3E16B

X-ray structure of human prostasin in complex with benzoxazole warhead peptidomimic, lysine in p3
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
247
structure length
247
Chain Sequence
ITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPISLPAAQASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNSLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASWIQSKVTELQPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prostasin
publication title Discovery of inhibitors of the channel-activating protease prostasin (CAP1/PRSS8) utilizing structure-based design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 50
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.-:
pdb deposition date 2008-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3e16B02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3e16B01
2FOGA 5GCHF 1SHHB 1A1RA 1QA7A 3TGKE 2PR3A 2B5TB 3GDSA 4X1PU 3MU1A 1OP2A 3M5OA 1KXAA 1O34A 3M3TA 2BY9X 1UVUH 3NWUA 1WV7H 2ZHQH 3SV2H 1O2IA 1OYQA 2THFB 3H7TA 4A1XA 2Y5FA 3S7KB 1SGRE 3RXAA 3M3SA 2O8TA 4B2CA 2ZGXH 3BF6H 4X1NU 2VNTA 1BB0B 2WPMS 5JB8S 2QYIA 1BHXF 3QGNB 1ZTJA 2BD3A 2R2MB 1HXEH 1QR3E 1WTGH 3RMMH 1UTNA 1HAGE 1Y3VA 1C1OA 2XC5A 4UFGH 4I8LA 1AUJA 1LTOA 7LPRA 3GY6A 1MTSA 4K8BA 3A8DA 2BY8X 2J92A 4CH2B 3ZZ7A 1OXGA 1Y3XA 4Y6DA 3HPTB 3HGNA 1V2ST 1NPMA 1D3TB 1ZPZA 3T27A 1SGEE 1E35B 3CS7A 3S7HB 4THNH 1FY3A 1NC6A 3HK6B 2WPKS 3BSQA 2ZIQH 1GBKA 3HK3B 3UUZA 4X2XA 2ZTZA 3MOCA 1MKXK 4ZXXH 2PSYA 3E0NB 2OXSA 3OU0A 4AB9A 5EXNA 3MNBA 1GI8B 3BN9A 4JZDH 1QFKH 3ZZAA 3V13A 1NM6A 4X6OA 4FU8A 3B9FH 1TYNA 1EZSC 2FESH 1S82A 5C67A 2ZCKP 4XBCA 1G2MA 3T62A 2EA3A 3O8CA 4FVDA 3TH2H 3A8BA 1A0JA 5A8XA 4YOJA 2BZ6H 5E0JA 3OTJE 2PSXA 3FP7E 2DUCA 4ZKNU 2ZDNA 1OX1A 2AGGX 4AN7A 3SU4A 1GWAA 1T8NA 1AZ8A 1TX7A 2QXIA 1GGDB 3MWIU 1QCPA 5CMXH 5PTPA 5FXLA 3F9EA 2G5VA 1T7CA 2LNCA 4FUHA 4LZ4B 3M61U 2QN5T 3FFGA 2VB0A 1Q31A 3A7XA 1J16A 1CT0E 2RA3A 2A1DB 2ZHEH 4ZH8A 4K1TA 4Y0ZE 3LC3A 5E8EH 2ALVA 4D8NA 1GGDC 1DICA 1SI5H 3TK9A 3BEIB 4WY3A 3TJUA 1DSUA 1MZDA 1C5YB 2YOLA 4CBNA 3V12A 2ZCLP 1AD8H 1F5RA 2BD9A 2XBWA 1E0FD 5GIBA 4XFQA 1MQ6A 2FI5E 1V3XA 2QXHA 3ATMA 2XBYA 1NTPA 2O9QA 1EAWA 3ENSB 5F03A 2ZDKA 1MD7A 1SBWA 3H5CB 4DIIH 1LVMA 1W12U 3HKIB 4BAOB 4MNXA 4INLA 4M7GA 1KXEA 4ISNA 3TNTA 1VCPA 2XNIA 1BOQA 3GYMA 2QIQA 3KIDU 2ZWLH 1GJ6A 3SU1A 5DPAA 4X8TH 4ABAA 2XWAA 4YT6H 1ACBE 1O2JA 3IITA 2O8MA 3HGPA 3UOUA 2OBQA 2FIRH 1K1LA 3DUXH 2ZPQA 1ELEE 1QRXA 1FIWA 3E1XB 4TY7A 3CENA 3P8NA 4HGCA 3SU3A 2ZQ2A 5I46H 1UVOA 3GY3A 3A84A 4MNWA 2BY5X 1O3JA 4BOHA 4GSOA 1OP0A 2BB4A 1K1OA 1EJAA 3PO1B 1EAIA 2ZQ1A 3PMBB 1O2UA 1CE5A 1GVLA 1FJSA 1OKXA 1LDTT 1DUAA 1F7ZA 1LHCH 4YT7H 5DK1A 1EZQA 4A1VA 5JBBS 1SLWB 1ABIH 1V2TT 3F9HA 1WUNH 1O3PB 4NWLA 2PV9B 4JCNA 1C4V2 1LMWB 1FN8A 3E90B 1DITH 1KXFA 2ZHWH 5EGMA 1ANBA 1BBRH 4GHTA 4Y10E 3TJOA 7KMEH 4H6TA 1YCPM 8LPRA 2QV1A 3OX7U 2SGQE 2W3KA 4SGBE 4IGDA 3OYPA 2GT7A 1AKSA 1HAXB 2Q6DA 3QTOH 3UNSA 1HRTH 3TIUA 1G3CA 1CT2E 3I78A 2ZDVH 2PKAB 1SSXA 3SV9A 1C5PA 1O5DH 1JOUB 3RU4T 1ANDA 4WXIA 2Q6GA 4CRFA 1E37B 2ZF0H 4OS1A 2PLXA 1CSOE 1IQJA 1K1PA 4RKJB 2ULLA 3VGCB 2STAE 6GCHF 2ZDMA 3MFJA 1SL3A 1D3PB 1KTTB 1FY4A 2ZFFH 1FNIA 1BTPA 1DPOA 3DFJA 3FZZA 3ATLA 2FPZA 1KIGH 1HJ9A 4TWWA 4FXGH 3M35A 2EI8A 1CT4E 1C1SA 1P9UA 2VJ1A 1IQLA 4NA8A 3VGCC 1EATA 4ABDA 1UK4A 2Z3EA 1DANH 2TGPZ 1MQ5A 4X8VH 1RD3B 4AB8A 1LHDH 3BTWE 2ZFPH 2Y7XA 5LPFA 2ESTE 1ZPCA 1V2OT 2BOHB 1HFDA 2ZFSA 1MH0A 1M9UA 1C2LA 1S85A 1P10A 3P92A 5FX5A 2RDLA 1BRCE 3RU4E 1SR5C 5C1UA 1VGCB 3UNRA 1TNGA 1QL9A 1O3IA 1DLEA 3LU9B 5EPNA 3G01A 1UHBB 2ZG0H 1BBRE 1P03A 3RXEA 3W94A 4Y7AA 3BEFB 4D9QA 3MH5A 1W7GH 3UR6A 2OTVA 1C2GA 1F0SA 2FO9A 1AFEH 2CV3A 1O2HA 1S6FA 2CMYA 1TGCA 1ZYOA 1QA0A 3AW1A 1DSTA 2H9TH 1C5ZB 5G4BA 1VGCC 3BTHE 4GUXA 5T6FA 4X1QU 2XCNA 1BCUH 1G32B 1O5GH 2AMPA 4ZHMU 1MKWK 1KDQA 1C1VH 1HCGA 4AZ2B 1JRTA 1J17T 1VCWA 3MO3A 3LJOA 1G3EA 5HM2A 4DVAU 4B75A 1SGCA 4HZHA 4INKA 3M5NA 1SGQE 1UHBA 1NU7B 1TGSZ 1O2GH 3TPIZ 1T4VH 4ISOA 1E38B 3TK6A 4A6LA 1AN1E 1GI2A 2BX4A 1BBRK 1V2LT 3RXOA 3NUMA 4UE7H 4ABIA 3EGKH 3SOSA 4JZEH 4CR9A 4X1RU 1V2JT 1O5BB 4FUFA 2G5NA 2BVSH 3M5MA 4ABEA 2KAIB 4X8SH 2R0KA 3Q76A 2BM2A 2TBSA 1O3OA 1ZSKA 1GCTB 4TY6A 4ABGA 3UWJH 1NZQH 1ZTLA 1C9TA 2FI4E 3MNCA 5AF9H 1ZGIA 1QTFA 2OC8A 1P2KA 1AI8H 5HYOA 1LQEA 4I32A 1FY5A 3EQ0H 3ZVFA 5TCAA 3LGVA 3PV4A 3BG4B 3VEQB 1XUGA 3HATH 1KLTA 4BAMB 4H42U 1SLVB 5JPMH 3LIWA 2VWOA 3TGJE 1F5LA 4BXSA 1GCTC 2B8OH 3SGBE 3OY5U 3EAJA 1O31A 4NA7A 1TPSA 1NO9H 1ESTA 2SNWA 3SHCH 1S6HA 2BDCA 2ZPRA 1IOEA 1PPEE 4MPXA 3BG4C 5DO4H 3A87A 1QL7A 3E3TA 4MLFB 2OC7A 4IBLH 3PYHA 1SFQB 5A2MH 1NFUA 3TH3H 2G4UA 3ESTA 3I77A 2ANYA 5DKMA 1LVOA 4B2BA 1VCQA 5C2ZA 6ESTA 1ELCA 3FP8E 3SZNA 2SGFE 1EPTB 1UCYH 4R0IA 1TNJA 1RTKA 2A7HA 2EI7A 2WUCA 5E0HA 1GL1A 2WV5A 1LKAA 2O8UA 1C1PA 3RXKA 1ARBA 5A0CA 4X0WU 3RC4A 2A4RA 2P3TB 3RXPA 5C5OA 1IHSH 1SLXB 4IMZA 4KTSA 1GBIA 3ZZ9A 5AFYH 1PPHE 2UWLA 3T5FH 4ZAEA 6CHAB 2J94A 1QIXB 4AG1A 1MAXA 4LK4A 1AWFH 2TRMA 1O2WA 3ZYEA 1Y3WA 1EPTA 4K8YA 1GHAG 1GI1A 2AERH 1NN6A 3JZ1B 4MPWA 2Y6TA 4ABJA 1TNKA 2LPRA 4MG3A 4NIYA 6CHAC 4O9VA 1QB1A 1P06A 3NCLA 2ZPSA 1C5VA 4MNYA 3RMNH 1BMLA 1GI5A 4IW4E 1WBGB 3DT0H 2GTBA 2V3OH 3L33A 2JH5D 1UJ1A 4H4FA 2R3UA 1QJ6B 1VITF 1AY6H 5ESBA 2FOBA 3SN8A 1GJCB 1TX6A 1L1NA 1ZJKA 1C5WB 1TE0A 1GI7B 3SQEE 1RRKA 1CVWH 4O03A 4GAWA 3OSYA 2A4GA 3LGIA 2FX6A 2BYAX 1IQHA 3ATIA 7GCHF 2BXTH 1SVPA 3M5LA 2A7CA 1UCYE 3Q3XA 2FLRH 1MU6B 1ZHPA 1GMDG 1S84A 1QBNA 4K1SA 1S0RA 1GG6B 2Y82A 1TAWA 1W3CA 3UPEA 2OINA 2HLCA 3EYDA 3FAOA 5HMAA 3STJA 2CF9H 4FU7A 2K1QA 3H7OA 3VB4A 1OP8A 2Z9GA 3BTFE 2XWBI 1IQMA 5C1XA 4X8UH 1ZOMA 2CHAB 3SI4H 1SPJA 2HNTC 2OBOA 4NIVA 3NXPA 1O38A 3LOXA 1GG6C 1HJAB 1F5KU 1LHGH 3GCTG 4B74A 4YESB 1PFXC 2BDYA 5FPTA 3VXEH 3SJIA 1UCYK 1UTPA 4AORA 2QAAA 1CQQA 2IJOB 5HGGA 3SJ9A 3AAVA 2H6MA 2VIWA 1O3NA 1AIXH 2CHAC 1GJ9B 1B7XB 1N8OB 6LPRA 1HJAC 4I8KA 4MPVA 1TWXB 2ILNA 1GBEA 1O3CA 1N1LA 1C2IA 1SB1H 1SGTA 2BX3A 4NWKA 3SV8A 3A7WA 2VWLA 2UUFB 1SG8B 3QWCH 1UK3A 3MU5A 3QTVH 4KELA 4U2WA 2WYJA 1HBTH 2PKSB 1HAPH 3P8OA 1TRMA 1N8OC 4FUGA 1OOKB 1FXYA 1C5RA 3LGYA 2J2UA 4I8JA 1L0ZA 1RTLA 1BJVA 1SGDE 4HI3A 3VB5A 3EA7A 4I31A 3DD2H 4IN1A 4WH6A 1XUJA 2ODPA 1DS2E 1DWDH 2PKSC 2VIVA 4WWYA 1C1MA 2W3IA 3PLBA 2D2DA 3Q77A 4Z0KA 4FUBA 1C2FA 1FI8A 1ZTKA 1OWJA 1DLKB 3CP7A 1VITH 2CGAA 3LGTA 3VB6A 1O30A 1AQ7A 3U69H 2R0LA 3RXFA 2BHGA 2EEKA 3JZ2B 1D6RA 3GCOA 3TITA 4Q7XA 1C4Y2 3OY6U 3SNEA 3RXUA 2BDGA 1C1NA 1GBAA 3BTEE 4ZXYH 5IYTA 4NIXA 2UUYA 2A5AA 2FODA 4UFFH 4OGXA 1GI4A 2JH0D 1HYLA 2HVXA 2VU8E 1TNLA 1FAXA 1GMHG 3V7TA 1XUKA 2OQUA 3QO6A 4GCHF 2FTLE 5AFZH 1O2LA 4KP0A 4WMDA 2GCHF 2Q6FA 2F9VA 1GBHA 1BJUA 1QHRB 4KTUA 1AFQB 1TGNA 3GOVB 5GCHG 1HXFH 1MAYA 1H9IE 2HPPH 1EAXA 2QCYA 3S9AA 4ISLA 3T26A 1GMCF 3R0FA 1DUEA 3O8DA 1O3GA 1WAYB 1H9HE 2BOKA 2ZU4A 1MZAA 5DG6A 3GY5A 5EQSA 3MNSA 2FOFA 4ABHA 4K1EA 1AFQC 4GVUA 1OWKA 1OWIA 5EXMA 2B9LA 3UFAA 1QBOA 1J15A 1UMAH 2FOAA 4AGKA 4DJZB 2BDIA 2WINI 1SLUB 4BXWA 1XKAC 4WXVA 1L2EA 1P09A 4DURA 5TCCA 2GMTB 2A4OA 5A8YA 4E7RG 1FY8E 1LVBA 5ABWA 2A32A 3A82A 5B6OA 1CHOF 4XBBA 3LPRA 4GPGA 1XMNB 1T8OA 2SGPE 1A46H 2AH4X 1Q2WA 2BTCE 1C5NH 4X6PA 1BRUP 1IQEA 2ZI2H 2A5IA 3K65B 1ETSH 3TJVA 1FPCH 1HB0B 4AFZA 1UTMA 2AMDA 3MU0A 1NRNH 1QNJA 3U98H 2GVFA 2GMTC 1XVMA 4D7FA 1U6QA 2BD2A 2HRVA 8KME2 1H4WA 4NGAH 5FBIA 1RXPA 5LH8A 2F9NA 1LHFH 2GZ9A 3RMOH 5E0GA 1PQ5A 3SBKA 1C2KA 1KXCA 3QUMP 3SJOA 4Q7YA 4Y71A 3GY8A 2ZGJA 3Q3KA 1L4DA 3URCA 3U8OH 4BAQB 4CRCA 1YPKH 2BDAA 4X2WA 5LPRA 3QX5H 3ZZ5A 3E16B 4ZROA 3PMHB 3RXHA 1GBLA 1IHTH 1P8VC 3T25A 4O3UA 1DE7H 3FZDA 2ZA5A 3LJJA 1QQUA 3QK1A 1QURH 1LKBA 8ESTE 1Z6EA 2BD7A 2OC0A 5LPEA 4D76A 1AVXA 3I29A 1SHYA 3FVFB 1TBQH 1F92A 1WOFA 1O5CB 4IN2A 1ZRKA 3U9AH 1EUFA 1AKSB 2GDEH 4AYVB 3ZZ6A 1HAOH 4AFQA 1Z8RA 3SGAE 5L2YH 3FP6E 2XRCA 2CN0H 3SW2B 1EB1H 2Z94A 4O3TA 1P3CA 4MNVA 4UFDH 1L1JA 3PO1C 2P3UB 3SUGA 4FUIA 1YPHC 4K2YA 4LXBH 1LHEH 1BUIA 4FU9A 3ZVBA 2F9OA 4CRGA 1MUEB 2C8WB 4KKDA 5K7RA 1D3DB 1FLEE 5EODA 3BTKE 3RU4D 2ZTYA 3KNXA 1ELTA 1Y3YA 5DP5A 3ZZCA 1ZMLA 1MD8A 3ATWA 1CO7E 1THPB 4FUJA 2IPHA 1WU1A 1ZSLA 3L6PA 3SUDA 1G3BA 3SORA 1A2CH 1JBUH 2HALA 3S9BA 1MTNB 1ESBA 2J34A 1T8MA 5A09A 3VB7A 2WV4A 1YF4A 4KTCA 1UVSH 2QC2A 3SO3A 1AZZA 1DY9A 3EE0B 1CU1A 3MU8A 8GCHF 4YM9A 4FVBA 1IQGA 2Q1JA 2VWMA 1GHXH 5T3HA 4YLUA 1O3HA 4ZUHA 2F9UA 1T4UH 1GHWH 1MTNC 7ESTE 3S9CA 1J9CH 2GCTB 3F9GA 1DVAH 1TPPA 1MCTA 2GV7A 2TPIZ 1ORFA 3MU4A 1XXFA 2VIDA 1S83A 3MO6A 3K6ZA 1KLJH 4E06H 1XVOA 2G4TA 4X6NA 1TFXA 2ZZUH 3D65E 5GWZA 1O3EA 5I25A 1YPJH 1TOMH 1V2VT 3A8CA 2GCTC 5F8TA 3D62A 1EAUA 1JIMA 5H4IB 1NFWA 3KL6A 1N6YA 2D26C 2WPHS 4CREA 1K21H 1KDQB 1YCPH 1O2RA 1AVWA 1MU8B 1Q3XA 4FUCA 4U32A 4NZLA 2PFEA 1O3AA 1TQ0B 1FY1A 3SUFA 3SNAA 1FDPA 3LC5A 1HAVA 1GBBA 5T6DA 1HLTH 2QY0B 3LONA 4ZKOU 3TK5A 1PJPA 4FUEA 1UK2A 1WQVH 2YNBA 4BTIB 4R8TB 1GDQA 2IOTA 2Z9JA 3U8RH 1ABJH 1BRBE 2WPIS 1GJBB 2PUXB 1GPZA 1K9OE 1GJAB 2SGDE 3M7TA 1TGTA 1WCZA 4WH8A 5LGOA 1XUFA 1BTZA 9ESTA 1QRZA 4Q80A 1V2WT 3ZV9A 1V2UT 4I8HA 2D1JA 4ASHA 3PTNA 1ZHMA 3TNSA 2OC1A 2QXGA 3QDZB 2GP9B 1BQYA 5TJXA 1HAZB 1O2VA 1P2OA 1CBWB 1LPZB 1V2RT 1FQ3A 3TH4H 3K9XB 3A7ZA 3P8FA 4GLYA 6GCHG 1A0HB 4YZUA 3GYLB 2ZP0H 1INCA 3GDUA 2PGQB 3PM3A 2V3HH 2UUKB 3GY7A 2F3CE 1IQIA 2TIOA 1GVKB 5K0HA 1MCVA 5FX6A 1W0YH 2V6NA 5GJ4B 4OS5A 4DGJA 4AGJA 3RXMA 1S0QA 5F8ZA 1CBWC 5A0AE 1N6XA 1S5SA 1FONA 4A7IB 3C27B 4AX9H 4QT8C 3SU0A 4HTCH 1X7AC 3BIUH 1TA2A 2XC4A 1HUTH 1BMNH 1XUHA 2A4QA 4I8GA 4Z6AH 4Q7ZA 3ODDA 4A1TA 1THSH 3ZZDA 1E34B 2A7JA 1BRAA 2A2XH 2C8YB 2OCVB 4JYVH 2STBE 1DXWA 3V3MA 3UTUH 5DP8A 2GX4A 3RXIA 3MO9A 2C8XB 2NU2E 3BEUA 1G3DA 1O3FA 4MTBA 5FCRA 4H6SB 2FDAA 1SQAA 1C2HA 3T2NA 2FXRA 1QBVH 1NFXA 3M36A 3ZVGA 5CE1A 4ZHLU 4YLQH 2ZNKH 2ODQA 1OWHA 3RXBA 2XBVA 4OS4A 1O5EH 2SFAA 2R9PA 4WVPE 4NA9H 1A4WH 2AEIH 3C1KA 3E91A 1O3MA 4MPUA 1K22H 2A31A 1AVGH 3TLOA 3NKKA 2XBXA 1V2QT 1EPTC 4CRBA 1JIRA 4AFSA 3VFEA 3GDVA 1XX9A 2TGAA 1BDAA 4IC6A 3QGJA 2NU0E 1TBZH 3VPKA 1GHBF 2FI3E 1C2MA 3A83A 4X1SU 1FPHH 1OWDA 1BHXB 1HDTH 5GPIB 2CJIA 4ISHH 1NRQH 4A5TS 1P0SH 4F4OC 1A5HA 1DOJA 2VINA 2Z3DA 1GHZA 2DE8A 3F1SB 2XTTB 5C3NA 1OSSA 4MVNA 1ANCA 2PTCE 9LPRA 4NG9H 3MTYA 1P2NA 1DWCH 1O39A 3KQDA 1QRWA 4BAKB 2PW8H 3A7YA 1GJ4H 4CH8B 1EX3A 1PPGE 1IQKA 2BZAA 2ZDLA 2P94A 3RXDA 1GBMA 2UWPA 2Y5GA 1C5OH 3UNQA 1K1IA 4ESTE 4DW2U 2VIOA 1K1MA 1YC0A 4WJG2 4IS5A 2NU1E 2HOBA 3PWCA 5GXPA 2ZFTA 2FYQA 1YLDA 1L1GA 1XKBC 3V0XA 1SFIA 2F9PA 2W7SA 1AE5A 2XW9A 3EDXB 4DY7B 2Z9KA 1Z1JA 1TOCB 2GKVE 3MI4A 4UEHH 4B71A 1P11E 1PQ8A 1NS3A 3KF2A 1HIAA 1MKXH 5DGJA 1KXBA 1OYTH 2HWLB 1A5IA 2H9EH 1O2SA 2AFQB 3SU5A 1WSSH 2FOEA 1GI0A 2C93B 2DE9A 3RXRA 3UR9A 2R2WU 1QJ1B 1GBFA 3ZZ3A 1P2JA 2VGCB 2ZHDA 1A3EH 4WMFA 1DWBH 1KY9A 1A3BH 1VJ9U 1BTHH 1FV9A 3O8RA 2G51A 4E7NA 1HGTH 1GBTA 4X2YA 2ALPA 1ELBA 1O2QA 3VB3A 3D23A 5EPYA 2AIQA 1HNEE 2FX4A 2FYRA 3LT3A 1O3BA 4B73A 1NESE 4CBOA 1BZXE 4XE4A 1SQOA 5C5NA 1MTVA 1LO6A 1BTXA 2VGCC 3SQHE 2BY6X 2GZ8A 5A8ZA 5HXFA 2D8WA 3BTME 2Z3CA 2A0QB 3M7QA 4UONA 4Y8YA 1FZZA 3PLPA 3RXTA 1NFYA 4X6MA 3E8LA 2BD4A 1W11U 1RGQA 1ETRH 2ZC9H 1LQDB 2J95A 2QGRA 1VZQH 3Q00A 1MTUA 3ZVAA 1DT2A 5A0BA 3P17H 1KYNA 1C5TA 1VJAU 1EZXC 3GICB 1GCDA 1O2PA 1YPHE 5C20A 2BLQA 4DG4A 3BTDE 2W5EA 3AAUA 5JB9S 1TQ7B 1Y5UT 2OUAA 3UY9A 2XC0A 2P95A 3T28A 4AYYB 1NT1A 1G30B 4K5ZA 1VITG 1DDJA 2A5KA 2AIPA 1O2NA 1FAKH 3STIA 1O32A 1YP9A 3NZIA 3ELAH 5F6MA 3S69A 3M37A 1C2JA 4DT7B 1D4PB 2VVUA 2PGBB 3AASA 2ASUB 3TGIE 1AE8H 4KGAA 5JBTA 3A88A 1C1UH 2A2QH 2NU3E 3LGWA 1O37A 3N7OA 4RN6A 2RG3A 1SGFA 3RC5A 5CHAB 4TPIZ 1ZJDA 1C1RA 3ZZ4A 3RC6A 3SI3H 7GCHG 3PTBA 2EI6A 2BQ6B 3MHWU 1UTOA 4WF8A 3MH6A 4MQAA 2TGTA 1O2ZA 1GBJA 2VIPA 2GZ7A 1FIZA 2ZEBA 2BMGB 3BTTE 2ZO3H 4Y8XA 1QB6A 3ZZBA 2FS8A 1CA0B 2UUJB 5CHAC 1P04A 4YO9A 2RCEA 1DX5M 1TX8A 1YPEH 1CHGA 3KGPA 4WMEA 1QB9A 3KEEA 4U01A 3B23B 4O97A 4ZKRU 1KSNA 1V6DA 2IN2A 2BVRH 3PWBA 4TWYA 3DHKH 1ZMJA 3AVZA 4NSVA 5GDSH 2AGIX 3RXSA 1V2MT 1SGPE 1PPZA 1EASA 4F49A 1C5LH 2OP9A 1CA0C 3RP2A 3MNXA 1B0FA 2C4FH 5FPSA 1C1TA 2J38A 1AMHA 1J14A 4XDEA 4IMQA 3FANA 1W13U 3EA8A 1C2DA 4LOYH 5AVDA 1GHYH 5ESTE 1K28D 1EKBB 3RXLA 4K3JA 2HNTF 2JH6D 2ANKH 4NCYA 2OQ5A 5L30H 1Z1IA 1LVYA 1P2MA 1QJ7B 5BRRE 1YLCA 5EQRA 4JK5A 3A81A 4OS6A 5FHTA 1TNIA 4I33A 4AFUA 1TMBH 1YKTA 2Z6BD 2VH6A 5T6GA 1J8AA 3E0PB 1O3LA 2VWNA 1C2EA 1P57B 5E2OA 2V0BA 4NFEA 4YTAA 3SNDA 3A7TA 2YNAA 5JBCS 1KXDA 1RFNA 3MMGA 3LGUA 3NK8A 1UVTH 2A45B 4PROA 1EP5A 4XBDA 4OGYA 2XXLA 3A80A 3IWMA 2W7UA 4BANB 1SC8U 1F0UA 2QF0A 1O2TA 2VH0A 5J4QA 4I7YH 2FOMB 1CA8B 1SQTA 3KQEA 3U1IB 5EXLA 1G2LA 2BQ7B 1TNHA 4BAHB 2H1UA 1G37A 1SGYE 2FTMA 3ZVDA 1F0RA 2PTNA 3RLYH 5EW1H 2PWXA 1GVZA 2I6QA 2VVCA 3BTQE 1Y5BT 3BTGE 1NRPH 3O8BA 3ZVEA 1ELDE 1C4U2 3HKJB 2WUBA 2FLBH 1P12E 1GI9B 1W7XH 3PB1E 1QY6A 5BPEA 3SV6A 2ZU5A 1H8DH 1O0DH 3UQOA 1ELVA 1HV7A 2CXVA 5EQQA 5FBEA 1NRRH 1CGIE 1GI3A 3QZQA 5FCKA 4RSPA 5DP3A 1TA6A 1ELAA 2Y80A 3ITIA 1UO6A 1JMOH 1DXPA 2HGTH 4GCHG 3U1JB 3CS0A 2QXJA 1O3DA 3QZRA 3E6PH 2GCHG 3QLPH 4NFFA 1YYY1 1P05A 2BVXH 4YOIA 3DFLA 1V2PT 2FM2A 1O33A 1MKWH 1YPMH 2PHBA 1GMCG 3D49H 4AOQA 2ZGCA 2QF3A 2FOHA 1BIOA 1Z6JH 1PPCE 1ZGVA 3AW0A 1E36B 3W95A 5JYIA 1G9IE 1TB6H 2BLOA 2H2ZA 2ZU3A 3R3GB 3S0NA 3ZVCA 3DA9B 1O2OA 5HM9A 4MDSA 3TVJB 1O35A 2H9HA 1TMUH 2BD8A 3SU2A 2B0FA 2ZECA 2GV6A 4OS2A 3ODFA 2AYWA 1H1BA 1EQ9A 4NZQA 2Y81A 4XOJA 1YPLH 1LPGB 2G81E 3LH1A 3BIVH 1ZMNA 2OLGA 1S81A 1W10U 2O8WA 2P3FH 2QA9E 3GCNA 4ABFA 4TYDA 1EJNA 1CHOG 1NY22 1W2KH 2RA0A 2UWOA 2FMJA 3GCHB 1AU8A 1A61H 3VXFH 1SGFG 2GD4B 1MMJN 1C9PA 1XUIA 1PYTD 1ZHRA 2FWWA 1KTSB 3A86A 3SNCA 4D7GA 3ATKA 2TGDA 1SGIB 1C1QA 1V2NT 1W8BH 2G55A 1PQAA 1BITA 3A85A 2FEQH 2H5DA 3KQCA 1EOLA 1Z8IB 1GJ7B 1O2MA 3UQVA 4ZKSU 3GCHC 4BTTB 1HAVB 2F83A 1UTKA 1O2XA 2V35A 1YM0A 1JRSA 3RXJA 1TGBA 1NROH 3QN7A 3RDZA 2ZKSA 4UD9H 5DP6A 1EZUC 1Z8JB 1BTUA 3RXGA 1D3QB 2PKAA 3RMLH 2BLVA 4LZ1H 2ZHFH 1EJMA 1XM1A 1P9SA 1BTWA 2AMQA 4J1YA 4B1TA 1BA8B 3GY4A 3SUEA 2F91A 1IAUA 2J9NA 2FS9A 1AUTC 1Y59T 2O8LA 1THRH 1OWEA 4E05H 1EXFA 2BD5A 1XXDA 1Y8TA 5FAHA 4K60A 1O36A 1PPBH 5JBAS 3M3VA 5E2PA 2JKHA 5EU8A 1O5AB 2W26A 2WPJS 2Y7ZA 3K6YA 4Y8ZA 5DJ7A 5F8XA 3SV7A 3RLWH 4Y76A 1K1NA 2BDHA 2BDBA 3P70B 1FN6A 1RIWB 1P2QA 3PMAB 1PQ7A 1Z7KA 4ISIH 1C5UA 1EP6A 4RKOB 3L3TA 2C8ZB 2P8OB 3RXQA 4GHQA 1QQ4A 3BG8A 4K69A 1BMMH 3URDA 3SHAH 3UOPA 1MBMA 1VR1H 3PROA 3RM2H 1TONA 5DP9A 2HNTE 4AG2A 2B7DH 3M7UA 1JWTA 1DY8A 1T32A 1F2SE 1GBDA 1RIWC 2SNVA 1ARCA 1ZLRA 1GI6A 3SJKA 1AB9B 2AS9A 1RJXB 4IC5A 2P8OC 4Q2KA 4DIHH 1D9IA 2EC9H 1H9LB 1RS0A 1OS8A 8GCHG 4Y0YE 1LPKB 1GHAF 1HAYB 3RM0H 3TJNA 1QL8A 3P95A 1C5MD 1BMAA 1C1WH 1HAIH 1H8IH 2ANMH 1AB9C 2NWNA 2ZU1A 3SU6A 2H5CA 1AHTH 3F68H 1EB2A 4ZMAH 3RXCA 3PLKA 1DWEH 2P16A 1MBQA 2J4IA 3SNBA 2C3SA 5EW2H 3SJ8A 2I6SA 3KQBA 3UREA 1HJ8A 4J2YB 5FPYA 2M5TA 1T8LA 3MH7A 4INHA 3GISB 1TABE 2Z7FE 3LH3A 3PMJA 3P8GA 3UIRA 1Y3UA 2GGVB 1ZRBA 1SMFE 1A0LA 1AWHB 1O3KA 1TRNA 2KAIA 1F0TA 2ZDAH 1GJ5H 1UTQA 3ZV8A 1AO5A 1D6WA 4Y79A 4JK6A 1CGJE 1FMGA 3TU7H 1SOTA 3A7VA 1YBWA 1GMDF 2ZU2A 4CR5A 1GJ8B 4JYUH 2G00A 1YPGH 1UVPA 2JETB 4JZ1A 2BLWA 1WYKA 1YCPK 2R3YA 2ZFQH 4JZFH 3RUOA 1FUJA 4JZIA 5C1YA 4UDWH 5JDUB 5IDKA 3F6UH 3F9FA 3A89A 1RTFB 2P93A 1TLDA 3MH4A 2P59A 1HAHH 1BTYA 2ANWA 1ZR0A 5L2ZH 1BT7A 1TIOA 2BQWB 2WYGA 1ZZZA 1AGJA 3GY2A 1G36A 2WPLS 3BV9B 2JETC 1HPGA 4OS7A 1P01A 5J4SA 1GJDB 3K2UA 4SGAE 2CF8H 3GCTF 3KN2A 1GL0E 4FUDA 3EA9A 1LCYA 4JMYA 1ELGA 2HPQH 2XYAA 1C5XB 3Q3YA 1TMTH 5EOKA 4D9RA 2ZGHA 3WY8A 1IQNA 4TPYA 1TBRH 2GDDA 1HIAB 5DP4A 3UWIA 1O2YA 1ESAA 1B5GH 1TALA 1A7SA 1B0EA 1ANEA 2XCFA 2SGEE 4UFEH 1OPHB 1SOZA 2F9BH 2FOCA 4NSYA 4JYTA 1O5FH 1Z8GA 2BY7X 4BTUB 4ZHAA 5DP7A 1TRYA 2C90B 2Y5HA 3KHVA 2PUQH 4DOQA 4VGCB 1TPAE 2ODYB 1QGFA 3B8JA 2VVVA 1W0ZU 3LDXH 4Y11E 1ZPBA 1T31A 1L4ZA 2VIQA 5EG4A 4A92A 1NRSH 1Z71A 2SGAA 2GT8A 1IQFA 1GDNA 1UTLM 1ZSJA 3RXVA 1KLIH 1O2KA 1V2KT 2ZCHP 4HFPB 5L6NH 2NU4E 4U30A 2Z9IA 2FP7B 1Y5AT 4VGCC 4CHAB 1GBCA 3MYWA 2ZTXA 1GDUA 1TPOA 5ETXA 1K1JA 5SGAE 1C5SA 4CRAA 4YOGA 1P3EA 1SGNE 2G52A 4CRDA 3SGQE 3A8AA 2ZGBH 4NIWA 1ELFA 2AGEX 2BXUH 3LKWA 1ETTH 4X2VA 3ZYDA 1ID5H 4BNRA 1WTHD 3ZZ8A 1K2I1 1WQSA 4CHAC 1W14U 2Z9LA 1EOJA 1PPFE 4ABBA 4XSKU 1YGCH 3KCGH 2G8TA 1NU9A 2FZZA 1UTJA 1P02A 1PYTC 1CGHA 3T29A 1DFPA 1GHVH 2OD3B 3NPSA 2ZFRH 4Y7BA 3IG6B 1JXPA 4DCDA 5AHGH 4B2AA 4B76A 1MTWA 1DM4B 1GMHF 1C5QA 3P6ZB 1GHBG 1A5GH 3U8TH 1P2IA
chains in the Genus database with same CATH superfamily
2FOGA 5GCHF 1SHHB 1A1RA 1QA7A 1H8ED 1NBMD 3TGKE 2PR3A 2B5TB 3GDSA 4X1PU 3MU1A 1OP2A 3M5OA 1KXAA 1O34A 3M3TA 2BY9X 1UVUH 3NWUA 1WV7H 2ZHQH 3SV2H 1O2IA 1OYQA 2THFB 3H7TA 4A1XA 2Y5FA 3S7KB 1SGRE 2KZ4A 3RXAA 3M3SA 2O8TA 4B2CA 2ZGXH 3BF6H 4X1NU 2VNTA 1UW7A 1BB0B 2WPMS 5JB8S 2QYIA 5HKKD 1BHXF 3QGNB 1ZTJA 2BD3A 2R2MB 1HXEH 1VKYA 1QR3E 1WTGH 3RMMH 1UTNA 1HAGE 1Y3VA 1C1OA 2XC5A 4UFGH 4I8LA 1AUJA 1LTOA 7LPRA 4F55A 3GY6A 1MTSA 4K8BA 3A8DA 2BY8X 2J92A 4CH2B 3ZZ7A 1OXGA 1Y3XA 4Y6DA 3HPTB 3HGNA 1V2ST 1NPMA 1D3TB 1ZPZA 3T27A 1SGEE 1E35B 3CS7A 3S7HB 4THNH 1FY3A 1NC6A 3HK6B 2WPKS 3BSQA 2ZIQH 3SZEA 1COWD 1KMHB 1GBKA 3HK3B 3UUZA 4X2XA 1NBME 2ZTZA 3MOCA 1MKXK 4ZXXH 2PSYA 3E0NB 2OXSA 3OU0A 4AB9A 5EXNA 3MNBA 1GI8B 3BN9A 4JZDH 1QFKH 3ZZAA 3V13A 1NM6A 4X6OA 4FU8A 3B9FH 1TYNA 1EZSC 2FESH 1S82A 5C67A 2ZCKP 4XBCA 1G2MA 3T62A 2EA3A 3O8CA 4FVDA 3F0OA 3TH2H 3A8BA 1A0JA 5A8XA 4YOJA 2BZ6H 5E0JA 3OTJE 2PSXA 3FP7E 2DUCA 4ZKNU 2ZDNA 1OX1A 2AGGX 4AN7A 3SU4A 1GWAA 1T8NA 1AZ8A 1TX7A 2QXIA 1GGDB 3MWIU 1QCPA 5CMXH 5PTPA 5FXLA 3F9EA 2G5VA 1T7CA 2LNCA 4FUHA 4LZ4B 3M61U 2QN5T 3FFGA 2VB0A 1Q31A 3A7XA 1J16A 1CT0E 2RA3A 4OM9A 2A1DB 2ZHEH 4ZH8A 4K1TA 4Y0ZE 3LC3A 5E8EH 2ALVA 4D8NA 1GGDC 1DICA 1SI5H 3TK9A 3BEIB 4WY3A 3TJUA 1DSUA 1MZDA 1C5YB 2YOLA 4CBNA 3V12A 2ZCLP 1AD8H 1F5RA 2BD9A 2XBWA 1E0FD 3KQ5A 5GIBA 4XFQA 1MQ6A 2FI5E 1V3XA 2QXHA 3ATMA 2XBYA 1NTPA 2O9QA 1EAWA 3ENSB 5F03A 2ZDKA 1MD7A 1SBWA 3H5CB 4DIIH 1LVMA 1W12U 3HKIB 4BAOB 4MNXA 4INLA 4M7GA 1KXEA 4ISNA 3TNTA 1VCPA 2XNIA 1BOQA 3GYMA 2QIQA 3KIDU 2ZWLH 3NRLA 1GJ6A 3SU1A 5DPAA 4X8TH 4ABAA 2XWAA 4YT6H 1ACBE 1O2JA 3IITA 2O8MA 3HGPA 4HG6A 3UOUA 2OBQA 2FIRH 1K1LA 3DUXH 2ZPQA 1ELEE 1QRXA 1FIWA 3E1XB 4TY7A 3CENA 3P8NA 4HGCA 3SU3A 2ZQ2A 4XRNA 5I46H 1UVOA 3GY3A 3A84A 4MNWA 2BY5X 1O3JA 4BOHA 4GSOA 1OP0A 2BB4A 1K1OA 1EJAA 3PO1B 1EAIA 2ZQ1A 3PMBB 1O2UA 1CE5A 1GVLA 1FJSA 1OKXA 1LDTT 1DUAA 1F7ZA 1LHCH 4YT7H 2AHME 5DK1A 1EZQA 4A1VA 5JBBS 1SLWB 2YMSB 1ABIH 1V2TT 3F9HA 4TSFD 1WUNH 1O3PB 4NWLA 2PV9B 4JCNA 1C4V2 1LMWB 1FN8A 3E90B 1DITH 1KXFA 2L6OA 2ZHWH 5EGMA 1ANBA 1BBRH 4GHTA 4Y10E 3TJOA 7KMEH 4H6TA 1YCPM 8LPRA 2QV1A 3OX7U 2SGQE 2W3KA 4SGBE 4IGDA 3OYPA 2KCAA 2GT7A 1AKSA 1HAXB 2Q6DA 3QTOH 3UNSA 1HRTH 3TIUA 1G3CA 1CT2E 3I78A 2ZDVH 2PKAB 3F2FA 1SSXA 3SV9A 1C5PA 1O5DH 1JOUB 3RU4T 1ANDA 4WXIA 2Q6GA 4CRFA 1E37B 2ZF0H 4OS1A 2PLXA 1CSOE 1IQJA 1K1PA 4RKJB 2ULLA 3VGCB 2STAE 6GCHF 2ZDMA 3MFJA 1SL3A 1D3PB 1KTTB 1FY4A 2KR7A 5C0UA 2ZFFH 1FNIA 1BTPA 1DPOA 3DFJA 3FZZA 3ATLA 2FPZA 1KIGH 1HJ9A 4TWWA 4FXGH 3M35A 2EI8A 1CT4E 1C1SA 1P9UA 2VJ1A 1IQLA 4NA8A 3VGCC 1EATA 4ABDA 1UK4A 2Z3EA 1DANH 2TGPZ 4Q4LA 1MQ5A 4X8VH 1RD3B 4AB8A 1LHDH 3BTWE 2ZFPH 2Y7XA 5LPFA 2ESTE 1ZPCA 3DSPA 1V2OT 2BOHB 1HFDA 2ZFSA 1MH0A 1M9UA 1C2LA 1S85A 1P10A 3P92A 5FX5A 2RDLA 1BRCE 3RU4E 1SR5C 5C1UA 1VGCB 3UNRA 1TNGA 1QL9A 1O3IA 1DLEA 2RDEA 3LU9B 5EPNA 3G01A 1UHBB 2ZG0H 1BBRE 1P03A 3RXEA 3W94A 4Y7AA 3BEFB 4D9QA 3MH5A 1W7GH 3UR6A 2OTVA 1C2GA 1F0SA 5C17A 2FO9A 1AFEH 2CV3A 1O2HA 1S6FA 2CMYA 1TGCA 1ZYOA 1QA0A 3AW1A 3OTPA 1DSTA 2H9TH 1C5ZB 5G4BA 1VGCC 3BTHE 4GUXA 2M2AA 5T6FA 4X1QU 2XCNA 2J97A 1BCUH 1G32B 2WPDD 1O5GH 2AMPA 4ZHMU 1FX0B 1MKWK 1KDQA 1C1VH 1HCGA 4AZ2B 1JRTA 1J17T 1VCWA 3MO3A 3LJOA 1G3EA 5HM2A 4DVAU 4B75A 1SGCA 4HZHA 4INKA 3M5NA 1SGQE 1UHBA 1NU7B 1TGSZ 1O2GH 3TPIZ 1T4VH 4ISOA 1E38B 3TK6A 4A6LA 1AN1E 1GI2A 2BX4A 1BBRK 2KX4A 1V2LT 3RXOA 3NUMA 4UE7H 4ABIA 3EGKH 3F2HA 3SOSA 4JZEH 4CR9A 4X1RU 1V2JT 1O5BB 4FUFA 2G5NA 2BVSH 3M5MA 4ABEA 2KAIB 1S6LA 2R0KA 4X8SH 3Q76A 2BM2A 2TBSA 4TT3D 1O3OA 1ZSKA 1GCTB 4TY6A 4ABGA 3UWJH 1NZQH 1ZTLA 1C9TA 2FI4E 3MNCA 5AF9H 1ZGIA 1QTFA 5CDFE 2OC8A 1P2KA 1AI8H 2WZQA 5HYOA 1LQEA 5HIZA 4I32A 1FY5A 3EQ0H 3ZVFA 5TCAA 3LGVA 3PV4A 3BG4B 3VEQB 1XUGA 3HATH 1KLTA 4BAMB 4H42U 1SLVB 5JPMH 3LIWA 2VWOA 1WDIA 3TGJE 1F5LA 3SYJA 4BXSA 1GCTC 2B8OH 3SGBE 3OY5U 3EAJA 1O31A 2VBCA 4NA7A 1TPSA 1NO9H 1ESTA 2SNWA 3SHCH 1S6HA 2BDCA 3F3BA 2ZPRA 1IOEA 1PPEE 4MPXA 3BG4C 5DO4H 1EFRD 3A87A 1QL7A 3E3TA 4MLFB 2OC7A 4IBLH 3PYHA 1SFQB 2WSSD 5A2MH 1NFUA 3TH3H 2G4UA 3ESTA 3I77A 2ANYA 5DKMA 1LVOA 4B2BA 1VCQA 5C2ZA 6ESTA 1ELCA 3FP8E 3SZNA 2SGFE 1EPTB 1UCYH 4R0IA 1TNJA 1RTKA 2A7HA 2EI7A 2WUCA 5E0HA 1GL1A 2WV5A 1LKAA 2O8UA 1C1PA 3RXKA 1ARBA 5A0CA 4X0WU 3RC4A 2A4RA 2P3TB 3RXPA 5C5OA 1IHSH 1SLXB 4IMZA 4KTSA 1GBIA 3ZZ9A 5AFYH 1PPHE 2UWLA 2KFWA 3T5FH 4ZAEA 6CHAB 2J94A 1QIXB 4AG1A 1MAXA 4LK4A 1AWFH 2TRMA 1O2WA 3ZYEA 1Y3WA 1EPTA 4K8YA 1GHAG 1GI1A 2AERH 1NN6A 3JZ1B 4MPWA 2Y6TA 4ABJA 1TNKA 2LPRA 4MG3A 4NIYA 1W0JD 6CHAC 4O9VA 1QB1A 1P06A 3NCLA 2ZPSA 1C5VA 4MNYA 3RMNH 1BMLA 1GI5A 4IW4E 1WBGB 3DT0H 2GTBA 2V3OH 3L33A 2JH5D 1UJ1A 4H4FA 2R3UA 1QJ6B 1VITF 1AY6H 5ESBA 2FOBA 3SN8A 1GJCB 1TX6A 1L1NA 1ZJKA 1C5WB 1SKYE 3MQKC 1TE0A 1GI7B 3SQEE 1RRKA 1CVWH 4O03A 4GAWA 3OSYA 2A4GA 3LGIA 2FX6A 3OAAD 2BYAX 1IQHA 3ATIA 7GCHF 2BXTH 1SVPA 3M5LA 2A7CA 1UCYE 2OK5A 3Q3XA 2FLRH 1MU6B 1ZHPA 1GMDG 1S84A 1QBNA 4K1SA 1S0RA 3W1EA 2J98A 1GG6B 2Y82A 1TAWA 1W3CA 3UPEA 2OINA 2HLCA 3EYDA 3FAOA 4M9FA 5HMAA 3STJA 5DN6D 2CF9H 4FU7A 2K1QA 3H7OA 3VB4A 1OP8A 2Z9GA 3BTFE 2XWBI 1IQMA 5C1XA 4X8UH 1ZOMA 2CHAB 3SI4H 1SPJA 2HNTC 2OBOA 4NIVA 3NXPA 1O38A 3LOXA 1GG6C 1HJAB 1F5KU 1LHGH 3GCTG 4B74A 4YESB 1PFXC 2BDYA 5FPTA 3VXEH 3SJIA 1UCYK 2K8IA 1UTPA 4AORA 2QAAA 1CQQA 2IJOB 5HGGA 3SJ9A 3AAVA 2H6MA 2VIWA 1YLNA 1O3NA 1AIXH 2CHAC 1GJ9B 5CHBA 1B7XB 1N8OB 6LPRA 1HJAC 4I8KA 4MPVA 5EIYA 1TWXB 2ILNA 1GBEA 1O3CA 1N1LA 1C2IA 1SB1H 1SGTA 2BX3A 4NWKA 3SV8A 3A7WA 2VWLA 2UUFB 1SG8B 3QWCH 1UK3A 3MU5A 3QTVH 4KELA 4U2WA 2WYJA 1HBTH 2PKSB 1HAPH 3P8OA 1TRMA 1N8OC 4FUGA 1OOKB 1FXYA 1C5RA 3LGYA 2J2UA 4I8JA 1L0ZA 1RTLA 1BJVA 1SGDE 4HI3A 3VB5A 3EA7A 4I31A 3DD2H 4IN1A 3PRBA 4WH6A 1XUJA 2ODPA 1DS2E 1DWDH 2PKSC 2VIVA 4WWYA 1C1MA 2W3IA 3PLBA 2D2DA 3Q77A 4Z0KA 4FUBA 1C2FA 1FI8A 1ZTKA 1OWJA 1DLKB 3CNRA 3CP7A 1VITH 2CGAA 3LGTA 3VB6A 1O30A 1AQ7A 3U69H 3OFND 2R0LA 3RXFA 2BHGA 2EEKA 3JZ2B 1D6RA 3GCOA 3TITA 4Q7XA 1C4Y2 3OY6U 3SNEA 3RXUA 2BDGA 1C1NA 1GBAA 3BTEE 4ZXYH 5IYTA 4NIXA 2UUYA 2A5AA 2FODA 4UFFH 4OGXA 1GI4A 2JH0D 1HYLA 2HVXA 2K0QA 2VU8E 1TNLA 1FAXA 5F53A 1GMHG 3V7TA 1XUKA 2OQUA 3QO6A 4GCHF 2FTLE 5AFZH 1O2LA 4KP0A 4WMDA 2GCHF 2Q6FA 2F9VA 1GBHA 1BJUA 1QHRB 4KTUA 1AFQB 1TGNA 3GOVB 5GCHG 1HXFH 1MAYA 1H9IE 2HPPH 1EAXA 3PV5A 2QCYA 3S9AA 4ISLA 3T26A 1GMCF 3R0FA 3WWFA 1DUEA 3FN8A 1O3GA 1WAYB 3O8DA 1H9HE 2BOKA 2ZU4A 1MZAA 5DG6A 3GY5A 5EQSA 3MNSA 2FOFA 4ABHA 4K1EA 1AFQC 4GVUA 1OWKA 1OWIA 5EXMA 2B9LA 3UFAA 1QBOA 1J15A 1UMAH 2FOAA 4AGKA 4DJZB 2BDIA 2WINI 1SLUB 4BXWA 1XKAC 4WXVA 1L2EA 1P09A 4DURA 5TCCA 2GMTB 2A4OA 5A8YA 3GS9A 4E7RG 1FY8E 1LVBA 5ABWA 2A32A 4Q63A 3A82A 5B6OA 1CHOF 4XBBA 3LPRA 4GPGA 1XMNB 1T8OA 2SGPE 1A46H 2AH4X 1Q2WA 2BTCE 1C5NH 4X6PA 1BRUP 1IQEA 2ZI2H 2A5IA 3K65B 1ETSH 3TJVA 1FPCH 1HB0B 4AFZA 1UTMA 2AMDA 3MU0A 3N99A 1NRNH 1QNJA 2WV9A 2GVFA 1E1QD 2GMTC 3U98H 1XVMA 4D7FA 1U6QA 2BD2A 2HRVA 8KME2 1H4WA 4NGAH 5FBIA 1RXPA 5LH8A 2F9NA 1LHFH 2GZ9A 3FKSD 3RMOH 5E0GA 1PQ5A 3SBKA 1C2KA 1KXCA 3QUMP 3SJOA 4Q7YA 4Y71A 3GY8A 2ZGJA 3Q3KA 1L4DA 3URCA 3U8OH 4BAQB 4CRCA 2QE7D 1YPKH 2BDAA 4X2WA 5LPRA 3QX5H 3ZZ5A 3E16B 4ZROA 3PMHB 3RXHA 1GBLA 1IHTH 1P8VC 3T25A 4O3UA 1DE7H 3FZDA 2QF5A 5C94A 2ZA5A 3LJJA 1QQUA 3QK1A 1QURH 1LKBA 8ESTE 1Z6EA 2BD7A 2OC0A 5LPEA 4D76A 1AVXA 3I29A 1SHYA 3FVFB 1TBQH 1F92A 1WOFA 1O5CB 2JJ1D 4IN2A 1ZRKA 3U9AH 1EUFA 1AKSB 2GDEH 4AYVB 2KCYA 4FETA 3ZZ6A 1HAOH 4AFQA 1Z8RA 3SGAE 5L2YH 3FP6E 2XRCA 2CN0H 3SW2B 1EB1H 2Z94A 4O3TA 1P3CA 4MNVA 4UFDH 1L1JA 3PO1C 2P3UB 3SUGA 4FUIA 1YPHC 4K2YA 4LXBH 1LHEH 1BUIA 4FU9A 3ZVBA 2F9OA 4CRGA 1MUEB 2C8WB 3UB0A 4KKDA 5K7RA 1D3DB 1FLEE 5EODA 2YMSC 3BTKE 3RU4D 2KCPA 2ZTYA 3KNXA 1ELTA 1Y3YA 5DP5A 2F4LA 3ZZCA 1ZMLA 1MD8A 3ATWA 1CO7E 1THPB 4FUJA 2IPHA 1WU1A 1ZSLA 3L6PA 3SUDA 1G3BA 3SORA 1A2CH 1JBUH 2HALA 3S9BA 1MTNB 1ESBA 2J34A 1T8MA 5A09A 3VB7A 2WV4A 1YF4A 4KTCA 1UVSH 2QC2A 3SO3A 1AZZA 1DY9A 3EE0B 1CU1A 3MU8A 8GCHF 4YM9A 4FVBA 5EJLA 1IQGA 2Q1JA 2VWMA 1GHXH 5T3HA 4YLUA 1O3HA 4ZUHA 2F9UA 1T4UH 1GHWH 1MTNC 7ESTE 3S9CA 1J9CH 2GCTB 3F9GA 1DVAH 1TPPA 1MCTA 2GV7A 2TPIZ 1ORFA 3MU4A 1XXFA 2VIDA 1S83A 3MO6A 3K6ZA 1KLJH 4E06H 1XVOA 2G4TA 4X6NA 1TFXA 2ZZUH 3D65E 5GWZA 2IJD1 1O3EA 4F48B 5I25A 1YPJH 1TOMH 1V2VT 3A8CA 2GCTC 5F8TA 3D62A 1EAUA 1JIMA 5H4IB 1NFWA 3KL6A 1N6YA 2D26C 2WPHS 4CREA 1K21H 1KDQB 1YCPH 1O2RA 1AVWA 1MU8B 1Q3XA 4FUCA 4U32A 4NZLA 2PFEA 1O3AA 1TQ0B 1FY1A 3F2GA 3SUFA 3SNAA 1FDPA 3LC5A 1HAVA 1GBBA 5T6DA 1HLTH 2QY0B 3LONA 4ZKOU 3TK5A 1PJPA 4FUEA 1UK2A 1WQVH 2YNBA 4BTIB 4R8TB 1GDQA 2IOTA 2Z9JA 3U8RH 1ABJH 1BRBE 2WPIS 1GJBB 2PUXB 1GPZA 1K9OE 1GJAB 2SGDE 3M7TA 1TGTA 1WCZA 4WH8A 5LGOA 1XUFA 1BTZA 9ESTA 1WXRA 1QRZA 4Q80A 1V2WT 3ZV9A 1V2UT 4I8HA 2D1JA 4ASHA 3PTNA 1ZHMA 4XD7D 3TNSA 2OC1A 2QXGA 3QDZB 2GP9B 1BQYA 5TJXA 1OHHD 1HAZB 1O2VA 1P2OA 4ZCNA 4RT0A 1CBWB 1LPZB 1V2RT 1FQ3A 3OE7D 3TH4H 3K9XB 3A7ZA 3P8FA 4GLYA 6GCHG 1A0HB 2HVYB 4YZUA 2EY4C 3GYLB 2V3MA 2ZP0H 1INCA 3GDUA 2PGQB 3PM3A 2V3HH 2UUKB 3GY7A 2F3CE 1IQIA 2TIOA 1GVKB 5K0HA 1MCVA 5FX6A 4B6EA 1W0YH 2V6NA 5GJ4B 4OS5A 4DGJA 4AGJA 2JJ2D 3RXMA 1S0QA 5F8ZA 1CBWC 5A0AE 4AC9A 1N6XA 1S5SA 1FONA 4A7IB 3AK5A 3C27B 4AX9H 1E1RD 4QT8C 2KM0A 3SU0A 4HTCH 1X7AC 3BIUH 2JDID 1TA2A 2XC4A 1HUTH 1BMNH 1XUHA 2A4QA 4I8GA 2V7QD 4Z6AH 4Q7ZA 3ODDA 4A1TA 1THSH 3ZZDA 1E34B 2LELA 2A7JA 2J5UA 1BRAA 4RT1A 2A2XH 2C8YB 2OCVB 4JYVH 2STBE 1DXWA 3V3MA 3UTUH 5DP8A 2GX4A 3RXIA 3MO9A 2C8XB 2NU2E 3BEUA 1G3DA 1O3FA 4MTBA 5FCRA 4H6SB 2FDAA 4I86A 5IK2D 1SQAA 1C2HA 3T2NA 2FXRA 1QBVH 1NFXA 3M36A 5EJZA 3ZVGA 5CE1A 4ZHLU 4YLQH 1MABB 2ZNKH 2ODQA 2F43B 1OWHA 3RXBA 2XBVA 4OS4A 1O5EH 2SFAA 2R9PA 4WVPE 4NA9H 1A4WH 2AEIH 2IPQX 3C1KA 1O3MA 3E91A 4MPUA 1K22H 4Z1MD 2A31A 1AVGH 3TLOA 3NKKA 2XBXA 1V2QT 5GNDA 1EPTC 4CRBA 1JIRA 4AFSA 3VFEA 3GDVA 1XX9A 2TGAA 1BDAA 5C0TA 4IC6A 3QGJA 2NU0E 1TBZH 3VPKA 1GHBF 2FI3E 1C2MA 3A83A 4X1SU 1FPHH 1OWDA 4ACBA 1BHXB 1HDTH 5GPIB 2CJIA 4ISHH 1NRQH 4A5TS 1P0SH 4F4OC 1A5HA 1DOJA 2VINA 2Z3DA 1GHZA 2DE8A 3DSGA 3OEHD 3F1SB 2XTTB 5C3NA 1OSSA 4MVNA 1ANCA 2PTCE 9LPRA 4NG9H 3MTYA 1P2NA 1DWCH 1O39A 3KQDA 1QRWA 3H09A 2QF4A 4BAKB 2PW8H 3A7YA 1GJ4H 4CH8B 1EX3A 1PPGE 1IQKA 2BZAA 2ZDLA 2P94A 3RXDA 1GBMA 2UWPA 2Y5GA 1C5OH 3UNQA 1K1IA 4ESTE 1YWUA 4DW2U 3FOAA 2VIOA 1K1MA 1YC0A 2J98B 4WJG2 4IS5A 2NU1E 2HOBA 3PWCA 5GXPA 2ZFTA 2FYQA 1YLDA 1L1GA 1XKBC 3V0XA 1SFIA 2F9PA 2W7SA 1AE5A 2XW9A 3EDXB 4DY7B 3PV2A 2Z9KA 1Z1JA 1TOCB 2GKVE 3MI4A 4UEHH 4B71A 1P11E 1PQ8A 1NS3A 3KF2A 1HIAA 1MKXH 5DGJA 1KXBA 1OYTH 2HWLB 1A5IA 2H9EH 1O2SA 2AFQB 3SU5A 1WSSH 2FOEA 1GI0A 2C93B 2DE9A 3RXRA 3UR9A 4ACAA 2R2WU 1QJ1B 1GBFA 3ZZ3A 1P2JA 2VGCB 2ZHDA 1A3EH 4WMFA 1DWBH 1KY9A 1A3BH 1VJ9U 1BTHH 1FV9A 3O8RA 2HLDD 2G51A 4E7NA 1HGTH 1GBTA 4X2YA 2ALPA 1ELBA 1O2QA 3VB3A 3D23A 5EPYA 2AIQA 1HNEE 2FX4A 2FYRA 3LT3A 1O3BA 4B73A 1NESE 4CBOA 1BZXE 4XE4A 1SQOA 5C5NA 1MTVA 1LO6A 1BTXA 1SQRA 2VGCC 3SQHE 2BY6X 2GZ8A 5A8ZA 4YXWD 3U28C 5HXFA 2D8WA 3BTME 2Z3CA 2A0QB 3M7QA 4UONA 4Y8YA 1FZZA 3PLPA 3RXTA 1NFYA 4X6MA 3E8LA 2BD4A 1W11U 1RGQA 1ETRH 2ZC9H 1LQDB 2J95A 2QGRA 1VZQH 3Q00A 1MTUA 5DSFA 3ZVAA 1DT2A 5A0BA 3P17H 1KYNA 1C5TA 1VJAU 1EZXC 3GICB 1GCDA 1O2PA 1YPHE 5C20A 3F0PA 2BLQA 4DG4A 3BTDE 2W5EA 3AAUA 5JB9S 1TQ7B 1Y5UT 2OUAA 3UY9A 2XC0A 2P95A 3T28A 4AYYB 1NT1A 1G30B 4K5ZA 1VITG 1DDJA 2A5KA 2AIPA 1O2NA 1FAKH 3STIA 1O32A 1YP9A 3NZIA 3ELAH 5F6MA 3S69A 3M37A 1C2JA 4DT7B 1D4PB 2VVUA 2PGBB 3AASA 2ASUB 3TGIE 1AE8H 4KGAA 5JBTA 3A88A 1C1UH 2A2QH 2NU3E 3ZIAD 3LGWA 1O37A 3N7OA 4RN6A 2RG3A 5KECA 1SGFA 3RC5A 5CHAB 4TPIZ 1ZJDA 1C1RA 3ZZ4A 3RC6A 3SI3H 7GCHG 3PTBA 2EI6A 2BQ6B 3MHWU 2GJGA 1UTOA 4WF8A 3MH6A 4MQAA 2TGTA 1O2ZA 1GBJA 2VIPA 3KYFA 2GZ7A 1FIZA 2ZEBA 2BMGB 3BTTE 2ZO3H 4Y8XA 5HIYA 5KGOA 1QB6A 3ZZBA 2FS8A 1CA0B 2UUJB 5CHAC 1P04A 4YO9A 2RCEA 1DX5M 1TX8A 1YPEH 1CHGA 2XOKD 3KGPA 4WMEA 1QB9A 3KEEA 4U01A 3B23B 4O97A 4ZKRU 1KSNA 1V6DA 2IN2A 2BVRH 3PWBA 4TWYA 3DHKH 1ZMJA 3AVZA 4NSVA 5GDSH 2AGIX 3RXSA 1V2MT 1SGPE 1PPZA 1EASA 4F49A 1C5LH 2OP9A 5FL7D 1CA0C 3RP2A 3MNXA 1B0FA 2C4FH 5FPSA 1C1TA 2J38A 1AMHA 1J14A 4XDEA 4IMQA 3FANA 3WWBA 1W13U 3EA8A 1C2DA 4LOYH 5AVDA 1GHYH 1H8HD 5ESTE 4P02A 1K28D 1EKBB 3RXLA 4K3JA 2HNTF 2JH6D 2ANKH 4NCYA 2OQ5A 5L30H 1Z1IA 1LVYA 1P2MA 1QJ7B 5BRRE 1YLCA 5T1VA 5EQRA 5B6LA 4JK5A 3A81A 4OS6A 5FHTA 1TNIA 4I33A 4AFUA 1TMBH 1YKTA 2Z6BD 2VH6A 5T6GA 1J8AA 3E0PB 1O3LA 2VWNA 1C2EA 1P57B 4FOUC 5E2OA 2V0BA 4NFEA 4YTAA 3SNDA 3A7TA 2YNAA 5JBCS 1KXDA 1RFNA 3MMGA 3LGUA 3NK8A 1UVTH 2A45B 4PROA 1EP5A 4XBDA 4OGYA 2XXLA 3A80A 3IWMA 2W7UA 4BANB 1SC8U 1F0UA 2QF0A 1O2TA 2VH0A 5J4QA 4I7YH 2FOMB 1CA8B 1SQTA 3KQEA 3U1IB 5EXLA 1G2LA 2BQ7B 1TNHA 4BAHB 2H1UA 4B6FA 3DSOA 4RI0A 1G37A 1SGYE 2FTMA 3ZVDA 1F0RA 2PTNA 3RLYH 5EW1H 2PWXA 1GVZA 2I6QA 2VVCA 3BTQE 1Y5BT 3BTGE 1NRPH 3O8BA 3ZVEA 1ELDE 1C4U2 3HKJB 2WUBA 2FLBH 1P12E 1GI9B 1W7XH 3PB1E 1QY6A 5BPEA 3SV6A 2ZU5A 1H8DH 1O0DH 4DT4A 3UQOA 1ELVA 1HV7A 2CXVA 5EQQA 5FBEA 1NRRH 1K0HA 1CGIE 1GI3A 3QZQA 5FCKA 4RSPA 5DP3A 1TA6A 1ELAA 2Y80A 3N7DA 3ITIA 1UO6A 1JMOH 1DXPA 2HGTH 4GCHG 3U1JB 3CS0A 2QXJA 1O3DA 3QZRA 3E6PH 2GCHG 3QLPH 4NFFA 1YYY1 1P05A 2BVXH 4YOIA 3DFLA 3PRDA 1V2PT 2FM2A 1O33A 1MKWH 1YPMH 2PHBA 1GMCG 3D49H 4AOQA 5KEDA 2ZGCA 2QF3A 2FOHA 1BIOA 1Z6JH 1PPCE 1ZGVA 3AW0A 1E36B 3W95A 5JYIA 1G9IE 1TB6H 2BLOA 2H2ZA 2ZU3A 3R3GB 3S0NA 3ZVCA 3DA9B 1O2OA 5HM9A 4MDSA 3TVJB 1O35A 2H9HA 1TMUH 2BD8A 3SU2A 2B0FA 2ZECA 2GV6A 4OS2A 3ODFA 2AYWA 1H1BA 1EQ9A 3N7EA 4NZQA 2Y81A 4XOJA 1YPLH 1LPGB 2G81E 3LH1A 3BIVH 1ZMNA 2OLGA 1S81A 1W10U 2O8WA 2P3FH 2QA9E 3GCNA 4ABFA 4TYDA 1EJNA 1CHOG 3VG8A 1NY22 1W2KH 2RA0A 2UWOA 2FMJA 3GCHB 1AU8A 1A61H 3VXFH 2JIZD 1SGFG 2GD4B 1MMJN 1C9PA 1XUIA 3WW7A 1PYTD 1ZHRA 2FWWA 1KTSB 3A86A 3SNCA 4D7GA 3ATKA 2TGDA 1SGIB 1C1QA 1V2NT 1W8BH 2G55A 1PQAA 1BITA 3A85A 2FEQH 2L74A 2H5DA 3KQCA 1EOLA 1Z8IB 1GJ7B 1O2MA 3UQVA 4ZKSU 3GCHC 4BTTB 1HAVB 2F83A 1UTKA 1O2XA 2V35A 2XNDD 1YM0A 1JRSA 3RXJA 1TGBA 1NROH 3QN7A 3RDZA 2ZKSA 4UD9H 5DP6A 1EZUC 1Z8JB 1BTUA 3RXGA 1D3QB 2PKAA 3RMLH 2BLVA 4LZ1H 2ZHFH 1EJMA 1XM1A 1P9SA 1BTWA 2AMQA 4J1YA 4B1TA 1BA8B 3GY4A 3SUEA 2F91A 1IAUA 2J9NA 5EJ1A 2FS9A 1AUTC 1Y59T 2O8LA 1THRH 1OWEA 4E05H 1EXFA 2BD5A 2RFKC 2PP6A 1XXDA 1Y8TA 5FAHA 4K60A 1O36A 1PPBH 5JBAS 3M3VA 5E2PA 2JKHA 5EU8A 1O5AB 2W26A 2WPJS 2Y7ZA 3K6YA 4Y8ZA 5DJ7A 5F8XA 3SV7A 3RLWH 4Y76A 1K1NA 2BDHA 2BDBA 3P70B 1FN6A 1RIWB 1P2QA 3PMAB 1PQ7A 1Z7KA 4ISIH 1C5UA 1EP6A 4RKOB 3L3TA 2C8ZB 2P8OB 3RXQA 3OEED 4GHQA 1QQ4A 3BG8A 4K69A 1BMMH 3URDA 3SHAH 3UOPA 1MBMA 1VR1H 3PROA 3RM2H 1TONA 5DP9A 2HNTE 4AG2A 2B7DH 3M7UA 1JWTA 1DY8A 1T32A 1F2SE 1GBDA 1RIWC 2SNVA 1ARCA 1ZLRA 1GI6A 3SJKA 1AB9B 2AS9A 1RJXB 4IC5A 2P8OC 4Q2KA 2KCOA 4DIHH 1D9IA 2EC9H 1H9LB 1RS0A 1OS8A 3FO8D 8GCHG 4Y0YE 1LPKB 1GHAF 1HAYB 3RM0H 3TJNA 1QL8A 3P95A 3UAIC 2W6ID 1C5MD 1BMAA 1C1WH 1HAIH 1BMFD 1H8IH 2ANMH 1QZ8A 1AB9C 2NWNA 2ZU1A 3SU6A 2H5CA 1AHTH 3F68H 1EB2A 4ZMAH 3RXCA 3PLKA 1DWEH 2P16A 1MBQA 2J4IA 3SNBA 2C3SA 5EW2H 3SJ8A 2I6SA 3KQBA 3UREA 1HJ8A 4J2YB 5FPYA 3DCLA 2M5TA 1T8LA 1W0KD 3MH7A 4INHA 3GISB 1TABE 2Z7FE 3LH3A 3PMJA 3P8GA 3UIRA 1Y3UA 2GGVB 1ZRBA 1SMFE 1A0LA 1AWHB 1O3KA 1TRNA 2KAIA 1F0TA 3EE7A 2ZDAH 1GJ5H 1UTQA 3ZV8A 1AO5A 1D6WA 4Y79A 4JK6A 1CGJE 1FMGA 3TU7H 1SOTA 3A7VA 1YBWA 1GMDF 2ZU2A 4CR5A 1E79D 1GJ8B 4JYUH 2G00A 1YPGH 1UVPA 2JETB 4JZ1A 2BLWA 1WYKA 1YCPK 2R3YA 2ZFQH 4JZFH 3RUOA 1FUJA 4JZIA 5C1YA 4UDWH 5JDUB 5IDKA 3F6UH 3F9FA 3A89A 1RTFB 2P93A 1TLDA 3MH4A 2P59A 1HAHH 1BTYA 2ANWA 1ZR0A 5L2ZH 1BT7A 1TIOA 2BQWB 2WYGA 1ZZZA 1AGJA 3GY2A 1G36A 2WPLS 3BV9B 2JETC 1HPGA 4OS7A 1P01A 5J4SA 1GJDB 3K2UA 4SGAE 2CF8H 3GCTF 3KN2A 1GL0E 4FUDA 4ASUD 3EA9A 1LCYA 4JMYA 1ELGA 2HPQH 2XYAA 1C5XB 3Q3YA 1TMTH 5EOKA 4D9RA 2ZGHA 3WY8A 1IQNA 2WHXA 4TPYA 1TBRH 2GDDA 1HIAB 5DP4A 3UWIA 1O2YA 1ESAA 1B5GH 1TALA 1A7SA 1B0EA 1ANEA 2XCFA 2SGEE 4UFEH 1OPHB 1SOZA 2F9BH 2FOCA 2W6JD 4NSYA 2LP6A 4JYTA 1O5FH 3KYGA 1Z8GA 2BY7X 4BTUB 4ZHAA 5DP7A 1TRYA 2C90B 2Y5HA 3KHVA 2PUQH 4DOQA 4VGCB 1TPAE 2ODYB 1QGFA 3B8JA 2VVVA 1W0ZU 3LDXH 4Y11E 1ZPBA 1T31A 1L4ZA 2VIQA 5EG4A 4A92A 1NRSH 1Z71A 2SGAA 2EQNA 2GT8A 1IQFA 1GDNA 1UTLM 1ZSJA 3RXVA 1KLIH 1O2KA 1V2KT 2ZCHP 4HFPB 5L6NH 2NU4E 4U30A 2Z9IA 2YMSD 2FP7B 1Y5AT 4VGCC 4CHAB 1GBCA 3MYWA 2ZTXA 1GDUA 1TPOA 5ETXA 1K1JA 5SGAE 1C5SA 4CRAA 4YOGA 1P3EA 1SGNE 2G52A 4CRDA 3SGQE 3A8AA 2ZGBH 4NIWA 1ELFA 2AGEX 2BXUH 3LKWA 1ETTH 4X2VA 3ZYDA 1ID5H 4BNRA 1WTHD 3ZZ8A 1K2I1 1WQSA 4CHAC 1W14U 2Z9LA 1EOJA 1PPFE 4ABBA 4XSKU 1YGCH 2CK3D 2G8TA 3KCGH 1NU9A 2FZZA 1UTJA 1YY3A 1P02A 1PYTC 1CGHA 3T29A 1DFPA 1GHVH 2OD3B 3NPSA 2ZFRH 4Y7BA 3IG6B 1JXPA 4DCDA 5AHGH 4B2AA 4B76A 1MTWA 1DM4B 1GMHF 1C5QA 3P6ZB 1GHBG 1A5GH 4P00A 3U8TH 1P2IA
chains in the Genus database with same CATH topology
2FOGA 5GCHF 1SHHB 1A1RA 1QA7A 3TGKE 2PR3A 2B5TB 3GDSA 4X1PU 3MU1A 1OP2A 3M5OA 1KXAA 1O34A 3M3TA 2BY9X 1UVUH 3NWUA 1WV7H 2ZHQH 3SV2H 1O2IA 1OYQA 2THFB 3H7TA 4A1XA 2Y5FA 3S7KB 1SGRE 3RXAA 3M3SA 2O8TA 4B2CA 2ZGXH 3BF6H 4X1NU 2VNTA 1BB0B 2WPMS 5JB8S 2QYIA 1BHXF 3QGNB 1ZTJA 2BD3A 2R2MB 1HXEH 1QR3E 1WTGH 3RMMH 1UTNA 1HAGE 1Y3VA 1C1OA 2XC5A 4UFGH 4I8LA 1AUJA 1LTOA 7LPRA 3GY6A 1MTSA 4K8BA 3A8DA 2BY8X 2J92A 4CH2B 3ZZ7A 1OXGA 1Y3XA 4Y6DA 3HPTB 3HGNA 1V2ST 1NPMA 1D3TB 1ZPZA 3T27A 1SGEE 1E35B 3CS7A 3S7HB 4THNH 1FY3A 1NC6A 3HK6B 2WPKS 3BSQA 2ZIQH 1GBKA 3HK3B 3UUZA 4X2XA 2ZTZA 3MOCA 1MKXK 4ZXXH 2PSYA 3E0NB 2OXSA 3OU0A 4AB9A 5EXNA 3MNBA 1GI8B 3BN9A 4JZDH 1QFKH 3ZZAA 3V13A 1NM6A 4X6OA 4FU8A 3B9FH 1TYNA 1EZSC 2FESH 1S82A 5C67A 2ZCKP 4XBCA 1G2MA 3T62A 2EA3A 3O8CA 4FVDA 3TH2H 3A8BA 1A0JA 5A8XA 4YOJA 2BZ6H 5E0JA 3OTJE 2PSXA 3FP7E 2DUCA 4ZKNU 2ZDNA 1OX1A 2AGGX 4AN7A 3SU4A 1GWAA 1T8NA 1AZ8A 1TX7A 2QXIA 1GGDB 3MWIU 1QCPA 5CMXH 5PTPA 5FXLA 3F9EA 2G5VA 1T7CA 2LNCA 4FUHA 4LZ4B 3M61U 2QN5T 3FFGA 2VB0A 1Q31A 3A7XA 1J16A 1CT0E 2RA3A 2A1DB 2ZHEH 4ZH8A 4K1TA 4Y0ZE 3LC3A 5E8EH 2ALVA 4D8NA 1GGDC 1DICA 1SI5H 3TK9A 3BEIB 4WY3A 3TJUA 1DSUA 1MZDA 1C5YB 2YOLA 4CBNA 3V12A 2ZCLP 1AD8H 1F5RA 2BD9A 2XBWA 1E0FD 5GIBA 4XFQA 1MQ6A 2FI5E 1V3XA 2QXHA 3ATMA 2XBYA 1NTPA 2O9QA 1EAWA 3ENSB 5F03A 2ZDKA 1MD7A 1SBWA 3H5CB 4DIIH 1LVMA 1W12U 3HKIB 4BAOB 4MNXA 4INLA 4M7GA 1KXEA 4ISNA 3TNTA 1VCPA 2XNIA 1BOQA 3GYMA 2QIQA 3KIDU 2ZWLH 1GJ6A 3SU1A 5DPAA 4X8TH 4ABAA 2XWAA 4YT6H 1ACBE 1O2JA 3IITA 2O8MA 3HGPA 3UOUA 2OBQA 2FIRH 1K1LA 3DUXH 2ZPQA 1ELEE 1QRXA 1FIWA 3E1XB 4TY7A 3CENA 3P8NA 4HGCA 3SU3A 2ZQ2A 5I46H 1UVOA 3GY3A 3A84A 4MNWA 2BY5X 1O3JA 4BOHA 4GSOA 1OP0A 2BB4A 1K1OA 1EJAA 3PO1B 1EAIA 2ZQ1A 3PMBB 1O2UA 1CE5A 1GVLA 1FJSA 1OKXA 1LDTT 1DUAA 1F7ZA 1LHCH 4YT7H 5DK1A 1EZQA 4A1VA 5JBBS 1SLWB 1ABIH 1V2TT 3F9HA 1WUNH 1O3PB 4NWLA 2PV9B 4JCNA 1C4V2 1LMWB 1FN8A 3E90B 1DITH 1KXFA 2ZHWH 5EGMA 1ANBA 1BBRH 4GHTA 4Y10E 3TJOA 7KMEH 4H6TA 1YCPM 8LPRA 2QV1A 3OX7U 2SGQE 2W3KA 4SGBE 4IGDA 3OYPA 2GT7A 1AKSA 1HAXB 2Q6DA 3QTOH 3UNSA 1HRTH 3TIUA 1G3CA 1CT2E 3I78A 2ZDVH 2PKAB 1SSXA 3SV9A 1C5PA 1O5DH 1JOUB 3RU4T 1ANDA 4WXIA 2Q6GA 4CRFA 1E37B 2ZF0H 4OS1A 2PLXA 1CSOE 1IQJA 1K1PA 4RKJB 2ULLA 3VGCB 2STAE 6GCHF 2ZDMA 3MFJA 1SL3A 1D3PB 1KTTB 1FY4A 2ZFFH 1FNIA 1BTPA 1DPOA 3DFJA 3FZZA 3ATLA 2FPZA 1KIGH 1HJ9A 4TWWA 4FXGH 3M35A 2EI8A 1CT4E 1C1SA 1P9UA 2VJ1A 1IQLA 4NA8A 3VGCC 1EATA 4ABDA 1UK4A 2Z3EA 1DANH 2TGPZ 1MQ5A 4X8VH 1RD3B 4AB8A 1LHDH 3BTWE 2ZFPH 2Y7XA 5LPFA 2ESTE 1ZPCA 1V2OT 2BOHB 1HFDA 2ZFSA 1MH0A 1M9UA 1C2LA 1S85A 1P10A 3P92A 5FX5A 2RDLA 1BRCE 3RU4E 1SR5C 5C1UA 1VGCB 3UNRA 1TNGA 1QL9A 1O3IA 1DLEA 3LU9B 5EPNA 3G01A 1UHBB 2ZG0H 1BBRE 1P03A 3RXEA 3W94A 4Y7AA 3BEFB 4D9QA 3MH5A 1W7GH 3UR6A 2OTVA 1C2GA 1F0SA 2FO9A 1AFEH 2CV3A 1O2HA 1S6FA 2CMYA 1TGCA 1ZYOA 1QA0A 3AW1A 1DSTA 2H9TH 1C5ZB 5G4BA 1VGCC 3BTHE 4GUXA 5T6FA 4X1QU 2XCNA 1BCUH 1G32B 1O5GH 2AMPA 4ZHMU 1MKWK 1KDQA 1C1VH 1HCGA 4AZ2B 1JRTA 1J17T 1VCWA 3MO3A 3LJOA 1G3EA 5HM2A 4DVAU 4B75A 1SGCA 4HZHA 4INKA 3M5NA 1SGQE 1UHBA 1NU7B 1TGSZ 1O2GH 3TPIZ 1T4VH 4ISOA 1E38B 3TK6A 4A6LA 1AN1E 1GI2A 2BX4A 1BBRK 1V2LT 3RXOA 3NUMA 4UE7H 4ABIA 3EGKH 3SOSA 4JZEH 4CR9A 4X1RU 1V2JT 1O5BB 4FUFA 2G5NA 2BVSH 3M5MA 4ABEA 2KAIB 4X8SH 2R0KA 3Q76A 2BM2A 2TBSA 1O3OA 1ZSKA 1GCTB 4TY6A 4ABGA 3UWJH 1NZQH 1ZTLA 1C9TA 2FI4E 3MNCA 5AF9H 1ZGIA 1QTFA 2OC8A 1P2KA 1AI8H 5HYOA 1LQEA 4I32A 1FY5A 3EQ0H 3ZVFA 5TCAA 3LGVA 3PV4A 3BG4B 3VEQB 1XUGA 3HATH 1KLTA 4BAMB 4H42U 1SLVB 5JPMH 3LIWA 2VWOA 3TGJE 1F5LA 4BXSA 1GCTC 2B8OH 3SGBE 3OY5U 3EAJA 1O31A 4NA7A 1TPSA 1NO9H 1ESTA 2SNWA 3SHCH 1S6HA 2BDCA 2ZPRA 1IOEA 1PPEE 4MPXA 3BG4C 5DO4H 3A87A 1QL7A 3E3TA 4MLFB 2OC7A 4IBLH 3PYHA 1SFQB 5A2MH 1NFUA 3TH3H 2G4UA 3ESTA 3I77A 2ANYA 5DKMA 1LVOA 4B2BA 1VCQA 5C2ZA 6ESTA 1ELCA 3FP8E 3SZNA 2SGFE 1EPTB 1UCYH 4R0IA 1TNJA 1RTKA 2A7HA 2EI7A 2WUCA 5E0HA 1GL1A 2WV5A 1LKAA 2O8UA 1C1PA 3RXKA 1ARBA 5A0CA 4X0WU 3RC4A 2A4RA 2P3TB 3RXPA 5C5OA 1IHSH 1SLXB 4IMZA 4KTSA 1GBIA 3ZZ9A 5AFYH 1PPHE 2UWLA 3T5FH 4ZAEA 6CHAB 2J94A 1QIXB 4AG1A 1MAXA 4LK4A 1AWFH 2TRMA 1O2WA 3ZYEA 1Y3WA 1EPTA 4K8YA 1GHAG 1GI1A 2AERH 1NN6A 3JZ1B 4MPWA 2Y6TA 4ABJA 1TNKA 2LPRA 4MG3A 4NIYA 6CHAC 4O9VA 1QB1A 1P06A 3NCLA 2ZPSA 1C5VA 4MNYA 3RMNH 1BMLA 1GI5A 4IW4E 1WBGB 3DT0H 2GTBA 2V3OH 3L33A 2JH5D 1UJ1A 4H4FA 2R3UA 1QJ6B 1VITF 1AY6H 5ESBA 2FOBA 3SN8A 1GJCB 1TX6A 1L1NA 1ZJKA 1C5WB 1TE0A 1GI7B 3SQEE 1RRKA 1CVWH 4O03A 4GAWA 3OSYA 2A4GA 3LGIA 2FX6A 2BYAX 1IQHA 3ATIA 7GCHF 2BXTH 1SVPA 3M5LA 2A7CA 1UCYE 3Q3XA 2FLRH 1MU6B 1ZHPA 1GMDG 1S84A 1QBNA 4K1SA 1S0RA 1GG6B 2Y82A 1TAWA 1W3CA 3UPEA 2OINA 2HLCA 3EYDA 3FAOA 5HMAA 3STJA 2CF9H 4FU7A 2K1QA 3H7OA 3VB4A 1OP8A 2Z9GA 3BTFE 2XWBI 1IQMA 5C1XA 4X8UH 1ZOMA 2CHAB 3SI4H 1SPJA 2HNTC 2OBOA 4NIVA 3NXPA 1O38A 3LOXA 1GG6C 1HJAB 1F5KU 1LHGH 3GCTG 4B74A 4YESB 1PFXC 2BDYA 5FPTA 3VXEH 3SJIA 1UCYK 1UTPA 4AORA 2QAAA 1CQQA 2IJOB 5HGGA 3SJ9A 3AAVA 2H6MA 2VIWA 1O3NA 1AIXH 2CHAC 1GJ9B 1B7XB 1N8OB 6LPRA 1HJAC 4I8KA 4MPVA 1TWXB 2ILNA 1GBEA 1O3CA 1N1LA 1C2IA 1SB1H 1SGTA 2BX3A 4NWKA 3SV8A 3A7WA 2VWLA 2UUFB 1SG8B 3QWCH 1UK3A 3MU5A 3QTVH 4KELA 4U2WA 2WYJA 1HBTH 2PKSB 1HAPH 3P8OA 1TRMA 1N8OC 4FUGA 1OOKB 1FXYA 1C5RA 3LGYA 2J2UA 4I8JA 1L0ZA 1RTLA 1BJVA 1SGDE 4HI3A 3VB5A 3EA7A 4I31A 3DD2H 4IN1A 4WH6A 1XUJA 2ODPA 1DS2E 1DWDH 2PKSC 2VIVA 4WWYA 1C1MA 2W3IA 3PLBA 2D2DA 3Q77A 4Z0KA 4FUBA 1C2FA 1FI8A 1ZTKA 1OWJA 1DLKB 3CP7A 1VITH 2CGAA 3LGTA 3VB6A 1O30A 1AQ7A 3U69H 2R0LA 3RXFA 2BHGA 2EEKA 3JZ2B 1D6RA 3GCOA 3TITA 4Q7XA 1C4Y2 3OY6U 3SNEA 3RXUA 2BDGA 1C1NA 1GBAA 3BTEE 4ZXYH 5IYTA 4NIXA 2UUYA 2A5AA 2FODA 4UFFH 4OGXA 1GI4A 2JH0D 1HYLA 2HVXA 2VU8E 1TNLA 1FAXA 1GMHG 3V7TA 1XUKA 2OQUA 3QO6A 4GCHF 2FTLE 5AFZH 1O2LA 4KP0A 4WMDA 2GCHF 2Q6FA 2F9VA 1GBHA 1BJUA 1QHRB 4KTUA 1AFQB 1TGNA 3GOVB 5GCHG 1HXFH 1MAYA 1H9IE 2HPPH 1EAXA 2QCYA 3S9AA 4ISLA 3T26A 1GMCF 3R0FA 1DUEA 3O8DA 1O3GA 1WAYB 1H9HE 2BOKA 2ZU4A 1MZAA 5DG6A 3GY5A 5EQSA 3MNSA 2FOFA 4ABHA 4K1EA 1AFQC 4GVUA 1OWKA 1OWIA 5EXMA 2B9LA 3UFAA 1QBOA 1J15A 1UMAH 2FOAA 4AGKA 4DJZB 2BDIA 2WINI 1SLUB 4BXWA 1XKAC 4WXVA 1L2EA 1P09A 4DURA 5TCCA 2GMTB 2A4OA 5A8YA 4E7RG 1FY8E 1LVBA 5ABWA 2A32A 3A82A 5B6OA 1CHOF 4XBBA 3LPRA 4GPGA 1XMNB 1T8OA 2SGPE 1A46H 2AH4X 1Q2WA 2BTCE 1C5NH 4X6PA 1BRUP 1IQEA 2ZI2H 2A5IA 3K65B 1ETSH 3TJVA 1FPCH 1HB0B 4AFZA 1UTMA 2AMDA 3MU0A 1NRNH 1QNJA 3U98H 2GVFA 2GMTC 1XVMA 4D7FA 1U6QA 2BD2A 2HRVA 8KME2 1H4WA 4NGAH 5FBIA 1RXPA 5LH8A 2F9NA 1LHFH 2GZ9A 3RMOH 5E0GA 1PQ5A 3SBKA 1C2KA 1KXCA 3QUMP 3SJOA 4Q7YA 4Y71A 3GY8A 2ZGJA 3Q3KA 1L4DA 3URCA 3U8OH 4BAQB 4CRCA 1YPKH 2BDAA 4X2WA 5LPRA 3QX5H 3ZZ5A 3E16B 4ZROA 3PMHB 3RXHA 1GBLA 1IHTH 1P8VC 3T25A 4O3UA 1DE7H 3FZDA 2ZA5A 3LJJA 1QQUA 3QK1A 1QURH 1LKBA 8ESTE 1Z6EA 2BD7A 2OC0A 5LPEA 4D76A 1AVXA 3I29A 1SHYA 3FVFB 1TBQH 1F92A 1WOFA 1O5CB 4IN2A 1ZRKA 3U9AH 1EUFA 1AKSB 2GDEH 4AYVB 3ZZ6A 1HAOH 4AFQA 1Z8RA 3SGAE 5L2YH 3FP6E 2XRCA 2CN0H 3SW2B 1EB1H 2Z94A 4O3TA 1P3CA 4MNVA 4UFDH 1L1JA 3PO1C 2P3UB 3SUGA 4FUIA 1YPHC 4K2YA 4LXBH 1LHEH 1BUIA 4FU9A 3ZVBA 2F9OA 4CRGA 1MUEB 2C8WB 4KKDA 5K7RA 1D3DB 1FLEE 5EODA 3BTKE 3RU4D 2ZTYA 3KNXA 1ELTA 1Y3YA 5DP5A 3ZZCA 1ZMLA 1MD8A 3ATWA 1CO7E 1THPB 4FUJA 2IPHA 1WU1A 1ZSLA 3L6PA 3SUDA 1G3BA 3SORA 1A2CH 1JBUH 2HALA 3S9BA 1MTNB 1ESBA 2J34A 1T8MA 5A09A 3VB7A 2WV4A 1YF4A 4KTCA 1UVSH 2QC2A 3SO3A 1AZZA 1DY9A 3EE0B 1CU1A 3MU8A 8GCHF 4YM9A 4FVBA 1IQGA 2Q1JA 2VWMA 1GHXH 5T3HA 4YLUA 1O3HA 4ZUHA 2F9UA 1T4UH 1GHWH 1MTNC 7ESTE 3S9CA 1J9CH 2GCTB 3F9GA 1DVAH 1TPPA 1MCTA 2GV7A 2TPIZ 1ORFA 3MU4A 1XXFA 2VIDA 1S83A 3MO6A 3K6ZA 1KLJH 4E06H 1XVOA 2G4TA 4X6NA 1TFXA 2ZZUH 3D65E 5GWZA 1O3EA 5I25A 1YPJH 1TOMH 1V2VT 3A8CA 2GCTC 5F8TA 3D62A 1EAUA 1JIMA 5H4IB 1NFWA 3KL6A 1N6YA 2D26C 2WPHS 4CREA 1K21H 1KDQB 1YCPH 1O2RA 1AVWA 1MU8B 1Q3XA 4FUCA 4U32A 4NZLA 2PFEA 1O3AA 1TQ0B 1FY1A 3SUFA 3SNAA 1FDPA 3LC5A 1HAVA 1GBBA 5T6DA