2EEKA

Crystal structure of atlantic cod trypsin complexed with benzamidine
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
220
structure length
220
Chain Sequence
IVGGYECTKHSQAHQVSLNSGYHFCGGSLVSKDWVVSAAHCYKSVLRVRLGEHHIRVNEGTEQYISSSSVIRHPNYSSYNINNDIMLIKLTKPATLNQYVHAVALPTECAADATMCTVSGWGNTMSSVADGDKLQCLSLPILSHADCANSYPGMITQSMFCAGYLEGGKDSCQGDSGGPVVCNGVLQGVVSWGYGCAERDHPGVYAKVCVLSGWVRDTMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Trypsin-1
publication title Crystal structure of Atlantic cod trypsin complexed with benzamidine
rcsb
total genus 48
structure length 220
sequence length 220
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2007-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2eekA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2eekA02
4AFSA 3LT3A 2QXHA 1IQNA 3ATIA 2GT7A 1C5MD 1IQHA 5F03A 2JH0D 3GYMA 4YESB 3DFLA 1Q31A 4KGAA 4BXWA 4WMFA 3LJOA 3SQHE 3Q3KA 1MTWA 2AGEX 1OOKB 1MZAA 3V7TA 1G30B 1EB2A 3MH4A 1P9UA 3RXRA 5DKMA 1F0TA 5TCAA 1O2LA 1DWBH 1UTOA 5PTPA 1QA0A 4Q7ZA 1XXDA 1TNJA 4RSPA 4ZXYH 4LOYH 1O37A 3RP2A 1GG6B 1LKBA 4BAMB 4J2YB 5L2ZH 5EXLA 2H9HA 2LNCA 1BTYA 3UIRA 1O2ZA 2B0FA 2VINA 3B23B 1K1LA 1TMBH 3A83A 3BTWE 3M36A 3TLOA 4CBNA 4X1QU 2G4TA 4FUHA 2A5AA 5T6GA 2XCFA 4AN7A 2TBSA 3OY5U 4UFGH 3LJJA 1SGFG 1BJVA 1HRTH 1LHDH 2QY0B 1UTJA 3SI4H 4BXSA 5A0AE 1B5GH 2CGAA 3KQBA 4IMQA 1QBOA 5C20A 4HTCH 3RMLH 1EZXC 2VVVA 3SU6A 1QHRB 4ABFA 4JZEH 1AGJA 1FIZA 1SGQE 1GDQA 4K1SA 2ZFPH 2FI4E 3K6YA 1C2KA 2GD4B 4GUXA 1BITA 1O3KA 2ZIQH 1P3CA 1P9SA 3GY8A 1LKAA 5A2MH 1ELGA 3FFGA 4YOGA 4FUBA 4JYTA 1O3HA 2FO9A 1L1NA 1P3EA 2CF8H 2OC1A 1KY9A 1IQGA 1CHOF 1IQEA 1T4UH 4I8HA 1PQ8A 4XE4A 2GTBA 3RXDA 3TGJE 2CHAC 3SUDA 2CMYA 4B2CA 4WVPE 3BG4B 2Y81A 3M5NA 4XFQA 3ZZBA 1QQ4A 3RXIA 3SV2H 1Z6JH 3SU2A 1Y3VA 2FWWA 2SGAA 4TWWA 3RXJA 1HAIH 1SGCA 5AFYH 2C8WB 2PFEA 5K7RA 4AYVB 3MH7A 2STAE 2ZU5A 4F4OC 3M3VA 3RLYH 2WPHS 1CHGA 1JBUH 1MBQA 1NZQH 1HDTH 1MU8B 2PHBA 1BTPA 3UR6A 1C1MA 2Y6TA 3EA9A 3ZVGA 1CE5A 1ESAA 5G4BA 1BBRE 1ELAA 4FUDA 1GJ4H 2A31A 1TB6H 3ZZ3A 3PTBA 4OGYA 1W0YH 3M37A 3F9HA 3S0NA 2GCTB 3HKIB 2F9BH 3QN7A 4NIXA 1WV7H 3SUEA 1ELFA 3ZVAA 1GBMA 2H1UA 1O34A 4X1RU 4ZROA 1LQEA 4ABBA 1WCZA 3GCHC 1C5OH 5EXNA 1AIXH 4TWYA 2PR3A 1AZ8A 1GI6A 3SV9A 2ZG0H 1WYKA 2UWPA 1QJ7B 2G51A 2J94A 5EGMA 1RIWC 3PO1C 3RMOH 1UVUH 1ZGVA 2GVFA 3LC5A 4A7IB 1RJXB 2BY8X 3NXPA 1O2GH 1P09A 2R0KA 1MBMA 5EPNA 1QA7A 1V2RT 4CR9A 3RXQA 1SQAA 1NRRH 2ZU3A 3DT0H 1S5SA 3MI4A 1NM6A 3NK8A 1BRAA 3MTYA 1TNKA 3RXGA 4ZHMU 6GCHG 5AFZH 4DCDA 3MOCA 1EOLA 1TX8A 4NFEA 4X0WU 2ZKSA 1TX7A 1EOJA 1AZZA 3W94A 1AD8H 3KQDA 1MTSA 5FX6A 1GJ7B 4X2WA 3TGKE 1QGFA 3K65B 5J4SA 1NRQH 4JZDH 4X8UH 1A7SA 1J8AA 2R2MB 2Q1JA 5JYIA 2ULLA 2VWNA 1YCPM 1W13U 2BQ7B 1UTPA 1ABIH 3LKWA 1BTZA 1NFYA 3QLPH 1BCUH 2VWMA 3SV8A 2KAIA 1UO6A 4MTBA 2VGCC 2BX4A 1AWFH 1O2VA 2D8WA 2SGDE 5T6DA 3PLPA 5C3NA 3F1SB 1O2SA 1P05A 1YLCA 1Y3XA 2Y80A 1P06A 2FOGA 2QIQA 4IN1A 1MAYA 3K6ZA 2H2ZA 1HFDA 3GCTG 4IC6A 1E0FD 3RXOA 1FN8A 1P11E 1UVOA 2GKVE 1FY1A 1CT0E 3ZZ9A 4ABEA 1MD7A 3T25A 1O2HA 1ELDE 1W8BH 1FI8A 1DITH 3MNBA 2CXVA 1SVPA 4ZXXH 3GYLB 1KTSB 1MKWH 3OX7U 1C5WB 4UE7H 4Y7BA 1A5IA 2ZTXA 3A8BA 3FP8E 1NN6A 4KELA 3V0XA 1EJNA 2Z9JA 1IAUA 2BYAX 3P8OA 2HNTF 1ZPBA 2Z3DA 2ZFSA 3F9EA 2VIDA 1C2DA 3RLWH 2ZECA 5J4QA 1FNIA 5JPMH 2BDAA 3SI3H 2F9PA 1YCPK 2QA9E 1CT4E 2B8OH 1ELEE 1PPBH 4AYYB 5C1UA 3PM3A 9ESTA 1O3DA 1GHBG 1KLTA 1UCYE 1IQKA 1W10U 1WAYB 3SNBA 1QBNA 4Y79A 1SGYE 1Y8TA 1F2SE 3S9CA 1VJ9U 3SQEE 1QL7A 1SSXA 1PPHE 1TNGA 1LO6A 1JRSA 1UTMA 4YT7H 4UFDH 1GI7B 1EAWA 2K1QA 1BUIA 4GCHG 5DPAA 1V2TT 2FLRH 4JYUH 1OSSA 3M61U 1JIMA 2HNTC 1J15A 2R9PA 1C1PA 1GBLA 1O2YA 1UVTH 1IQMA 4HZHA 3RXCA 2F9NA 1SLWB 2A7CA 4O9VA 1NT1A 3RXPA 1ID5H 3CP7A 3EA7A 3FP6E 4NGAH 1UK4A 2OLGA 3RXUA 3A86A 3MU1A 1YPEH 1JOUB 2EA3A 1O3BA 1A61H 1T4VH 1ZSLA 2ZU1A 3PTNA 3MU5A 1TMUH 2HLCA 1O2JA 3ZZ4A 3K9XB 4DJZB 2M5TA 2BQWB 5DP5A 3MO3A 4FUIA 4DY7B 1ZOMA 3BTFE 3BTGE 2A4OA 3PWBA 3M3TA 1ZHRA 3KEEA 1HJ8A 3ZYDA 2PLXA 1NROH 2GV7A 1C1RA 2PUXB 4CBOA 2P3UB 2BDGA 1TMTH 4ABGA 4TY6A 1D3DB 2XRCA 1GBEA 3TPIZ 5E2PA 2OC8A 3S9BA 5JBCS 4AZ2B 3SORA 1XXFA 1HAGE 3L6PA 1Y5UT 5AF9H 8LPRA 4VGCC 1NFXA 5T3HA 4I7YH 1GJBB 5A8XA 1IOEA 2ZU4A 4FUFA 3SW2B 1O3EA 5DG6A 5E8EH 1DY9A 1V2PT 3QWCH 3EYDA 1LVOA 1O2OA 2BDIA 4U32A 2ZU2A 3A7TA 1MTNC 4BANB 2Z3CA 1AFEH 4KKDA 2ZNKH 4XBCA 2AERH 3A8CA 1YGCH 2ZWLH 2BDHA 4ISLA 1NU7B 1T31A 5E0JA 5FCKA 1GHVH 1HJAC 1BHXB 4E7RG 4M7GA 1WSSH 2FPZA 4MDSA 2Z3EA 3PLKA 1HGTH 3LGWA 1O39A 2AEIH 1GVLA 2A5KA 4MNYA 1KDQA 5GIBA 4AG1A 4AG2A 2J38A 5CHAC 2FEQH 3T2NA 2F3CE 4CH8B 5HXFA 2F9VA 2P59A 4ZH8A 1YLDA 2P8OB 1LHEH 1O3AA 1XMNB 1PYTD 4Z6AH 2BQ6B 3HPTB 2BD3A 3SJ9A 1O0DH 1GHAG 3M5LA 1ESBA 1SLXB 2ZPSA 4RN6A 3TJVA 3LH3A 4K8YA 4ZUHA 3KCGH 3QGNB 1QJ1B 5F8ZA 5F8TA 2FOFA 1K1MA 1NPMA 1EPTC 4B71A 3SGQE 1K1JA 1E35B 2ANKH 2V6NA 4MPUA 1UCYK 2ZQ2A 3QO6A 2TIOA 4WF8A 1YPJH 5DP7A 2ZI2H 4B2BA 1W7XH 3EAJA 1AFQB 2EEKA 1P2KA 1AFQC 2NU3E 2FI3E 3H7TA 3Q3YA 4AGJA 2UUYA 4RKJB 2ZDVH 4Q80A 1O3NA 1G2LA 1TOCB 1P8VC 3W95A 1HUTH 1D9IA 5C5OA 1D3TB 2G8TA 1ZMJA 1GJAB 1C2LA 1NO9H 2FS9A 4R0IA 4AX9H 1SBWA 5GXPA 1XKAC 3UWIA 1W2KH 2HOBA 1GCTB 2YNAA 4MNXA 1RTLA 2ZA5A 1CHOG 1LQDB 1AUTC 2PKSC 1WQVH 3ZZ6A 1HAPH 4WH6A 1RGQA 4B73A 5EW1H 1VCPA 1DPOA 1KXBA 1ZMNA 4KP0A 3UREA 2GCHG 1ZMLA 1MCVA 1TRYA 1Y3YA 3ZZ5A 4XBDA 1D6WA 3MNCA 1SFIA 3RM0H 2SFAA 3BV9B 4TPIZ 1BMAA 3JZ2B 1DWEH 2HGTH 1IQFA 3KL6A 3TIUA 1AQ7A 4LZ4B 1ZHMA 1OP0A 2A4RA 2A7JA 1VJAU 4A92A 3P70B 1OX1A 4ZKNU 8KME2 1TGBA 5CE1A 1HIAA 1LDTT 4JZIA 4AORA 1EPTA 2R2WU 2GDEH 1DLKB 5CMXH 2PSYA 1GWAA 1GBKA 2BLWA 3TGIE 2ZHEH 1TYNA 2JETB 3VGCB 1OWDA 5BRRE 1OPHB 3SJ8A 2XNIA 1GBTA 4X1NU 4DT7B 1C2IA 3CS0A 3CENA 3I29A 1S83A 1CSOE 1S0RA 4Y0ZE 3RXTA 2OTVA 1O2QA 2C8XB 2ZCKP 4X8VH 2J92A 3R0FA 8GCHF 1IHTH 4NSVA 2NWNA 3O8CA 4GSOA 2BTCE 1QBVH 1V2QT 1YPKH 1F0UA 2A4GA 1H9IE 2PSXA 1GI4A 2P16A 1EAIA 1LCYA 2AMPA 2ZGCA 4I8JA 1YKTA 2GMTC 3HK6B 2GT8A 3UQVA 1L1JA 1UTLM 1GI3A 2ZC9H 1C1NA 2FI5E 2WINI 1C1OA 3VXEH 5FPSA 2UWOA 5FPYA 2Y5FA 1QL8A 5I46H 2QXJA 1O5GH 1NU9A 1A3EH 3RXHA 1BRCE 3Q77A 4BOHA 4K5ZA 2ZHWH 1KTTB 1S82A 1L1GA 2FYRA 3GY7A 1HAHH 1K1PA 4Y71A 1PPEE 4AGKA 5IDKA 2G4UA 4ZAEA 4BTIB 3DD2H 4UEHH 2VIOA 3LOXA 3RXAA 3RXVA 1EZQA 3IG6B 2RG3A 1GG6C 1GBFA 2J95A 1W7GH 1O2WA 2DUCA 2CF9H 1HYLA 3LH1A 1HAVB 4JYVH 2BOHB 5FBIA 1V2MT 1A3BH 1DUEA 1O3LA 4J1YA 5JBTA 1NTPA 1ARCA 5EW2H 1G3CA 1ARBA 3PYHA 1GMHG 1TE0A 1CGHA 5EU8A 1ANCA 1SHHB 5DO4H 1E34B 1ESTA 4D76A 4BAKB 1Q2WA 2CN0H 7ESTE 4D9QA 4CHAB 1C9PA 1O30A 5LPRA 1C1UH 2W5EA 5A0BA 1T32A 1YPLH 1C1VH 1UTQA 2ZF0H 1FPCH 4Z0KA 3EE0B 3TK6A 2PW8H 3BTHE 3TH4H 1J17T 3I77A 3GY4A 4SGBE 3UY9A 3UNQA 2XC5A 3PMAB 3VPKA 1P2MA 3MO6A 2ZDMA 3FANA 1DVAH 3SUGA 4ASHA 4MPVA 2OXSA 2ZPQA 2Y7XA 4CRDA 1GI5A 2FESH 1NRSH 2BDBA 3D49H 1AUJA 3PROA 1CBWB 1TLDA 2B9LA 1DXWA 4FU8A 3U1IB 1SGIB 1P01A 1A46H 2AH4X 1FAKH 1MKXH 2ZGJA 4LZ1H 2QXGA 1G36A 1QR3E 3LGYA 4NWKA 1GMCF 1YF4A 1MU6B 4I32A 4X2VA 1AE8H 1H4WA 3BG4C 3LGTA 3DFJA 3ZVBA 1T8LA 1Y5BT 2HWLB 1YYY1 1TOMH 2WPJS 1EKBB 5JBAS 1DLEA 1S81A 1ACBE 1TRMA 4UD9H 2Z9GA 2WPMS 1AWHB 1LHCH 1GMDG 4ESTE 2QC2A 3P92A 3ZZCA 4THNH 3Q3XA 5IYTA 2OD3B 1VITF 2WPIS 1TNHA 1H1BA 2FOCA 3PMHB 4Y6DA 1QY6A 3SO3A 2J4IA 3P8NA 1EJMA 2SNWA 4INLA 1W14U 2R3UA 5DP4A 2BVXH 3SGBE 4AFQA 1YC0A 3UR9A 4WH8A 3MU0A 1BZXE 3SU0A 3ZVFA 3GCOA 2XYAA 3NCLA 3P95A 2OBOA 1MMJN 2WPLS 7GCHF 1ELBA 3MU4A 2D26C 2GCTC 3PB1E 2LPRA 2W3KA 3T27A 1HLTH 5E2OA 1HAYB 2ZZUH 3AW1A 1OWJA 2HALA 2ZGHA 2TGAA 3ITIA 1S6HA 4K2YA 1B0FA 1CU1A 1HAOH 1KIGH 1SGTA 1C5RA 1LHFH 3QZQA 3RC5A 1ZZZA 1BTWA 2RA3A 1BRBE 3LPRA 4GLYA 2BD8A 2XTTB 1AN1E 4YTAA 3U69H 1HXFH 1CA8B 1F5RA 1J14A 1KXFA 3NWUA 1OP8A 5GJ4B 1EAUA 1ELVA 1SGDE 1C2JA 3V12A 1LVBA 1V2KT 5GPIB 1W0ZU 4MVNA 2PGQB 3OY6U 4R8TB 3GY2A 1KLJH 4H6TA 1YPHE 1B7XB 1D3PB 1SL3A 1FY3A 2SGPE 2Y5HA 4CR5A 1SOZA 1IHSH 1CGJE 2OBQA 1AKSB 1F5KU 1O5FH 1TBQH 4FVDA 3U98H 4IW4E 1YPGH 4UFFH 3V13A 1ZRKA 2QYIA 3RMNH 3ODFA 1DOJA 4D7GA 1CO7E 3ZVCA 2C90B 2R3YA 1GJ5H 1B0EA 2JH5D 3EDXB 1EB1H 4BAOB 2XC4A 4TYDA 5DK1A 4AOQA 2VB0A 1GHWH 3MYWA 3FVFB 3BEFB 4I31A 1GBHA 2A4QA 5HYOA 1UMAH 1G3EA 4IGDA 3NZIA 2VH0A 1V2JT 5JBBS 1JMOH 3URDA 5L30H 1H9HE 5C1YA 2FTMA 1HJ9A 1WUNH 5EQQA 4X6NA 1O32A 1S85A 1GI2A 2O8MA 1UTNA 3MO9A 2QCYA 4FUGA 3RXSA 3SJOA 3SNDA 4BAQB 4NA9H 4I8LA 2ODYB 4X6MA 3A88A 3MNXA 1P04A 1C4U2 3HGNA 1T7CA 3DUXH 5SGAE 2V0BA 1RTFB 4OS7A 2ZCLP 3RXFA 4AB9A 1ZSKA 1ZTLA 2C8YB 1P57B 3T26A 4TY7A 1ZJDA 3AVZA 2BXUH 2FP7B 1UHBB 3TNTA 3GDUA 4OGXA 3ENSB 2P94A 4LXBH 3HGPA 1C5TA 3E0PB 1OP2A 4D9RA 2ZTYA 1BBRK 1P2OA 3TJNA 3RXBA 1FLEE 1C1TA 2GV6A 1E37B 4FUCA 1EX3A 5JB9S 1LPKB 2TPIZ 3AAVA 2XBXA 1TGTA 6ESTA 1ETRH 4K3JA 3RDZA 1FY8E 1H8IH 4KTSA 1GVZA 5C67A 3SV7A 1O2UA 1O3MA 3CS7A 2SGEE 8ESTE 2GP9B 4O03A 2ESTE 1GL1A 2O8TA 3E90B 3QX5H 1ZRBA 1LPGB 2SGQE 1FDPA 1AMHA 4D7FA 3SJKA 1C9TA 2F91A 2HVXA 2VU8E 1IQLA 4ABJA 1OWEA 3B8JA 1MQ6A 3A81A 1G32B 1HV7A 1KDQB 3FAOA 1O3FA 4FUJA 1F0RA 2AIPA 4OS2A 1O2RA 3BTEE 1XUIA 1TBZH 3C27B 4MNVA 3IITA 4X6PA 2AMDA 3LU9B 4Q2KA 2Q6FA 1NESE 1PYTC 3VB4A 3UOUA 3RXEA 1GDUA 1ZPCA 4OS5A 4Q7XA 1V3XA 2ZDLA 2FZZA 1BHXF 1TA2A 1OYQA 2ZCHP 2FOMB 3UNRA 2YNBA 6CHAB 2R0LA 3TJUA 3OTJE 3KQCA 5C5NA 2ANMH 3GDSA 4UFEH 1EUFA 5F8XA 3SUFA 2ZEBA 2FOBA 4F49A 1A5GH 1O2KA 5C2ZA 5GCHG 1VR1H 3VXFH 1RFNA 2TGDA 1NRNH 1O2PA 4ZHAA 1UVPA 1A5HA 3E1XB 1GBJA 2BX3A 4Y10E 6GCHF 3VEQB 5EQRA 3BF6H 4FVBA 1Y3UA 4O3TA 1S6FA 5TCCA 3F6UH 3OU0A 1RRKA 1TIOA 1U6QA 2W7SA 1XM1A 1Z7KA 2V3OH 2Z94A 1DUAA 3RXMA 3FP7E 5EOKA 3RXLA 2UUFB 1XVMA 2A2XH 4BNRA 1ETTH 1FV9A 1GI0A 3S7HB 1VITH 1V2WT 1PPZA 4ISHH 2BM2A 1MUEB 1BA8B 5DP9A 5L6NH 2P8OC 1BMLA 3MMGA 1Z1JA 3ZV9A 4IMZA 4WY3A 3B9FH 4ISNA 4A1XA 1A0JA 3A7WA 2NU4E 3BSQA 3KQEA 2FS8A 1O2NA 1ZTJA 3MU8A 1O2TA 4K8BA 3STIA 3GCTF 3BEUA 4ABDA 2G55A 5LGOA 1P02A 1SGEE 4IS5A 1PPGE 3LIWA 5LPFA 1XUFA 3ODDA 2WUBA 2AGIX 2UWLA 3LONA 3M7QA 2BD7A 1XVOA 4I8GA 2H9EH 1GHYH 1HIAB 4NCYA 4YM9A 1C1SA 1SLUB 4B75A 4DG4A 5ABWA 1P03A 3I78A 1PFXC 2HPQH 1FMGA 4FUEA 1QRXA 3S69A 2PKAB 1IQIA 3WY8A 7LPRA 2FTLE 2UUJB 1GVKB 2Z9LA 4BTTB 3BTTE 4H6SB 3RXKA 4ISOA 3T28A 1W11U 3A7ZA 4BTUB 1D4PB 1PPCE 1TALA 1EP6A 1OS8A 3A85A 3A89A 3KGPA 5EPYA 1C2GA 2A45B 1C4V2 2EC9H 3BG8A 3RC6A 2ANYA 2ALVA 6LPRA 1Z8GA 1CQQA 1GCTC 1D3QB 1OYTH 4E05H 1MKWK 4FU7A 1L4DA 2ZP0H 3TNSA 1M9UA 1C5NH 1DE7H 2O8UA 1GMCG 4XSKU 4GCHF 3M7UA 3U1JB 1Q3XA 3U8OH 1MCTA 1BJUA 2JH6D 1MH0A 3NKKA 3MNSA 2EI8A 5A09A 3LC3A 1GBBA 1K2I1 4YLQH 5BPEA 1ZTKA 1JIRA 3HATH 9LPRA 3P8FA 1KSNA 1AVXA 1WTHD 1XKBC 2IPHA 4DOQA 3SJIA 4CRBA 1P12E 1THRH 1RXPA 4UDWH 1KXDA 4ABAA 2DE9A 1GBCA 3QUMP 3T5FH 1A0LA 5FHTA 4AFZA 4B2AA 1S84A 3NPSA 1J9CH 1AU8A 1BT7A 3QTOH 1T8MA 1SQOA 1O3GA 2RDLA 1OKXA 2GZ7A 1W3CA 2RA0A 3E91A 3A8DA 2XBVA 3T29A 2BZAA 2PWXA 1SPJA 2OC0A 5FCRA 3VGCC 2JETC 1F7ZA 1LHGH 2PTCE 1SFQB 2BMGB 3GOVB 3A87A 3SBKA 1UTKA 5FPTA 3EGKH 1N8OB 1BQYA 4Y11E 4U30A 4NSYA 1TA6A 1CA0B 2EI6A 1C1QA 2NU0E 4CRAA 2QXIA 4JZFH 1TGCA 1FUJA 2H6MA 3O8BA 2V35A 4OS4A 1CVWH 1WQSA 2PTNA 2HRVA 2P3TB 1Z8JB 1V2LT 1JXPA 4DURA 5ESTE 4B74A 1O5CB 1O3CA 3VFEA 3M5OA 1KLIH 2OQ5A 2FXRA 2VH6A 1P2QA 1FAXA 2ZHQH 3PLBA 1TQ0B 4Y0YE 5GDSH 1ELTA 2BDCA 1WU1A 5B6OA 3MH6A 1O38A 4KTCA 5ESBA 2FYQA 1O5DH 2WV5A 1SOTA 4JK6A 1GI9B 1TX6A 2I6SA 3T62A 1QTFA 4DIHH 4X1SU 2IOTA 3AW0A 3A84A 4GHQA 1O2MA 2J2UA 7KMEH 2FOHA 1TBRH 1AY6H 1TAWA 2SNVA 2AS9A 4UONA 2BZ6H 1GDNA 1FIWA 2STBE 3HK3B 2W3IA 2GZ8A 1SMFE 3MH5A 4D8NA 1P2JA 1INCA 3GISB 3SNEA 1GBDA 4HGCA 3QDZB 1C5QA 2ZHDA 3GY3A 1GHAF 1TFXA 5H4IB 1K21H 4MPWA 4PROA 2VVUA 2ZO3H 1QCPA 3JZ1B 1P2NA 4CHAC 1NY22 2HNTE 2VIVA 1YCPH 1FQ3A 3FZDA 1C5YB 1ZHPA 1BBRH 1G3BA 3EA8A 2YOLA 3A7VA 4ISIH 3PMBB 4MLFB 4YZUA 1K9OE 3BIVH 1DY8A 2VWOA 3K2UA 2D2DA 4NWLA 3M35A 4ABHA 2AGGX 1WTGH 1ANDA 3AASA 5FBEA 5HM2A 2C4FH 1GI1A 2VJ1A 1KXAA 3VB7A 1V6DA 1XUJA 3GICB 1AE5A 1CBWC 4NIVA 1BMMH 2BOKA 4Y8ZA 1UK3A 3KHVA 3TU7H 1KYNA 5LH8A 3U9AH 1HXEH 5DP3A 1OXGA 2TRMA 1QB6A 3VB3A 4A6LA 3AAUA 1LVMA 2NU2E 2P3FH 3DA9B 3ZZ7A 3ATKA 2ZGXH 3BTKE 4QT8C 3MHWU 1VZQH 1C2MA 2CHAB 4O97A 4KTUA 1DDJA 5L2YH 4X8TH 2OQUA 1AHTH 1F92A 1BTXA 2FM2A 3UOPA 1BTUA 5C1XA 1N1LA 4K1TA 3TH3H 4Y76A 3UQOA 5EXMA 2FDAA 2I6QA 2GCHF 3GY6A 1OWIA 3GDVA 1HAVA 1AB9B 1C5SA 1G37A 2XWAA 4NIYA 2AIQA 3RC4A 2O9QA 1CGIE 1AB9C 1DM4B 2A2QH 3QGJA 1AI8H 4DVAU 3E0NB 2TGPZ 2O8WA 2PV9B 3STJA 1OWKA 2PGBB 2Z6BD 1DSUA 5DP6A 2UUKB 3ZZ8A 1ELCA 3DHKH 2BLVA 2O8LA 4MNWA 3TJOA 3SU5A 2KAIB 3UUZA 1VCQA 1PQAA 3RU4E 1QQUA 2QV1A 2Y5GA 3UTUH 4WMDA 2AFQB 2H5CA 3IWMA 1XUGA 1FY5A 4MG3A 1VCWA 1Z6EA 5A8ZA 5LPEA 5EODA 3SNCA 2G81E 2BVRH 3D62A 1BTHH 1C5XB 1QFKH 3BN9A 4OS6A 1DXPA 3SZNA 3TH2H 3E3TA 2NU1E 1K1IA 3GCHB 1SI5H 1TPPA 2XWBI 1S0QA 5HMAA 1DX5M 1PQ7A 3LDXH 3P17H 4A5TS 1TQ7B 2V3HH 3A7XA 1RIWB 2QN5T 3PO1B 4IBLH 2RCEA 2H9TH 3SV6A 2BVSH 1Y59T 4TPYA 4NZLA 1O2XA 2B5TB 1EXFA 3BEIB 1ZLRA 3UFAA 3SU4A 3ZV8A 1QL9A 1GGDB 2ZFQH 1L0ZA 1GGDC 5EQSA 1BMNH 3SNAA 1FZZA 2ZDNA 5A8YA 1G2MA 2WV4A 1Z1IA 1H9LB 1UJ1A 2Q6GA 3NUMA 1C1WH 1K28D 1YM0A 3SGAE 1EAXA 2P95A 1P0SH 1SC8U 1GBAA 2XC0A 2VIQA 2FX6A 2BD5A 1NFUA 4ZKOU 3F68H 1XUKA 2W26A 4WWYA 1IQJA 1O33A 3BTDE 4A1VA 1HCGA 4DW2U 1A0HB 1UCYH 4CREA 1C5LH 2G52A 2BDYA 4JZ1A 1O3PB 1GHZA 1T8OA 1A2CH 4B1TA 2F9UA 2ODQA 2Z7FE 2BY7X 5ETXA 4Y7AA 2JKHA 2VGCB 3L3TA 1GJCB 2BLQA 3A8AA 4CRGA 3LGIA 1V2UT 1QNJA 2FOAA 1GMHF 2OC7A 1HB0B 2BY5X 3S7KB 2ZDKA 1QJ6B 2WYJA 2ZFFH 1K22H 3ZZAA 3ELAH 4JCNA 1O3JA 2AYWA 3Q76A 2C8ZB 5JB8S 1QRWA 5K0HA 3KIDU 3OSYA 2FMJA 2ANWA 1EZUC 4Y8XA 2SGFE 2ASUB 1FN6A 1FXYA 1CT2E 1C2EA 2A5IA 2B7DH 5EG4A 4GPGA 3KNXA 1E36B 2GGVB 1BDAA 4JMYA 2ZFRH 1BB0B 2ZQ1A 1C5VA 4XOJA 5I25A 3SN8A 4X2YA 4ZHLU 1QB1A 5AVDA 3S9AA 3O8RA 1HAZB 2XBWA 2A0QB 4CH2B 2WYGA 2IN2A 4NFFA 3TITA 3PV4A 2G5NA 3SHCH 3MWIU 5E0HA 2A32A 1ABJH 1EZSC 2OP9A 2QAAA 3PMJA 1AKSA 5FAHA 4XDEA 4DIIH 1Z71A 3QK1A 1JRTA 2BHGA 1DS2E 1KXCA 1VGCB 4YOJA 1F5LA 1GJ8B 1RS0A 4SGAE 1SB1H 1VGCC 4NA8A 2FIRH 1EATA 1GMDF 1ZSJA 3SU1A 5DGJA 4GAWA 4X8SH 2GX4A 2Z9KA 3GY5A 3N7OA 2FX4A 1FY4A 1GJ9B 4E7NA 1PJPA 1E38B 1XX9A 1SGRE 1O3IA 4WXVA 1N6YA 2ALPA 1JWTA 1KXEA 2ZFTA 1MKXK 1O2IA 2FODA 2J9NA 3TK9A 4RKOB 3A7YA 1ZYOA 1O3OA 3Q00A 3KN2A 1C2FA 2IJOB 3D65E 1TPSA 2THFB 4IC5A 2VIPA 5FX5A 1GJDB 3SU3A 1TNIA 1GI8B 3QZRA 3EQ0H 3BTQE 1UVSH 3RU4T 1V2OT 1EASA 2VIWA 3U8TH 1W12U 3ZVDA 1N6XA 1AVWA 3U8RH 1MTVA 2BLOA 3D23A 1OWHA 1FPHH 6CHAC 3ZZDA 2J34A 1UHBA 2HPPH 1TGSZ 8GCHG 1BIOA 1ANBA 1QIXB 3H5CB 1NC6A 3RMMH 2BB4A 2XBYA 4K1EA 1TPOA 1SGFA 3MFJA 3VB6A 5T6FA 2FLBH 4VGCB 4Y8YA 1Z8IB 4ZKRU 1J16A 1WBGB 1QB9A 1L4ZA 1V2VT 5F6MA 1O5EH 2QGRA 3G01A 2ZPRA 4H42U 4INKA 3SHAH 2TGTA 2VWLA 3BTME 3E6PH 1SQTA 1LTOA 1SGPE 1O5AB 2ZDAH 1MTNB 2XW9A 4BAHB 1LVYA 4X1PU 1O5BB 1D6RA 4WXIA 1DWDH 2OINA 1A4WH 3KF2A 2WPKS 1HJAB 1SGNE 1Y5AT 1ZJKA 3ATMA 4YT6H 1GBIA 1RTKA 1O31A 1QRZA 1EJAA 2OCVB 2P93A 4MPXA 2VNTA 3F9GA 1X7AC 2Y82A 1TABE 4E06H 3C1KA 1DICA 1L2EA 5CHAB 3A80A 1DWCH 4GVUA 2C3SA 1RD3B 1DANH 1AVGH 2AMQA 1QURH 1SLVB 4U2WA 1AO5A 5HGGA 4NIWA 1ZR0A 4NZQA 1HNEE 4AFUA 1MTUA 3PWCA 3A82A 3ZVEA 4CRFA 2FOEA 4NG9H 4HFPB 2H5DA 2A7HA 2ILNA 3F9FA 3TK5A 3FZZA 5GWZA 1MAXA 1P10A 1T8NA 1NFWA 3V3MA 1XUHA 4WMEA 1TGNA 1EP5A 5JDUB 2OUAA 1EPTB 2GZ9A 2XXLA 2ZTZA 3M5MA 3M3SA 4NA7A 5DP8A 1FONA 1V2ST 5DJ7A 1GHXH 1LPZB 1TNLA 4O3UA 1K1NA 2ZHFH 4LK4A 1YBWA 1THSH 1V2NT 2QF3A 2W7UA 3P8GA 1NRPH 2A1DB 1C4Y2 4ZKSU 4HI3A 3VB5A 1YPHC 3P6ZB 4MQAA 4X6OA 1C5ZB 1TPAE 3LGVA 1Y3WA 3TVJB 4YLUA 3ZYEA 4INHA 4B76A 1ZGIA 1SG8B 2DE8A 2ZGBH 5AHGH 1ETSH 1YPMH 1BOQA 1GHBF 1O36A 1MQ5A 4DGJA 1EQ9A 2BD2A 3R3GB 3RU4D 3ESTA 4WJG2 4I33A 1GJ6A 1PPFE 1GL0E 4Q7YA 3URCA 1HBTH 1PQ5A 3O8DA 3QTVH 1ZPZA 2XCNA 1ANEA 1A1RA 4OS1A 2F83A 1WOFA 1Z8RA 1DSTA 2PKSB 5FXLA 2QF0A 2EI7A 4X2XA 2PUQH 2VVCA 2BY9X 2CV3A 3L33A 3BIUH 4A1TA 1VITG 1ORFA 4K60A 1THPB 1SR5C 1UK2A 4FU9A 4XBBA 4IN2A 3H7OA 3E8LA 2BY6X 4H4FA 2Z9IA 4ABIA 1DFPA 3RUOA 2G5VA 1MD8A 4U01A 4YO9A 2BD9A 5TJXA 2C93B 1K1OA 7GCHG 1DT2A 1TRNA 3HKJB 2GDDA 4GHTA 5A0CA 2D1JA 2WUCA 5E0GA 5HM9A 1LMWB 4AB8A 1C5PA 1MZDA 1NS3A 2BXTH 4YOIA 1N8OC 4JK5A 3E16B 3M7TA 3UPEA 1HPGA 2PKAA 2G00A 1CA0C 1G9IE 1FJSA 4ZMAH 3UWJH 1BRUP 1H8DH 1HAXB 4K69A 1F0SA 1GCDA 2CJIA 2BD4A 3ATLA 1C2HA 3GCNA 1C5UA 5GCHF 3SOSA 2F9OA 1G3DA 2Q6DA 3OYPA 2ODPA 2Y7ZA 1TWXB 4CRCA 3ATWA 1GPZA 2GMTB 1TONA 1P2IA 3LGUA 1YP9A 1O35A 3UNSA 3RM2H 1SHYA 4I8KA 4FXGH
chains in the Genus database with same CATH superfamily
4AFSA 3LT3A 2QXHA 1IQNA 3ATIA 2GT7A 1C5MD 1IQHA 2J98B 5F03A 2JH0D 3GYMA 4YESB 3DFLA 1Q31A 4KGAA 4BXWA 4WMFA 3LJOA 3SQHE 3Q3KA 1MTWA 2AGEX 1OOKB 1MZAA 3V7TA 1G30B 1EB2A 3MH4A 2F4LA 1P9UA 3RXRA 5DKMA 1F0TA 5TCAA 1O2LA 1DWBH 1UTOA 5PTPA 1QA0A 4Q7ZA 1XXDA 1TNJA 4RSPA 4ZXYH 4LOYH 1O37A 3OEED 3RP2A 5KECA 1GG6B 1W0KD 1LKBA 4BAMB 4J2YB 5L2ZH 5EXLA 2H9HA 2LNCA 1BTYA 3UIRA 1O2ZA 3DSOA 2B0FA 2VINA 3B23B 5CDFE 1K1LA 1TMBH 3A83A 3BTWE 3M36A 3TLOA 4CBNA 4X1QU 2G4TA 4FUHA 2A5AA 5T6GA 2XCFA 4AN7A 2TBSA 3OY5U 4UFGH 3LJJA 1SGFG 1BJVA 1HRTH 1LHDH 2WZQA 2QY0B 1UTJA 3SI4H 4BXSA 5A0AE 1B5GH 2CGAA 3KQBA 4IMQA 1QBOA 4ACAA 5C20A 4HTCH 3RMLH 1EZXC 2VVVA 3SU6A 1QHRB 4ABFA 2YMSD 4JZEH 1AGJA 1FIZA 1SGQE 1GDQA 4K1SA 2ZFPH 2FI4E 2WSSD 3K6YA 1C2KA 2GD4B 4GUXA 1BITA 1O3KA 2ZIQH 1P3CA 1P9SA 3GY8A 1LKAA 5A2MH 1ELGA 3FFGA 4YOGA 4FUBA 4JYTA 1O3HA 2FO9A 1L1NA 1P3EA 2CF8H 2OC1A 4M9FA 1KY9A 1IQGA 1CHOF 1IQEA 1T4UH 4I8HA 1PQ8A 4XE4A 2GTBA 3RXDA 3TGJE 2CHAC 3SUDA 2CMYA 4B2CA 4WVPE 3BG4B 2Y81A 3M5NA 4XFQA 3ZZBA 1QQ4A 3RXIA 3SV2H 1Z6JH 3SU2A 1Y3VA 2FWWA 2SGAA 4TWWA 3RXJA 1HAIH 1SGCA 5AFYH 2C8WB 2PFEA 1E79D 5K7RA 4AYVB 3MH7A 2STAE 2ZU5A 4F4OC 3M3VA 1S6LA 3RLYH 2WPHS 3N7EA 1CHGA 1JBUH 1MBQA 1NZQH 1HDTH 1MU8B 2PHBA 1BTPA 3UR6A 1C1MA 2Y6TA 3EA9A 3ZVGA 1CE5A 2HLDD 1ESAA 5G4BA 1BBRE 1ELAA 4FUDA 1GJ4H 2A31A 1TB6H 3ZZ3A 3PTBA 4OGYA 1W0YH 3M37A 3F9HA 3S0NA 2GCTB 3HKIB 2F9BH 3QN7A 4NIXA 1WV7H 3SUEA 1ELFA 2L74A 3ZVAA 1GBMA 2H1UA 1O34A 4X1RU 4ZROA 1LQEA 4ABBA 1WCZA 3GCHC 1C5OH 5EXNA 1AIXH 4TWYA 2PR3A 1H8HD 1AZ8A 1GI6A 3SV9A 2ZG0H 1WYKA 2UWPA 1QJ7B 2G51A 2J94A 5EGMA 1RIWC 3PO1C 5DSFA 5C0TA 3RMOH 1UVUH 1ZGVA 2GVFA 4TSFD 3H09A 3LC5A 4A7IB 1RJXB 2BY8X 3NXPA 1O2GH 1P09A 2R0KA 1MBMA 5EPNA 2LP6A 1QA7A 1V2RT 4CR9A 3RXQA 1SQAA 1NRRH 2ZU3A 3DT0H 1S5SA 3MI4A 1NM6A 3NK8A 1BRAA 3MTYA 1TNKA 3RXGA 4ZHMU 6GCHG 5AFZH 4DCDA 3MOCA 4XRNA 1EOLA 1TX8A 4NFEA 4X0WU 2ZKSA 1TX7A 1EOJA 1AZZA 3W94A 1AD8H 3KQDA 1MTSA 5FX6A 1GJ7B 4X2WA 3TGKE 1QGFA 3K65B 5J4SA 1NRQH 4JZDH 4X8UH 1A7SA 1J8AA 2R2MB 2Q1JA 5JYIA 2ULLA 2VWNA 1YCPM 1W13U 2BQ7B 1UTPA 1ABIH 3LKWA 1BTZA 1NFYA 3QLPH 1BCUH 2VWMA 3SV8A 2K8IA 2KAIA 1UO6A 5HKKD 4MTBA 2VGCC 2BX4A 1AWFH 2K0QA 2QE7D 1O2VA 2D8WA 2SGDE 5T6DA 3PLPA 5C3NA 3F1SB 1O2SA 1P05A 1YLCA 1Y3XA 2Y80A 1P06A 2FOGA 2QIQA 4IN1A 1MAYA 3K6ZA 2H2ZA 1HFDA 3GCTG 3NRLA 4IC6A 1E0FD 3RXOA 1YWUA 1FN8A 1P11E 1UVOA 2GKVE 1FY1A 1CT0E 3ZZ9A 4ABEA 1MD7A 3T25A 1O2HA 1ELDE 1W8BH 1FI8A 1DITH 3MNBA 2CXVA 2RDEA 1SVPA 4ZXXH 3GYLB 1KTSB 1MKWH 3OX7U 1C5WB 4UE7H 4Y7BA 1A5IA 2ZTXA 3A8BA 3FP8E 1NN6A 4KELA 3V0XA 1EJNA 2Z9JA 1IAUA 2BYAX 3P8OA 2HNTF 1VKYA 1BMFD 1ZPBA 2Z3DA 2ZFSA 3F9EA 2VIDA 1C2DA 3RLWH 2ZECA 2KR7A 5J4QA 1FNIA 5JPMH 2W6ID 2BDAA 3SI3H 2F9PA 1YCPK 2QA9E 1CT4E 2B8OH 1ELEE 2KCAA 1PPBH 4AYYB 5C1UA 3PM3A 9ESTA 1O3DA 1GHBG 1KLTA 1UCYE 1IQKA 1W10U 1WAYB 3SNBA 1QBNA 4Y79A 1SGYE 1Y8TA 1F2SE 3S9CA 2JIZD 1VJ9U 3SQEE 1QL7A 1SSXA 1PPHE 1TNGA 1LO6A 1JRSA 1UTMA 4YT7H 4UFDH 1GI7B 1EAWA 2K1QA 1BUIA 4GCHG 5DPAA 1V2TT 2FLRH 4JYUH 1OSSA 3M61U 1JIMA 2HNTC 1J15A 2R9PA 1C1PA 1GBLA 1O2YA 1UVTH 1IQMA 4HZHA 2KFWA 2F9NA 3RXCA 1SLWB 2A7CA 4O9VA 1NT1A 3RXPA 1ID5H 3CP7A 3EA7A 3FP6E 4NGAH 1UK4A 2OLGA 3RXUA 1SKYE 3A86A 3MU1A 1YPEH 1MABB 2PP6A 1JOUB 2EA3A 1O3BA 1A61H 1T4VH 1ZSLA 2ZU1A 3PTNA 3MU5A 1TMUH 2HLCA 1O2JA 3ZZ4A 3K9XB 4DJZB 2M5TA 2BQWB 5DP5A 3MO3A 4FUIA 4DY7B 1ZOMA 3BTFE 3BTGE 2A4OA 3PWBA 3M3TA 1ZHRA 3KEEA 1HJ8A 3ZYDA 2PLXA 1NROH 2GV7A 1C1RA 2PUXB 4CBOA 2P3UB 2BDGA 4Q63A 1TMTH 4ABGA 4TY6A 1D3DB 2XRCA 1GBEA 2WHXA 3TPIZ 5E2PA 2OC8A 2KZ4A 3S9BA 5JBCS 4AZ2B 3SORA 1XXFA 1HAGE 3L6PA 1Y5UT 5AF9H 8LPRA 4VGCC 1NFXA 5T3HA 4I7YH 1GJBB 5A8XA 1IOEA 2ZU4A 4FUFA 3SW2B 1O3EA 5DG6A 5E8EH 2WV9A 1DY9A 1V2PT 3QWCH 4OM9A 3EYDA 1LVOA 1O2OA 2BDIA 4U32A 2ZU2A 3A7TA 1MTNC 4BANB 2Z3CA 1AFEH 4KKDA 2ZNKH 4XBCA 2AERH 3A8CA 1OHHD 1YGCH 2ZWLH 2BDHA 4ISLA 1NU7B 1T31A 5E0JA 5FCKA 1GHVH 1HJAC 1BHXB 4E7RG 4M7GA 1WSSH 2FPZA 4MDSA 2Z3EA 3PLKA 1HGTH 3LGWA 4Q4LA 1O39A 2AEIH 1GVLA 2A5KA 4MNYA 1KDQA 5GIBA 4AG1A 4AG2A 2J38A 5CHAC 2FEQH 3T2NA 2F3CE 4CH8B 5HXFA 2F9VA 2P59A 4ZH8A 1YLDA 2P8OB 1LHEH 1O3AA 1XMNB 1PYTD 4Z6AH 2BQ6B 3HPTB 2BD3A 3SJ9A 1O0DH 1GHAG 3M5LA 1ESBA 1SLXB 2ZPSA 4RN6A 3TJVA 3LH3A 4K8YA 4ZUHA 3KCGH 3QGNB 1QJ1B 5F8ZA 5F8TA 2FOFA 1K1MA 1NPMA 1EPTC 4B71A 3SGQE 1K1JA 1E35B 2ANKH 2V6NA 4MPUA 1UCYK 2ZQ2A 3QO6A 2TIOA 4WF8A 1YPJH 5DP7A 3GS9A 2ZI2H 4B6EA 4B2BA 1W7XH 3EAJA 1AFQB 2EEKA 1P2KA 1AFQC 2NU3E 5CHBA 2FI3E 4YXWD 3H7TA 3Q3YA 4AGJA 2UUYA 4RKJB 3SZEA 2ZDVH 4Q80A 1O3NA 1G2LA 1TOCB 1P8VC 3W95A 1HUTH 1D9IA 5C5OA 1D3TB 2G8TA 1ZMJA 1GJAB 1C2LA 1NO9H 2FS9A 4R0IA 4AX9H 1SBWA 5GXPA 1XKAC 3UWIA 1W2KH 2HOBA 1GCTB 2YNAA 4MNXA 1RTLA 2ZA5A 1CHOG 1LQDB 1AUTC 2PKSC 1WQVH 3ZZ6A 1HAPH 4WH6A 1RGQA 4I86A 4B73A 5EW1H 1VCPA 1DPOA 1KXBA 1ZMNA 4KP0A 3UREA 2GCHG 1ZMLA 1MCVA 1TRYA 1Y3YA 3ZZ5A 4XBDA 1D6WA 3MNCA 1SFIA 3RM0H 2SFAA 3BV9B 1FX0B 4TPIZ 1BMAA 3JZ2B 1DWEH 2HGTH 1IQFA 3KL6A 3TIUA 1AQ7A 4LZ4B 1ZHMA 1OP0A 2A4RA 2A7JA 1VJAU 4A92A 3P70B 1OX1A 2AHME 4ZKNU 8KME2 1TGBA 5CE1A 1HIAA 1LDTT 4JZIA 4AORA 1EPTA 2R2WU 2GDEH 1DLKB 5CMXH 2PSYA 1GWAA 1GBKA 2BLWA 3TGIE 2ZHEH 1TYNA 2JETB 2CK3D 1OWDA 3VGCB 1OPHB 5BRRE 3SJ8A 2XNIA 1GBTA 4X1NU 4DT7B 1C2IA 3CS0A 3CENA 3I29A 1S83A 1CSOE 1S0RA 4Y0ZE 3RXTA 2OTVA 1O2QA 2C8XB 2ZCKP 4X8VH 2J92A 3R0FA 8GCHF 1IHTH 5EJLA 4NSVA 2NWNA 3O8CA 4GSOA 2BTCE 1QBVH 1V2QT 1YPKH 1F0UA 2A4GA 1H9IE 2PSXA 1GI4A 2P16A 1EAIA 1LCYA 2AMPA 2ZGCA 4I8JA 1YKTA 2GMTC 3HK6B 2GT8A 3UQVA 1L1JA 1UTLM 1GI3A 3PV5A 2ZC9H 1C1NA 2FI5E 2WINI 1C1OA 4Z1MD 3VXEH 5FPSA 2UWOA 1EFRD 5FPYA 2Y5FA 1QL8A 5I46H 4P02A 2QXJA 3MQKC 1O5GH 1NU9A 1A3EH 3RXHA 1BRCE 3Q77A 4BOHA 4K5ZA 2ZHWH 1KTTB 1S82A 1L1GA 2FYRA 3GY7A 1HAHH 1K1PA 4Y71A 1PPEE 4AGKA 5IDKA 2G4UA 4ZAEA 4BTIB 3DD2H 4UEHH 2VIOA 3LOXA 3RXAA 3RXVA 1EZQA 3IG6B 2RG3A 1GG6C 1GBFA 2J95A 1W7GH 1O2WA 4RT0A 2DUCA 2CF9H 1HYLA 3LH1A 1HAVB 5F53A 4JYVH 2BOHB 5FBIA 1V2MT 1A3BH 1DUEA 3WWFA 1O3LA 4J1YA 5JBTA 1NTPA 1ARCA 5EW2H 1G3CA 1ARBA 3PYHA 1GMHG 1TE0A 1CGHA 5EU8A 2QF4A 2XNDD 1ANCA 1SHHB 5DO4H 1E34B 1ESTA 4D76A 4BAKB 1Q2WA 2CN0H 7ESTE 4D9QA 4CHAB 1C9PA 1O30A 5LPRA 4P00A 1C1UH 2W5EA 5A0BA 1T32A 1YPLH 1C1VH 1UTQA 2ZF0H 1FPCH 4Z0KA 3EE0B 3ZIAD 3TK6A 2PW8H 3BTHE 3TH4H 1NBME 1J17T 3I77A 3GY4A 4SGBE 3UY9A 3UNQA 2XC5A 3PMAB 3VPKA 1P2MA 3MO6A 2ZDMA 3FANA 1DVAH 3SUGA 4ASHA 4MPVA 2OXSA 2ZPQA 2Y7XA 4CRDA 1GI5A 2FESH 1NRSH 2BDBA 3D49H 1AUJA 3PROA 1CBWB 1TLDA 2B9LA 1DXWA 4FU8A 3U1IB 1SGIB 1P01A 1A46H 2AH4X 1FAKH 2J98A 1MKXH 2ZGJA 4LZ1H 2QXGA 1G36A 1QR3E 3LGYA 4NWKA 1GMCF 1YF4A 1MU6B 4I32A 4X2VA 1AE8H 1H4WA 3BG4C 3LGTA 3DFJA 3ZVBA 1T8LA 1Y5BT 2HWLB 1YYY1 1TOMH 2WPJS 1EKBB 5JBAS 1DLEA 1S81A 1ACBE 1TRMA 4UD9H 4F48B 2Z9GA 2WPMS 1AWHB 1LHCH 2IPQX 1GMDG 4ESTE 2QC2A 3P92A 3ZZCA 4THNH 3Q3XA 5IYTA 2OD3B 1VITF 5C0UA 2WPIS 1TNHA 1H1BA 2FOCA 3PMHB 4Y6DA 1QY6A 3SO3A 2J4IA 3P8NA 1EJMA 2SNWA 4INLA 1W14U 2R3UA 5DP4A 2BVXH 3SGBE 4AFQA 1YC0A 3UR9A 4WH8A 3MU0A 3F3BA 1BZXE 3SU0A 3ZVFA 3GCOA 2XYAA 3NCLA 3P95A 2OBOA 1MMJN 2WPLS 7GCHF 1ELBA 3MU4A 2D26C 2GCTC 3PB1E 2LPRA 2W3KA 3T27A 1HLTH 5E2OA 1HAYB 2ZZUH 3AW1A 1OWJA 2HALA 2ZGHA 4F55A 2TGAA 3ITIA 1S6HA 4K2YA 1B0FA 1CU1A 1HAOH 1KIGH 1SGTA 1C5RA 2LELA 1LHFH 3QZQA 3RC5A 1ZZZA 1BTWA 2RA3A 1BRBE 2XOKD 5C94A 3LPRA 4GLYA 2L6OA 2BD8A 2XTTB 1AN1E 4YTAA 3U69H 1HXFH 2IJD1 1CA8B 1F5RA 1J14A 1KXFA 3NWUA 1OP8A 5GJ4B 1EAUA 1ELVA 2J97A 1SGDE 1C2JA 3V12A 1LVBA 1V2KT 5GPIB 1W0ZU 2OK5A 4MVNA 2PGQB 3OY6U 4R8TB 3GY2A 1KLJH 4H6TA 1YPHE 1B7XB 1D3PB 1SL3A 1FY3A 2SGPE 2Y5HA 4CR5A 1SOZA 1IHSH 1CGJE 2OBQA 1AKSB 1F5KU 1O5FH 1TBQH 4FVDA 3U98H 4IW4E 1YPGH 4UFFH 3V13A 1ZRKA 2QYIA 3RMNH 3ODFA 1DOJA 4D7GA 1CO7E 3ZVCA 2C90B 2R3YA 1GJ5H 1B0EA 2JH5D 3EDXB 1EB1H 4BAOB 2XC4A 4TYDA 5DK1A 4AOQA 2VB0A 1GHWH 3MYWA 3FVFB 3BEFB 4I31A 1GBHA 2A4QA 5HYOA 1UMAH 5IK2D 1G3EA 4IGDA 3NZIA 2VH0A 1YLNA 1V2JT 5JBBS 1JMOH 3URDA 5L30H 1H9HE 5C1YA 2FTMA 1HJ9A 1WUNH 5EQQA 4X6NA 1O32A 1S85A 1GI2A 1UTNA 2O8MA 3MO9A 2QCYA 4FUGA 3RXSA 3SJOA 3SNDA 4BAQB 4NA9H 4I8LA 2ODYB 4X6MA 3A88A 3MNXA 1P04A 1C4U2 3HGNA 3PRBA 1T7CA 3DUXH 5SGAE 2V0BA 1RTFB 4OS7A 2ZCLP 3RXFA 4AB9A 1ZSKA 1ZTLA 2C8YB 1P57B 3T26A 4TY7A 1ZJDA 3AVZA 2BXUH 2FP7B 1UHBB 3TNTA 3GDUA 4OGXA 3ENSB 2P94A 4LXBH 3HGPA 1C5TA 3E0PB 1OP2A 4D9RA 2ZTYA 1BBRK 1P2OA 3TJNA 3RXBA 1FLEE 1C1TA 2GV6A 1E37B 4FUCA 1EX3A 5JB9S 1LPKB 4FOUC 2TPIZ 3AAVA 2XBXA 1TGTA 6ESTA 1ETRH 4K3JA 3RDZA 1FY8E 1H8IH 4KTSA 1GVZA 3SYJA 5C67A 3SV7A 1O2UA 1O3MA 3CS7A 2SGEE 8ESTE 2GP9B 4O03A 2ESTE 1GL1A 2O8TA 3E90B 3QX5H 1ZRBA 1LPGB 2SGQE 1FDPA 1AMHA 4D7FA 3SJKA 5KGOA 1C9TA 2F91A 2HVXA 2VU8E 1IQLA 4ABJA 1OWEA 3B8JA 1MQ6A 3A81A 1G32B 1HV7A 1KDQB 3FAOA 1O3FA 4FUJA 1F0RA 2AIPA 3OEHD 4OS2A 1O2RA 3BTEE 1XUIA 1TBZH 3C27B 4MNVA 3IITA 4X6PA 2KCYA 2AMDA 3LU9B 4Q2KA 2Q6FA 1NESE 1PYTC 3VB4A 3UOUA 3RXEA 1GDUA 1ZPCA 4OS5A 4Q7XA 1V3XA 2ZDLA 2FZZA 1BHXF 1TA2A 1OYQA 2ZCHP 4AC9A 2FOMB 1WDIA 3UNRA 2YNBA 1COWD 6CHAB 5DN6D 2R0LA 3TJUA 3OTJE 3KQCA 5C5NA 2ANMH 3GDSA 4UFEH 1EUFA 5F8XA 3SUFA 2ZEBA 2FOBA 3CNRA 4F49A 5T1VA 1A5GH 1O2KA 5C2ZA 5GCHG 1VR1H 3VXFH 1RFNA 2TGDA 1NRNH 1O2PA 4ZHAA 1UVPA 1A5HA 3E1XB 1GBJA 2BX3A 4Y10E 6GCHF 3VEQB 5EQRA 3BF6H 4FVBA 1Y3UA 4O3TA 1S6FA 5TCCA 3F6UH 3OU0A 1RRKA 1TIOA 1U6QA 2W7SA 1XM1A 1Z7KA 2V3OH 4ASUD 2Z94A 1DUAA 3RXMA 3FP7E 4TT3D 5EOKA 3RXLA 2UUFB 1XVMA 2A2XH 2EQNA 4BNRA 1ETTH 1FV9A 1GI0A 3S7HB 1VITH 1V2WT 1PPZA 4ISHH 2BM2A 1MUEB 3OAAD 1BA8B 5DP9A 5L6NH 2P8OC 1BMLA 3MMGA 1Z1JA 3ZV9A 4IMZA 4WY3A 4B6FA 3B9FH 4ISNA 4A1XA 1A0JA 3A7WA 2NU4E 3BSQA 2GJGA 3KQEA 2FS8A 2JDID 1O2NA 1ZTJA 3MU8A 1O2TA 4K8BA 3STIA 3GCTF 3BEUA 4ABDA 4DT4A 2G55A 5LGOA 1P02A 1SGEE 4IS5A 1PPGE 3LIWA 5LPFA 1XUFA 3ODDA 2WUBA 2AGIX 2EY4C 2UWLA 3LONA 3M7QA 2BD7A 1XVOA 4I8GA 2H9EH 1GHYH 1HIAB 4NCYA 4YM9A 1C1SA 1SLUB 4B75A 4DG4A 5ABWA 5EJ1A 1P03A 3I78A 1PFXC 2HPQH 1FMGA 4FUEA 1QRXA 1W0JD 2VBCA 3S69A 2PKAB 1IQIA 3WY8A 7LPRA 2FTLE 2UUJB 1GVKB 2Z9LA 4BTTB 3BTTE 4RI0A 4H6SB 3RXKA 4ISOA 3T28A 1W11U 3A7ZA 4BTUB 1D4PB 1PPCE 1TALA 1EP6A 1OS8A 3A85A 3A89A 3KGPA 5EPYA 1C2GA 2A45B 1C4V2 2EC9H 3DCLA 3BG8A 3RC6A 2M2AA 2ANYA 2V7QD 2ALVA 6LPRA 1Z8GA 1CQQA 1GCTC 1D3QB 1OYTH 4E05H 1MKWK 4FU7A 1L4DA 2ZP0H 3TNSA 1M9UA 1C5NH 1DE7H 2O8UA 1GMCG 2JJ2D 4XSKU 4GCHF 3M7UA 3U1JB 1Q3XA 3U8OH 1MCTA 1BJUA 2JH6D 1MH0A 3NKKA 3MNSA 2EI8A 5A09A 3LC3A 1GBBA 1K2I1 4YLQH 5BPEA 1ZTKA 1JIRA 3HATH 9LPRA 3P8FA 1KSNA 1AVXA 1WTHD 1XKBC 2IPHA 4DOQA 2V3MA 1YY3A 3SJIA 4CRBA 1P12E 1THRH 1RXPA 4UDWH 1KXDA 4ABAA 2DE9A 1GBCA 3QUMP 3T5FH 1A0LA 5FHTA 4AFZA 4B2AA 1S84A 3NPSA 1J9CH 1AU8A 1BT7A 3QTOH 1T8MA 1SQOA 1O3GA 2RDLA 1OKXA 2GZ7A 1W3CA 2RA0A 3E91A 3A8DA 2XBVA 3T29A 2BZAA 2PWXA 1SPJA 2OC0A 5FCRA 3VGCC 2JETC 1F7ZA 1LHGH 2PTCE 1SFQB 2BMGB 3GOVB 3A87A 3SBKA 1UTKA 5FPTA 3EGKH 1N8OB 1BQYA 4Y11E 4U30A 4NSYA 1TA6A 3KYGA 1CA0B 2EI6A 1C1QA 2NU0E 4CRAA 2QXIA 4JZFH 1TGCA 1FUJA 2H6MA 3O8BA 3F2HA 3EE7A 2V35A 4OS4A 1CVWH 1WQSA 2PTNA 2HRVA 2P3TB 1Z8JB 1V2LT 1JXPA 4DURA 5ESTE 4B74A 1O5CB 1O3CA 3VFEA 3M5OA 1KLIH 2FXRA 2OQ5A 2VH6A 1P2QA 1FAXA 2ZHQH 3PLBA 1TQ0B 4Y0YE 5GDSH 1ELTA 2BDCA 3WW7A 1WU1A 5B6OA 3MH6A 1O38A 4KTCA 5ESBA 2FYQA 1O5DH 2WV5A 1SOTA 4JK6A 1GI9B 2F43B 3WWBA 1TX6A 2I6SA 3T62A 1QTFA 4DIHH 4X1SU 2IOTA 3AW0A 3A84A 4GHQA 1O2MA 2J2UA 7KMEH 2FOHA 1TBRH 1QZ8A 1AY6H 1TAWA 2SNVA 2AS9A 4UONA 2BZ6H 1GDNA 1FIWA 2STBE 3HK3B 2W3IA 2GZ8A 1SMFE 3MH5A 4D8NA 1P2JA 3FOAA 1INCA 3GISB 4FETA 1GBDA 3SNEA 4HGCA 3QDZB 1C5QA 3F2FA 2ZHDA 3GY3A 1GHAF 1TFXA 5H4IB 1K21H 4MPWA 5B6LA 4PROA 2VVUA 2ZO3H 1QCPA 3JZ1B 1P2NA 4CHAC 1NY22 3FKSD 2HNTE 2VIVA 1YCPH 1FQ3A 3FZDA 1C5YB 1ZHPA 2KCOA 2RFKC 1BBRH 1G3BA 3EA8A 2YOLA 3A7VA 4ISIH 3PMBB 4MLFB 4YZUA 1K9OE 3BIVH 1DY8A 2VWOA 3K2UA 2D2DA 4NWLA 3M35A 4ABHA 2AGGX 1WTGH 1ANDA 3AASA 5FBEA 5HM2A 2C4FH 1GI1A 2VJ1A 1KXAA 3VB7A 1V6DA 1XUJA 3GICB 1AE5A 1CBWC 4NIVA 3UAIC 1BMMH 2BOKA 5HIZA 4Y8ZA 1UK3A 3KHVA 3TU7H 1KYNA 3OFND 5LH8A 3U9AH 1HXEH 5DP3A 1OXGA 2TRMA 1QB6A 3VB3A 4A6LA 3AAUA 1LVMA 2NU2E 2P3FH 3DA9B 3ZZ7A 3ATKA 2ZGXH 3BTKE 4QT8C 3MHWU 1VZQH 1C2MA 2CHAB 4O97A 4KTUA 1DDJA 5L2YH 4X8TH 2OQUA 1AHTH 1F92A 1BTXA 2FM2A 3UOPA 1BTUA 5C1XA 1N1LA 4K1TA 3TH3H 4Y76A 3UQOA 5EXMA 2FDAA 2I6QA 2GCHF 3GY6A 1OWIA 3GDVA 1HAVA 1AB9B 1C5SA 1G37A 2XWAA 4NIYA 2AIQA 3RC4A 2O9QA 1CGIE 1AB9C 1DM4B 2A2QH 3UB0A 3QGJA 1AI8H 4DVAU 2QF5A 3E0NB 2TGPZ 2O8WA 2PV9B 3STJA 1OWKA 2PGBB 2Z6BD 1DSUA 5DP6A 2UUKB 3U28C 1ELCA 3DHKH 3ZZ8A 2BLVA 2O8LA 4MNWA 3TJOA 2KX4A 2KAIB 3SU5A 3UUZA 1VCQA 1PQAA 3OE7D 3RU4E 1QQUA 2QV1A 2Y5GA 3UTUH 4WMDA 2AFQB 2H5CA 3IWMA 1XUGA 1FY5A 4MG3A 1VCWA 1Z6EA 5A8ZA 5LPEA 5EODA 3SNCA 2G81E 2BVRH 3D62A 1BTHH 1C5XB 1QFKH 3BN9A 4OS6A 1DXPA 3SZNA 3TH2H 3E3TA 2NU1E 1K1IA 3N99A 3GCHB 1SI5H 1TPPA 2XWBI 1S0QA 5HMAA 1DX5M 1PQ7A 3LDXH 3P17H 4A5TS 1TQ7B 2V3HH 3A7XA 3F2GA 1RIWB 2QN5T 3PO1B 4IBLH 2RCEA 2H9TH 3PRDA 3SV6A 2BVSH 1Y59T 4TPYA 4NZLA 1O2XA 2B5TB 1EXFA 3BEIB 1ZLRA 3UFAA 3SU4A 1E1QD 3ZV8A 1KMHB 1QL9A 1GGDB 2ZFQH 3AK5A 1L0ZA 1GGDC 5EQSA 1BMNH 3SNAA 1FZZA 2ZDNA 5A8YA 1G2MA 1H8ED 2WV4A 1Z1IA 1H9LB 1UJ1A 2Q6GA 3NUMA 1C1WH 1K28D 2HVYB 1YM0A 3SGAE 1EAXA 2P95A 1P0SH 1SC8U 1GBAA 3OTPA 2XC0A 2VIQA 2FX6A 2BD5A 1NFUA 4ZKOU 3F68H 1XUKA 2W26A 4WWYA 1IQJA 1O33A 3BTDE 3W1EA 1HCGA 4A1VA 4DW2U 1A0HB 1UCYH 4CREA 1C5LH 2G52A 2BDYA 4JZ1A 1O3PB 1GHZA 1T8OA 1A2CH 4B1TA 2F9UA 2ODQA 2Z7FE 2BY7X 5ETXA 4RT1A 4Y7AA 2JKHA 2VGCB 3L3TA 1GJCB 2BLQA 3A8AA 4CRGA 3LGIA 1V2UT 4ACBA 1QNJA 2FOAA 1GMHF 2OC7A 1HB0B 2BY5X 5GNDA 3S7KB 2ZDKA 1QJ6B 2WYJA 2ZFFH 1K22H 3ZZAA 3ELAH 4JCNA 1O3JA 2AYWA 3Q76A 2C8ZB 5JB8S 1SQRA 1QRWA 5K0HA 3KIDU 3OSYA 2FMJA 2ANWA 1EZUC 4Y8XA 2SGFE 2ASUB 1FN6A 1FXYA 1CT2E 1C2EA 2A5IA 2B7DH 5EG4A 4GPGA 3KNXA 3F0PA 1E36B 2GGVB 3PV2A 3KQ5A 1BDAA 4JMYA 2ZFRH 1BB0B 2ZQ1A 1C5VA 4XOJA 5I25A 3SN8A 4X2YA 4ZHLU 1QB1A 5AVDA 3S9AA 3O8RA 1HAZB 2XBWA 2A0QB 4CH2B 2WYGA 2IN2A 4NFFA 3TITA 3PV4A 3DSGA 2G5NA 3SHCH 3MWIU 5E0HA 2A32A 1ABJH 1EZSC 2OP9A 2QAAA 3PMJA 1AKSA 5FAHA 4XDEA 4DIIH 1Z71A 3QK1A 1JRTA 2BHGA 1DS2E 1KXCA 1VGCB 4YOJA 1F5LA 1GJ8B 1RS0A 5KEDA 1E1RD 4SGAE 1SB1H 1VGCC 4NA8A 2FIRH 1EATA 1GMDF 1ZSJA 3SU1A 3DSPA 5DGJA 4GAWA 4X8SH 2GX4A 2Z9KA 3GY5A 3N7OA 2FX4A 1FY4A 1GJ9B 4E7NA 5EJZA 1PJPA 1E38B 1XX9A 1SGRE 1O3IA 4WXVA 1N6YA 2ALPA 1JWTA 1KXEA 2ZFTA 1MKXK 1O2IA 2FODA 2J9NA 3TK9A 4RKOB 3A7YA 1ZYOA 1O3OA 3Q00A 5HIYA 3KN2A 1C2FA 2IJOB 3D65E 1TPSA 2THFB 4IC5A 2VIPA 5FX5A 1GJDB 3SU3A 1TNIA 1GI8B 3QZRA 3EQ0H 3BTQE 1UVSH 3RU4T 1V2OT 1EASA 2VIWA 3U8TH 1W12U 3ZVDA 1N6XA 1AVWA 3U8RH 1MTVA 2BLOA 4HG6A 3D23A 1OWHA 1FPHH 6CHAC 3ZZDA 2J34A 1UHBA 1WXRA 2HPPH 1TGSZ 8GCHG 1BIOA 1ANBA 1QIXB 3H5CB 1NC6A 3RMMH 2BB4A 2XBYA 4K1EA 1TPOA 1SGFA 3MFJA 3VB6A 5T6FA 2FLBH 3FO8D 4VGCB 1K0HA 4Y8YA 5C17A 1Z8IB 4ZKRU 1J16A 1WBGB 1QB9A 1L4ZA 1V2VT 5F6MA 1O5EH 2QGRA 3G01A 2ZPRA 4H42U 4INKA 3SHAH 2TGTA 2VWLA 3BTME 3E6PH 1SQTA 1LTOA 4ZCNA 1SGPE 1O5AB 2ZDAH 1MTNB 2XW9A 4BAHB 1LVYA 4X1PU 1O5BB 1D6RA 4WXIA 1DWDH 2OINA 1A4WH 3KF2A 2WPKS 1HJAB 1SGNE 1Y5AT 1ZJKA 3ATMA 4YT6H 1GBIA 1NBMD 1RTKA 3VG8A 1O31A 1QRZA 1EJAA 2OCVB 2P93A 4MPXA 2VNTA 3F9GA 1X7AC 2Y82A 1TABE 4E06H 3C1KA 1DICA 1L2EA 5CHAB 3A80A 1DWCH 4GVUA 2C3SA 1RD3B 1DANH 1AVGH 2AMQA 3N7DA 1QURH 1SLVB 4U2WA 1AO5A 5HGGA 2JJ1D 4NIWA 1ZR0A 4NZQA 1HNEE 4AFUA 1MTUA 3PWCA 3A82A 3ZVEA 4CRFA 2FOEA 4NG9H 4HFPB 2H5DA 2A7HA 2ILNA 3F9FA 3TK5A 3FZZA 5GWZA 1MAXA 1P10A 1T8NA 1NFWA 3V3MA 1XUHA 4WMEA 1TGNA 5FL7D 1EP5A 5JDUB 2OUAA 1EPTB 2GZ9A 2XXLA 2ZTZA 3M5MA 3M3SA 4NA7A 5DP8A 1FONA 1V2ST 5DJ7A 1GHXH 1LPZB 1TNLA 4O3UA 1K1NA 2ZHFH 4LK4A 1YBWA 1THSH 1V2NT 2QF3A 2W7UA 3FN8A 3P8GA 1NRPH 2A1DB 1C4Y2 4ZKSU 4HI3A 3VB5A 1YPHC 3P6ZB 4MQAA 4X6OA 1C5ZB 1TPAE 3LGVA 1Y3WA 3TVJB 4YLUA 3ZYEA 4INHA 4B76A 1ZGIA 1SG8B 2DE8A 2ZGBH 5AHGH 1ETSH 1YPMH 1BOQA 1GHBF 1O36A 1MQ5A 4DGJA 1EQ9A 2BD2A 3R3GB 3RU4D 3ESTA 4WJG2 2KCPA 4I33A 1GJ6A 1PPFE 1GL0E 4Q7YA 3URCA 1HBTH 1PQ5A 3O8DA 3QTVH 1ZPZA 2XCNA 1ANEA 1A1RA 4OS1A 2F83A 1WOFA 1Z8RA 1DSTA 2PKSB 5FXLA 2QF0A 4XD7D 2EI7A 4X2XA 2PUQH 2VVCA 2BY9X 2CV3A 3L33A 3BIUH 4A1TA 1VITG 1ORFA 5EIYA 3F0OA 4K60A 1THPB 1SR5C 1UK2A 4FU9A 4XBBA 4IN2A 3H7OA 3E8LA 2BY6X 4H4FA 2Z9IA 4ABIA 1DFPA 3RUOA 2G5VA 1MD8A 2WPDD 4U01A 4YO9A 2BD9A 5TJXA 2C93B 1K1OA 7GCHG 1DT2A 1TRNA 3HKJB 2GDDA 4GHTA 5A0CA 2D1JA 2WUCA 5E0GA 5HM9A 1LMWB 2J5UA 4AB8A 1C5PA 1MZDA 1NS3A 2BXTH 4YOIA 1N8OC 4JK5A 3E16B 3M7TA 3UPEA 1HPGA 1UW7A 2PKAA 2G00A 1CA0C 1G9IE 1FJSA 4ZMAH 3UWJH 1BRUP 1H8DH 1HAXB 4K69A 1F0SA 1GCDA 2CJIA 2BD4A 3ATLA 1C2HA 3GCNA 1C5UA 5GCHF 3SOSA 2F9OA 2W6JD 1G3DA 3KYFA 2Q6DA 3OYPA 2ODPA 2Y7ZA 2KM0A 1TWXB 4CRCA 3ATWA 1GPZA 2GMTB 1TONA 1P2IA 2YMSB 3LGUA 1YP9A 1O35A 3UNSA 3RM2H 1SHYA 2YMSC 4I8KA 4FXGH
chains in the Genus database with same CATH topology
4AFSA 3LT3A 2QXHA 1IQNA 3ATIA 2GT7A 1C5MD 1IQHA 5F03A 2JH0D 3GYMA 4YESB 3DFLA 1Q31A 4KGAA 4BXWA 4WMFA 3LJOA 3SQHE 3Q3KA 1MTWA 2AGEX 1OOKB 1MZAA 3V7TA 1G30B 1EB2A 3MH4A 1P9UA 3RXRA 5DKMA 1F0TA 5TCAA 1O2LA 1DWBH 1UTOA 5PTPA 1QA0A 4Q7ZA 1XXDA 1TNJA 4RSPA 4ZXYH 4LOYH 1O37A 3RP2A 1GG6B 1LKBA 4BAMB 4J2YB 5L2ZH 5EXLA 2H9HA 2LNCA 1BTYA 3UIRA 1O2ZA 2B0FA 2VINA 3B23B 1K1LA 1TMBH 3A83A 3BTWE 3M36A 3TLOA 4CBNA 4X1QU 2G4TA 4FUHA 2A5AA 5T6GA 2XCFA 4AN7A 2TBSA 3OY5U 4UFGH 3LJJA 1SGFG 1BJVA 1HRTH 1LHDH 2QY0B 1UTJA 3SI4H 4BXSA 5A0AE 1B5GH 2CGAA 3KQBA 4IMQA 1QBOA 5C20A 4HTCH 3RMLH 1EZXC 2VVVA 3SU6A 1QHRB 4ABFA 4JZEH 1AGJA 1FIZA 1SGQE 1GDQA 4K1SA 2ZFPH 2FI4E 3K6YA 1C2KA 2GD4B 4GUXA 1BITA 1O3KA 2ZIQH 1P3CA 1P9SA 3GY8A 1LKAA 5A2MH 1ELGA 3FFGA 4YOGA 4FUBA 4JYTA 1O3HA 2FO9A 1L1NA 1P3EA 2CF8H 2OC1A 1KY9A 1IQGA 1CHOF 1IQEA 1T4UH 4I8HA 1PQ8A 4XE4A 2GTBA 3RXDA 3TGJE 2CHAC 3SUDA 2CMYA 4B2CA 4WVPE 3BG4B 2Y81A 3M5NA 4XFQA 3ZZBA 1QQ4A 3RXIA 3SV2H 1Z6JH 3SU2A 1Y3VA 2FWWA 2SGAA 4TWWA 3RXJA 1HAIH 1SGCA 5AFYH 2C8WB 2PFEA 5K7RA 4AYVB 3MH7A 2STAE 2ZU5A 4F4OC 3M3VA 3RLYH 2WPHS 1CHGA 1JBUH 1MBQA 1NZQH 1HDTH 1MU8B 2PHBA 1BTPA 3UR6A 1C1MA 2Y6TA 3EA9A 3ZVGA 1CE5A 1ESAA 5G4BA 1BBRE 1ELAA 4FUDA 1GJ4H 2A31A 1TB6H 3ZZ3A 3PTBA 4OGYA 1W0YH 3M37A 3F9HA 3S0NA 2GCTB 3HKIB 2F9BH 3QN7A 4NIXA 1WV7H 3SUEA 1ELFA 3ZVAA 1GBMA 2H1UA 1O34A 4X1RU 4ZROA 1LQEA 4ABBA 1WCZA 3GCHC 1C5OH 5EXNA 1AIXH 4TWYA 2PR3A 1AZ8A 1GI6A 3SV9A 2ZG0H 1WYKA 2UWPA 1QJ7B 2G51A 2J94A 5EGMA 1RIWC 3PO1C 3RMOH 1UVUH 1ZGVA 2GVFA 3LC5A 4A7IB 1RJXB 2BY8X 3NXPA 1O2GH 1P09A 2R0KA 1MBMA 5EPNA 1QA7A 1V2RT 4CR9A 3RXQA 1SQAA 1NRRH 2ZU3A 3DT0H 1S5SA 3MI4A 1NM6A 3NK8A 1BRAA 3MTYA 1TNKA 3RXGA 4ZHMU 6GCHG 5AFZH 4DCDA 3MOCA 1EOLA 1TX8A 4NFEA 4X0WU 2ZKSA 1TX7A 1EOJA 1AZZA 3W94A 1AD8H 3KQDA 1MTSA 5FX6A 1GJ7B 4X2WA 3TGKE 1QGFA 3K65B 5J4SA 1NRQH 4JZDH 4X8UH 1A7SA 1J8AA 2R2MB 2Q1JA 5JYIA 2ULLA 2VWNA 1YCPM 1W13U 2BQ7B 1UTPA 1ABIH 3LKWA 1BTZA 1NFYA 3QLPH 1BCUH 2VWMA 3SV8A 2KAIA 1UO6A 4MTBA 2VGCC 2BX4A 1AWFH 1O2VA 2D8WA 2SGDE 5T6DA 3PLPA 5C3NA 3F1SB 1O2SA 1P05A 1YLCA 1Y3XA 2Y80A 1P06A 2FOGA 2QIQA 4IN1A 1MAYA 3K6ZA 2H2ZA 1HFDA 3GCTG 4IC6A 1E0FD 3RXOA 1FN8A 1P11E 1UVOA 2GKVE 1FY1A 1CT0E 3ZZ9A 4ABEA 1MD7A 3T25A 1O2HA 1ELDE 1W8BH 1FI8A 1DITH 3MNBA 2CXVA 1SVPA 4ZXXH 3GYLB 1KTSB 1MKWH 3OX7U 1C5WB 4UE7H 4Y7BA 1A5IA 2ZTXA 3A8BA 3FP8E 1NN6A 4KELA 3V0XA 1EJNA 2Z9JA 1IAUA 2BYAX 3P8OA 2HNTF 1ZPBA 2Z3DA 2ZFSA 3F9EA 2VIDA 1C2DA 3RLWH 2ZECA 5J4QA 1FNIA 5JPMH 2BDAA 3SI3H 2F9PA 1YCPK 2QA9E 1CT4E 2B8OH 1ELEE 1PPBH 4AYYB 5C1UA 3PM3A 9ESTA 1O3DA 1GHBG 1KLTA 1UCYE 1IQKA 1W10U 1WAYB 3SNBA 1QBNA 4Y79A 1SGYE 1Y8TA 1F2SE 3S9CA 1VJ9U 3SQEE 1QL7A 1SSXA 1PPHE 1TNGA 1LO6A 1JRSA 1UTMA 4YT7H 4UFDH 1GI7B 1EAWA 2K1QA 1BUIA 4GCHG 5DPAA 1V2TT 2FLRH 4JYUH 1OSSA 3M61U 1JIMA 2HNTC 1J15A 2R9PA 1C1PA 1GBLA 1O2YA 1UVTH 1IQMA 4HZHA 3RXCA 2F9NA 1SLWB 2A7CA 4O9VA 1NT1A 3RXPA 1ID5H 3CP7A 3EA7A 3FP6E 4NGAH 1UK4A 2OLGA 3RXUA 3A86A 3MU1A 1YPEH 1JOUB 2EA3A 1O3BA 1A61H 1T4VH 1ZSLA 2ZU1A 3PTNA 3MU5A 1TMUH 2HLCA 1O2JA 3ZZ4A 3K9XB 4DJZB 2M5TA 2BQWB 5DP5A 3MO3A 4FUIA 4DY7B 1ZOMA 3BTFE 3BTGE 2A4OA 3PWBA 3M3TA 1ZHRA 3KEEA 1HJ8A 3ZYDA 2PLXA 1NROH 2GV7A 1C1RA 2PUXB 4CBOA 2P3UB 2BDGA 1TMTH 4ABGA 4TY6A 1D3DB 2XRCA 1GBEA 3TPIZ 5E2PA 2OC8A 3S9BA 5JBCS 4AZ2B 3SORA 1XXFA 1HAGE 3L6PA 1Y5UT 5AF9H 8LPRA 4VGCC 1NFXA 5T3HA 4I7YH 1GJBB 5A8XA 1IOEA 2ZU4A 4FUFA 3SW2B 1O3EA 5DG6A 5E8EH 1DY9A 1V2PT 3QWCH 3EYDA 1LVOA 1O2OA 2BDIA 4U32A 2ZU2A 3A7TA 1MTNC 4BANB 2Z3CA 1AFEH 4KKDA 2ZNKH 4XBCA 2AERH 3A8CA 1YGCH 2ZWLH 2BDHA 4ISLA 1NU7B 1T31A 5E0JA 5FCKA 1GHVH 1HJAC 1BHXB 4E7RG 4M7GA 1WSSH 2FPZA 4MDSA 2Z3EA 3PLKA 1HGTH 3LGWA 1O39A 2AEIH 1GVLA 2A5KA 4MNYA 1KDQA 5GIBA 4AG1A 4AG2A 2J38A 5CHAC 2FEQH 3T2NA 2F3CE 4CH8B 5HXFA 2F9VA 2P59A 4ZH8A 1YLDA 2P8OB 1LHEH 1O3AA 1XMNB 1PYTD 4Z6AH 2BQ6B 3HPTB 2BD3A 3SJ9A 1O0DH 1GHAG 3M5LA 1ESBA 1SLXB 2ZPSA 4RN6A 3TJVA 3LH3A 4K8YA 4ZUHA 3KCGH 3QGNB 1QJ1B 5F8ZA 5F8TA 2FOFA 1K1MA 1NPMA 1EPTC 4B71A 3SGQE 1K1JA 1E35B 2ANKH 2V6NA 4MPUA 1UCYK 2ZQ2A 3QO6A 2TIOA 4WF8A 1YPJH 5DP7A 2ZI2H 4B2BA 1W7XH 3EAJA 1AFQB 2EEKA 1P2KA 1AFQC 2NU3E 2FI3E 3H7TA 3Q3YA 4AGJA 2UUYA 4RKJB 2ZDVH 4Q80A 1O3NA 1G2LA 1TOCB 1P8VC 3W95A 1HUTH 1D9IA 5C5OA 1D3TB 2G8TA 1ZMJA 1GJAB 1C2LA 1NO9H 2FS9A 4R0IA 4AX9H 1SBWA 5GXPA 1XKAC 3UWIA 1W2KH 2HOBA 1GCTB 2YNAA 4MNXA 1RTLA 2ZA5A 1CHOG 1LQDB 1AUTC 2PKSC 1WQVH 3ZZ6A 1HAPH 4WH6A 1RGQA 4B73A 5EW1H 1VCPA 1DPOA 1KXBA 1ZMNA 4KP0A 3UREA 2GCHG 1ZMLA 1MCVA 1TRYA 1Y3YA 3ZZ5A 4XBDA 1D6WA 3MNCA 1SFIA 3RM0H 2SFAA 3BV9B 4TPIZ 1BMAA 3JZ2B 1DWEH 2HGTH 1IQFA 3KL6A 3TIUA 1AQ7A 4LZ4B 1ZHMA 1OP0A 2A4RA 2A7JA 1VJAU 4A92A 3P70B 1OX1A 4ZKNU 8KME2 1TGBA 5CE1A 1HIAA 1LDTT 4JZIA 4AORA 1EPTA 2R2WU 2GDEH 1DLKB 5CMXH 2PSYA 1GWAA 1GBKA 2BLWA 3TGIE 2ZHEH 1TYNA 2JETB 3VGCB 1OWDA 5BRRE 1OPHB 3SJ8A 2XNIA 1GBTA 4X1NU 4DT7B 1C2IA 3CS0A 3CENA 3I29A 1S83A 1CSOE 1S0RA 4Y0ZE 3RXTA 2OTVA 1O2QA 2C8XB 2ZCKP 4X8VH 2J92A 3R0FA 8GCHF 1IHTH 4NSVA 2NWNA 3O8CA 4GSOA 2BTCE 1QBVH 1V2QT 1YPKH 1F0UA 2A4GA 1H9IE 2PSXA 1GI4A 2P16A 1EAIA 1LCYA 2AMPA 2ZGCA 4I8JA 1YKTA 2GMTC 3HK6B 2GT8A 3UQVA 1L1JA 1UTLM 1GI3A 2ZC9H 1C1NA 2FI5E 2WINI 1C1OA 3VXEH 5FPSA 2UWOA 5FPYA 2Y5FA 1QL8A 5I46H 2QXJA 1O5GH 1NU9A 1A3EH 3RXHA 1BRCE 3Q77A 4BOHA 4K5ZA 2ZHWH 1KTTB 1S82A 1L1GA 2FYRA 3GY7A 1HAHH 1K1PA 4Y71A 1PPEE 4AGKA 5IDKA 2G4UA 4ZAEA 4BTIB 3DD2H 4UEHH 2VIOA 3LOXA 3RXAA 3RXVA 1EZQA 3IG6B 2RG3A 1GG6C 1GBFA 2J95A 1W7GH 1O2WA 2DUCA 2CF9H 1HYLA 3LH1A 1HAVB 4JYVH 2BOHB 5FBIA 1V2MT 1A3BH 1DUEA 1O3LA 4J1YA 5JBTA 1NTPA 1ARCA 5EW2H 1G3CA 1ARBA 3PYHA 1GMHG 1TE0A 1CGHA 5EU8A 1ANCA 1SHHB 5DO4H 1E34B 1ESTA 4D76A 4BAKB 1Q2WA 2CN0H 7ESTE 4D9QA 4CHAB 1C9PA 1O30A 5LPRA 1C1UH 2W5EA 5A0BA 1T32A 1YPLH 1C1VH 1UTQA 2ZF0H 1FPCH 4Z0KA 3EE0B 3TK6A 2PW8H 3BTHE 3TH4H 1J17T 3I77A 3GY4A 4SGBE 3UY9A 3UNQA 2XC5A 3PMAB 3VPKA 1P2MA 3MO6A 2ZDMA 3FANA 1DVAH 3SUGA 4ASHA 4MPVA 2OXSA 2ZPQA 2Y7XA 4CRDA 1GI5A 2FESH 1NRSH 2BDBA 3D49H 1AUJA 3PROA 1CBWB 1TLDA 2B9LA 1DXWA 4FU8A 3U1IB 1SGIB 1P01A 1A46H 2AH4X 1FAKH 1MKXH 2ZGJA 4LZ1H 2QXGA 1G36A 1QR3E 3LGYA 4NWKA 1GMCF 1YF4A 1MU6B 4I32A 4X2VA 1AE8H 1H4WA 3BG4C 3LGTA 3DFJA 3ZVBA 1T8LA 1Y5BT 2HWLB 1YYY1 1TOMH 2WPJS 1EKBB 5JBAS 1DLEA 1S81A 1ACBE 1TRMA 4UD9H 2Z9GA 2WPMS 1AWHB 1LHCH 1GMDG 4ESTE 2QC2A 3P92A 3ZZCA 4THNH 3Q3XA 5IYTA 2OD3B 1VITF 2WPIS 1TNHA 1H1BA 2FOCA 3PMHB 4Y6DA 1QY6A 3SO3A 2J4IA 3P8NA 1EJMA 2SNWA 4INLA 1W14U 2R3UA 5DP4A 2BVXH 3SGBE 4AFQA 1YC0A 3UR9A 4WH8A 3MU0A 1BZXE 3SU0A 3ZVFA 3GCOA 2XYAA 3NCLA 3P95A 2OBOA 1MMJN 2WPLS 7GCHF 1ELBA 3MU4A 2D26C 2GCTC 3PB1E 2LPRA 2W3KA 3T27A 1HLTH 5E2OA 1HAYB 2ZZUH 3AW1A 1OWJA 2HALA 2ZGHA 2TGAA 3ITIA 1S6HA 4K2YA 1B0FA 1CU1A 1HAOH 1KIGH 1SGTA 1C5RA 1LHFH 3QZQA 3RC5A 1ZZZA 1BTWA 2RA3A 1BRBE 3LPRA 4GLYA 2BD8A 2XTTB 1AN1E 4YTAA 3U69H 1HXFH 1CA8B 1F5RA 1J14A 1KXFA 3NWUA 1OP8A 5GJ4B 1EAUA 1ELVA 1SGDE 1C2JA 3V12A 1LVBA 1V2KT 5GPIB 1W0ZU 4MVNA 2PGQB 3OY6U 4R8TB 3GY2A 1KLJH 4H6TA 1YPHE 1B7XB 1D3PB 1SL3A 1FY3A 2SGPE 2Y5HA 4CR5A 1SOZA 1IHSH 1CGJE 2OBQA 1AKSB 1F5KU 1O5FH 1TBQH 4FVDA 3U98H 4IW4E 1YPGH 4UFFH 3V13A 1ZRKA 2QYIA 3RMNH 3ODFA 1DOJA 4D7GA 1CO7E 3ZVCA 2C90B 2R3YA 1GJ5H 1B0EA 2JH5D 3EDXB 1EB1H 4BAOB 2XC4A 4TYDA 5DK1A 4AOQA 2VB0A 1GHWH 3MYWA 3FVFB 3BEFB 4I31A 1GBHA 2A4QA 5HYOA 1UMAH 1G3EA 4IGDA 3NZIA 2VH0A 1V2JT 5JBBS 1JMOH 3URDA 5L30H 1H9HE 5C1YA 2FTMA 1HJ9A 1WUNH 5EQQA 4X6NA 1O32A 1S85A 1GI2A 2O8MA 1UTNA 3MO9A 2QCYA 4FUGA 3RXSA 3SJOA 3SNDA 4BAQB 4NA9H 4I8LA 2ODYB 4X6MA 3A88A 3MNXA 1P04A 1C4U2 3HGNA 1T7CA 3DUXH 5SGAE 2V0BA 1RTFB 4OS7A 2ZCLP 3RXFA 4AB9A 1ZSKA 1ZTLA 2C8YB 1P57B 3T26A 4TY7A 1ZJDA 3AVZA 2BXUH 2FP7B 1UHBB 3TNTA 3GDUA 4OGXA 3ENSB 2P94A 4LXBH 3HGPA 1C5TA 3E0PB 1OP2A 4D9RA 2ZTYA 1BBRK 1P2OA 3TJNA 3RXBA 1FLEE 1C1TA 2GV6A 1E37B 4FUCA 1EX3A 5JB9S 1LPKB 2TPIZ 3AAVA 2XBXA 1TGTA 6ESTA 1ETRH 4K3JA 3RDZA 1FY8E 1H8IH 4KTSA 1GVZA 5C67A 3SV7A 1O2UA 1O3MA 3CS7A 2SGEE 8ESTE