 3B8JA 2ZFTA 4MPWA 3U9AH 6ESTA 3ATKA 1GJAB 3TJVA 1GBLA 4CHAB 3RDZA 2P16A 4IC5A 2PSYA 2PV9B 1GJCB 1V2RT 1O2RA 5LPEA 1RRKA 1Y5AT 4TYDA 2UUJB 3GISB 2ZDLA 1P09A 5C1XA 3P95A 2CGAA 1GVLA 1SLVB 4FU7A 4E7RG 2ZI2H 4XFQA 2LP6A 3P6ZB 1P2JA 1L1NA 1JRSA 1LO6A 1EZUC 1O3LA 1SHHB 3RXHA 3RLWH 3ZYEA 1EJAA 1D6RA 1C5RA 2G4TA 1UTNA 2OQUA 3STIA 3EA7A 1JMOH 1EAUA 2BXUH 1UK3A 1GHYH 5DG6A 4NGAH 4CH8B 2BDBA 1NFXA 3F3BA 1MU8B 1ZRKA 1Y59T 2XTTB 4YT7H 3DCLA 1H8IH 4DG4A 1DM4B 5IDKA 3GCTG 5A2MH 2BY5X 2QA9E 3FN8A 3ZYDA 1LHFH 1OS8A 2HGTH 1SVPA 1JRTA 4TSFD 1F5KU 4YZUA 1UJ1A 2SGQE 5EW2H 2ZU4A 3STJA 1NFUA 3BTTE 3W1EA 2VWOA 2RA0A 2BDCA 2FOGA 2V3HH 3BG4B 4J1YA 1UVPA 1GJBB 3ZZ4A 3A8DA 4DCDA 1DLKB 1L4DA 1H9HE 4K1EA 2YOLA 1AGJA 2BX4A 1BRUP 1K1JA 5GCHG 2C8WB 4RT1A 4AZ2B 1K1NA 1IHSH 3SGBE 1C5ZB 1W7XH 5T6DA 1MCTA 8GCHF 3TPIZ 2HPPH 1VGCC 2XOKD 2BY7X 3SGQE 2SGPE 1LVMA 2GTBA 3AK5A 3OTPA 2WYJA 2ZU5A 4YO9A 2ZDAH 3KQCA 2RG3A 2P95A 4DURA 3M7UA 3HK6B 1GBDA 1O3OA 1PFXC 4OS5A 4FUCA 3QTVH 4R8TB 1O32A 1C2DA 1UCYH 3BIUH 3GDUA 1TRMA 5IYTA 3TITA 1EX3A 1Y3VA 1FAKH 1L2EA 1OWIA 2AFQB 2KAIA 3SQHE 2QXHA 2A4OA 2ODYB 2BDIA 1SGIB 2V0BA 4WY3A 1OWDA 4Y7AA 1O30A 4H6SB 1ZSLA 2FS8A 5A8ZA 2C4FH 2OXSA 4ABJA 1UMAH 2ZGXH 1DS2E 4XBCA 4X2YA 2AGIX 4DGJA 3KQDA 2P3UB 1EKBB 1GHBF 3S9CA 2ASUB 5CHBA 1FY1A 1DY9A 3UNQA 2O8UA 1ZYOA 4WH6A 2J34A 3OX7U 1G3CA 1WQVH 1AUTC 5EG4A 1NT1A 2VVUA 2HLCA 1ZGVA 1N1LA 3KIDU 2WINI 3BTHE 3M3TA 2XCFA 3OEED 5F8ZA 2VIWA 1NS3A 2HNTC 4YLQH 4ZH8A 3MNXA 3ZZDA 1EP6A 1D3TB 1P3CA 1F5LA 1F0TA 2ZFFH 1O0DH 3RXDA 2VWMA 5FPTA 1GMCF 5KECA 1AIXH 3FP7E 3PLPA 1EB2A 2Y82A 3SUFA 1IQEA 1GHAG 4AORA 1HV7A 1CQQA 3ZIAD 3T28A 3ZZAA 4CREA 1YPGH 1SGQE 4GCHF 8GCHG 4I8HA 3SHCH 3F0PA 1UTOA 2ZEBA 2PKAB 3V13A 1O3HA 4MLFB 5FBIA 4K8BA 2CN0H 1LKBA 2A7HA 4GPGA 1A1RA 2FMJA 2BTCE 3ZVFA 1V2LT 3VB7A 1EZQA 3B9FH 5DO4H 1WOFA 2ZDNA 2BLQA 2CJIA 4XD7D 1GJ7B 1UTLM 2YMSB 4VGCC 1VR1H 3ODFA 2J98A 4ZHAA 1GCTC 3S7KB 5HYOA 4YESB 3IG6B 4UFDH 2HVYB 3K9XB 3MFJA 4K69A 3M61U 1E79D 8ESTE 3MOCA 1K1MA 1NRNH 4AN7A 4JYVH 4I7YH 1PQ8A 3SU2A 1TGNA 6CHAB 1HGTH 4FXGH 1HJAB 1AWHB 2HNTF 2YMSD 2QIQA 1MUEB 3MU5A 1H8DH 3CP7A 2ZPQA 2ZIQH 2GDEH 3A86A 1N6XA 1XXDA 2C3SA 2Y6TA 1GHBG 1XUGA 1LTOA 2BOKA 4NWLA 1NM6A 2VNTA 1QBNA 2WPHS 1ANCA 1ESAA 1O2VA 2CV3A 5AFYH 3QLPH 2P8OB 3E90B 2NU0E 3HKIB 3ZVDA 1A0HB 3ATMA 1VITH 1LPGB 2SFAA 2WUBA 3ZZ6A 1BMLA 1QBOA 1O37A 2Y5FA 2A2QH 2HOBA 1RIWB 1SHYA 2B8OH 3R0FA 1DUAA 3SORA 1BOQA 1H1BA 1W0YH 1GJ6A 4IMZA 3RXLA 2TBSA 1GBAA 1C4Y2 1KXBA 3QZQA 2RDLA 3E0NB 3P17H 1LKAA 4CRBA 3L6PA 3UTUH 4ASUD 1Y8TA 4TPIZ 1GMCG 3NUMA 1O3AA 1TPPA 1ESBA 2OP9A 1A4WH 1S82A 2BX3A 3V0XA 1E36B 2A4QA 2EY4C 2J9NA 4ISIH 1GBMA 1CT4E 2GDDA 1Z6JH 1S81A 2XC5A 3TH4H 2ZFQH 1SGFA 4ZKNU 1EOJA 2Z6BD 3Q00A 4GCHG 4NIWA 2Y7XA 1ZMJA 4XBDA 2AYWA 2NU4E 1N8OB 5EQSA 1ZHRA 1QCPA 1NC6A 1ID5H 2B9LA 2QF0A 4A7IB 4PROA 2ULLA 4TWWA 2IPHA 1SGTA 4KELA 1A0JA 1O2QA 1GBCA 2FOAA 3AVZA 1MTVA 4WXIA 5EJLA 1VCWA 4MVNA 1ELAA 3FFGA 1CA0B 1THSH 3V7TA 4RN6A 4FVBA 1UO6A 4ZKSU 2WPIS 4D8NA 4CRAA 5DP7A 3U1JB 1G2MA 1BBRE 3DSOA 3SJKA 2BD2A 2P3FH 4ISLA 1S84A 2G00A 3UREA 1O2OA 1TX8A 3UQOA 2Y81A 2G5VA 3M7TA 3BSQA 1QZ8A 1YLDA 1RFNA 1C2KA 1ELBA 4X1NU 1A5HA 1PQ7A 2Q6FA 5EGMA 1EAIA 4IN2A 1OWHA 2O8MA 4B2AA 3FVFB 3LIWA 1QIXB 5GJ4B 1OKXA 4M7GA 1ARBA 1TE0A 5GWZA 4LZ4B 1DWCH 2FO9A 1CGIE 1GHVH 2G4UA 4O97A 4SGBE 2V3OH 4TY7A 3UAIC 1K0HA 4OM9A 4YT6H 1EAWA 5SGAE 3D65E 2IJD1 4P02A 2BDHA 1GMHF 3I29A 2BD4A 1GJ9B 1GMDF 3A7TA 2F43B 3UNSA 1C5UA 1O2SA 1SGEE 5G4BA 3R3GB 1C2MA 4BAMB 1AQ7A 1YPEH 4FUBA 3EQ0H 2G8TA 1G3BA 4NIXA 2PFEA 3BG8A 2FODA 3GS9A 4ISOA 4Q63A 1ZSKA 2TGDA 2Y5GA 2WPMS 4ZHMU 5HKKD 3TH3H 2WPDD 1YPMH 1C1UH 4DOQA 3QGNB 4K8YA 1O3NA 4Z0KA 1K1LA 4MG3A 3C1KA 1O3IA 3OE7D 1FPCH 2ZFRH 3SN8A 4BTUB 2M2AA 1BCUH 1T31A 3P8OA 3KF2A 4BAOB 1V2WT 2ZQ1A 1WUNH 4NFFA 1ZMLA 1F0SA 4KKDA 1QRXA 2FEQH 1MU6B 1S83A 4X6PA 1HPGA 1YPHE 2BD3A 1O5CB 4UONA 1HJ9A 4NG9H 1BHXB 1HUTH 2GCTC 1Z1JA 1UTJA 3SUDA 2H1UA 1T8MA 3F9FA 1BMAA 4AYYB 1NRQH 2XBYA 2ZQ2A 2ZWLH 1FY8E 2CF9H 1SFQB 2J2UA 1GI0A 2XWAA 2ZKSA 2RCEA 1COWD 2VH0A 3KN2A 1QJ6B 2OQ5A 2H9EH 2W26A 4IC6A 4Y71A 2VIOA 1LHEH 3PWCA 2Q6DA 4B2BA 2PKSB 4HG6A 2BDGA 2P3TB 1O38A 2ESTE 1KY9A 3RXVA 1BTUA 2ZHQH 3ZVAA 5C0UA 3KQBA 3DUXH 3LPRA 2HWLB 5LPFA 2BMGB 2YMSC 4AGJA 1RS0A 3SNEA 1P01A 2AIQA 2RFKC 1BT7A 3FANA 3LGVA 1O3MA 1PQ5A 5E0GA 4JZIA 1W11U 2J97A 1GJDB 1NPMA 2AGGX 2JKHA 2FI5E 2R9PA 4AGKA 1L4ZA 5F8TA 2BLWA 1G37A 2ANMH 5EIYA 3KL6A 1GMHG 2W6JD 1GMDG 1K21H 2OC7A 1E37B 2G5NA 2ZU3A 3PO1C 4Y8XA 6CHAC 5K7RA 1HJAC 2VGCB 1BITA 3S7HB 2JETC 1HAHH 4X2VA 1O2JA 4O03A 3U98H 1AZ8A 5GNDA 3HKJB 1WXRA 5F6MA 3M3VA 5HMAA 1J14A 3RXIA 4ZAEA 4YXWD 1FONA 1TNHA 3M3SA 3PLKA 4AB9A 3A7XA 2CK3D 1CT2E 1PPZA 1YY3A 2WZQA 4Y76A 3KQEA 1ELEE 2BD5A 2EI6A 3GY5A 2ANYA 1MTUA 3TJNA 2FYRA 7ESTE 3KYGA 3VG8A 1NU7B 3URDA 4DIHH 4TPYA 4CBOA 3F2GA 3SQEE 2BVRH 2F83A 2LNCA 1OP0A 2ZFSA 3P70B 1GVKB 1UVUH 1IQNA 1C2JA 2F9NA 3EE7A 4I8LA 2ZC9H 3Q3KA 4A1XA 2YNBA 2ZTXA 3MH7A 3QTOH 1C9TA 1V2MT 1BJVA 1KIGH 1PPBH 1MKWH 2BD7A 3KEEA 4FUJA 1OXGA 4ACBA 2BDAA 4I86A 1DY8A 1G9IE 3PYHA 2DUCA 2XBWA 4KTUA 3U8RH 2GMTB 1T4UH 1DWBH 2A45B 1V2UT 1GBJA 3K6YA 3RXMA 3K2UA 1CBWB 3MU1A 1GHZA 1XVOA 1BTZA 1L1JA 3P92A 1ANBA 3RXKA 3NKKA 5DP9A 1P8VC 3UB0A 5E2PA 2K1QA 3K65B 3MU0A 1HDTH 1XX9A 3SNAA 4IMQA 3LT3A 5EQRA 3RC5A 2ANWA 1O3GA 1UTPA 2HPQH 1ZLRA 3MNBA 5GPIB 1GJ8B 1O3DA 4BAHB 1PYTC 2R0KA 2ZNKH 3MH4A 1SQAA 4Y0YE 4BNRA 1LVBA 2W7SA 3E1XB 1P2NA 1IQGA 3N99A 4X0WU 3ZVBA 1B5GH 2R0LA 1P9UA 3TNTA 1Y3YA 1FY4A 1TNJA 1DOJA 2B5TB 2FIRH 4YTAA 1ZPCA 2FOCA 2J95A 3SUEA 2PGQB 1T7CA 1C2EA 3MO9A 2L6OA 2GV6A 1BTXA 3O8DA 3KYFA 4RT0A 1XKBC 4INHA 2KM0A 2BYAX 1HYLA 1WCZA 3ZZ9A 2XWBI 4H6TA 1KLJH 3P8FA 1GI3A 3Q76A 3A89A 1V2PT 4IS5A 5JBCS 3UWIA 5I25A 1S6LA 1O3CA 1BRBE 2PGBB 2OLGA 4MNXA 3LGUA 1GDNA 5L2YH 2PHBA 1LDTT 1OWJA 4AOQA 1H8ED 1QGFA 5KEDA 1BRCE 2GJGA 1P06A 1O31A 3MQKC 4NA7A 1GI4A 6GCHF 3Q3XA 1TX7A 1GBEA 2AIPA 3OAAD 1HXEH 3RM2H 3SU3A 3AAUA 1INCA 5HGGA 1P2IA 7GCHF 2FX4A 1MTNC 3QWCH 2XC0A 2FZZA 3CNRA 1MKWK 4Q7ZA 1O2GH 3RUOA 2PKAA 3SNDA 3U8OH 3ZV9A 3ZZBA 3NWUA 1NO9H 3RMMH 2Q6GA 1J16A 1BB0B 4WVPE 1ABIH 4DVAU 1ETTH 4WWYA 2QY0B 3BTFE 4KTSA 4BANB 2VJ1A 4U32A 4X2XA 4FETA 1AE5A 1GDUA 1W0ZU 1A2CH 1AU8A 2VIVA 1TWXB 4FVDA 4UD9H 4M9FA 4BOHA 5DPAA 1RJXB 2Z3CA 2O9QA 3RXPA 3ZVEA 3H5CB 4F49A 1DUEA 5PTPA 3FAOA 4SGAE 2FWWA 2O8LA 2ZF0H 1XUJA 3TJUA 3LOXA 3BTGE 2OK5A 5L30H 1BIOA 1TA6A 1SGCA 7KMEH 3UWJH 2FOHA 1CHOF 3VB3A 2WPKS 2OINA 3LDXH 1C1WH 3VFEA 1AO5A 1VKYA 4Q7XA 3F1SB 1KDQB 4IBLH 1JOUB 3GCOA 2UWLA 3BTKE 1SI5H 4HFPB 2V3MA 1MTWA 1DWEH 1HRTH 1C5VA 1GBTA 1NY22 3BTDE 4TY6A 4A1VA 1C1QA 1C2HA 1WU1A 1O2YA 2XYAA 4NA8A 2Z9LA 1UHBA 3RP2A 1Y3XA 1RTKA 4NSVA 1SG8B 1SGDE 1W7GH 4A1TA 4IN1A 3VXEH 3RMOH 3ZZ7A 2CMYA 3HK3B 2AGEX 1O3PB 1TPSA 1F92A 3BIVH 2KCPA 1F7ZA 3U1IB 3UFAA 1D3DB 1S85A 5F8XA 2TGTA 2EEKA 3HGNA 4AFZA 1A0LA 2ODQA 1ELVA 2ZCLP 2EI7A 3UR6A 1VITF 5JBBS 2F91A 1A5IA 4B74A 4Y0ZE 2AMDA 3LC5A 5FPSA 3E3TA 1DLEA 4CRGA 2D1JA 1YPHC 3T25A 1UVTH 2FI3E 9ESTA 1NBME 1EZXC 1P02A 3HPTB 3V3MA 3LGWA 4GHTA 4AB8A 4INKA 6GCHG 2CHAC 1GG6B 1ELGA 2A2XH 4Y8YA 1A7SA 7GCHG 1EPTB 2ZPRA 3RM0H 4ABFA 3A7WA 3BV9B 1HCGA 1QB1A 1P05A 2FX6A 1MAYA 4I8KA 5EXLA 4NIYA 4WF8A 1EFRD 5TJXA 3TLOA 1NU9A 5DSFA 3M7QA 1ZPZA 2PSXA 2WYGA 3NZIA 4K2YA 2I6QA 3RU4T 1OHHD 3LKWA 2UUKB 1GHXH 3PMJA 3T5FH 4A5TS 3UNRA 5AVDA 3LH3A 1YGCH 1P03A 3AW1A 3E0PB 1JIMA 2Z3EA 3ENSB 1HAZB 1BTHH 2IOTA 4ABGA 4FU8A 2QF3A 2KZ4A 2BQWB 1NROH 2SNWA 1P12E 5I46H 2KCAA 1CHOG 2OBOA 1HJ8A 3F68H 5FCRA 3OFND 1OYTH 1O2WA 3MO3A 5C67A 1AI8H 1P10A 1TLDA 2M5TA 2Y80A 1ZJKA 1W13U 1CBWC 5HM9A 1QA0A 2ZCHP 1DANH 1DFPA 3M5LA 1O36A 4BXWA 1F5RA 1C4U2 1O5DH 2NU2E 4NFEA 2FYQA 5DP8A 5A8YA 3BTQE 1SR5C 5CHAC 2PUXB 1A3BH 3TK5A 2P59A 3P8GA 1S6HA 5BPEA 4LZ1H 2TPIZ 4ZXYH 3SJ9A 2OC8A 2D2DA 4X6MA 1FDPA 1SGRE 1GGDC 3NK8A 1O5FH 2FTMA 4RKJB 3RXRA 4XSKU 3MI4A 1NBMD 1PJPA 4WMDA 4YOIA 5C5NA 5HXFA 1MZAA 2QV1A 1Y5UT 1LHGH 1VITG 2G51A 3SJOA 4CHAC 1XMNB 1TAWA 1DX5M 2ZU2A 1NN6A 1TA2A 1GBKA 1XKAC 1CHGA 1AY6H 2FOMB 1NFYA 1C2IA 4ABHA 2KX4A 1BJUA 1D3QB 1ELFA 1MD8A 1NTPA 1AVWA 1BBRH 3TK9A 1GCDA 1C5TA 2XBVA 1WTGH 3QO6A 2ZHWH 1IQLA 4ZKRU 5T3HA 2EI8A 1PPGE 4FU9A 4HTCH 5FPYA 2JIZD 1EOLA 5AHGH 2VIPA 1GHWH 4ZKOU 3UQVA 4JZ1A 3PTBA 3BEIB 1C1VH 4Y10E 5C17A 4K1TA 1YCPM 5GXPA 1V2TT 1VJ9U 3SV7A 2SGFE 3SGAE 2A7CA 3SO3A 1FX0B 1Y5BT 1BTPA 4XRNA 1LVYA 3SHAH 3F0OA 1SGFG 1O2LA 3H09A 1J15A 4FUIA 1QA7A 1AFEH 4ZROA 3GCNA 1TOCB 2B7DH 4TWYA 1DICA 1O2MA 1GBIA 2AERH 3BG4C 3RU4E 3LONA 3MH5A 3SNCA 2BZAA 2WV4A 5DKMA 1VZQH 1AVGH 3M5NA 3QGJA 1DWDH 3MTYA 1AMHA 5C1YA 3ZZCA 4IGDA 1VCPA 2A5AA 2Z9IA 3GCHB 3S9AA 2FESH 4KP0A 4B75A 3SJ8A 3O8RA 3Q77A 4OS2A 1YCPH 4ESTE 1O2UA 2P94A 3PTNA 2CF8H 1SLXB 2G55A 2UUYA 1YYY1 2Z3DA 1HLTH 1NRPH 1KXDA 4AC9A 4FUEA 1ETRH 1GBFA 1IAUA 1E38B 5F03A 3N7DA 2BLOA 2ZTYA 1K9OE 1GBBA 2VINA 3SV2H 3VGCB 1YLCA 1QNJA 1UK2A 3F6UH 1D4PB 3A81A 4Q2KA 1C1PA 1QRZA 3OSYA 3DFJA 2XNIA 3A7ZA 3A84A 2J38A 3IITA 4F55A 4D7GA 2HVXA 1Z71A 1BMNH 1Z8IB 1V2NT 2BQ6B 1DXPA 1AN1E 5JPMH 1HXFH 1G3EA 1C1RA 4B6FA 4DT4A 3NCLA 5DK1A 5EPYA 3RXQA 1BBRK 1ZTKA 3P8NA 1C2GA 1QR3E 2GZ8A 5CDFE 2KCOA 2A4RA 3RXGA 1LMWB 1TNGA 1SLWB 2W5EA 3NPSA 3MNCA 4MNWA 1GL1A 1BQYA 1S6FA 4F48B 1QFKH 4MPUA 2UWOA 1DE7H 4X6OA 1C2FA 2J98B 2FTLE 1TMUH 3GY8A 2Y5HA 4DW2U 3W95A 3MH6A 4A92A 2W6ID 1W8BH 4X8SH 1V2OT 3RU4D 1FXYA 1GDQA 1Z1IA 4MQAA 3QN7A 4Y6DA 5DN6D 2NWNA 2A5IA 3G01A 1OPHB 5BRRE 3TGIE 1ZMNA 2ANKH 3M37A 3VB5A 2RA3A 1O2TA 1C5YB 3ESTA 1QJ7B 4MNYA 1GI9B 2O8TA 3MYWA 5T6GA 4Z1MD 1KLIH 3T2NA 5CMXH 5DP6A 1C1TA 1JIRA 1CU1A 1UK4A 1SGNE 5HM2A 5A0AE 1C5LH 1TYNA 1GBHA 1YCPK 1W0KD 2BY6X 3U28C 1MCVA 1SQRA 1HAVB 1FIWA 5EW1H 2F9PA 4ZXXH 5E0JA 1JBUH 2ZDKA 4GLYA 5A09A 1VGCB 3LU9B 4AFUA 4ASHA 1GL0E 4BTTB 1KYNA 2TRMA 1X7AC 2HRVA 2BVXH 4UFEH 1QL7A 5EPNA 1FLEE 2P93A 5EODA 7LPRA 1LQEA 2HNTE 3FP8E 1C5WB 2R3YA 3LH1A 4AG2A 1YLNA 2ZG0H 4AFQA 2BVSH 2Z9JA 4WXVA 4HZHA 1SMFE 3D62A 4NCYA 2TGPZ 2W3IA 1BMFD 1C1SA 3SNBA 5J4SA 2QXJA 1TGBA 5L6NH 1S0QA 1NZQH 2GGVB 3MNSA 3LGIA 3DSGA 4WH8A 5TCAA 4BTIB 4YLUA 1RD3B 4YM9A 3SV8A 4U30A 1MBQA 3BTWE 2BDYA 1FN8A 2XCNA 3UOPA 5FBEA 4OGYA 1TOMH 3TVJB 2SGDE 4B2CA 3GY2A 2JJ2D 4I33A 1XUHA 3T29A 4ABBA 2HLDD 4GHQA 1OWKA 1SOTA 3ATIA 4D9QA 2XBXA 3A80A 5CE1A 1ACBE 1W10U 4E06H 1JXPA 5C2ZA 1ELTA 5JDUB 1Z7KA 3E8LA 2P8OC 1V3XA 2F9UA 3MHWU 3SYJA 4D76A 1A46H 1THRH 2BHGA 2QCYA 3A8CA 4THNH 3VPKA 1V2KT 4ABIA 1WV7H 1B0EA 5EXNA 4D7FA 1RIWC 5C94A 1TIOA 1ZSJA 1YKTA 3FO8D 3HGPA 1ZRBA 5JB9S 1A3EH 1S5SA 1W0JD 1TRYA 1PPHE 1QY6A 1K1IA 1UVOA 4ISNA 1KXEA 3OY6U 3RXUA 2C8YB 1VJAU 1BRAA 3A85A 1AB9B 1N6YA 2GKVE 5FCKA 1P57B 1KDQA 2EC9H 1U6QA 2SGEE 5A8XA 1FQ3A 1QRWA 3A88A 3MU8A 3V12A 2AEIH 1L0ZA 4OS4A 2JJ1D 3M36A 1HBTH 1K28D 2XC4A 1VCQA 3SBKA 5E8EH 4YOGA 1A5GH 3SUGA 2JH0D 2J5UA 1GI7B 2A4GA 1N8OC 1SGYE 3O8BA 1TBZH 4ABEA 4R0IA 3W94A 4X6NA 2GV7A 1SKYE 1ZHPA 2Y7ZA 4JZEH 3RXTA 2V35A 1HNEE 4P00A 1KXAA 5J4QA 3UR9A 1LHCH 1KXFA 4O9VA 4I8GA 4ZMAH 1G30B 2FXRA 2B0FA 3CENA 3E16B 3EA8A 1O39A 2PLXA 5B6LA 1P2MA 1CA0C 2QN5T 3ZVCA 5LH8A 2Z9KA 3I78A 2BXTH 2WSSD 2ZGBH 2A5KA 4JYTA 1QURH 1ZPBA 1K2I1 1GCTB 3PM3A 4FUGA 4MPVA 1F0UA 3LJJA 2GD4B 2V6NA 5T6FA 2GX4A 4K60A 1MAXA 3PWBA 1QTFA 1O5AB 4Y11E 3LGYA 1OOKB 2IJOB 1H4WA 4E7NA 4XOJA 3SI4H 1ELDE 1EPTA 1SGPE 2FLBH 2D8WA 1C9PA 1HIAB 2A7JA 1O3EA 2GZ9A 1CSOE 3RXBA 2FOFA 4O3TA 3CS0A 1O35A 2H6MA 2H9HA 2AH4X 3WWFA 2V7QD 1O5EH 1D9IA 1TBQH 2FS9A 1HAGE 1TALA 1AZZA 3A7YA 4I31A 2OBQA 3RXAA 1GI8B 2ZCKP 1AD8H 1O3KA 1XUKA 4TT3D 1EJMA 4B76A 3U8TH 4X1PU 1FAXA 4Z6AH 5FX5A 3JZ2B 2ZFPH 3F2FA 5JB8S 1GPZA 1GVZA 4MPXA 4MTBA 1FUJA 3F9HA 4K1SA 1G32B 1Z6EA 1V2ST 1TBRH 1LHDH 2GVFA 2G81E 1O2NA 2FPZA 3FZDA 1E1QD 3ZZ3A 5EOKA 4MDSA 2QF5A 4X8UH 1KSNA 2GT8A 2GZ7A 1E34B 2GCHF 1EASA 2OC1A 3PB1E 4B71A 5C0TA 5LGOA 3H7OA 1YF4A 1T8LA 1QBVH 3SW2B 1C5SA 1WDIA 1Y3UA 4QT8C 5GDSH 3QUMP 1IQFA 3TGKE 1C5MD 4J2YB 2A0QB 1TGSZ 2BY8X 2GP9B 1TB6H 3GOVB 1AKSB 3PMAB 1E35B 1WBGB 1OWEA 2A32A 4OS1A 1QQUA 3DFLA 3D49H 3ATLA 2SGAA 1YPJH 4X2WA 2G52A 1EZSC 1SBWA 1D3PB 2ZECA 5FL7D 2ZPSA 1FY3A 4AX9H 4BXSA 3PLBA 2VB0A 5C20A 1O2IA 1GHAF 2NU1E 1GI6A 1G2LA 1W14U 1ANDA 5ESBA 4YOJA 1J17T 2ZGCA 5AF9H 2J94A 2KFWA 2F9BH 2PKSC 1O34A 2YNAA 5HIYA 3UPEA 1LPKB 2AHME 2QC2A 3A7VA 4Q80A 3TNSA 3F9EA 4ACAA 1A61H 1QB9A 2A1DB 1FJSA 2VH6A 1ZOMA 1PPFE 3PRDA 2ZHFH 1SLUB 3SOSA 1QL9A 3GY3A 3QDZB 2LELA 2EQNA 2FOEA 1OYQA 2ZHDA 3RXFA 1HAXB 2QYIA 4Q4LA 1FI8A 3M5OA 3BEUA 2ZDVH 3GDVA 5FXLA 3K6ZA 4U2WA 1OSSA 5DP4A 5EJZA 3E91A 4X8TH 1W2KH 3TK6A 4GAWA 2XW9A 1MTSA 4Y7BA 3A8BA 1DSUA 3RXEA 5C3NA 1C5PA 1TRNA 2VGCC 3A8AA 1XVMA 1V2JT 2C8XB 2R2MB 3BTEE 5EU8A 4CBNA 3OY5U 2FOBA 3ATWA 3UIRA 5IK2D 3BEFB 3PMBB 4LOYH 4JCNA 1AVXA 1IQIA 1BHXF 4X1SU 1J8AA 1GI5A 2VVCA 1D6WA 3JZ1B 2Z94A 4IW4E 4Y79A 2WUCA 3DT0H 2JDID 1GI2A 3N7OA 4X1QU 1M9UA 4AG1A 1O33A 2GCHG 1MQ5A 4UFGH 4CRCA 1DXWA 4UFFH 5E0HA 1MKXH 1LVOA 3GICB 1O3JA 4Q7YA 1Z8RA 1UTKA 2PUQH 2ALVA 1V2QT 3QK1A 2W3KA 4D9RA 1UTQA 1IQHA
chains in the Genus database with same CATH topology
1CGHA 1ORFA 2OUAA 1AB9C 5H4IB 3T26A 1WAYB 2BY9X 3RMLH 1ESTA 1UCYE 3GY6A 2F3CE 1FN6A 1SQTA 2GMTC 2GCTB 1O2PA 4UEHH 4DIIH 4OS6A 1CA8B 2ZO3H 3F9GA 1MD7A 3KGPA 3LC3A 4WMFA 1DITH 3Q3YA 2O8WA 3MO6A 1NFWA 1P11E 3DHKH 5GIBA 3RXOA 4E05H 2JH6D 1YP9A 2EA3A 3KHVA 1AE8H 2ZU1A 3VEQB 1NRRH 2R2WU 3D23A 1OP8A 2ZHEH 3ZZ5A 1TNKA 1B7XB 1V6DA 3ELAH 4ISHH 1GJ4H 1OX1A 5DGJA 3FP6E 1SFIA 4KGAA 1LQDB 5JBTA 5ESTE 1UCYK 2ZA5A 2STAE 2I6SA 3L3TA 1SL3A 5AFZH 1DT2A 1TGCA 5JBAS 2OC0A 1TMTH 3UY9A 4XBBA 3SU1A 2CXVA 2ZP0H 5A0BA 1EXFA 4NSYA 2F9OA 6LPRA 2VWLA 1EAXA 2SNVA 1NESE 2ZGHA 3RXCA 3SI3H 1O5GH 3PO1B 1TQ7B 2JETB 4FUHA 4Y8ZA 3LGTA 4JMYA 1P2KA 4AYVB 3GY7A 3SU5A 4WMEA 5EQQA 3MMGA 1YC0A 1SSXA 1AFQB 3A87A 1AUJA 4RKOB 4O3UA 1MBMA 5C1UA 1KLTA 2BZ6H 1T8NA 3TIUA 4ABAA 1RGQA 2FP7B 1WQSA 1MMJN 4NIVA 3DA9B 3M5MA 3TJOA 3OU0A 1MH0A 2BB4A 2STBE 5JYIA 1XXFA 3LJOA 4GUXA 1UHBB 2KAIB 1AWFH 3S0NA 4GSOA 5B6OA 1C1OA 1MKXK 1Z8GA 1GWAA 1TONA 4DJZB 1IQKA 1HAVA 2BOHB 4H4FA 3QX5H 1HAOH 1QHRB 1XM1A 2ZTZA 4OS7A 3GYMA 4U01A 2W7UA 4KTCA 5A0CA 2C90B 3OYPA 4NZLA 2BQ7B 1FIZA 1FPHH 1W3CA 5FAHA 2FLRH 1C5NH 1P9SA 2H5CA 3ZV8A 3HATH 1T32A 1EATA 2ILNA 3KNXA 2ALPA 3UOUA 1Q3XA 3TGJE 1P04A 1C5OH 1ELCA 1GI1A 1E0FD 2WPJS 3ZVGA 1HFDA 1RTFB 3EA9A 3S9BA 1F2SE 1ZTLA 3U69H 4JZFH 5FHTA 2BD8A 2DE8A 1UVSH 4LK4A 2DE9A 1ZJDA 3SV9A 3TU7H 1DSTA 4FUFA 4MNVA 5E2OA 1ZTJA 3PROA 4UE7H 3MWIU 3VXFH 1T8OA 1Y3WA 5K0HA 2ZZUH 1YM0A 1ZGIA 1IQJA 1B0FA 2XRCA 1C1MA 3SJIA 1J9CH 1C2LA 4ZHLU 3A83A 2TGAA 1CGJE 1KTTB 2FI4E 1O3BA 1G3DA 2BM2A 1G36A 3ZZ8A 4XDEA 2QAAA 3KCGH 4F4OC 1PYTD 1AHTH 2C8ZB 1FZZA 3RC4A 1BZXE 2GT7A 2NU3E 1MQ6A 2OTVA 1O5BB 1T4VH 4UDWH 1DDJA 4ZUHA 1L1GA 1HAIH 1EUFA 1S0RA 2VVVA 4JYUH 1TPAE 3S69A 1TFXA 4AFSA 2ZDMA 1TMBH 1YPLH 2HALA 4JK6A 5LPRA 1ARCA 3AW0A 2JH5D 5DP5A 2J4IA 4WJG2 1TGTA 1C5QA 1GG6C 1O2KA 2FM2A 3MU4A 4RSPA 1K22H 1CVWH 4ABDA 1MTNB 4DY7B 2OD3B 3EAJA 1EPTC 2VWNA 1YBWA 2Z9GA 1TNLA 4I32A 5DJ7A 1Q2WA 1JWTA 1NRSH 5ETXA 1HB0B 3O8CA 1ETSH 3CS7A 2J92A 2UUFB 1BDAA 3SU4A 3SZNA 4A6LA 1C4V2 1W12U 5TCCA 1BMMH 1OP2A 1O2HA 4H42U 5C5OA 1IOEA 1PPCE 1QB6A 3RLYH 2PR3A 1SQOA 1F0RA 4BAQB 1CO7E 4CR9A 4K3JA 3RMNH 2A31A 3ODDA 3SU6A 3AAVA 4JK5A 1IHTH 3A82A 4CR5A 3T27A 4HGCA 4NZQA 1P2QA 3BTME 1WYKA 2WPLS 1HIAA 4B1TA 2H5DA 1PQAA 1DPOA 3PV4A 2VIQA 1RTLA 2LPRA 3RC6A 2VIDA 3C27B 4CRFA 1ZZZA 2H9TH 3FZZA 4JZDH 1H9IE 1TNIA 1EB1H 2IN2A 1ABJH 1ZR0A 3EYDA 3QZRA 1WSSH 4HI3A 5EXMA 1THPB 4NWKA 3T62A 2THFB 3DD2H 1KXCA 4X1RU 1FMGA 3E6PH 8KME2 1PPEE 1TQ0B 3VB4A 2R3UA 1MZDA 2VU8E 1HAYB 1V2VT 2AS9A 4FUDA 5DP3A 1EQ9A 2QGRA 2PTNA 1P0SH 1ANEA 1BTYA 1XUFA 2XXLA 1O2XA 2BD9A 4NA9H 1DVAH 1GJ5H 4B73A 3OTJE 2BLVA 2QXIA 1EJNA 4CRDA 3SV6A 1QQ4A 1O2ZA 2PTCE 1SB1H 1AFQC 3GYLB 1BTWA 1SOZA 3EGKH 2CHAB 1QJ1B 1KTSB 2WV5A 2PW8H 1AKSA 1P2OA 3PMHB 5FX6A 2ODPA 1BA8B 1H9LB 3BF6H 3UUZA 1TX6A 3BN9A 4XE4A 1O3FA 2UWPA 1LCYA 3RXJA 3VB6A 3URCA 3B23B 1CT0E 3GY4A 1FV9A 1XUIA 1EP5A 1SPJA 1YPKH 4K5ZA 4DT7B 1TABE 1FNIA 3GCTF 3L33A 4GVUA 4OGXA 1RXPA 3AASA 3IWMA 2QXGA 1K1PA 2FDAA 1IQMA 1Q31A 4LXBH 3RXSA 3NXPA 5ABWA 3EE0B 4BAKB 8LPRA 4I8JA 3TH2H 1C1NA 4INLA 1FY5A 2AMPA 5L2ZH 9LPRA 2F9VA 5GCHF 1WTHD 2TIOA 3GCHC 1CE5A 1HAPH 3WY8A 2AMQA 2Q1JA 4VGCB 1SC8U 1ZHMA 4CH2B 1C5XB 3SU0A 1TPOA 3I77A 1LPZB 2OCVB 1QL8A 1P3EA 3EDXB 3ITIA 1K1OA 4X8VH 2D26C 5CHAB 3H7TA 1BUIA 2H2ZA 2Z7FE 1UTMA 2PWXA 3GDSA 1Z8JB 2C93B 3VGCC 1GGDB 3M35A 2ZGJA 3B8JA 2ZFTA 4MPWA 3U9AH 6ESTA 3ATKA 1GJAB 3TJVA 1GBLA 4CHAB 3RDZA 2P16A 4IC5A 2PSYA 2PV9B 1GJCB 1V2RT 1O2RA 5LPEA 1RRKA 1Y5AT 4TYDA 2UUJB 3GISB 2ZDLA 1P09A 5C1XA 3P95A 2CGAA 1GVLA 1SLVB 4FU7A 4E7RG 2ZI2H 4XFQA 3P6ZB 1P2JA 1L1NA 1JRSA 1LO6A 1EZUC 1O3LA 1SHHB 3RXHA 3RLWH 3ZYEA 1EJAA 1D6RA 1C5RA 2G4TA 1UTNA 2OQUA 3STIA 3EA7A 1JMOH 1EAUA 2BXUH 1UK3A 1GHYH 5DG6A 4NGAH 4CH8B 2BDBA 1NFXA 1MU8B 1ZRKA 1Y59T 2XTTB 4YT7H 1H8IH 4DG4A 1DM4B 5IDKA 3GCTG 5A2MH 2BY5X 2QA9E 3ZYDA 1LHFH 1OS8A 2HGTH 1SVPA 1JRTA 1F5KU 4YZUA 1UJ1A 2SGQE 5EW2H 2ZU4A 3STJA 1NFUA 3BTTE 2VWOA 2RA0A 2BDCA 2FOGA 2V3HH 3BG4B 4J1YA 1UVPA 1GJBB 3ZZ4A 3A8DA 4DCDA 1DLKB 1L4DA 1H9HE 4K1EA 2YOLA 1AGJA 2BX4A 1BRUP 1K1JA 5GCHG 2C8WB 4AZ2B 1K1NA 1IHSH 3SGBE 1C5ZB 1W7XH 5T6DA 1MCTA 8GCHF 3TPIZ 2HPPH 1VGCC 2BY7X 3SGQE 2SGPE 1LVMA 2GTBA 2WYJA 2ZU5A 4YO9A 2ZDAH 3KQCA 2RG3A 2P95A 4DURA 3M7UA 3HK6B 1GBDA 1O3OA 1PFXC 4OS5A 4FUCA 3QTVH 4R8TB 1O32A 1C2DA 1UCYH 3BIUH 3GDUA 1TRMA 5IYTA 3TITA 1EX3A 1Y3VA 1FAKH 1L2EA 1OWIA 2AFQB 2KAIA 3SQHE 2QXHA 2A4OA 2ODYB 2BDIA 1SGIB 2V0BA 4WY3A 1OWDA 4Y7AA 1O30A 4H6SB 1ZSLA 2FS8A 5A8ZA 2C4FH 2OXSA 4ABJA 1UMAH 2ZGXH 1DS2E 4XBCA 4X2YA 2AGIX 4DGJA 3KQDA 2P3UB 1EKBB 1GHBF 3S9CA 2ASUB 1FY1A 1DY9A 3UNQA 2O8UA 1ZYOA 4WH6A 2J34A 3OX7U 1G3CA 1WQVH 1AUTC 5EG4A 1NT1A 2VVUA 2HLCA 1ZGVA 1N1LA 3KIDU 2WINI 3BTHE 3M3TA 2XCFA 5F8ZA 2VIWA 1NS3A 2HNTC 4YLQH 4ZH8A 3MNXA 3ZZDA 1EP6A 1D3TB 1P3CA 1F5LA 1F0TA 2ZFFH 1O0DH 3RXDA 2VWMA 5FPTA 1GMCF 1AIXH 3FP7E 3PLPA 1EB2A 2Y82A 3SUFA 1IQEA 1GHAG 4AORA 1HV7A 1CQQA 3T28A 3ZZAA 4CREA 1YPGH 1SGQE 4GCHF 8GCHG 4I8HA 3SHCH 1UTOA 2ZEBA 2PKAB 3V13A 1O3HA 4MLFB 5FBIA 4K8BA 2CN0H 1LKBA 2A7HA 4GPGA 1A1RA 2FMJA 2BTCE 3ZVFA 1V2LT 3VB7A 1EZQA 3B9FH 5DO4H 1WOFA 2ZDNA 2BLQA 2CJIA 1GJ7B 1UTLM 4VGCC 1VR1H 3ODFA 4ZHAA 1GCTC 3S7KB 5HYOA 4YESB 3IG6B 4UFDH 3K9XB 3MFJA 4K69A 3M61U 8ESTE 3MOCA 1K1MA 1NRNH 4AN7A 4JYVH 4I7YH 1PQ8A 3SU2A 1TGNA 6CHAB 1HGTH 4FXGH 1HJAB 1AWHB 2HNTF 2QIQA 1MUEB 3MU5A 1H8DH 3CP7A 2ZPQA 2ZIQH 2GDEH 3A86A 1N6XA 1XXDA 2C3SA 2Y6TA 1GHBG 1XUGA 1LTOA 2BOKA 4NWLA 1NM6A 2VNTA 1QBNA 2WPHS 1ANCA 1ESAA 1O2VA 2CV3A 5AFYH 3QLPH 2P8OB 3E90B 2NU0E 3HKIB 3ZVDA 1A0HB 3ATMA 1VITH 1LPGB 2SFAA 2WUBA 3ZZ6A 1BMLA 1QBOA 1O37A 2Y5FA 2A2QH 2HOBA 1RIWB 1SHYA 2B8OH 3R0FA 1DUAA 3SORA 1BOQA 1H1BA 1W0YH 1GJ6A 4IMZA 3RXLA 2TBSA 1GBAA 1C4Y2 1KXBA 3QZQA 2RDLA 3E0NB 3P17H 1LKAA 4CRBA 3L6PA 3UTUH 1Y8TA 4TPIZ 1GMCG 3NUMA 1O3AA 1TPPA 1ESBA 2OP9A 1A4WH 1S82A 2BX3A 3V0XA 1E36B 2A4QA 2J9NA 4ISIH 1GBMA 1CT4E 2GDDA 1Z6JH 1S81A 2XC5A 3TH4H 2ZFQH 1SGFA 4ZKNU 1EOJA 2Z6BD 3Q00A 4GCHG 4NIWA 2Y7XA 1ZMJA 4XBDA 2AYWA 2NU4E 1N8OB 5EQSA 1ZHRA 1QCPA 1NC6A 1ID5H 2B9LA 2QF0A 4A7IB 4PROA 2ULLA 4TWWA 2IPHA 1SGTA 4KELA 1A0JA 1O2QA 1GBCA 2FOAA 3AVZA 1MTVA 4WXIA 1VCWA 4MVNA 1ELAA 3FFGA 1CA0B 1THSH 3V7TA 4RN6A 4FVBA 1UO6A 4ZKSU 2WPIS 4D8NA 4CRAA 5DP7A 3U1JB 1G2MA 1BBRE 3SJKA 2BD2A 2P3FH 4ISLA 1S84A 2G00A 3UREA 1O2OA 1TX8A 3UQOA 2Y81A 2G5VA 3M7TA 3BSQA 1YLDA 1RFNA 1C2KA 1ELBA 4X1NU 1A5HA 1PQ7A 2Q6FA 5EGMA 1EAIA 4IN2A 1OWHA 2O8MA 4B2AA 3FVFB 3LIWA 1QIXB 5GJ4B 1OKXA 4M7GA 1ARBA 1TE0A 5GWZA 4LZ4B 1DWCH 2FO9A 1CGIE 1GHVH 2G4UA 4O97A 4SGBE 2V3OH 4TY7A 4YT6H 1EAWA 5SGAE 3D65E 2BDHA 1GMHF 3I29A 2BD4A 1GJ9B 1GMDF 3A7TA 3UNSA 1C5UA 1O2SA 1SGEE 5G4BA 3R3GB 1C2MA 4BAMB 1AQ7A 1YPEH 4FUBA 3EQ0H 2G8TA 1G3BA 4NIXA 2PFEA 3BG8A 2FODA 4ISOA 1ZSKA 2TGDA 2Y5GA 2WPMS 4ZHMU 3TH3H 1YPMH 1C1UH 4DOQA 3QGNB 4K8YA 1O3NA 4Z0KA 1K1LA 4MG3A 3C1KA 1O3IA 1FPCH 2ZFRH 3SN8A 4BTUB 1BCUH 1T31A 3P8OA 3KF2A 4BAOB 1V2WT 2ZQ1A 1WUNH 4NFFA 1ZMLA 1F0SA 4KKDA 1QRXA 2FEQH 1MU6B 1S83A 4X6PA 1HPGA 1YPHE 2BD3A 1O5CB 4UONA 1HJ9A 4NG9H 1BHXB 1HUTH 2GCTC 1Z1JA 1UTJA 3SUDA 2H1UA 1T8MA 3F9FA 1BMAA 4AYYB 1NRQH 2XBYA 2ZQ2A 2ZWLH 1FY8E 2CF9H 1SFQB 2J2UA 1GI0A 2XWAA 2ZKSA 2RCEA 2VH0A 3KN2A 1QJ6B 2OQ5A 2H9EH 2W26A 4IC6A 4Y71A 2VIOA 1LHEH 3PWCA 2Q6DA 4B2BA 2PKSB 2BDGA 2P3TB 1O38A 2ESTE 1KY9A 3RXVA 1BTUA 2ZHQH 3ZVAA 3KQBA 3DUXH 3LPRA 2HWLB 5LPFA 2BMGB 4AGJA 1RS0A 3SNEA 1P01A 2AIQA 1BT7A 3FANA 3LGVA 1O3MA 1PQ5A 5E0GA 4JZIA 1W11U 1GJDB 1NPMA 2AGGX 2JKHA 2FI5E 2R9PA 4AGKA 1L4ZA 5F8TA 2BLWA 1G37A 2ANMH 3KL6A 1GMHG 1GMDG 1K21H 2OC7A 1E37B 2G5NA 2ZU3A 3PO1C 4Y8XA 6CHAC 5K7RA 1HJAC 2VGCB 1BITA 3S7HB 2JETC 1HAHH 4X2VA 1O2JA 4O03A 3U98H 1AZ8A 3HKJB 5F6MA 3M3VA 5HMAA 1J14A 3RXIA 4ZAEA 1FONA 1TNHA 3M3SA 3PLKA 4AB9A 3A7XA 1CT2E 1PPZA 4Y76A 3KQEA 1ELEE 2BD5A 2EI6A 3GY5A 2ANYA 1MTUA 3TJNA 2FYRA 7ESTE 1NU7B 3URDA 4DIHH 4TPYA 4CBOA 3SQEE 2BVRH 2F83A 2LNCA