3TGKE

Trypsinogen mutant d194n and deletion of ile 16-val 17 complexed with bovine pancreatic trypsin inhibitor (bpti)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
222
structure length
217
Chain Sequence
KGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGNSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/ hydrolase inhibitor
molecule keywords TRYPSIN II, ANIONIC
publication title The energetic cost of induced fit catalysis: Crystal structures of trypsinogen mutants with enhanced activity and inhibitor affinity.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 53
structure length 217
sequence length 222
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1998-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3tgkE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3tgkE02
3M7QA 1TRYA 2FIRH 4BAQB 1HV7A 1G36A 4BAMB 1SQAA 3H5CB 4AGJA 2QXHA 3DFLA 5GWZA 1DFPA 4TWWA 3UWIA 4MNYA 1O2HA 1P9UA 2A5IA 2FI5E 3U8OH 5C3NA 1O2QA 1OKXA 3TGKE 1O2XA 2O8WA 1K22H 2FOAA 5AFYH 3SGQE 3Q76A 1BRCE 1ELBA 3QTOH 3ATWA 1O5FH 1ZOMA 2H5DA 1UK2A 3U1JB 2A2QH 1ZZZA 3S0NA 1OWDA 1C5NH 2A4RA 3O8CA 2PSXA 2JH6D 1ZYOA 1FAKH 2I6SA 1ZJKA 4IW4E 3V3MA 2J94A 1PYTC 4CRGA 1P2JA 1GJCB 4IC6A 2XYAA 1AKSA 1MTUA 1GHZA 1SLVB 2A7JA 2BD3A 2ZC9H 1B5GH 4Y10E 2ANMH 5EPYA 2TRMA 2SGPE 1G9IE 5EPNA 3TH3H 1RIWC 3SJ9A 3VB4A 2P59A 1SLWB 1QHRB 2SGFE 2WINI 1HUTH 2GCHF 2GZ7A 5F6MA 1AVXA 1AY6H 4ZXYH 1T8NA 3UUZA 1ELFA 5EQRA 1L0ZA 1TRMA 2ULLA 3RU4D 2AIQA 5L30H 1QL9A 4B2CA 1SGYE 1V2RT 1FXYA 2C93B 1FAXA 1WU1A 4OS6A 5JBBS 1LHEH 2FX4A 1TX7A 3A7TA 1AB9C 1D9IA 1O3DA 2QY0B 1ETTH 2HALA 4M7GA 3MNXA 2VWMA 1O2MA 4KTUA 1A61H 2FWWA 2R2WU 2ZO3H 4I31A 3A7VA 3QGNB 1F5KU 1SGQE 2NU2E 1CA0C 1O3GA 1PPCE 1U6QA 3QK1A 4B1TA 1FV9A 4OS2A 1AI8H 3F1SB 1H8DH 3ZZBA 4Q7XA 1W7XH 2AEIH 3TGIE 4D9RA 2RDLA 3A81A 1KXAA 4JK6A 1MZDA 1YBWA 1RIWB 1OWHA 1O2NA 3KHVA 1Z8IB 2Q6DA 3M37A 2NU4E 1N6XA 1T8MA 1P01A 4Y79A 1AWFH 1JWTA 2G52A 2XBVA 2Z9LA 5FXLA 1PPGE 3FANA 2UUYA 1E34B 1BZXE 2F9NA 2FOFA 1IQGA 2ZTYA 1YKTA 7LPRA 4K1SA 1TFXA 4WWYA 2EC9H 1HAOH 1FY4A 1XKAC 1F0UA 3ATKA 2OTVA 3CS0A 4HGCA 4Y6DA 1P11E 2W26A 1AB9B 1GI0A 4A1XA 1GBTA 4IC5A 1DE7H 2SGQE 4ZAEA 1TAWA 4ZHLU 1T8OA 2CN0H 2Q1JA 3SGAE 2ZGCA 2FEQH 2XCNA 1TGNA 2XWAA 1CA0B 2ZFRH 2Y81A 2B9LA 2OQ5A 1TE0A 1LVOA 1ZTKA 3ATMA 1QJ1B 5EW1H 5A0CA 4NA9H 3UQVA 2A4GA 1EPTC 4FUBA 5JBTA 3RXLA 3SV7A 5BPEA 4JZEH 1SGRE 1UTJA 1O2ZA 1C5PA 2GMTB 2W7UA 1IAUA 3BV9B 2OBOA 2PLXA 1Z8GA 1WCZA 1TX6A 2OXSA 3OY5U 4OGYA 3ZVDA 2Z9JA 3E0NB 3MNSA 4FVDA 1GMDG 2AGEX 5LGOA 5JB8S 3TJNA 1EAXA 3BF6H 1O36A 1VCWA 1IQMA 3E0PB 5L6NH 1DM4B 2PHBA 2STBE 4DURA 1GHXH 2BTCE 4MLFB 1O3CA 2ZCKP 3MWIU 3GYMA 1QR3E 1O3EA 1DWBH 1SVPA 5E0HA 4BOHA 4U2WA 2Y80A 3VFEA 1AZZA 4X1SU 1C1WH 8GCHF 4SGBE 5AHGH 1YLCA 2FOMB 2VIPA 4FUDA 1Y59T 2K1QA 1Y3XA 3RXSA 3TGJE 1ESTA 1O2SA 4B2BA 3OY6U 1EUFA 1O3OA 1FIZA 1RTKA 4ABFA 1NC6A 1YCPK 2HPPH 1OP0A 2DUCA 5AF9H 1EAIA 2RCEA 5FPTA 5DP9A 1PYTD 3Q00A 4MPVA 3SW2B 1HIAB 1MAYA 5HM2A 1QQUA 2AMDA 2F3CE 1NO9H 1HCGA 2EA3A 1Z1IA 6GCHG 2IN2A 1K1LA 3RXOA 4E05H 2ZDAH 3LOXA 3ZVFA 1DANH 2W3KA 4MTBA 5GJ4B 4NZLA 3P8OA 1B7XB 4BANB 5TJXA 3P8FA 4I8KA 2XNIA 1QJ6B 5SGAE 1OWIA 2AMQA 1KYNA 1EPTA 1NFWA 1GHAF 4X1RU 4Z6AH 2JH0D 4NCYA 1ABIH 3U1IB 2FOEA 1CHOG 1NRPH 3DHKH 2A45B 1GVLA 1BJVA 3LH3A 1HIAA 4BXSA 3TH2H 1H9IE 7ESTE 2J4IA 1B0FA 3A84A 2O9QA 3E16B 3RXIA 1J15A 1S6HA 1UVPA 3K6YA 1GJ7B 4UEHH 1C1UH 2JH5D 4BTIB 1TX8A 4ISLA 1O3KA 2FESH 4A1TA 2VH6A 3S7HB 3UOUA 1V2TT 3B9FH 3PM3A 1C1NA 4X2XA 1P3EA 3GY3A 3SU2A 3HATH 2ILNA 1G2LA 4JYTA 3SQEE 2GT8A 4MPWA 4Y8YA 2ZNKH 1CGIE 1TONA 2PFEA 3VEQB 2BY8X 3LC5A 1IQNA 2B0FA 1V2WT 3ZVAA 1PPHE 3DFJA 1RTLA 2HNTE 1EXFA 3URDA 3UTUH 1XUGA 4DT7B 1AUTC 1PPBH 3I77A 1GBKA 1C4Y2 2GZ9A 1TNKA 5JBCS 1F5LA 2AS9A 3SU3A 4D8NA 1GI5A 1MTSA 4GVUA 3TK6A 1UCYH 1KDQB 3PLBA 3A82A 1TYNA 4OS5A 1AVWA 1G2MA 5FPSA 3GCTF 1QA7A 1WUNH 1L4DA 4GCHF 3MO6A 1G32B 4YZUA 3M5OA 3QLPH 1VCQA 3ATLA 4J1YA 3H7OA 2ODYB 1BHXB 3ZV8A 4OS4A 1J9CH 3T27A 5A0BA 2O8LA 1ZSJA 1O2WA 1D3DB 1TLDA 2PGQB 4K8BA 4O97A 4ZKRU 2CHAC 3TK9A 1HAPH 1C2DA 3OYPA 1OXGA 5C5NA 3P70B 1QL8A 1TNHA 3NCLA 1GG6C 1GBEA 3LGYA 1GBFA 1ZPBA 4K69A 1ANBA 4CREA 1TGCA 2G51A 1O2TA 2VIDA 3GISB 1TNJA 4XE4A 2BZAA 1GI4A 2ZDLA 1SPJA 4WMEA 1LTOA 3LKWA 3NK8A 4X2WA 5T6GA 2P16A 1TBQH 2QXGA 2P3UB 1ZHPA 1ARBA 5JBAS 2FOGA 1GBHA 2ZHWH 4YM9A 1BJUA 4XOJA 2W7SA 4ZXXH 1CVWH 4DIHH 1HJ8A 1TIOA 3SUDA 3PROA 2BD4A 3EA9A 1MU6B 1IQIA 1GI6A 2PKSC 1DSUA 1XM1A 4IGDA 1TOCB 1P9SA 2BVSH 3VB3A 1C5WB 1TPSA 1QB1A 3LC3A 3T5FH 5GPIB 8ESTE 1MKWH 2BLWA 4I32A 2W5EA 2H5CA 4IBLH 1C5ZB 1C2MA 1HLTH 3QDZB 2CHAB 5FCRA 2ZHQH 3A88A 5DP6A 2B5TB 1DXPA 1TMBH 2ZU1A 4B2AA 5FX6A 2ZA5A 1K28D 1GG6B 3BTKE 5GXPA 3RXUA 1S81A 1SB1H 1Q2WA 2BZ6H 3GYLB 2BVRH 2NU3E 4D76A 1BCUH 4D7GA 2H9TH 2VGCC 2TBSA 1V2QT 2FTMA 1FQ3A 2F9BH 5CMXH 2BD8A 4MVNA 4H6SB 5CHAC 1Y3VA 1GHYH 4CH2B 3HK3B 1C5SA 2C8ZB 3PMHB 5FX5A 3RXJA 3RXBA 2ZHEH 2CMYA 1AGJA 2UUFB 5HGGA 3SNAA 1EB2A 1W0YH 3RM0H 2PUXB 1O2LA 1ELVA 3RXCA 3OX7U 1HJ9A 2ZDKA 1NRNH 1SOTA 2R3YA 1K2I1 3BEUA 2FM2A 2V3HH 2BOHB 1C5QA 2FX6A 1LVYA 1ZSKA 2PKSB 3UNSA 1PPEE 2DE9A 2OQUA 3M36A 1UTQA 2BM2A 3GY5A 3SJKA 4YLQH 5EG4A 1PQAA 3M5LA 1GJBB 4JCNA 1GBDA 7GCHG 1E38B 4QT8C 1BDAA 1GJAB 3TJVA 2O8MA 3ATIA 1MQ6A 3MU4A 2VWOA 3STJA 5E8EH 1C4U2 1YYY1 2QXIA 1MKXH 4MDSA 1C2HA 3A8DA 1ZLRA 2ZGXH 3BG8A 4K2YA 3BIVH 3ZZDA 3RMLH 1BTYA 1HRTH 1TPAE 4X6MA 1TQ0B 2QCYA 2VGCB 3FVFB 1SR5C 3GCHC 5C5OA 3SU4A 1S83A 4Q7ZA 5CHAB 6CHAC 2VJ1A 4ZROA 4X8TH 4K1TA 4FUCA 2KAIB 3I78A 2VWLA 1MTVA 1RS0A 1P2MA 1RD3B 3TK5A 2FOBA 2OBQA 3B8JA 5FHTA 4D7FA 1QBOA 1UTPA 1O2IA 1AFEH 1D6RA 2BD9A 1P57B 1EZXC 3PWBA 3RXQA 1P3CA 3KNXA 4TY6A 1C1OA 3MH4A 4AX9H 4KGAA 2P3TB 1HB0B 1O2VA 2BQ6B 1QB9A 1ID5H 1YP9A 2HGTH 4OGXA 5ETXA 1RFNA 1GHBF 1C5LH 2XC0A 2Y6TA 1O5CB 3LDXH 4VGCC 1MCVA 3VGCB 1QTFA 3AAUA 2ZU3A 1YPEH 4ZKSU 1F0RA 1O2RA 5EODA 4CH8B 8LPRA 2G00A 1PJPA 5A8YA 2FPZA 3F6UH 2BDGA 4RKOB 3SN8A 1S82A 3LIWA 3RUOA 2SGDE 1IOEA 2V6NA 4DW2U 3SNCA 1UVSH 3ZYDA 2BDYA 2HNTC 2NU0E 3U8TH 3GCHB 1KXBA 4Y8XA 1PQ8A 2PTCE 6CHAB 4YESB 2WPLS 1NY22 4GPGA 2Z3EA 3HKJB 1A0JA 2HWLB 5C1UA 2GZ8A 1QB6A 1TB6H 2GV6A 2Z9KA 4NGAH 1LQDB 1IQHA 1C2GA 1AWHB 2PKAB 4DY7B 2D1JA 2BX4A 1YCPM 4RKJB 4VGCB 3VB5A 2Z94A 1FY3A 2G5VA 1A5IA 1C5TA 3NKKA 1O3NA 1QCPA 3A83A 1F92A 2QC2A 4ISIH 1EX3A 1GCTC 1THRH 1TGTA 2FI4E 2NWNA 2FS9A 1Y3WA 3A8CA 6LPRA 1JRTA 1L2EA 5JPMH 3RXRA 2GKVE 5DJ7A 2Q6GA 3RXGA 4K5ZA 2F9VA 3MO3A 1BUIA 2BXTH 4X1QU 2JETC 4WMFA 4NIVA 2GCTC 5EXMA 3TJOA 2I6QA 3SJIA 4B74A 2Z9GA 2GCHG 4ISNA 1SFQB 1P2QA 1KSNA 1G37A 1NESE 9ESTA 2CJIA 1LMWB 1S5SA 3IG6B 2ZZUH 4D9QA 1SGFG 1FLEE 3PMAB 1IQJA 2C3SA 3KGPA 1BIOA 1CHGA 2QA9E 4UONA 3SHCH 1AZ8A 3PWCA 3HK6B 3ODFA 3LGUA 4KKDA 1GDQA 4DOQA 1VCPA 2BD2A 1RXPA 2WUCA 2XWBI 3F9FA 3PO1B 3MH5A 2R3UA 2Q6FA 1GCTB 2TIOA 3UNQA 4HZHA 3EQ0H 1UJ1A 3BIUH 4K8YA 1P0SH 1S0QA 1BA8B 5T6FA 3T2NA 3KQEA 2C4FH 1TALA 3MU5A 2SFAA 1UTOA 2VIWA 1BT7A 5FCKA 1ZRBA 1J17T 3ZZ7A 2BLVA 5ESTE 2XBYA 1AO5A 1SMFE 3ESTA 1HAGE 2FZZA 1TMUH 2JETB 1SGIB 2GCTB 3K6ZA 3P8GA 3IWMA 1BRBE 1UTNA 1ZHMA 5EOKA 4CRBA 1BBRE 3FP8E 2GMTC 2GGVB 3RMMH 1E37B 4AG1A 4AORA 3A7ZA 5DP7A 5PTPA 3RDZA 1TPPA 3GCNA 4R0IA 4E7RG 1TA2A 2OUAA 1V2OT 4DJZB 1WOFA 4I8HA 3QZRA 2BXUH 4O9VA 1T7CA 1KXCA 1ZGVA 1LPZB 1P2IA 4Z0KA 2BD5A 2GTBA 1HBTH 1QRZA 1CA8B 2CXVA 1TRNA 5DG6A 2P3FH 1HAXB 1C2FA 2BDHA 1VR1H 1C1SA 4H42U 4YTAA 2TGTA 2BY6X 1GDNA 1DS2E 1AVGH 1HXFH 2AMPA 2QIQA 5J4QA 2P94A 5EQQA 1SHHB 3TPIZ 2B7DH 1RJXB 4OS7A 1FNIA 1NU7B 2QV1A 3FZZA 3L33A 4U01A 3I29A 2ZDNA 2SGAA 4J2YB 5FPYA 1P09A 1Z6EA 3NWUA 1TBRH 2VVUA 4CRFA 4WJG2 5A2MH 1FZZA 4UE7H 1ZGIA 5EGMA 1EAUA 3SBKA 3LJJA 3CP7A 3RXAA 3T29A 2ZQ1A 4JK5A 2TGDA 3OU0A 2OD3B 5JYIA 3SUGA 2C8YB 1O2UA 1GBIA 1O2PA 1UTLM 1YPJH 1O0DH 3UR9A 1MH0A 1BBRH 5K0HA 3SV8A 2EI8A 1N1LA 1F7ZA 2F83A 2ZFPH 4E7NA 1PPFE 1OWEA 5A09A 2Z9IA 1XUJA 3RMOH 1GI9B 1ZTJA 5GDSH 8GCHG 1E35B 2GVFA 2QF3A 1LHCH 3SORA 1QRXA 1G3CA 4PROA 3K2UA 4FUJA 1DLKB 1ELTA 2WPMS 5BRRE 3STIA 4NWLA 1GVKB 1C4V2 2XW9A 3LGWA 2Y7XA 5AVDA 3BN9A 1K1PA 4XBDA 1W0ZU 1GJDB 2ZFFH 4R8TB 1VJ9U 3BTWE 4DGJA 1FPHH 1O3AA 2FOCA 2ZHFH 1NM6A 2BLOA 2WUBA 3DD2H 1W8BH 1EB1H 1NTPA 3LH1A 1O31A 1A0HB 3D23A 1D3PB 2M5TA 2BY7X 3A89A 2FS8A 1DWDH 1DXWA 1TPOA 3LPRA 2BY9X 3LONA 1MTWA 1LPKB 3GDVA 3Q77A 4WVPE 5C67A 1Q31A 2OCVB 3C27B 3ENSB 1SG8B 1OYQA 3SGBE 1MU8B 3PLKA 1GMCG 2ZG0H 4CHAC 3E6PH 4AOQA 1BTUA 2H2ZA 1TABE 2VIVA 1GHAG 3RMNH 2G8TA 5IYTA 1AIXH 2R0LA 1Y5AT 3M5MA 1ZRKA 4ISHH 4KTCA 1C1PA 5T3HA 3CENA 4O3TA 4U32A 1UCYE 2OP9A 1UVUH 3SHAH 2WV5A 3EA7A 1NRQH 1O5BB 1WQVH 1D6WA 1UK3A 4JMYA 1OSSA 4TY7A 1OWKA 1NRRH 3BEIB 3MU8A 4K1EA 2FYQA 1FJSA 5EU8A 1O37A 2H9EH 1P2KA 1P2NA 3MU1A 4WH6A 2J9NA 4IMZA 4BTTB 1WTHD 3SNEA 1EP6A 5E0GA 1J8AA 1V2LT 3ZZ8A 2BQWB 2XC5A 4IS5A 4Q7YA 1KY9A 3LGTA 3D65E 1XVOA 1FMGA 1FONA 3U69H 3TNTA 4CHAB 1A3BH 1DICA 2A1DB 2AIPA 4X2YA 1QFKH 1GJ6A 4Y8ZA 5DO4H 1O2OA 1OP8A 2ZFTA 5IDKA 1SBWA 4OS1A 3SUEA 3K9XB 1VITF 3KCGH 1K1OA 4LZ4B 3FP7E 1GPZA 2PWXA 4NA7A 1XX9A 1GL0E 1E0FD 4A5TS 3RLYH 1JRSA 3M7TA 3NPSA 1O33A 1TBZH 1MBQA 1ZJDA 2BDIA 5LH8A 6ESTA 2D8WA 3H7TA 1SL3A 4BAHB 4X6OA 1GI3A 1INCA 1KTSB 1W3CA 1YPKH 3A8AA 2H6MA 1EJMA 1S6FA 1W11U 2V0BA 1O35A 1GI7B 1DWEH 1UO6A 1P2OA 4WY3A 4ABAA 2H9HA 1GMHF 1UHBB 4RN6A 4ASHA 5E0JA 1S84A 4KTSA 4DG4A 4SGAE 4JZ1A 1LHFH 1KDQA 1XUIA 1ZHRA 3URCA 2PTNA 2ANWA 1H9LB 1EOLA 1C5UA 2P95A 1W13U 4X1PU 1L1JA 1HNEE 3E8LA 1CT0E 3DUXH 1ETRH 3GOVB 4AYYB 2IPHA 1FN6A 1E36B 1TWXB 4WXVA 2Z6BD 2AH4X 4I8JA 1C2JA 1C5RA 1FI8A 1KLIH 2VVVA 1JMOH 1BOQA 2EI7A 3W94A 4CBOA 2OINA 2PGBB 1GI8B 2ZGHA 1GBMA 3SI3H 3SNDA 2ZFSA 3M5NA 1C1RA 1K21H 1DOJA 2RG3A 1TGBA 2F9UA 3UPEA 1FIWA 1V2MT 1F0SA 1ZMNA 3MO9A 1D3QB 1DVAH 1P02A 2ZDMA 3KQDA 4ABEA 2D2DA 3P8NA 3A86A 2AYWA 3P17H 1DITH 4YLUA 3HKIB 2ZECA 3LJOA 3L3TA 2BHGA 3SZNA 3ODDA 3ZZ3A 3UOPA 2BD7A 1P04A 1T4UH 4Y0YE 3G01A 1MBMA 2ZGJA 1SGCA 3KF2A 2NU1E 2G5NA 2WPKS 2OC7A 3NXPA 4F49A 4O03A 3UFAA 5C1YA 1FPCH 1WTGH 1SGNE 2GD4B 4YOJA 4I8GA 1AU8A 4B71A 3MNCA 1NN6A 3KQCA 3R3GB 4DCDA 2FLRH 1AMHA 1IQKA 1IQEA 1FY5A 1HDTH 1HAHH 1DLEA 1W7GH 2YOLA 2ODPA 3GY8A 3KL6A 4IN2A 3RU4T 4LOYH 1W14U 2OLGA 1EZQA 3MU0A 5GCHF 1LHDH 2FYRA 3MOCA 3T28A 3TJUA 3UIRA 1SGDE 1EZUC 5FBEA 1YCPH 5GIBA 3BTQE 2STAE 4ABHA 2Y5FA 3A85A 1S0RA 3ZV9A 5HXFA 3VGCC 3M3TA 2ZDVH 1O2KA 1O3BA 2G81E 4ZKOU 1ELEE 1UTKA 2XXLA 3NUMA 2BDBA 3ZVGA 2ZU2A 1NFUA 4NA8A 5F03A 1EQ9A 1PFXC 3EYDA 3PMJA 5EXNA 1B0EA 4FVBA 5DKMA 4NSVA 1C5VA 1LKAA 2FTLE 3M35A 1FY8E 3QN7A 5J4SA 2JKHA 2G4UA 1MD8A 3GY4A 3SNBA 1HAVB 3IITA 1Q3XA 4BXWA 4INLA 4NFEA 1J14A 4K3JA 3R0FA 3SQHE 4XDEA 1GHWH 3PB1E 4NIYA 2VWNA 2HRVA 1BTHH 3V0XA 3F68H 2XC4A 1GHBG 3O8DA 2J92A 3RXEA 2PR3A 3MH7A 1MD7A 2G4TA 3SI4H 1YPLH 1EATA 2P8OC 3V7TA 3D49H 3GDUA 1O3JA 3RC5A 3QWCH 3BEFB 4INKA 3HPTB 1SGEE 3PTBA 4NZQA 4Y11E 3A87A 1BRAA 2ZU5A 2KAIA 3RXTA 1NPMA 2ALPA 1GBAA 2FI3E 1NFYA 3A8BA 1SGTA 4TYDA 3S9BA 3P6ZB 4FUEA 3BTME 4ABDA 2EEKA 1ZMJA 2BVXH 2TGPZ 4H4FA 1AE5A 5EXLA 1ZPCA 1F5RA 4AZ2B 1EJNA 1K1IA 4AFSA 1QRWA 5ABWA 1LHGH 1VJAU 1C2EA 3U8RH 4CRCA 3LU9B 4NIXA 5HM9A 4MPUA 4YT7H 1FY1A 1P06A 4XBBA 1JBUH 3M3VA 1KLTA 1TNGA 2WPJS 1XKBC 5E2OA 1CGHA 2P8OB 2A4QA 3AAVA 1SFIA 4X8SH 4AB9A 3PV4A 1HYLA 3PO1C 2A0QB 2Z7FE 1TMTH 2SNWA 1WBGB 4GHQA 3V12A 3AW1A 5DGJA 1EJAA 2GV7A 4FUHA 4GHTA 1Z6JH 1V2NT 1AKSB 3Q3XA 1YF4A 1QGFA 2QGRA 3MI4A 5CE1A 3SV9A 2J38A 3MMGA 3SUFA 1A2CH 3EE0B 1ESBA 1T32A 2GX4A 3GICB 5I25A 2J2UA 2PKAA 5L2ZH 1F2SE 1MQ5A 1JOUB 2WYJA 4WMDA 1LVMA 3L6PA 1O39A 1TGSZ 2C8WB 2VNTA 3RXVA 3ZVEA 1XMNB 2DE8A 3S7KB 1Y8TA 4DIIH 1KXEA 1LDTT 5JDUB 5LPFA 1MZAA 1VGCC 1QNJA 3MHWU 4AB8A 5F8TA 1Z8RA 1V2KT 3RXFA 1YPMH 2OC8A 1BHXF 4FUFA 1NU9A 1SLUB 3MH6A 4H6TA 1CO7E 1NZQH 1Y5UT 3BTHE 2BYAX 2R2MB 1G30B 3OTJE 4U30A 5G4BA 3TVJB 3MNBA 3A7WA 1C9PA 1ANDA 4Y71A 1HAYB 1GJ5H 2ZF0H 4BAOB 2TPIZ 3AVZA 3RXKA 3ZZ5A 4GLYA 3BTTE 1C1VH 2VIQA 4FUIA 1PPZA 1DT2A 1TNIA 1BTPA 2CF9H 4WH8A 3DA9B 4CRDA 3ZZAA 2A5KA 1MMJN 2PSYA 1O5GH 5F8ZA 1HXEH 1O3FA 1Z1JA 1WAYB 2ANKH 3QZQA 3SU1A 4THNH 1Y3YA 1UCYK 1OX1A 1ZSLA 3KQBA 4UFDH 4UFFH 3VB6A 3U98H 1BMAA 1DSTA 1VGCB 2WPHS 5C1XA 4NSYA 2FODA 1HGTH 2BMGB 2VB0A 1XXDA 3TH4H 4HI3A 1C5XB 3ELAH 3OSYA 1O5EH 8KME2 1Z71A 1A0LA 4X0WU 2Y5HA 3NZIA 1BTWA 3F9HA 1H9HE 3KEEA 3LGIA 1CT4E 5K7RA 1AUJA 3ZZ9A 1V2VT 4GAWA 4O3UA 5DP4A 3MYWA 1WYKA 1C1QA 1XUFA 4AG2A 1OWJA 2LPRA 3MTYA 1SHYA 4A6LA 2J34A 4NWKA 1Y5BT 4ZKNU 1ARCA 3ZZ4A 4KP0A 4I7YH 1PQ5A 3RXPA 2GDEH 2W3IA 3GY7A 1AE8H 1W12U 1YLDA 4CBNA 3EAJA 4NG9H 1KIGH 1YPHE 1ZTLA 1HFDA 1ELDE 2A7HA 2A5AA 3SU6A 1WV7H 4JYVH 1AQ7A 4B75A 2ZI2H 1RRKA 2QN5T 2ZTXA 4MNWA 2YNBA 4FU9A 2AGGX 1DUAA 5FBIA 1QBVH 1LQEA 1NT1A 4DVAU 1UTMA 1JIRA 4BTUB 1MCTA 1F0TA 3PMBB 3AW0A 3E1XB 4LK4A 1C1MA 3WY8A 1MKWK 1SQTA 1ABJH 3T62A 1MTNC 5H4IB 4AFUA 1GJ9B 3KIDU 1RTFB 5C20A 1SQOA 1ETSH 2OC0A 4ZHAA 2ZEBA 3B23B 4NIWA 4Q80A 3RM2H 1NFXA 4WF8A 4AFQA 1EOJA 1GGDC 2B8OH 2ZU4A 1GMDF 1O3HA 3UY9A 1CQQA 1GVZA 3D62A 5ESBA 2ZPQA 3TNSA 2WYGA 1ZMLA 1DDJA 3A7XA 2R9PA 4Q2KA 5EW2H 3W95A 1ELAA 1OP2A 1JXPA 1ZR0A 2ZPSA 3MFJA 4I33A 3ZZ6A 1EZSC 1K1JA 1UMAH 5L2YH 1KXFA 4KELA 3S69A 4RSPA 3M61U 3SOSA 3F9GA 1EPTB 3RU4E 1O30A 4LZ1H 4FU8A 2C8XB 1C5MD 1SGPE 4X1NU 1KTTB 1KXDA 1P10A 1CU1A 3SJ8A 1GJ8B 2ASUB 1LPGB 3P95A 3HGPA 1MTNB 1XUHA 5LPRA 1A1RA 3F9EA 1A7SA 5LPEA 2A7CA 2V3OH 1G3BA 2UWLA 1P8VC 2XCFA 1BMMH 1K1MA 1O2GH 1MKXK 3Q3YA 4NFFA 2GDDA 4CRAA 1BB0B 4AFZA 1ZPZA 3E3TA 3A7YA 1ESAA 2LNCA 6GCHF 3VPKA 2BY5X 1GL1A 1GGDB 1GMCF 4HFPB 4X6PA 1CSOE 3SO3A 3U9AH 4GSOA 2A2XH 2AGIX 1G3DA 1DY8A 4X8VH 4AGKA 2FDAA 1DWCH 3QUMP 1FDPA 1N8OC 4YOIA 4JZIA 3SJOA 2CF8H 2SNVA 1DPOA 1HPGA 3TLOA 1QA0A 1CHOF 1XXFA 3S9AA 4YOGA 4UDWH 2SGEE 1P03A 1C9TA 2ZIQH 1AD8H 1BQYA 2UUKB 2CV3A 2F91A 5E2PA 1VITG 3DT0H 3TITA 3EA8A 5FAHA 1D3TB 4XSKU 4LXBH 1MAXA 2CGAA 2R0KA 4E06H 1O34A 4INHA 1V3XA 1OS8A 5DPAA 1A46H 2BQ7B 2VVCA 2FP7B 2VU8E 1T8LA 1BTXA 2ODQA 2HNTF 2AERH 3UQOA 1BTZA 5EQSA 2HLCA 3EGKH 4XBCA 3GCTG 1EP5A 1DY9A 2FO9A 3FFGA 1O32A 2FLBH 4FU7A 4AN7A 1YM0A 3SU0A 4GCHG 2QF0A 2IJOB 1GJ4H 1N8OB 1C2KA 2P93A 2RA3A 3UNRA 2GT7A 1DUEA 2ZCLP 3M7UA 1C2IA 1Z7KA 1A3EH 3VB7A 2QYIA 3Q3KA 1UVTH 4MNXA 1CGJE 1V2JT 1GMHG 1O38A 1QIXB 3RC4A 5TCCA 4TWYA 4B73A 4CR5A 2ZGBH 3ZZCA 4ABJA 1K9OE 2BB4A 5DK1A 1SOZA 1WSSH 2ZKSA 4XFQA 1ANCA 2QAAA 1AN1E 3VXEH 1RGQA 5DP8A 3RXMA 2C90B 3AASA 4UFGH 2VINA 1O5AB 3VXFH 1JIMA 3LT3A 1O2YA 1UVOA 1Y3UA 4AYVB 4BAKB 2Y5GA 1C5YB 5B6OA 3K65B 1TOMH 3ZVBA 1LVBA 2A4OA 1N6YA 3KN2A 1SI5H 3N7OA 3GDSA 2BLQA 1UHBA 1J16A 2HOBA 1THPB 1H4WA 1YPHC 1NRSH 1X7AC 4JZDH 1IHTH 1VITH 3PTNA 3O8BA 2J95A 5HMAA 4MNVA 3A80A 1D4PB 1C5OH 2YNAA 4JYUH 3HGNA 2ZTZA 1CT2E 1GI2A 1SGFA 2V35A 3EDXB 4HTCH 2BX3A 3UREA 1ELCA 1P12E 2XRCA 1UK4A 1W10U 1HJAC 1QL7A 1V6DA 3P92A 3TU7H 3RLWH 1DX5M 5A8ZA 4CR9A 5A0AE 4YT6H 1A5HA 1A4WH 1QQ4A 4ISOA 2HVXA 4UFEH 2UUJB 1ELGA 4IMQA 1KLJH 4FUGA 3BSQA 2O8TA 3V13A 1BMLA 1K1NA 1QY6A 1FN8A 1GI1A 2GP9B 3GY2A 1O3PB 4F4OC 2ZP0H 4I8LA 1AFQC 2FXRA 1H8IH 1SC8U 4ZHMU 2ZQ2A 4A92A 2ALVA 4UD9H 4Y7AA 1C2LA 1NROH 5GCHG 1H1BA 3S9CA 3JZ2B 2A31A 4MPXA 2F9PA 1QURH 4GUXA 1O3IA 1EKBB 1V2ST 2BDAA 1HAZB 3SU5A 3RC6A 5I46H 1CBWC 3FAOA 3TIUA 1GBCA 3BTEE 1GCDA 4ZUHA 1L4ZA 1M9UA 2ZFQH 7KMEH 5DP5A 3FP6E 1EASA 2VH0A 2Z3CA 1LKBA 2ZHDA 1GWAA 1Z8JB 1O3MA 1CE5A 4Y0ZE 1HJAB 3BG4C 1ACBE 2D26C 2FOHA 1SLXB 1O3LA 5AFZH 2XTTB 5TCAA 3PYHA 1GBJA 1LCYA 3M3SA 1QJ7B 4X8UH 4X6NA 2ESTE 1HAIH 2BDCA 2PW8H 1ANEA 3T26A 1WQSA 3QX5H 2ZCHP 1BRUP 2OC1A 1GDUA 3RXHA 3T25A 2Z3DA 4K60A 1AFQB 3QGJA 5F8XA 2FMJA 1IQLA 5T6DA 4B76A 2H1UA 3RXDA 3UWJH 1YC0A 1TQ7B 2XBWA 7GCHF 3BTFE 1L1GA 2ANYA 1GHVH 1QBNA 1V2UT 3QTVH 1V2PT 1TA6A 1GBLA 1FUJA 3E90B 2PUQH 4ABGA 3ZVCA 4TPIZ 3UR6A 1EAWA 1CBWB 2EI6A 3ZYEA 2WPIS 1O5DH 2A32A 3BTGE 1AHTH 4BNRA 2TGAA 2VIOA 1HAVA 2XBXA 3E91A 3FZDA 2RA0A 3BG4B 4MG3A 4IN1A 1GBBA 4YO9A 2WV4A 4ABBA 5DP3A 5JB9S 4A1VA 1BBRK 4Y7BA 2UWOA 2HPQH 4ZMAH 1T31A 4ESTE 1BMNH 1NS3A 3GCOA 2O8UA 1TNLA 9LPRA 4A7IB 2Y82A 2QXJA 1G3EA 3JZ1B 2THFB 5HYOA 1YPGH 2BOKA 3ITIA 3QO6A 1OPHB 5C2ZA 2AFQB 3SV6A 3RP2A 1L1NA 3BTDE 4JZFH 3LGVA 1A5GH 1W2KH 2UWPA 1IQFA 4FXGH 3SV2H 2IOTA 2ZPRA 5A8XA 1O2JA 1T4VH 1PQ7A 1P05A 3O8RA 2PV9B 4Y76A 1OYTH 1LO6A 3GY6A 2Y7ZA 4ZH8A 1ORFA 3CS7A 2F9OA 1BITA 4ABIA 1IHSH 1OOKB 1THSH 1YGCH 1MUEB 3C1KA 4TPYA 3PLPA 4X2VA 2G55A 4WXIA 1SSXA 4MQAA 1XVMA 2ZWLH 1VZQH 1C1TA 1XUKA 1S85A
chains in the Genus database with same CATH superfamily
3M7QA 1TRYA 4Q63A 3VG8A 2FIRH 4BAQB 1HV7A 1G36A 3F3BA 4BAMB 1SQAA 3H5CB 4AGJA 2QXHA 3DFLA 5GWZA 1DFPA 4TWWA 3UWIA 4MNYA 1O2HA 1P9UA 2A5IA 2FI5E 3U8OH 5C3NA 1O2QA 1OKXA 3TGKE 1O2XA 2O8WA 3WW7A 1K22H 2LELA 2FOAA 5AFYH 3SGQE 1W0KD 3Q76A 1BRCE 1ELBA 3QTOH 3ATWA 1O5FH 1ZOMA 2H5DA 1UK2A 3U1JB 2A2QH 1ZZZA 3S0NA 1OWDA 1C5NH 2A4RA 3O8CA 2PSXA 2JH6D 1ZYOA 1FAKH 2I6SA 1ZJKA 4IW4E 3V3MA 2J94A 1PYTC 4CRGA 1P2JA 1GJCB 4IC6A 2XYAA 1AKSA 1MTUA 1GHZA 1SLVB 2A7JA 2BD3A 2ZC9H 1B5GH 4Y10E 2ANMH 5CHBA 5EPYA 2TRMA 2SGPE 1G9IE 5EPNA 2J98A 3TH3H 1RIWC 3SJ9A 3VB4A 2P59A 1SLWB 1QHRB 2SGFE 2WINI 1HUTH 2GCHF 2GZ7A 5F6MA 1AVXA 1AY6H 4ZXYH 1T8NA 3UUZA 2KR7A 1ELFA 5EQRA 1L0ZA 1TRMA 2ULLA 3RU4D 2AIQA 5HKKD 5L30H 1QL9A 4B2CA 1SGYE 1V2RT 1FXYA 2C93B 1FAXA 1WU1A 4OS6A 5JBBS 1UW7A 1LHEH 2FX4A 1TX7A 3A7TA 1AB9C 1D9IA 1O3DA 2QY0B 1ETTH 2HALA 4M7GA 3MNXA 2VWMA 1O2MA 4KTUA 1A61H 2FWWA 2R2WU 2ZO3H 4I31A 3A7VA 4XD7D 3QGNB 3FN8A 1F5KU 1SGQE 2NU2E 1CA0C 1O3GA 1PPCE 1U6QA 3QK1A 4B1TA 1FV9A 1H8HD 4OS2A 1AI8H 3F1SB 1H8DH 3ZZBA 4Q7XA 1W7XH 2F43B 2AEIH 3TGIE 4D9RA 2RDLA 3A81A 1KXAA 4JK6A 1MZDA 1YBWA 1RIWB 1OWHA 1O2NA 3KHVA 1Z8IB 2Q6DA 3M37A 2NU4E 1N6XA 1T8MA 1P01A 4Y79A 1AWFH 1JWTA 2G52A 2XBVA 2Z9LA 5FXLA 1PPGE 3FANA 2UUYA 3FKSD 1E34B 1BZXE 2F9NA 3UAIC 2FOFA 1IQGA 2ZTYA 1YKTA 7LPRA 4K1SA 1TFXA 4WWYA 2EC9H 1HAOH 1FY4A 1XKAC 1F0UA 4DT4A 3ATKA 2OTVA 3CS0A 4HGCA 4Y6DA 1P11E 2W26A 1AB9B 3KYGA 1GI0A 4A1XA 1GBTA 4IC5A 1DE7H 2SGQE 4ZAEA 1TAWA 4ZHLU 1T8OA 2CN0H 2Q1JA 3SGAE 2ZGCA 2FEQH 2XCNA 1TGNA 2XWAA 1CA0B 2ZFRH 2Y81A 2B9LA 2OQ5A 5C94A 1TE0A 1LVOA 1ZTKA 3ATMA 1QJ1B 5EW1H 5A0CA 4NA9H 3UQVA 2A4GA 1EPTC 4FUBA 5JBTA 3RXLA 3SV7A 5BPEA 4JZEH 1SGRE 1UTJA 1O2ZA 1C5PA 2GMTB 2K0QA 2W7UA 1IAUA 3BV9B 4YXWD 2OBOA 2PLXA 1Z8GA 1OHHD 1WCZA 1TX6A 2OXSA 3OY5U 4OGYA 3ZVDA 2Z9JA 3E0NB 3MNSA 4FVDA 1GMDG 2AGEX 5LGOA 5JB8S 3TJNA 1EAXA 3BF6H 1O36A 1VCWA 5EJLA 2JJ2D 1IQMA 3E0PB 5L6NH 1DM4B 2PHBA 2STBE 4DURA 1GHXH 2BTCE 4MLFB 1O3CA 4B6EA 2ZCKP 3MWIU 3GYMA 1QR3E 1EFRD 1O3EA 1DWBH 1SVPA 5E0HA 4BOHA 4U2WA 2Y80A 3VFEA 1AZZA 4X1SU 1C1WH 8GCHF 4SGBE 5AHGH 1YLCA 2FOMB 2VIPA 4FUDA 1Y59T 2K1QA 1Y3XA 3RXSA 3TGJE 1ESTA 1O2SA 4B2BA 3OY6U 3SYJA 1EUFA 1O3OA 1FIZA 1RTKA 4ABFA 1NC6A 1YCPK 2HPPH 1OP0A 2DUCA 5AF9H 1EAIA 2RCEA 5FPTA 5DP9A 1PYTD 3Q00A 4MPVA 3SW2B 1HIAB 1MAYA 5HM2A 1QQUA 2AMDA 2F3CE 1NO9H 3NRLA 1HCGA 2EA3A 1Z1IA 6GCHG 2IN2A 1K1LA 3RXOA 4E05H 2ZDAH 3LOXA 3ZVFA 1DANH 2W3KA 4MTBA 5GJ4B 4NZLA 3P8OA 1B7XB 4BANB 5TJXA 3P8FA 4I8KA 2XNIA 1QJ6B 3PRDA 5SGAE 1OWIA 2AMQA 1KYNA 1EPTA 1NFWA 1GHAF 4X1RU 4Z6AH 2JH0D 4NCYA 1ABIH 3U1IB 2FOEA 1CHOG 1NRPH 3DHKH 2A45B 1GVLA 1BJVA 3LH3A 1HIAA 4BXSA 3FOAA 5GNDA 3TH2H 1H9IE 7ESTE 2J4IA 1B0FA 3A84A 2O9QA 3E16B 3RXIA 1J15A 1S6HA 1UVPA 3K6YA 1GJ7B 4UEHH 1C1UH 2JH5D 4BTIB 1TX8A 4ISLA 1O3KA 2FESH 4A1TA 1NBME 2VH6A 3S7HB 3UOUA 1V2TT 3B9FH 3PM3A 1C1NA 4X2XA 1P3EA 3GY3A 2IPQX 3SU2A 3HATH 2ILNA 1G2LA 4JYTA 3SQEE 2GT8A 4MPWA 4Y8YA 3N7EA 2ZNKH 1CGIE 1TONA 2PFEA 3VEQB 2BY8X 3LC5A 1IQNA 2B0FA 1V2WT 3ZVAA 1PPHE 3DFJA 1RTLA 2HNTE 1EXFA 3URDA 3UTUH 1XUGA 4DT7B 1AUTC 1PPBH 2YMSC 3I77A 1GBKA 1C4Y2 1VKYA 2GZ9A 1TNKA 5JBCS 1F5LA 2AS9A 3SU3A 4D8NA 1GI5A 1MTSA 4GVUA 3TK6A 1UCYH 1KDQB 3PLBA 3A82A 1TYNA 3PV5A 2QE7D 5CDFE 4OS5A 1AVWA 1G2MA 5FPSA 3GCTF 1QA7A 1WUNH 1L4DA 4GCHF 3MO6A 1G32B 4YZUA 3M5OA 3QLPH 1VCQA 3ATLA 4J1YA 3H7OA 2ODYB 1BHXB 3ZV8A 4OS4A 1J9CH 3T27A 5A0BA 2O8LA 5HIYA 1ZSJA 1O2WA 1D3DB 1TLDA 2PGQB 4K8BA 4O97A 4ZKRU 2CHAC 3TK9A 1HAPH 1C2DA 3OYPA 1OXGA 5C5NA 3P70B 1QL8A 1SQRA 1TNHA 3NCLA 1GG6C 1GBEA 3LGYA 1GBFA 1ZPBA 4K69A 1ANBA 4CREA 1TGCA 2G51A 1O2TA 2VIDA 3GISB 1TNJA 4XE4A 2BZAA 3SZEA 3WWFA 1GI4A 2ZDLA 1SPJA 4WMEA 1LTOA 3LKWA 1YLNA 3NK8A 4X2WA 5T6GA 2P16A 1TBQH 2WHXA 2QXGA 2P3UB 1ZHPA 1ARBA 5JBAS 2FOGA 1GBHA 2ZHWH 4YM9A 1BJUA 4XOJA 2W7SA 4ZXXH 1CVWH 4DIHH 1HJ8A 1TIOA 3SUDA 3PROA 2BD4A 3EA9A 1YY3A 1MU6B 1IQIA 1GI6A 2PKSC 1DSUA 1XM1A 4IGDA 1TOCB 1P9SA 1S6LA 2BVSH 1C5WB 1TPSA 1QB1A 3LC3A 3T5FH 5GPIB 3VB3A 8ESTE 1MKWH 2BLWA 4I32A 2W5EA 2H5CA 4IBLH 1C5ZB 1C2MA 1HLTH 3QDZB 2CHAB 5FCRA 2ZHQH 3A88A 5DP6A 2B5TB 1DXPA 1TMBH 2ZU1A 4B2AA 5FX6A 2KCPA 2ZA5A 1K28D 1GG6B 3BTKE 5GXPA 3RXUA 1S81A 1SB1H 1Q2WA 2BZ6H 3GYLB 2BVRH 2NU3E 4D76A 1BCUH 4D7GA 2H9TH 2VGCC 2TBSA 1V2QT 2FTMA 2IJD1 1FQ3A 2F9BH 5CMXH 2BD8A 4MVNA 4H6SB 5CHAC 1Y3VA 1GHYH 3N99A 4CH2B 3HK3B 1C5SA 2C8ZB 3PMHB 5FX5A 3RXJA 3RXBA 2ZHEH 2CMYA 1AGJA 2UUFB 5HGGA 3SNAA 1EB2A 1W0YH 1H8ED 2PUXB 3RM0H 1O2LA 1ELVA 3RXCA 3OX7U 1HJ9A 2ZDKA 1NRNH 1SOTA 2R3YA 1K2I1 3BEUA 2FM2A 2V3HH 2BOHB 1C5QA 2FX6A 2PP6A 1LVYA 1ZSKA 2PKSB 3UNSA 1PPEE 2DE9A 2OQUA 3DCLA 1UTQA 3M36A 2BM2A 3GY5A 1MABB 3SJKA 4YLQH 5EG4A 1PQAA 4M9FA 3M5LA 1GJBB 4JCNA 1GBDA 7GCHG 1E38B 4QT8C 1BDAA 1GJAB 3TJVA 2O8MA 2W6ID 3ATIA 1MQ6A 3MU4A 2VWOA 3STJA 5E8EH 1C4U2 1YYY1 2QXIA 1MKXH 4MDSA 1C2HA 2XOKD 3A8DA 1ZLRA 2ZGXH 3BG8A 4K2YA 3BIVH 3ZZDA 3RMLH 1BTYA 1HRTH 1TPAE 4X6MA 1TQ0B 2QCYA 2VGCB 3FVFB 1SR5C 3GCHC 5C5OA 3SU4A 1S83A 4Q7ZA 5CHAB 6CHAC 2VJ1A 4ZROA 4X8TH 4K1TA 4FUCA 2KAIB 3I78A 2VWLA 1MTVA 1RS0A 2YMSD 1P2MA 1RD3B 3TK5A 2FOBA 2OBQA 3B8JA 5FHTA 5T1VA 4D7FA 1QBOA 1UTPA 1O2IA 1AFEH 1D6RA 2BD9A 1P57B 1EZXC 3PWBA 3RXQA 1P3CA 3KNXA 4B6FA 3H09A 4TY6A 1C1OA 3MH4A 4AX9H 4KGAA 3OFND 2P3TB 1HB0B 1O2VA 2BQ6B 1QB9A 1ID5H 1YP9A 2HGTH 4OGXA 5ETXA 1RFNA 1GHBF 1C5LH 2XC0A 2Y6TA 1O5CB 3LDXH 4VGCC 1MCVA 3VGCB 1QTFA 3AAUA 2ZU3A 1YPEH 3F2HA 4ZKSU 1F0RA 1O2RA 5EODA 4CH8B 8LPRA 2G00A 1PJPA 5A8YA 2FPZA 3F6UH 2BDGA 4RKOB 3SN8A 1S82A 3LIWA 3RUOA 2SGDE 1IOEA 2V6NA 4DW2U 3SNCA 1UVSH 3ZYDA 2BDYA 2HNTC 2NU0E 3U8TH 4P02A 3GCHB 1KXBA 4Y8XA 1PQ8A 2PTCE 6CHAB 4YESB 2WPLS 1NY22 4GPGA 2Z3EA 3HKJB 1A0JA 2HWLB 5C1UA 2KCYA 2GZ8A 1QB6A 1TB6H 2GV6A 2Z9KA 4NGAH 1LQDB 1IQHA 1C2GA 1COWD 1AWHB 2PKAB 4DY7B 2D1JA 5DN6D 4ACAA 2BX4A 1YCPM 4RKJB 4VGCB 3VB5A 2Z94A 1FY3A 2G5VA 1A5IA 1C5TA 3NKKA 1O3NA 1QCPA 3A83A 1F92A 2QC2A 4ISIH 1EX3A 1GCTC 1THRH 1TGTA 2FI4E 2NWNA 2FS9A 1Y3WA 3A8CA 6LPRA 1JRTA 1L2EA 5JPMH 3RXRA 2GKVE 5DJ7A 2Q6GA 3RXGA 4K5ZA 2F9VA 3MO3A 1BUIA 2BXTH 4X1QU 2JETC 4WMFA 4NIVA 2GCTC 5EXMA 3TJOA 2I6QA 3SJIA 4B74A 2Z9GA 2GCHG 4ISNA 1SFQB 1P2QA 1KSNA 1G37A 1NESE 9ESTA 2CJIA 1LMWB 1S5SA 3IG6B 2ZZUH 4D9QA 1SGFG 1FLEE 3PMAB 1IQJA 2C3SA 3KGPA 1BIOA 1CHGA 2QA9E 4UONA 2KCAA 5EJZA 3SHCH 1AZ8A 3PWCA 3HK6B 3ODFA 3LGUA 4KKDA 1GDQA 4DOQA 1VCPA 2BD2A 1RXPA 2WUCA 2XWBI 3F9FA 3PO1B 3MH5A 2R3UA 2Q6FA 4RT0A 1GCTB 2TIOA 3UNQA 4HZHA 3EQ0H 1UJ1A 3BIUH 4K8YA 1P0SH 1S0QA 1BA8B 1QZ8A 5T6FA 3T2NA 3KQEA 2C4FH 1TALA 3MU5A 2SFAA 1UTOA 2VIWA 1BT7A 5FCKA 1ZRBA 1J17T 3ZZ7A 5EJ1A 4ACBA 2BLVA 5ESTE 2XBYA 1AO5A 1SMFE 3ESTA 1HAGE 2FZZA 1TMUH 2JETB 1SGIB 2GCTB 2WZQA 3K6ZA 3P8GA 3IWMA 2M2AA 1BRBE 1UTNA 1ZHMA 5EOKA 4CRBA 2QF5A 1BBRE 3FP8E 2GMTC 2GGVB 3RMMH 1E37B 4AG1A 4AORA 3A7ZA 5DP7A 5PTPA 3RDZA 1TPPA 3GCNA 4R0IA 4E7RG 1TA2A 2OUAA 1V2OT 4DJZB 1WOFA 4I8HA 3QZRA 2BXUH 4O9VA 1T7CA 1WXRA 1KXCA 1ZGVA 1LPZB 1P2IA 4Z0KA 2BD5A 2GTBA 1HBTH 1QRZA 1CA8B 2CXVA 1TRNA 5DG6A 2P3FH 1HAXB 1NBMD 1C2FA 2BDHA 1VR1H 4RT1A 1C1SA 4H42U 4YTAA 2TGTA 2BY6X 1GDNA 1DS2E 1AVGH 1HXFH 2AMPA 2QIQA 5J4QA 2P94A 5EQQA 1SHHB 3TPIZ 2B7DH 1RJXB 4OS7A 1FNIA 1NU7B 2QV1A 3FZZA 3L33A 4U01A 3I29A 2ZDNA 2SGAA 3KQ5A 4J2YB 5FPYA 1P09A 2L6OA 1Z6EA 3NWUA 1TBRH 2VVUA 4CRFA 4WJG2 5A2MH 1FZZA 4UE7H 1ZGIA 5EGMA 1EAUA 3SBKA 3LJJA 2CK3D 3CP7A 3RXAA 2ZQ1A 4JK5A 2TGDA 3OU0A 3T29A 2KZ4A 1SKYE 2OD3B 3SUGA 5JYIA 2C8YB 1O2UA 1GBIA 1O2PA 1UTLM 1YPJH 1O0DH 3WWBA 3UR9A 1MH0A 1BBRH 5K0HA 3SV8A 2EI8A 1N1LA 1F7ZA 2F83A 1BMFD 2ZFPH 4E7NA 1PPFE 1OWEA 5A09A 2Z9IA 1XUJA 3RMOH 1GI9B 1ZTJA 5GDSH 8GCHG 1E35B 2GVFA 2QF3A 1LHCH 3SORA 1QRXA 1YWUA 1G3CA 4PROA 3K2UA 4FUJA 1DLKB 1ELTA 2WPMS 5BRRE 3STIA 4NWLA 1GVKB 1C4V2 2XW9A 3LGWA 2Y7XA 5AVDA 3BN9A 1K1PA 4XBDA 1W0ZU 1GJDB 2ZFFH 4R8TB 1VJ9U 3BTWE 4DGJA 1FPHH 1O3AA 2FOCA 2ZHFH 1NM6A 2BLOA 2WUBA 3DD2H 1W8BH 1EB1H 1NTPA 3LH1A 4XRNA 1O31A 1A0HB 3D23A 1D3PB 2M5TA 2BY7X 3A89A 2FS8A 1DWDH 1DXWA 1TPOA 3LPRA 2BY9X 3LONA 1MTWA 1LPKB 3GDVA 3Q77A 4WVPE 5C67A 1Q31A 2J5UA 2OCVB 3C27B 3ENSB 1SG8B 1OYQA 3SGBE 1MU8B 3PLKA 1GMCG 2ZG0H 4CHAC 3E6PH 4AOQA 1BTUA 2H2ZA 1TABE 2VIVA 1GHAG 3RMNH 2G8TA 5IYTA 1AIXH 2R0LA 1Y5AT 3M5MA 1ZRKA 4ISHH 4KTCA 1C1PA 5T3HA 3CENA 3FO8D 4O3TA 4U32A 1UCYE 3MQKC 2HLDD 2OP9A 1UVUH 3SHAH 2WV5A 3EA7A 1NRQH 1O5BB 1WQVH 1D6WA 1UK3A 4JMYA 1OSSA 4TY7A 5FL7D 1OWKA 1NRRH 3BEIB 3MU8A 4K1EA 2FYQA 1FJSA 5EU8A 1O37A 2H9EH 1P2KA 1P2NA 3MU1A 4WH6A 2J9NA 4IMZA 4BTTB 4F48B 1WTHD 3SNEA 1EP6A 5E0GA 1J8AA 1V2LT 3ZZ8A 2BQWB 4OM9A 2XC5A 4IS5A 4Q7YA 1KY9A 3LGTA 3D65E 2F4LA 1XVOA 5EIYA 1FMGA 1FONA 3U69H 3TNTA 4CHAB 1A3BH 1DICA 5IK2D 2A1DB 2AIPA 4X2YA 1QFKH 1GJ6A 4Y8ZA 5DO4H 1O2OA 1OP8A 2ZFTA 5IDKA 1SBWA 4OS1A 3SUEA 3K9XB 1VITF 3KCGH 1K1OA 4LZ4B 3FP7E 1GPZA 2PWXA 4NA7A 1XX9A 4AC9A 1GL0E 1E0FD 4A5TS 3RLYH 1JRSA 3M7TA 3NPSA 1O33A 1TBZH 1MBQA 1ZJDA 2BDIA 5LH8A 6ESTA 2D8WA 3H7TA 1SL3A 4BAHB 4X6OA 1GI3A 1INCA 1KTSB 1W3CA 1YPKH 3A8AA 2H6MA 1EJMA 1S6FA 1W11U 2V0BA 1O35A 2XNDD 1GI7B 3DSGA 3F0OA 4F55A 1DWEH 1UO6A 1P2OA 4WY3A 4ABAA 1W0JD 2H9HA 1GMHF 1UHBB 4RN6A 5HIZA 4ASHA 1E79D 5E0JA 1S84A 4KTSA 4DG4A 4SGAE 4JZ1A 1LHFH 1KDQA 1XUIA 1ZHRA 3URCA 2PTNA 2ANWA 1H9LB 1EOLA 1C5UA 2P95A 1W13U 4X1PU 3OEED 1L1JA 1HNEE 3E8LA 1CT0E 3DUXH 1ETRH 3GOVB 4AYYB 2IPHA 1FN6A 1E36B 1TWXB 4WXVA 2Z6BD 2AH4X 4I8JA 1C2JA 1C5RA 1FI8A 1KLIH 2VVVA 1JMOH 1BOQA 2EI7A 3W94A 4CBOA 2OINA 2PGBB 1GI8B 2ZGHA 1GBMA 3SI3H 3SNDA 2ZFSA 3M5NA 1C1RA 1K21H 1DOJA 2RG3A 1TGBA 2F9UA 2WPDD 4FETA 3UPEA 1FIWA 1V2MT 1F0SA 1ZMNA 3MO9A 1D3QB 1DVAH 1P02A 2ZDMA 3KQDA 4ABEA 2D2DA 3P8NA 3A86A 2AYWA 3P17H 1DITH 4YLUA 3HKIB 2ZECA 3LJOA 3L3TA 2BHGA 3SZNA 3ODDA 3ZZ3A 3UOPA 2BD7A 4ASUD 1P04A 1T4UH 4Y0YE 3G01A 1MBMA 2ZGJA 1SGCA 3KF2A 2NU1E 2G5NA 2WPKS 2OC7A 3NXPA 4F49A 4O03A 3UFAA 5C1YA 1FPCH 2K8IA 1WTGH 1SGNE 2GD4B 4YOJA 1E1QD 4I8GA 1AU8A 4B71A 3MNCA 1NN6A 3KQCA 3R3GB 4DCDA 2FLRH 1AMHA 1IQKA 1IQEA 1FY5A 1HDTH 1HAHH 1DLEA 1W7GH 2YOLA 2ODPA 3GY8A 3KL6A 4IN2A 3RU4T 4LOYH 1W14U 3UB0A 2OLGA 1EZQA 3MU0A 5GCHF 1LHDH 2FYRA 3MOCA 3T28A 3TJUA 3UIRA 1SGDE 1EZUC 5FBEA 1YCPH 5GIBA 3BTQE 2STAE 4ABHA 2Y5FA 3A85A 1S0RA 3ZV9A 5HXFA 3VGCC 3M3TA 2ZDVH 1O2KA 1O3BA 2G81E 4ZKOU 3W1EA 1ELEE 1UTKA 2XXLA 3NUMA 2BDBA 3ZVGA 2ZU2A 1NFUA 4NA8A 5F03A 1EQ9A 1PFXC 3EYDA 3PMJA 5EXNA 1B0EA 4FVBA 5DKMA 4NSVA 1C5VA 1LKAA 2JJ1D 3F2GA 2FTLE 3M35A 1FY8E 3QN7A 5J4SA 2JKHA 2G4UA 2QF4A 1MD8A 3GY4A 3SNBA 1HAVB 3IITA 1Q3XA 4BXWA 4INLA 4NFEA 1J14A 4K3JA 3R0FA 3SQHE 4XDEA 1GHWH 3PB1E 4NIYA 2VWNA 2HRVA 1BTHH 3V0XA 3F68H 2XC4A 1GHBG 2EY4C 2J92A 3O8DA 3RXEA 2PR3A 3MH7A 1MD7A 2G4TA 3SI4H 1YPLH 1EATA 2P8OC 3V7TA 3D49H 3GDUA 1O3JA 3RC5A 3QWCH 2KM0A 3BEFB 3HPTB 1SGEE 3PTBA 4INKA 4NZQA 4Y11E 3A87A 5KGOA 1BRAA 2ZU5A 2KAIA 3RXTA 1NPMA 2ALPA 1GBAA 2FI3E 1NFYA 3A8BA 1SGTA 4TYDA 3S9BA 3P6ZB 4FUEA 3BTME 4ABDA 2EEKA 3N7DA 4P00A 3AK5A 1ZMJA 2BVXH 2TGPZ 4H4FA 1AE5A 5EXLA 1ZPCA 1F5RA 4AZ2B 1EJNA 1K1IA 4AFSA 1QRWA 5ABWA 1LHGH 1VJAU 1C2EA 3U8RH 4CRCA 3LU9B 4NIXA 5HM9A 2W6JD 4MPUA 4YT7H 1FY1A 1P06A 4XBBA 1JBUH 3M3VA 1KLTA 1TNGA 2WPJS 1XKBC 5E2OA 1CGHA 2P8OB 2A4QA 3GS9A 3AAVA 1SFIA 4X8SH 4AB9A 3PV4A 4FOUC 1HYLA 3PO1C 2A0QB 2Z7FE 1TMTH 2SNWA 1WBGB 4GHQA 3V12A 3AW1A 5DGJA 1EJAA 2GV7A 4FUHA 4GHTA 1Z6JH 1V2NT 4Z1MD 1AKSB 3Q3XA 1YF4A 1QGFA 2QGRA 3MI4A 5CE1A 3SV9A 2J38A 3MMGA 3SUFA 1A2CH 3EE0B 1ESBA 1T32A 2GX4A 2J98B 3GICB 5I25A 4ZCNA 2J2UA 2PKAA 5L2ZH 1F2SE 1MQ5A 2L74A 1JOUB 2WYJA 4WMDA 1LVMA 3L6PA 1O39A 1TGSZ 2C8WB 2VNTA 1K0HA 3RXVA 3ZVEA 1XMNB 2DE8A 3KYFA 3S7KB 1Y8TA 4DIIH 1KXEA 2KX4A 1LDTT 5JDUB 5LPFA 1MZAA 1VGCC 1QNJA 4I86A 2EQNA 2KCOA 3MHWU 4AB8A 5F8TA 1Z8RA 3U28C 1V2KT 3RXFA 1YPMH 2OC8A 2JDID 1BHXF 4FUFA 1NU9A 1SLUB 3MH6A 4H6TA 1CO7E 1NZQH 1Y5UT 3BTHE 2BYAX 2R2MB 1G30B 3OTJE 4U30A 5G4BA 3TVJB 3MNBA 3A7WA 1C9PA 1ANDA 4Y71A 1HAYB 1GJ5H 2ZF0H 4BAOB 2TPIZ 3AVZA 3RXKA 3ZZ5A 4GLYA 3BTTE 1C1VH 2VIQA 4FUIA 1PPZA 1DT2A 1TNIA 1BTPA 2CF9H 4WH8A 3DA9B 4CRDA 3OE7D 3ZZAA 2A5KA 1MMJN 2PSYA 1O5GH 5F8ZA 2LP6A 1HXEH 1O3FA 1Z1JA 1WAYB 2ANKH 3QZQA 3ZIAD 3SU1A 4THNH 1Y3YA 1UCYK 1OX1A 1ZSLA 3KQBA 4UFDH 4UFFH 3VB6A 3U98H 1BMAA 1DSTA 1VGCB 2WPHS 5C1XA 4NSYA 2FODA 1HGTH 2BMGB 3F0PA 2VB0A 1XXDA 3TH4H 2WV9A 4HI3A 1C5XB 3ELAH 3OSYA 1O5EH 8KME2 1Z71A 1A0LA 4X0WU 2Y5HA 3NZIA 1BTWA 3F9HA 1H9HE 3KEEA 3LGIA 1CT4E 5K7RA 1AUJA 3ZZ9A 1V2VT 4GAWA 4O3UA 5DP4A 3MYWA 1WYKA 3EE7A 1C1QA 1WDIA 1XUFA 4AG2A 1OWJA 2LPRA 3MTYA 1SHYA 4A6LA 2J34A 4NWKA 1Y5BT 4ZKNU 1ARCA 3ZZ4A 4KP0A 4I7YH 1PQ5A 3RXPA 2GDEH 2W3IA 3GY7A 1AE8H 1W12U 1YLDA 4CBNA 3EAJA 4NG9H 1KIGH 1YPHE 1ZTLA 1HFDA 1ELDE 2A7HA 2A5AA 3SU6A 1WV7H 5C0TA 4JYVH 1AQ7A 4B75A 2ZI2H 1RRKA 2QN5T 2ZTXA 4MNWA 2YNBA 4FU9A 2AGGX 1DUAA 5FBIA 1QBVH 1LQEA 1NT1A 4DVAU 1UTMA 1JIRA 4BTUB 1MCTA 1F0TA 3PMBB 3AW0A 2VBCA 3E1XB 4LK4A 1C1MA 3WY8A 2KFWA 1MKWK 3OTPA 1SQTA 1ABJH 3T62A 1MTNC 5H4IB 4AFUA 1GJ9B 3KIDU 1RTFB 5C20A 1SQOA 1ETSH 2OC0A 4ZHAA 2ZEBA 3B23B 4NIWA 4Q80A 3RM2H 1NFXA 4WF8A 4AFQA 1EOJA 1GGDC 2B8OH 2ZU4A 1GMDF 1O3HA 3UY9A 1CQQA 1GVZA 3D62A 5ESBA 3OEHD 2ZPQA 3TNSA 2WYGA 1ZMLA 2HVYB 1DDJA 3A7XA 2R9PA 4Q2KA 5EW2H 3W95A 1ELAA 1OP2A 1JXPA 1ZR0A 2ZPSA 2RFKC 3MFJA 3OAAD 4I33A 2V3MA 3ZZ6A 1EZSC 1K1JA 1UMAH 5L2YH 1KXFA 4KELA 3S69A 4RSPA 3M61U 3SOSA 3F9GA 1EPTB 3RU4E 1O30A 4LZ1H 4FU8A 2C8XB 1C5MD 1SGPE 4X1NU 1KTTB 1KXDA 1P10A 1CU1A 3SJ8A 1GJ8B 2ASUB 1LPGB 3P95A 3HGPA 1MTNB 1XUHA 5LPRA 1A1RA 3F9EA 1A7SA 1E1RD 5LPEA 2A7CA 2V3OH 1G3BA 2UWLA 1P8VC 2XCFA 1BMMH 1K1MA 1O2GH 1MKXK 3Q3YA 4NFFA 2GDDA 4CRAA 1BB0B 4AFZA 1ZPZA 3E3TA 3A7YA 1ESAA 2LNCA 6GCHF 3VPKA 2BY5X 2WSSD 1GL1A 1GGDB 1GMCF 4HFPB 4X6PA 1CSOE 3SO3A 3U9AH 4GSOA 2A2XH 2AGIX 1G3DA 1DY8A 4X8VH 4AGKA 2FDAA 1DWCH 3QUMP 1FDPA 1N8OC 4YOIA 4JZIA 3SJOA 2CF8H 2SNVA 1DPOA 1HPGA 3TLOA 1QA0A 2JIZD 1KMHB 1CHOF 1XXFA 3S9AA 4YOGA 4UDWH 2SGEE 1P03A 4RI0A 1C9TA 2ZIQH 5KECA 1AD8H 5C0UA 1BQYA 2UUKB 2CV3A 2F91A 5E2PA 1VITG 3DT0H 3TITA 3EA8A 5FAHA 1D3TB 4XSKU 4LXBH 1MAXA 2CGAA 2R0KA 4E06H 1O34A 4INHA 1V3XA 1OS8A 5DPAA 1A46H 2BQ7B 2VVCA 2FP7B 2VU8E 1T8LA 1BTXA 2ODQA 2HNTF 2AERH 5DSFA 3UQOA 1BTZA 5EQSA 2HLCA 3EGKH 4XBCA 3GCTG 1EP5A 1DY9A 2FO9A 3FFGA 1O32A 2FLBH 4FU7A 4AN7A 1YM0A 3SU0A 4GCHG 2QF0A 2IJOB 1GJ4H 1N8OB 1C2KA 2P93A 2RA3A 3UNRA 2GT7A 1DUEA 2ZCLP 3M7UA 1C2IA 1Z7KA 1A3EH 2J97A 3VB7A 2QYIA 3Q3KA 1UVTH 4MNXA 1CGJE 1V2JT 1GMHG 1O38A 2GJGA 1QIXB 3RC4A 5TCCA 4TWYA 4B73A 4CR5A 2ZGBH 3ZZCA 4ABJA 1K9OE 2BB4A 5DK1A 1SOZA 1WSSH 2ZKSA 4XFQA 1ANCA 2QAAA 1AN1E 3VXEH 1RGQA 5DP8A 3RXMA 2C90B 3AASA 4UFGH 2VINA 1O5AB 3VXFH 1JIMA 3LT3A 1O2YA 5B6LA 1UVOA 1Y3UA 4AYVB 4BAKB 2Y5GA 1C5YB 5B6OA 3K65B 1TOMH 3ZVBA 1LVBA 2A4OA 1FX0B 1N6YA 2V7QD 3KN2A 1SI5H 3N7OA 3GDSA 2BLQA 1UHBA 1J16A 2HOBA 3CNRA 1THPB 1H4WA 1YPHC 1NRSH 1X7AC 2YMSB 4JZDH 1IHTH 1VITH 3PTNA 3O8BA 2J95A 5HMAA 4MNVA 2OK5A 3A80A 1D4PB 1C5OH 2YNAA 4JYUH 5F53A 3HGNA 2ZTZA 1CT2E 1GI2A 1SGFA 2V35A 3EDXB 4HTCH 2BX3A 3UREA 1ELCA 1P12E 2XRCA 1UK4A 1W10U 1HJAC 1QL7A 1V6DA 3P92A 3TU7H 3RLWH 1DX5M 5A8ZA 4CR9A 5A0AE 4YT6H 1A5HA 1A4WH 1QQ4A 4ISOA 2HVXA 4UFEH 2UUJB 1ELGA 4IMQA 1KLJH 4FUGA 3BSQA 2O8TA 3V13A 1BMLA 1K1NA 1QY6A 1FN8A 1GI1A 2GP9B 3GY2A 1O3PB 4Q4LA 4F4OC 2ZP0H 4I8LA 1AFQC 2FXRA 1H8IH 1SC8U 4ZHMU 2ZQ2A 4A92A 2ALVA 4UD9H 4Y7AA 1C2LA 1NROH 5GCHG 1H1BA 3S9CA 3JZ2B 2A31A 4MPXA 2F9PA 3DSOA 1QURH 4GUXA 1O3IA 1EKBB 1V2ST 5KEDA 2BDAA 1HAZB 3SU5A 3RC6A 5I46H 1CBWC 3FAOA 3TIUA 1GBCA 3BTEE 1GCDA 4ZUHA 1L4ZA 1M9UA 2ZFQH 7KMEH 5DP5A 4TT3D 3FP6E 1EASA 2VH0A 2Z3CA 1LKBA 2ZHDA 1GWAA 1Z8JB 1O3MA 1CE5A 2AHME 4Y0ZE 1HJAB 3BG4C 1ACBE 2D26C 2FOHA 1SLXB 1O3LA 5AFZH 2XTTB 5TCAA 3PYHA 1GBJA 1LCYA 3M3SA 1QJ7B 4X8UH 4X6NA 5C17A 2ESTE 1HAIH 3F2FA 2BDCA 2PW8H 1ANEA 3T26A 1WQSA 3QX5H 2ZCHP 1BRUP 2OC1A 1GDUA 3RXHA 3T25A 2Z3DA 4K60A 1AFQB 3QGJA 5F8XA 2FMJA 1IQLA 5T6DA 4B76A 2H1UA 3RXDA 3UWJH 1YC0A 1TQ7B 2XBWA 7GCHF 3DSPA 3BTFE 1L1GA 2ANYA 1GHVH 1QBNA 1V2UT 3QTVH 1V2PT 3PV2A 1TA6A 1GBLA 1FUJA 3E90B 2PUQH 4TSFD 4ABGA 3ZVCA 4TPIZ 3UR6A 1EAWA 1CBWB 2EI6A 3ZYEA 2WPIS 2RDEA 1O5DH 2A32A 3BTGE 1AHTH 4BNRA 2TGAA 2VIOA 1HAVA 2XBXA 3E91A 3FZDA 2RA0A 3BG4B 4MG3A 4IN1A 1GBBA 4YO9A 2WV4A 4ABBA 5DP3A 5JB9S 4A1VA 1BBRK 4HG6A 4Y7BA 2UWOA 2HPQH 4ZMAH 1T31A 4ESTE 1BMNH 1NS3A 3GCOA 2O8UA 1TNLA 9LPRA 4A7IB 2Y82A 2QXJA 1G3EA 3JZ1B 2THFB 5HYOA 1YPGH 2BOKA 3ITIA 3QO6A 1OPHB 5C2ZA 2AFQB 3SV6A 3RP2A 1L1NA 3BTDE 4JZFH 3LGVA 1A5GH 1W2KH 2UWPA 1IQFA 4FXGH 3SV2H 2IOTA 2ZPRA 5A8XA 1O2JA 3PRBA 1T4VH 1PQ7A 1P05A 3O8RA 2PV9B 4Y76A 1OYTH 1LO6A 3GY6A 2Y7ZA 4ZH8A 1ORFA 3CS7A 2F9OA 1BITA 4ABIA 1IHSH 1OOKB 1THSH 1YGCH 1MUEB 3C1KA 4TPYA 3PLPA 4X2VA 2G55A 4WXIA 1SSXA 4MQAA 1XVMA 2ZWLH 1VZQH 1C1TA 1XUKA 1S85A
chains in the Genus database with same CATH topology
3M7QA 1TRYA 2FIRH 4BAQB 1HV7A 1G36A 4BAMB 1SQAA 3H5CB 4AGJA 2QXHA 3DFLA 5GWZA 1DFPA 4TWWA 3UWIA 4MNYA 1O2HA 1P9UA 2A5IA 2FI5E 3U8OH 5C3NA 1O2QA 1OKXA 3TGKE 1O2XA 2O8WA 1K22H 2FOAA 5AFYH 3SGQE 3Q76A 1BRCE 1ELBA 3QTOH 3ATWA 1O5FH 1ZOMA 2H5DA 1UK2A 3U1JB 2A2QH 1ZZZA 3S0NA 1OWDA 1C5NH 2A4RA 3O8CA 2PSXA 2JH6D 1ZYOA 1FAKH 2I6SA 1ZJKA 4IW4E 3V3MA 2J94A 1PYTC 4CRGA 1P2JA 1GJCB 4IC6A 2XYAA 1AKSA 1MTUA 1GHZA 1SLVB 2A7JA 2BD3A 2ZC9H 1B5GH 4Y10E 2ANMH 5EPYA 2TRMA 2SGPE 1G9IE 5EPNA 3TH3H 1RIWC 3SJ9A 3VB4A 2P59A 1SLWB 1QHRB 2SGFE 2WINI 1HUTH 2GCHF 2GZ7A 5F6MA 1AVXA 1AY6H 4ZXYH 1T8NA 3UUZA 1ELFA 5EQRA 1L0ZA 1TRMA 2ULLA 3RU4D 2AIQA 5L30H 1QL9A 4B2CA 1SGYE 1V2RT 1FXYA 2C93B 1FAXA 1WU1A 4OS6A 5JBBS 1LHEH 2FX4A 1TX7A 3A7TA 1AB9C 1D9IA 1O3DA 2QY0B 1ETTH 2HALA 4M7GA 3MNXA 2VWMA 1O2MA 4KTUA 1A61H 2FWWA 2R2WU 2ZO3H 4I31A 3A7VA 3QGNB 1F5KU 1SGQE 2NU2E 1CA0C 1O3GA 1PPCE 1U6QA 3QK1A 4B1TA 1FV9A 4OS2A 1AI8H 3F1SB 1H8DH 3ZZBA 4Q7XA 1W7XH 2AEIH 3TGIE 4D9RA 2RDLA 3A81A 1KXAA 4JK6A 1MZDA 1YBWA 1RIWB 1OWHA 1O2NA 3KHVA 1Z8IB 2Q6DA 3M37A 2NU4E 1N6XA 1T8MA 1P01A 4Y79A 1AWFH 1JWTA 2G52A 2XBVA 2Z9LA 5FXLA 1PPGE 3FANA 2UUYA 1E34B 1BZXE 2F9NA 2FOFA 1IQGA 2ZTYA 1YKTA 7LPRA 4K1SA 1TFXA 4WWYA 2EC9H 1HAOH 1FY4A 1XKAC 1F0UA 3ATKA 2OTVA 3CS0A 4HGCA 4Y6DA 1P11E 2W26A 1AB9B 1GI0A 4A1XA 1GBTA 4IC5A 1DE7H 2SGQE 4ZAEA 1TAWA 4ZHLU 1T8OA 2CN0H 2Q1JA 3SGAE 2ZGCA 2FEQH 2XCNA 1TGNA 2XWAA 1CA0B 2ZFRH 2Y81A 2B9LA 2OQ5A 1TE0A 1LVOA 1ZTKA 3ATMA 1QJ1B 5EW1H 5A0CA 4NA9H 3UQVA 2A4GA 1EPTC 4FUBA 5JBTA 3RXLA 3SV7A 5BPEA 4JZEH 1SGRE 1UTJA 1O2ZA 1C5PA 2GMTB 2W7UA 1IAUA 3BV9B 2OBOA 2PLXA 1Z8GA 1WCZA 1TX6A 2OXSA 3OY5U 4OGYA 3ZVDA 2Z9JA 3E0NB 3MNSA 4FVDA 1GMDG 2AGEX 5LGOA 5JB8S 3TJNA 1EAXA 3BF6H 1O36A 1VCWA 1IQMA 3E0PB 5L6NH 1DM4B 2PHBA 2STBE 4DURA 1GHXH 2BTCE 4MLFB 1O3CA 2ZCKP 3MWIU 3GYMA 1QR3E 1O3EA 1DWBH 1SVPA 5E0HA 4BOHA 4U2WA 2Y80A 3VFEA 1AZZA 4X1SU 1C1WH 8GCHF 4SGBE 5AHGH 1YLCA 2FOMB 2VIPA 4FUDA 1Y59T 2K1QA 1Y3XA 3RXSA 3TGJE 1ESTA 1O2SA 4B2BA 3OY6U 1EUFA 1O3OA 1FIZA 1RTKA 4ABFA 1NC6A 1YCPK 2HPPH 1OP0A 2DUCA 5AF9H 1EAIA 2RCEA 5FPTA 5DP9A 1PYTD 3Q00A 4MPVA 3SW2B 1HIAB 1MAYA 5HM2A 1QQUA 2AMDA 2F3CE 1NO9H 1HCGA 2EA3A 1Z1IA 6GCHG 2IN2A 1K1LA 3RXOA 4E05H 2ZDAH 3LOXA 3ZVFA 1DANH 2W3KA 4MTBA 5GJ4B 4NZLA 3P8OA 1B7XB 4BANB 5TJXA 3P8FA 4I8KA 2XNIA 1QJ6B 5SGAE 1OWIA 2AMQA 1KYNA 1EPTA 1NFWA 1GHAF 4X1RU 4Z6AH 2JH0D 4NCYA 1ABIH 3U1IB 2FOEA 1CHOG 1NRPH 3DHKH 2A45B 1GVLA 1BJVA 3LH3A 1HIAA 4BXSA 3TH2H 1H9IE 7ESTE 2J4IA 1B0FA 3A84A 2O9QA 3E16B 3RXIA 1J15A 1S6HA 1UVPA 3K6YA 1GJ7B 4UEHH 1C1UH 2JH5D 4BTIB 1TX8A 4ISLA 1O3KA 2FESH 4A1TA 2VH6A 3S7HB 3UOUA 1V2TT 3B9FH 3PM3A 1C1NA 4X2XA 1P3EA 3GY3A 3SU2A 3HATH 2ILNA 1G2LA 4JYTA 3SQEE 2GT8A 4MPWA 4Y8YA 2ZNKH 1CGIE 1TONA 2PFEA 3VEQB 2BY8X 3LC5A 1IQNA 2B0FA 1V2WT 3ZVAA 1PPHE 3DFJA 1RTLA 2HNTE 1EXFA 3URDA 3UTUH 1XUGA 4DT7B 1AUTC 1PPBH 3I77A 1GBKA 1C4Y2 2GZ9A 1TNKA 5JBCS 1F5LA 2AS9A 3SU3A 4D8NA 1GI5A 1MTSA 4GVUA 3TK6A 1UCYH 1KDQB 3PLBA 3A82A 1TYNA 4OS5A 1AVWA 1G2MA 5FPSA 3GCTF 1QA7A 1WUNH 1L4DA 4GCHF 3MO6A 1G32B 4YZUA 3M5OA 3QLPH 1VCQA 3ATLA 4J1YA 3H7OA 2ODYB 1BHXB 3ZV8A 4OS4A 1J9CH 3T27A 5A0BA 2O8LA 1ZSJA 1O2WA 1D3DB 1TLDA 2PGQB 4K8BA 4O97A 4ZKRU 2CHAC 3TK9A 1HAPH 1C2DA 3OYPA 1OXGA 5C5NA 3P70B 1QL8A 1TNHA 3NCLA 1GG6C 1GBEA 3LGYA 1GBFA 1ZPBA 4K69A 1ANBA 4CREA 1TGCA 2G51A 1O2TA 2VIDA 3GISB 1TNJA 4XE4A 2BZAA 1GI4A 2ZDLA 1SPJA 4WMEA 1LTOA 3LKWA 3NK8A 4X2WA 5T6GA 2P16A 1TBQH 2QXGA 2P3UB 1ZHPA 1ARBA 5JBAS 2FOGA 1GBHA 2ZHWH 4YM9A 1BJUA 4XOJA 2W7SA 4ZXXH 1CVWH 4DIHH 1HJ8A 1TIOA 3SUDA 3PROA 2BD4A 3EA9A 1MU6B 1IQIA 1GI6A 2PKSC 1DSUA 1XM1A 4IGDA 1TOCB 1P9SA 2BVSH 3VB3A 1C5WB 1TPSA 1QB1A 3LC3A 3T5FH 5GPIB 8ESTE 1MKWH 2BLWA 4I32A 2W5EA 2H5CA 4IBLH 1C5ZB 1C2MA 1HLTH 3QDZB 2CHAB 5FCRA 2ZHQH 3A88A 5DP6A 2B5TB 1DXPA 1TMBH 2ZU1A 4B2AA 5FX6A 2ZA5A 1K28D 1GG6B 3BTKE 5GXPA 3RXUA 1S81A 1SB1H 1Q2WA 2BZ6H 3GYLB 2BVRH 2NU3E 4D76A 1BCUH 4D7GA 2H9TH 2VGCC 2TBSA 1V2QT 2FTMA 1FQ3A 2F9BH 5CMXH 2BD8A 4MVNA 4H6SB 5CHAC 1Y3VA 1GHYH 4CH2B 3HK3B 1C5SA 2C8ZB 3PMHB 5FX5A 3RXJA 3RXBA 2ZHEH 2CMYA 1AGJA 2UUFB 5HGGA 3SNAA 1EB2A 1W0YH 3RM0H 2PUXB 1O2LA 1ELVA 3RXCA 3OX7U 1HJ9A 2ZDKA 1NRNH 1SOTA 2R3YA 1K2I1 3BEUA 2FM2A 2V3HH 2BOHB 1C5QA 2FX6A 1LVYA 1ZSKA 2PKSB 3UNSA 1PPEE 2DE9A 2OQUA 3M36A 1UTQA 2BM2A 3GY5A 3SJKA 4YLQH 5EG4A 1PQAA 3M5LA 1GJBB 4JCNA 1GBDA 7GCHG 1E38B 4QT8C 1BDAA 1GJAB 3TJVA 2O8MA 3ATIA 1MQ6A 3MU4A 2VWOA 3STJA 5E8EH 1C4U2 1YYY1 2QXIA 1MKXH 4MDSA 1C2HA 3A8DA 1ZLRA 2ZGXH 3BG8A 4K2YA 3BIVH 3ZZDA 3RMLH 1BTYA 1HRTH 1TPAE 4X6MA 1TQ0B 2QCYA 2VGCB 3FVFB 1SR5C 3GCHC 5C5OA 3SU4A 1S83A 4Q7ZA 5CHAB 6CHAC 2VJ1A 4ZROA 4X8TH 4K1TA 4FUCA 2KAIB 3I78A 2VWLA 1MTVA 1RS0A 1P2MA 1RD3B 3TK5A 2FOBA 2OBQA 3B8JA 5FHTA 4D7FA 1QBOA 1UTPA 1O2IA 1AFEH 1D6RA 2BD9A 1P57B 1EZXC 3PWBA 3RXQA 1P3CA 3KNXA 4TY6A 1C1OA 3MH4A 4AX9H 4KGAA 2P3TB 1HB0B 1O2VA 2BQ6B 1QB9A 1ID5H 1YP9A 2HGTH 4OGXA 5ETXA 1RFNA 1GHBF 1C5LH 2XC0A 2Y6TA 1O5CB 3LDXH 4VGCC 1MCVA 3VGCB 1QTFA 3AAUA 2ZU3A 1YPEH 4ZKSU 1F0RA 1O2RA 5EODA 4CH8B 8LPRA 2G00A 1PJPA 5A8YA 2FPZA 3F6UH 2BDGA 4RKOB 3SN8A 1S82A 3LIWA 3RUOA 2SGDE 1IOEA 2V6NA 4DW2U 3SNCA 1UVSH 3ZYDA 2BDYA 2HNTC 2NU0E 3U8TH 3GCHB 1KXBA 4Y8XA 1PQ8A 2PTCE 6CHAB 4YESB 2WPLS 1NY22 4GPGA 2Z3EA 3HKJB 1A0JA 2HWLB 5C1UA 2GZ8A 1QB6A 1TB6H 2GV6A 2Z9KA 4NGAH 1LQDB 1IQHA 1C2GA 1AWHB 2PKAB 4DY7B 2D1JA 2BX4A 1YCPM 4RKJB 4VGCB 3VB5A 2Z94A 1FY3A 2G5VA 1A5IA 1C5TA 3NKKA 1O3NA 1QCPA 3A83A 1F92A 2QC2A 4ISIH 1EX3A 1GCTC 1THRH 1TGTA 2FI4E 2NWNA 2FS9A 1Y3WA 3A8CA 6LPRA 1JRTA 1L2EA 5JPMH 3RXRA 2GKVE 5DJ7A 2Q6GA 3RXGA 4K5ZA 2F9VA 3MO3A 1BUIA 2BXTH 4X1QU 2JETC 4WMFA 4NIVA 2GCTC 5EXMA 3TJOA 2I6QA 3SJIA 4B74A 2Z9GA 2GCHG 4ISNA 1SFQB 1P2QA 1KSNA 1G37A 1NESE 9ESTA 2CJIA 1LMWB 1S5SA 3IG6B 2ZZUH 4D9QA 1SGFG 1FLEE 3PMAB 1IQJA 2C3SA 3KGPA 1BIOA 1CHGA 2QA9E 4UONA 3SHCH 1AZ8A 3PWCA 3HK6B 3ODFA 3LGUA 4KKDA 1GDQA 4DOQA 1VCPA 2BD2A 1RXPA 2WUCA 2XWBI 3F9FA 3PO1B 3MH5A 2R3UA 2Q6FA 1GCTB 2TIOA 3UNQA 4HZHA 3EQ0H 1UJ1A 3BIUH 4K8YA 1P0SH 1S0QA 1BA8B 5T6FA 3T2NA 3KQEA 2C4FH 1TALA 3MU5A 2SFAA 1UTOA 2VIWA 1BT7A 5FCKA 1ZRBA 1J17T 3ZZ7A 2BLVA 5ESTE 2XBYA 1AO5A 1SMFE 3ESTA 1HAGE 2FZZA 1TMUH 2JETB 1SGIB 2GCTB 3K6ZA 3P8GA 3IWMA 1BRBE 1UTNA 1ZHMA 5EOKA 4CRBA 1BBRE 3FP8E 2GMTC 2GGVB 3RMMH 1E37B 4AG1A 4AORA 3A7ZA 5DP7A 5PTPA 3RDZA 1TPPA 3GCNA 4R0IA 4E7RG 1TA2A 2OUAA 1V2OT 4DJZB 1WOFA 4I8HA 3QZRA 2BXUH 4O9VA 1T7CA 1KXCA 1ZGVA 1LPZB 1P2IA 4Z0KA 2BD5A 2GTBA 1HBTH 1QRZA 1CA8B 2CXVA 1TRNA 5DG6A 2P3FH 1HAXB 1C2FA 2BDHA 1VR1H 1C1SA 4H42U 4YTAA 2TGTA 2BY6X 1GDNA 1DS2E 1AVGH 1HXFH 2AMPA 2QIQA 5J4QA 2P94A 5EQQA 1SHHB 3TPIZ 2B7DH 1RJXB 4OS7A 1FNIA 1NU7B 2QV1A 3FZZA 3L33A 4U01A 3I29A 2ZDNA 2SGAA 4J2YB 5FPYA 1P09A 1Z6EA 3NWUA 1TBRH 2VVUA 4CRFA 4WJG2 5A2MH 1FZZA 4UE7H 1ZGIA 5EGMA 1EAUA 3SBKA 3LJJA 3CP7A 3RXAA 3T29A 2ZQ1A 4JK5A 2TGDA 3OU0A 2OD3B 5JYIA 3SUGA 2C8YB 1O2UA 1GBIA 1O2PA 1UTLM 1YPJH 1O0DH 3UR9A 1MH0A 1BBRH 5K0HA 3SV8A 2EI8A 1N1LA 1F7ZA 2F83A 2ZFPH 4E7NA 1PPFE 1OWEA 5A09A 2Z9IA 1XUJA 3RMOH 1GI9B 1ZTJA 5GDSH 8GCHG 1E35B 2GVFA 2QF3A 1LHCH 3SORA 1QRXA 1G3CA 4PROA 3K2UA 4FUJA 1DLKB 1ELTA 2WPMS 5BRRE 3STIA 4NWLA 1GVKB 1C4V2 2XW9A 3LGWA 2Y7XA 5AVDA 3BN9A 1K1PA 4XBDA 1W0ZU 1GJDB 2ZFFH 4R8TB 1VJ9U 3BTWE 4DGJA 1FPHH 1O3AA 2FOCA 2ZHFH 1NM6A 2BLOA 2WUBA 3DD2H 1W8BH 1EB1H 1NTPA 3LH1A 1O31A 1A0HB 3D23A 1D3PB 2M5TA 2BY7X 3A89A 2FS8A 1DWDH 1DXWA 1TPOA 3LPRA 2BY9X 3LONA 1MTWA 1LPKB 3GDVA 3Q77A 4WVPE 5C67A 1Q31A 2OCVB 3C27B 3ENSB 1SG8B 1OYQA 3SGBE 1MU8B 3PLKA 1GMCG 2ZG0H 4CHAC 3E6PH 4AOQA 1BTUA 2H2ZA 1TABE 2VIVA 1GHAG 3RMNH 2G8TA 5IYTA 1AIXH 2R0LA 1Y5AT 3M5MA 1ZRKA 4ISHH 4KTCA 1C1PA 5T3HA 3CENA 4O3TA 4U32A 1UCYE 2OP9A 1UVUH 3SHAH 2WV5A 3EA7A 1NRQH 1O5BB 1WQVH 1D6WA 1UK3A 4JMYA 1OSSA 4TY7A 1OWKA 1NRRH 3BEIB 3MU8A 4K1EA 2FYQA 1FJSA 5EU8A 1O37A 2H9EH 1P2KA 1P2NA 3MU1A 4WH6A 2J9NA 4IMZA 4BTTB 1WTHD 3SNEA 1EP6A 5E0GA 1J8AA 1V2LT 3ZZ8A 2BQWB 2XC5A