3E16B

X-ray structure of human prostasin in complex with benzoxazole warhead peptidomimic, lysine in p3
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
247
structure length
247
Chain Sequence
ITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPISLPAAQASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNSLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASWIQSKVTELQPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Prostasin
publication title Discovery of inhibitors of the channel-activating protease prostasin (CAP1/PRSS8) utilizing structure-based design.
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.-:
pdb deposition date 2008-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3e16B02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3e16B01
1FXYA 1Z6EA 3T27A 4XBDA 3RXCA 1Z8RA 4F4OC 1WBGB 2OLGA 4XE4A 3MHWU 2PR3A 2VB0A 1YPKH 4FUJA 4UDWH 3TJVA 3SU3A 1X7AC 1EJAA 1NRQH 5IDKA 4AX9H 5A0CA 4J1YA 2XNIA 4AFZA 1G32B 1C1TA 4MPUA 1HAPH 4B1TA 1GDQA 1L1NA 1V2JT 2FOBA 1ZHRA 4YZUA 3DT0H 2BD2A 4OS5A 3A85A 5FX5A 1MZDA 4FVBA 3BTTE 3LT3A 3LGWA 1HGTH 2XYAA 1D3DB 1F5KU 2ZP0H 4GHQA 1ZGIA 4DCDA 3MNCA 2PTNA 1G3EA 4JZ1A 1FPHH 1O3GA 1W7GH 2A7HA 4WMDA 1V2MT 3A8DA 2ODYB 1EX3A 1MKWH 1OP8A 1UTKA 4I32A 2PUQH 2VIVA 3E0NB 1S6FA 4HTCH 3OY6U 4JCNA 2VH6A 4Z6AH 4MNYA 3FFGA 1T4VH 1Y3VA 1JMOH 1G3BA 1MTWA 2BVRH 1UTNA 2ILNA 2BMGB 4O97A 1HUTH 2OUAA 4AFUA 4DURA 2V35A 1N6XA 1ANEA 3O8BA 3ZZAA 1GI7B 5EXNA 4AORA 1ZTKA 5DO4H 3BTKE 5EXLA 1TRMA 3ZZ6A 2UUFB 4JMYA 1C1SA 4D7GA 1GCDA 2FZZA 3FAOA 4GLYA 1QNJA 1P2JA 1VITG 3PLPA 4ZHLU 1NFXA 1C4Y2 1ELDE 1GDUA 1DPOA 1PFXC 2BY9X 3MH6A 1GL0E 1FMGA 1B7XB 5F8TA 1LDTT 2VIWA 1NFYA 4VGCB 5HM9A 3K6ZA 2G52A 1TABE 3FZZA 5CHAC 4FUBA 1O0DH 2FEQH 4UE7H 1D6WA 3ELAH 1FAXA 2ZGCA 2BVXH 1L1JA 1A1RA 3Q3KA 4X6OA 3A7TA 4ZXXH 1FV9A 2Y82A 5T3HA 5JPMH 1Z1IA 3HPTB 3TH2H 2ESTE 5EQRA 1NO9H 4AZ2B 1FN6A 4YLUA 1WQVH 1O5BB 1V2WT 1GMCF 2J92A 2GCTB 5HGGA 3URDA 3GCNA 3ZZ9A 3S7HB 3VB5A 4ABEA 1CT4E 2NWNA 3M5LA 2J38A 2SGPE 1C5QA 1O3NA 3RLYH 2GD4B 1ELCA 3JZ2B 2JH6D 1E37B 4YOIA 4ASHA 3BF6H 4Y76A 2AMDA 1DUEA 4QT8C 2P8OC 4UFDH 1BB0B 1F5LA 1T7CA 3C27B 3I29A 2QN5T 1QB9A 1PQ8A 4BOHA 1CHOF 1YF4A 3RXPA 1RJXB 1S85A 3A8CA 2PFEA 3SNBA 2XC4A 2EA3A 1GBAA 1JWTA 1V2VT 2H9EH 2OTVA 2WPJS 5E2OA 1TNGA 4AOQA 3UQVA 4BTIB 4K5ZA 4RSPA 1O2NA 3STIA 1FUJA 5EQSA 2BM2A 4CHAC 4RN6A 1UTQA 3L3TA 4ABHA 2FXRA 2ZCLP 3LGUA 1AVWA 2XCNA 2FOAA 1SLXB 1OP0A 4X8SH 1C5WB 5C2ZA 4K8YA 2F9PA 1AKSB 1YCPM 3MH7A 1C5OH 1P2QA 5FBIA 1HLTH 2ZGJA 1TGSZ 3P8GA 4XSKU 5C1XA 2R3UA 2GZ9A 3UOUA 8ESTE 1ZTJA 1J8AA 4U32A 3M5NA 1A3BH 1OWJA 2CHAB 3PLBA 1O3FA 4B75A 2W3IA 3TU7H 1C2IA 3TJOA 1S5SA 5DK1A 2GT8A 1OWEA 1P06A 1GPZA 1ANCA 3Q76A 3GCHB 4K60A 1SHHB 5AF9H 1YCPH 1K28D 1XUHA 4XFQA 3A86A 2ZTXA 2ALPA 3LJJA 2BYAX 1LVYA 2DE8A 4BXSA 2WPIS 2PGBB 1O2VA 2F3CE 2QGRA 5DP5A 5C1YA 1Z7KA 4KTUA 3RXHA 1OP2A 2QY0B 4DGJA 3LIWA 1ABJH 4ABIA 4WXVA 1FY4A 1GMCG 2Z6BD 2R2WU 1P2NA 1GI9B 2RA0A 3PROA 2AGGX 1C4V2 2BX3A 2ZHDA 1UO6A 4CREA 2F9OA 1OWDA 3P6ZB 4X8VH 1J14A 4YT6H 1W12U 2PHBA 1CHOG 5AFZH 5PTPA 4A5TS 4YOGA 2FLRH 1CHGA 5EOKA 1O3JA 3P92A 1EKBB 5AHGH 5T6DA 3MU0A 4CR9A 2F91A 2THFB 1V2TT 3ZVGA 3UNSA 2BDBA 1KSNA 1YP9A 1EPTC 2SGFE 1W8BH 2TPIZ 4X2YA 5DKMA 5DP9A 2WV4A 2PKAB 4NWLA 1GBFA 4JYUH 4K69A 1C5MD 1P0SH 1SR5C 1F0TA 3TVJB 1SFIA 4MNXA 1C5NH 2ZTYA 2FYQA 2G8TA 1IQEA 1XXDA 3D23A 2GTBA 1EB1H 1PQAA 3MNXA 4IC5A 1C2FA 3ZZ4A 2BY8X 4CBOA 3BIVH 1LPZB 4WH8A 3TIUA 2BY5X 2BQ7B 1TX6A 1QB1A 4SGBE 2GZ7A 1DICA 1V2LT 1HNEE 1C5UA 4A7IB 1UVSH 1ETTH 1XX9A 4JZEH 1O3IA 4YLQH 3S9CA 1XUKA 1G3DA 2J4IA 1GBIA 4JK5A 2BB4A 2ZHEH 4GVUA 1WSSH 2AYWA 2BXTH 4Y7AA 2H5CA 1QQUA 1W13U 1MH0A 1MZAA 1C1VH 1TE0A 2ZGBH 1K22H 1AFEH 2ZCKP 4ZXYH 1GG6C 1O2IA 4GCHF 4TYDA 2BOKA 2ZFQH 4KP0A 2ZQ1A 1GHAF 7GCHF 1P57B 2XCFA 1O3KA 1GI3A 3NPSA 2XC5A 2BOHB 1S81A 2B5TB 3A84A 3F9HA 3SQHE 2J34A 2SGQE 2XXLA 3TK5A 2OC7A 3GDSA 3RC5A 2VWLA 1QJ7B 2R0KA 5E8EH 2FX4A 5ESBA 1TWXB 3SJOA 3U98H 3EAJA 4OS4A 1HIAA 1DWCH 4ZKOU 2C90B 1O5DH 1ETRH 3W94A 1ELGA 4OS6A 4Y8ZA 1NT1A 4ABAA 3ZVFA 1BMLA 3ZYDA 1AB9B 4A6LA 2PSYA 2Q6GA 1GVKB 1NM6A 2XRCA 3RXUA 2OINA 4Y8YA 2FOHA 4WF8A 4B2CA 5T6GA 3W95A 3SUFA 2CMYA 5A0AE 2C8ZB 2SNWA 1OSSA 4AGJA 3A7VA 3SGQE 2Y7ZA 2FX6A 2ASUB 3B9FH 4ISHH 1AZZA 3EA7A 1P9SA 4ZMAH 4B76A 3E8LA 3P8OA 3FP7E 1C2MA 5FXLA 1CA0C 1CGIE 1FY1A 3SNCA 2SGDE 3ZVBA 1S82A 4TY7A 4AFQA 3V12A 1HAVB 1GCTC 5ESTE 2ZFTA 3QTOH 3STJA 1QL9A 1XUJA 1JOUB 1WQSA 2O8MA 4ISLA 3P70B 1OX1A 1PYTC 4K2YA 1A3EH 1WOFA 1ZLRA 1N6YA 3MTYA 4Y7BA 4ZKRU 1IQKA 1KXEA 3UWJH 1TGNA 3V3MA 1H1BA 4GCHG 3PO1B 1HCGA 1ZMJA 2Y81A 1DUAA 1GHAG 7GCHG 3KEEA 4X8TH 3AVZA 3S0NA 1EPTA 1XUGA 1DSTA 1JRTA 3N7OA 1UVTH 5TJXA 3V7TA 4UFGH 3SGAE 5JBCS 2ZG0H 1NC6A 3PMAB 3P95A 3U1IB 2ZF0H 3AW0A 3BN9A 1UTLM 1DE7H 4OS1A 1O5EH 1HXEH 2H9TH 3P17H 3Q3XA 3LONA 5L6NH 2FOFA 5A8XA 2O8UA 2P94A 1V6DA 2ZI2H 4RKJB 1ID5H 1Y3UA 2VU8E 5A8YA 1YPHC 2VWNA 2Z9GA 1BBRE 2OD3B 3MO3A 1A7SA 1FY5A 1ZPBA 1DS2E 3D49H 1DXWA 1HJAC 1QBNA 3ZVAA 4BAMB 4IMZA 1KY9A 2C8YB 4FU7A 1O3PB 1Z6JH 1TIOA 3EYDA 4GPGA 1LKAA 1PPFE 2ZDKA 3BTME 2EI8A 3RXSA 4BAOB 1ELVA 1AIXH 1LVBA 1O5GH 1ZPZA 1UHBA 5EQQA 3DUXH 1O5CB 3BTQE 3M5OA 1O3MA 1O2PA 1BMMH 3LGYA 2QCYA 3K9XB 4A1TA 4FUFA 4ABBA 2ZECA 1O5AB 2GCHF 4AYVB 3VB3A 3RDZA 1GI1A 1SGFA 1RIWB 3VFEA 1AO5A 1Y59T 1WTHD 1DY8A 3KGPA 4Y0ZE 2BZ6H 1IHSH 4NFEA 2PKSC 1W11U 2BQWB 3RXTA 1UK3A 1TYNA 4MG3A 1GBMA 1CE5A 3SJ8A 2ULLA 3GDUA 4ISIH 1SI5H 2Z9JA 3QX5H 1EUFA 3KQDA 4NSYA 4ABFA 3ZV9A 1C2HA 3QZRA 3FP8E 3RUOA 2P3UB 1EZSC 1PPBH 1THPB 3GY3A 3BSQA 2K1QA 5HXFA 1K1IA 1A0HB 2ZFRH 4ZHAA 1AI8H 1RTKA 3RC6A 5GPIB 2D8WA 2FOGA 1F5RA 2OC0A 2P95A 4FUIA 3A8BA 1WTGH 4Q7XA 3RU4E 3PTBA 1C5XB 4ZROA 3RM0H 1J17T 1OYTH 2A2XH 2BLWA 2HPQH 3QWCH 1MMJN 2SGEE 3MYWA 4E05H 1EZXC 3SV8A 4LZ1H 3S7KB 1E0FD 3E1XB 3MH4A 1EJNA 5AFYH 1C5LH 2FWWA 1TNJA 1EAIA 3QGJA 1O2RA 3K65B 4H6TA 2HLCA 8KME2 3BTFE 3M3SA 5I46H 2BVSH 3E90B 1NPMA 2HNTF 5E0JA 3PWBA 1LPKB 1ANDA 4KTSA 1HBTH 1SGCA 2GCHG 1DWEH 3L33A 3H7OA 4U01A 1F0SA 1A46H 1SGQE 4IS5A 1Q2WA 3M7QA 3GY7A 4KELA 2FP7B 1OXGA 2GMTB 2VIQA 1L4ZA 5E0HA 7KMEH 1O32A 2VIOA 1V2ST 3FANA 5GDSH 1RGQA 2TGAA 1TNLA 2A0QB 1WUNH 1TBQH 1ZMNA 2A4OA 1QRXA 2ZU3A 1J15A 1TFXA 1S0QA 3KF2A 4Y71A 3V0XA 3T29A 3GY5A 3P8FA 4NWKA 1CT0E 3O8RA 3BEUA 4MQAA 3ZZBA 1O34A 1ZPCA 2LNCA 1O2UA 2F83A 3QK1A 1YPHE 3QUMP 3VPKA 2AIQA 5E2PA 2FIRH 2OQUA 1O2OA 1YPGH 5DP4A 2H6MA 5JBBS 3A8AA 3A7ZA 3SJ9A 1KLJH 1EAXA 2OBQA 1THRH 3ATIA 1NS3A 2G5NA 5HMAA 2FPZA 4Y0YE 4I7YH 1GJBB 1TMUH 3SNAA 3K6YA 1GJ6A 3SHAH 4D8NA 3KN2A 8GCHF 3ATLA 1BBRK 1P10A 1UJ1A 4XOJA 2TGTA 3BG4B 1QURH 3ESTA 5A8ZA 1N1LA 1MTVA 1YPMH 3R0FA 2UUKB 1G2LA 1GJCB 2W3KA 2BDYA 5EPYA 4ZKSU 3TGIE 2GCTC 3TJNA 3MNSA 3SO3A 1DXPA 2BX4A 2UWPA 1TGBA 4IMQA 3E6PH 1QJ1B 2BLVA 1TMTH 1N8OB 3E16B 4AFSA 2I6SA 2A31A 1C5VA 1NFWA 1SQTA 4JYTA 3SV7A 3A7WA 1RTFB 3R3GB 3UWIA 4X1NU 1Z1JA 3DD2H 2PGQB 1AE8H 3ODDA 2B8OH 4TWWA 2A4GA 2ZPSA 1CBWB 1UMAH 2NU3E 3EE0B 1XMNB 3RXJA 1KLTA 2B9LA 3TPIZ 1TQ7B 1ZRKA 3BV9B 1C5RA 4D9QA 1SLVB 1Z71A 5BRRE 1LHCH 3SV2H 1K1JA 1UK2A 4J2YB 1YLDA 4CRDA 1PPHE 2QYIA 1GBJA 3LGIA 3RMOH 1EOJA 3TLOA 5GWZA 1J16A 4NGAH 1G2MA 4R0IA 4OGXA 2ZIQH 3F6UH 2STBE 2BDCA 4CRAA 4Y11E 4X2XA 3UY9A 3SOSA 3SV9A 4B2AA 1UTOA 3CS7A 2VWOA 3SV6A 1O3AA 2CHAC 1OS8A 2Z3DA 5EW2H 3A7XA 1BJUA 4HGCA 1T31A 5EU8A 4FVDA 3GCHC 2CF9H 3DFLA 2OBOA 3HGNA 3F68H 2A7CA 1QTFA 5B6OA 1HAGE 4YOJA 1O3LA 3QLPH 1T8MA 6CHAB 1NRNH 2ZDLA 3T28A 4X2WA 4ZH8A 1TGTA 1W10U 1DVAH 3ZVCA 1CVWH 8GCHG 2Y5FA 1W7XH 1C2DA 1P2MA 2H1UA 1QJ6B 1AWHB 2A4QA 1CA8B 1QL7A 1XVOA 1MQ6A 2V3OH 1JXPA 1NESE 2QXHA 4FU9A 3PV4A 2J2UA 1BHXB 3RXFA 2AGEX 1EAWA 1BT7A 2QXGA 1GDNA 2BY7X 2BQ6B 4X1QU 3ZZ7A 1DLKB 1BTYA 2RA3A 1ARBA 2Y7XA 2C3SA 2M5TA 1MKXK 2ZHWH 3LGTA 4TPYA 1A2CH 1J9CH 3M35A 3RXGA 1RFNA 1KDQB 2QC2A 3G01A 2GX4A 4LZ4B 2ANKH 2FI3E 2TBSA 3OU0A 1HPGA 1HYLA 4BNRA 4CRCA 1GBDA 3M5MA 2GVFA 4BTUB 1CQQA 1UCYE 1A4WH 1AGJA 2V3HH 4MLFB 1D4PB 2R0LA 2ZZUH 4X2VA 1P01A 1V3XA 3PM3A 2ZPQA 2VIPA 1QA7A 1GHVH 2FI5E 1TONA 2Z7FE 1B0FA 1QIXB 2W7SA 3LH3A 1LTOA 1ZHMA 4BTTB 1S84A 1DSUA 5L2YH 1F92A 1G9IE 1EZUC 1D9IA 1DM4B 1XVMA 4E7NA 3MMGA 1MD8A 2QV1A 1VJAU 4HFPB 3PTNA 1SFQB 1SGPE 3GCTF 5A0BA 3UQOA 1SB1H 1EZQA 2VH0A 4H42U 1SQAA 3H7TA 3F1SB 5EG4A 4Q7YA 1AVXA 1PPZA 4NA8A 1S6HA 1MTSA 1GBTA 3SNDA 5H4IB 2R2MB 3LJOA 1IOEA 1Z8JB 1VZQH 3C1KA 4MPXA 1JIMA 2AMQA 1BZXE 5GCHF 5FAHA 4R8TB 5T6FA 3GISB 1TA2A 1KXDA 1GJ8B 1W0ZU 3E3TA 4MTBA 1E34B 3ATMA 1ZGVA 1LPGB 5DG6A 2G81E 4INKA 1XUFA 1RXPA 3BEIB 1C5PA 1V2RT 3ATWA 1P2OA 3F9FA 1LKBA 3MI4A 3MOCA 3RMLH 1UK4A 2C93B 1RTLA 1C4U2 2SGAA 1S83A 1YBWA 2P93A 1K1MA 3SW2B 3IITA 1DANH 1AKSA 1IQMA 2AERH 4Q7ZA 2HALA 1TRNA 3E91A 1ZR0A 2FTLE 2B0FA 3OX7U 1GMDF 2BZAA 3QN7A 3ZVEA 1BTUA 5C5NA 1GI4A 1TLDA 4B71A 1O36A 1JBUH 1SQOA 3TNSA 1BRUP 3VB7A 3B8JA 2PV9B 3GYLB 1NRPH 1HFDA 1V2NT 1C2LA 2SFAA 1TPSA 5LPFA 5JBAS 2UWLA 1QGFA 4K1SA 2D26C 4CH8B 1AB9C 3TJUA 1LHFH 2EEKA 2F9VA 1K1LA 2ANYA 2ZKSA 3MU1A 2DUCA 2JKHA 2Y6TA 3A83A 1O2SA 1TGCA 2GKVE 2P3TB 3LPRA 3NWUA 4NIWA 7ESTE 3Q3YA 1AFQB 3A7YA 4DG4A 3M7TA 3ZYEA 1RS0A 1NU9A 2W7UA 3RXQA 4BXWA 1D6RA 1GJ7B 6LPRA 4ZAEA 1SG8B 1IQNA 3CS0A 4Y6DA 3GCTG 4I8HA 4AB8A 1UVPA 1KLIH 4TWYA 1EATA 1TNKA 2SNVA 1FQ3A 2KAIB 2Y5HA 1Y5AT 3SUGA 2FS9A 3U1JB 1L2EA 3NUMA 2YOLA 3AW1A 4X6NA 5ABWA 2FO9A 1EJMA 1IQIA 1H9HE 2RG3A 2VINA 1YPLH 2RCEA 1TRYA 3SU1A 3ENSB 1YM0A 5K0HA 4YTAA 4JYVH 1P2IA 1O5FH 1SSXA 1SHYA 1GBEA 5HM2A 1K1PA 1AUTC 1HAZB 2TGPZ 1MCVA 3GY2A 1LMWB 1GBBA 4ZUHA 5GCHG 5EW1H 3RMMH 2ZDMA 3PB1E 1C5YB 3RXEA 1FJSA 3S9AA 3PO1C 4THNH 1O31A 3QZQA 3FP6E 2AEIH 4ABJA 1QBVH 1VGCB 1SOTA 2JETB 3LDXH 2ZC9H 2PKAA 3SJIA 4H6SB 5DJ7A 3U9AH 4NIXA 1BMNH 3M61U 1CGJE 4E06H 4Q80A 1GBLA 1TBRH 2JH5D 1QCPA 2OP9A 1GMDG 2PWXA 4AGKA 3D65E 1GI5A 5J4SA 1QBOA 5K7RA 1NU7B 2XBWA 1ZYOA 2QA9E 1BTPA 5DP6A 1GHBF 3RXVA 4O3TA 4TY6A 1FAKH 5GXPA 2GGVB 4FUGA 3BTEE 1H8DH 1O2HA 3ZZ5A 1O2LA 3KL6A 1GHYH 1MTNB 3ZZCA 1DY9A 2Q6FA 3RM2H 3ZV8A 3EA8A 1A5GH 1TBZH 5C67A 2GT7A 3LOXA 4FXGH 4BAKB 1K9OE 3SU6A 2PSXA 1P03A 1ESBA 1SGNE 2WYGA 4D9RA 1O2TA 1Z8GA 5FHTA 2FESH 5A09A 3DHKH 3RXKA 4X1PU 3VXEH 1YPEH 2O9QA 2ZTZA 5LPRA 2HRVA 4YT7H 1ZOMA 1ZTLA 1RIWC 1FLEE 3K2UA 2IN2A 2Z9LA 1BTZA 2CXVA 3T5FH 2CJIA 1F0UA 1MUEB 5TCCA 4JZDH 2HPPH 3D62A 1BIOA 3U8TH 1TX8A 1BTHH 2BD7A 3QO6A 5HYOA 4U30A 1KTSB 4BANB 2PUXB 2HNTC 1VR1H 1FI8A 1HRTH 3RXDA 5L30H 1WCZA 1C2EA 3KCGH 4GHTA 2AH4X 1HAOH 2CV3A 3LC5A 4NSVA 4OS7A 1PYTD 1QRZA 5C20A 2Q1JA 1O2WA 2FMJA 1FZZA 4AG2A 4KTCA 2R3YA 4BAHB 2VWMA 1BBRH 1H8IH 1NZQH 1O38A 1DITH 1CSOE 2BD5A 1DLEA 3TGKE 1P3CA 1NTPA 1D3PB 1QL8A 1WU1A 1PPEE 3A88A 1AN1E 3IWMA 1BCUH 3MFJA 1C2KA 8LPRA 1LO6A 1Y5BT 4CRGA 2XW9A 5ETXA 1AZ8A 1QA0A 1GI8B 3TH4H 1GGDB 1GHBG 4GSOA 3VEQB 3TNTA 1EQ9A 3UR6A 1L1GA 3NKKA 1C9TA 3BTHE 2A5AA 2OC1A 1QFKH 5LGOA 1AU8A 1C1QA 1GL1A 3KNXA 1K1NA 2FOEA 1AUJA 3Q00A 1THSH 3HKIB 1JRSA 1HAVA 1H9IE 1OWKA 1MQ5A 3T25A 4UONA 1EXFA 2P3FH 1BTXA 1P8VC 2Z3EA 2VVCA 2Z3CA 2ZNKH 3E0PB 1P12E 3GCOA 1ELAA 4IW4E 5EXMA 1ESAA 1NROH 3EQ0H 2A32A 2F9UA 2VGCB 3VGCB 3RP2A 1GI0A 1SGDE 1F0RA 4X6PA 1ELBA 3SI4H 2HVXA 2ZFPH 3OTJE 1ZJKA 3QTVH 4IGDA 2QXIA 1V2KT 2TRMA 2V6NA 2AS9A 1IQGA 1EP6A 3O8DA 1NFUA 1ESTA 2XWAA 1ZZZA 4I8KA 2ZU4A 1YLCA 3GDVA 4IC6A 5FPYA 3S69A 1ELFA 2AIPA 4LOYH 4B73A 2GMTC 3MH5A 2F9NA 3I78A 4H4FA 3HK6B 2F9BH 3Q77A 3JZ1B 1SC8U 9LPRA 1KXCA 4LXBH 4AN7A 1GBCA 2C4FH 2ZQ2A 1SLUB 5F6MA 1HJ8A 1TB6H 1HAYB 1AVGH 1MU6B 1XKBC 2G5VA 3SUDA 3A89A 1SGTA 2O8WA 5DP3A 5FBEA 1M9UA 1P09A 4MVNA 9ESTA 1GHWH 1HAIH 5FCKA 3BG8A 1G36A 1L4DA 1AMHA 2V0BA 2C8WB 1F7ZA 1MTUA 4YM9A 2O8TA 2Y5GA 1OYQA 2BD4A 1CGHA 1DT2A 4BAQB 1PQ5A 4KKDA 3PLKA 3AAVA 1K1OA 3A82A 3QGNB 3EGKH 4FUHA 2NU1E 1OKXA 1AQ7A 2XBVA 4MPWA 4FU8A 5LH8A 1SGIB 2ZFSA 4I33A 4VGCC 1PJPA 1ZHPA 3VB6A 4UEHH 1BITA 1O3CA 4K1EA 1T8NA 1G30B 3KQBA 2A7JA 4I8GA 4NFFA 1BUIA 1GBKA 1MKXH 2AGIX 4TPIZ 4RKOB 1CT2E 4DJZB 1NY22 2QF0A 3BG4C 1T8OA 3H5CB 1IQHA 2UWOA 3UREA 1O2XA 2ZGHA 3SU2A 3VB4A 5C5OA 2PTCE 3KQCA 1P02A 1L0ZA 1O2YA 3SU5A 4ESTE 1P2KA 1H9LB 4XDEA 1XUIA 1O3HA 3SGBE 4CH2B 4MDSA 2ODPA 2WPLS 1N8OC 1HJ9A 4JK6A 2WINI 2ALVA 2H9HA 3SZNA 3VXFH 1UVUH 4NIYA 4INHA 2HNTE 3SU0A 4F49A 1SVPA 1TOMH 1BRCE 4FUDA 5A2MH 3A81A 1A5HA 1F2SE 2WUCA 4GUXA 1WYKA 5CHAB 1CBWC 3MWIU 1FY3A 1W0YH 1FIWA 1FONA 1A61H 2EI6A 3TK6A 1FNIA 3RXMA 1ZRBA 3EDXB 4NA9H 1GI2A 3RXLA 1C9PA 1IAUA 2G51A 1MCTA 2BDGA 2HGTH 2ZA5A 2H2ZA 4MNVA 2ZDAH 2OC8A 2QIQA 1MU8B 2ZHFH 4NIVA 2ODQA 1ZSLA 1VITH 3BTDE 4ZHMU 1YC0A 3V13A 4JZIA 2BY6X 3OSYA 2G4UA 4WJG2 1TQ0B 2P8OB 4UFFH 2XBXA 2ZU5A 3UIRA 3PYHA 2GZ8A 1TNHA 3AAUA 2Y80A 1Z8IB 3GOVB 4B74A 3RXAA 2I6QA 1CU1A 2Z94A 1ZMLA 1HV7A 3TK9A 3KHVA 1C2GA 1P04A 2ZFFH 2DE9A 1QRWA 2BXUH 2HOBA 1Y8TA 3SN8A 1IQLA 1HAHH 3M7UA 4GAWA 5DPAA 2A4RA 1LQEA 1IHTH 5GJ4B 3ZZ3A 3I77A 6CHAC 4CHAB 1ACBE 1C5ZB 2C8XB 1C1NA 2A5IA 2CGAA 2J94A 1AY6H 1TMBH 4FUEA 1MKWK 2WPKS 1LQDB 3RXOA 3UUZA 1TOCB 3SHCH 1MD7A 1SOZA 4JZFH 3RLWH 2G4TA 4WMEA 5EODA 4OGYA 5L2ZH 4Q2KA 1NN6A 3A87A 4M7GA 1C1MA 1BDAA 3MU5A 2ZCHP 1BRBE 1EAUA 3MU8A 1DDJA 1HIAB 1W14U 4E7RG 5CMXH 2Z9KA 4X8UH 3EA9A 3L6PA 2QAAA 2QXJA 4O9VA 1VJ9U 5F8XA 2Q6DA 1O30A 1FIZA 1B0EA 3KQEA 1H4WA 3LC3A 3M3TA 4K3JA 4AG1A 4IN1A 1SGRE 2LPRA 1AHTH 2GDDA 3UTUH 2RDLA 4MPVA 3T26A 4DY7B 5F03A 3M37A 5GIBA 1EASA 2FTMA 1IQFA 3ITIA 2BDHA 3GY6A 1C1PA 5FCRA 3SBKA 1LVOA 1GHZA 4NCYA 1G37A 4X1RU 1O2MA 1TX7A 1Q31A 4ISOA 4X0WU 1KXBA 4O3UA 1E38B 1KIGH 5J4QA 1A0JA 4XBCA 3U8RH 4O03A 4U2WA 3T62A 2D2DA 3LU9B 4LK4A 2WUBA 2FLBH 3HATH 3RMNH 1D3QB 2A45B 4ABDA 5FPTA 1EB2A 5C1UA 1RRKA 2OQ5A 3GY8A 2ZPRA 1KXFA 3SNEA 1JIRA 5DGJA 5JB9S 5JDUB 4X6MA 2D1JA 4YO9A 1O2QA 3KIDU 3P8NA 3F9EA 3WY8A 2IPHA 1W3CA 1ORFA 3U8OH 3DA9B 1BHXF 4NG9H 2GDEH 1TPOA 3ODFA 3T2NA 1ELTA 2BDAA 2BTCE 1LHEH 4FUCA 3UNRA 1EP5A 4Y79A 4CRFA 4Z0KA 2QF3A 1EPTB 3RXIA 3MO9A 2IOTA 2J9NA 3UFAA 1TALA 1PQ7A 2FDAA 3OY5U 2HWLB 1GJ9B 1TPAE 2PLXA 4ABGA 4DIHH 2XC0A 1TPPA 1GHXH 1QY6A 1LCYA 1WV7H 2PW8H 1YGCH 3SU4A 1LHGH 1O3DA 1HAXB 2ZU2A 2FYRA 4A92A 1O3EA 2FODA 1ZSKA 1UCYH 1KXAA 3HK3B 2WYJA 5TCAA 1TNIA 3UNQA 1GI6A 3OYPA 2FM2A 1DFPA 1OPHB 2NU0E 1VCWA 4ISNA 1SLWB 2B7DH 1KYNA 4WVPE 2VNTA 2ANWA 4WH6A 4Y8XA 5FX6A 4AB9A 3PMJA 2AMPA 4DT7B 1UTPA 3U69H 1B5GH 3AASA 3GY4A 2J95A 2R9PA 5C3NA 2FOCA 1EOLA 1P11E 3HKJB 2ZU1A 1UHBB 5JB8S 1U6QA 2UUYA 1PPGE 1GG6B 3NZIA 2WPHS 1BOQA 1QHRB 4D76A 4HZHA 2GV6A 1O2KA 1YCPK 1GJAB 1YYY1 1D3TB 6GCHF 2OCVB 4DVAU 1O35A 1TA6A 1K21H 2FS8A 1AFQC 3TH3H 7LPRA 1Y3YA 3SJKA 1OOKB 1ARCA 1Y5UT 4WWYA 5JYIA 4A1XA 2XBYA 3M3VA 4PROA 5LPEA 2BDIA 2GV7A 3BEFB 2AFQB 1E36B 2A1DB 1ELEE 1O33A 1C1WH 2FI4E 1BA8B 5G4BA 1DWDH 1PPCE 1G3CA 1BMAA 3LH1A 2ZGXH 5EGMA 1C1UH 1FPCH 1Q3XA 1DX5M 3PMHB 4I8LA 2W5EA 3MO6A 1GVZA 3BTGE 1KDQA 2H5DA 1O39A 1WAYB 3UOPA 3DFJA 5SGAE 4I31A 3LKWA 4NZLA 4DIIH 1S0RA 1GJ4H 1SGEE 1OWIA 2YNAA 3RU4T 1VCPA 5FPSA 4OS2A 3UPEA 2BD9A 2ZHQH 3PWCA 1XXFA 1LVMA 2VIDA 2NU4E 2ZO3H 1VGCC 2JETC 2ZEBA 1SBWA 1KTTB 2W26A 4WY3A 2NU2E 1TAWA 2BHGA 4DOQA 1IQJA 4B2BA 3CP7A 4CR5A 1CA0B 1P3EA 1V2OT 3FZDA 1SPJA 3TITA 2OXSA 1Y3XA 1GJDB 1K2I1 2ZDVH 1MBMA 4NA7A 1A5IA 1AE5A 1YKTA 1GCTB 3ATKA 2CF8H 5F8ZA 2WV5A 3GYMA 2TGDA 2BD8A 1MAXA 1CO7E 1O3BA 3PMBB 4UFEH 1C1RA 1GMHF 1DWBH 5JBTA 1DOJA 4MNWA 4Y10E 1QQ4A 1T4UH 2G00A 2VJ1A 3MNBA 5IYTA 1UTJA 1MTNC 4ZKNU 1VCQA 3A80A 1UCYK 2EC9H 5AVDA 1BTWA 6GCHG 2ANMH 1GJ5H 1NRRH 1XM1A 1ZJDA 2TIOA 3QDZB 3CENA 1HDTH 3M36A 4I8JA 2XTTB 2GP9B 2JH0D 1LHDH 3O8CA 2G55A 4CRBA 1E35B 3NCLA 1XKAC 2FOMB 1C2JA 1V2QT 4X1SU 3URCA 2WPMS 5DP8A 3MU4A 5E0GA 3RU4D 3ZZ8A 5CE1A 1INCA 6ESTA 1C1OA 3RC4A 1ZSJA 2STAE 3GICB 3F9GA 2CN0H 1HJAB 1ABIH 3NXPA 1O3OA 2VVVA 2BLQA 4D7FA 1A0LA 1GVLA 2O8LA 1FY8E 1HXFH 1SL3A 5EPNA 4SGAE 5I25A 3HGPA 1SGYE 3RXRA 4DW2U 2BD3A 1OWHA 3NK8A 1O2ZA 1V2UT 1P9UA 3SI3H 2IJOB 1V2PT 1BRAA 1QB6A 3B23B 1SMFE 1T8LA 2P59A 1ETSH 1UTMA 5BPEA 3ZZDA 1MBQA 1ANBA 1YPJH 3BIUH 4WMFA 3IG6B 1SGFG 1AD8H 4HI3A 2Z9IA 1C5SA 4WXIA 4XBBA 2P16A 3RXBA 3BTWE 1FN8A 2YNBA 1BJVA 2PKSB 2A2QH 1GGDC 3SUEA 4NZQA 2UUJB 2KAIA 3UR9A 2BLOA 2ZWLH 1GMHG 4IN2A 1W2KH 1P05A 1T32A 4CBNA 1Y3WA 4IBLH 1NRSH 2VVUA 3FVFB 4AYYB 3ZVDA 4UD9H 3SORA 1GWAA 3SQEE 4A1VA 1QR3E 2ZDNA 4K8BA 3LGVA 1C5TA 4INLA 2XWBI 3TGJE 1O37A 1HB0B 1AWFH 2EI7A 1GBHA 1RD3B 2A5KA 2VGCC 5DP7A 1FDPA 1VITF 3S9BA 1UVOA 1O2JA 3VGCC 4YESB 1O2GH 1MAYA 1BQYA 4K1TA 4KGAA
chains in the Genus database with same CATH superfamily
1FXYA 1Z6EA 3T27A 4XBDA 3RXCA 1Z8RA 4F4OC 1WBGB 2OLGA 4XE4A 3MHWU 2PR3A 2VB0A 1YPKH 4FUJA 4UDWH 3TJVA 3SU3A 1X7AC 1EJAA 1NRQH 5IDKA 4AX9H 5A0CA 4J1YA 2XNIA 4AFZA 1G32B 1C1TA 4MPUA 1HAPH 4B1TA 1GDQA 1L1NA 1V2JT 2FOBA 1ZHRA 2K0QA 4YZUA 3DT0H 2BD2A 4OS5A 3A85A 5FX5A 1MZDA 1OHHD 4RT1A 4FVBA 3BTTE 3LT3A 3LGWA 1HGTH 2XYAA 1D3DB 1F5KU 2ZP0H 4GHQA 1H8ED 1ZGIA 4DCDA 3MNCA 2PTNA 1G3EA 4JZ1A 1FPHH 1O3GA 1W7GH 2A7HA 4WMDA 1V2MT 3A8DA 2ODYB 1EX3A 1MKWH 1OP8A 1UTKA 4I32A 2PUQH 2VIVA 5EJ1A 3E0NB 1WDIA 1S6FA 4HTCH 3OY6U 4JCNA 2VH6A 4Z6AH 4MNYA 3FFGA 1T4VH 1Y3VA 1JMOH 1G3BA 4TT3D 1MTWA 2BVRH 1UTNA 2ILNA 2BMGB 2KM0A 4O97A 2OUAA 4AFUA 4DURA 1HUTH 2V35A 1N6XA 1ANEA 3O8BA 3WWBA 3ZZAA 1GI7B 5EXNA 4AORA 1ZTKA 5DO4H 3BTKE 5EXLA 1TRMA 3F2GA 3ZZ6A 2UUFB 4JMYA 1C1SA 4D7GA 1GCDA 2FZZA 5EJLA 3CNRA 3FAOA 4GLYA 1QNJA 1P2JA 1VITG 3PLPA 3N7EA 4ZHLU 1NFXA 1C4Y2 1ELDE 1GDUA 1DPOA 1PFXC 2BY9X 3MH6A 1GL0E 1FMGA 1B7XB 5F8TA 1LDTT 2VIWA 1NFYA 4VGCB 5HM9A 3K6ZA 2G52A 1TABE 3FZZA 5CHAC 4FUBA 1O0DH 2FEQH 4UE7H 1D6WA 3ELAH 1FAXA 2ZGCA 2BVXH 1L1JA 1A1RA 3Q3KA 1FX0B 4X6OA 3A7TA 4ZXXH 1FV9A 2Y82A 5T3HA 5JPMH 1Z1IA 3HPTB 3TH2H 2ESTE 5EQRA 1NO9H 4AZ2B 1FN6A 4YLUA 1WQVH 1O5BB 1SKYE 1V2WT 1GMCF 2J92A 2GCTB 5HGGA 3URDA 3GCNA 3ZZ9A 3S7HB 3VB5A 4ABEA 1CT4E 2NWNA 3M5LA 2J38A 2SGPE 1C5QA 1O3NA 3RLYH 2GD4B 1ELCA 3JZ2B 2JH6D 1E37B 4YOIA 4ASHA 3BF6H 4Y76A 2AMDA 1DUEA 4QT8C 2P8OC 4UFDH 1BB0B 1F5LA 1T7CA 3C27B 3I29A 2QN5T 1QB9A 1PQ8A 4BOHA 1CHOF 1YF4A 3RXPA 1RJXB 1S85A 3A8CA 2PFEA 3DSGA 3SNBA 4ZCNA 2XC4A 2EA3A 1GBAA 1JWTA 1UW7A 1V2VT 2H9EH 2OTVA 2WPJS 5E2OA 3UAIC 1TNGA 4AOQA 3UQVA 4BTIB 4K5ZA 4RSPA 1O2NA 3STIA 1FUJA 5EQSA 2BM2A 4CHAC 4RN6A 1UTQA 3L3TA 4ABHA 2FXRA 2ZCLP 3LGUA 1AVWA 2XCNA 2FOAA 1SLXB 1OP0A 4X8SH 1C5WB 5C2ZA 4K8YA 2F9PA 1AKSB 1YCPM 3MH7A 1C5OH 1P2QA 5HIZA 5FBIA 1HLTH 2ZGJA 1TGSZ 3P8GA 4XSKU 5C1XA 2R3UA 2GZ9A 3UOUA 8ESTE 3N7DA 1ZTJA 1J8AA 4U32A 3M5NA 1A3BH 1OWJA 2CHAB 3PLBA 1O3FA 4B75A 2W3IA 3F2FA 3TU7H 1WXRA 1C2IA 3TJOA 1S5SA 3OTPA 5DK1A 2GT8A 1OWEA 1P06A 1GPZA 5EJZA 1ANCA 3Q76A 3GCHB 4K60A 1SHHB 5AF9H 1YCPH 1K28D 1XUHA 4XFQA 3A86A 2ZTXA 2ALPA 3LJJA 2BYAX 1LVYA 2DE8A 4BXSA 2WPIS 2PGBB 3OEHD 1O2VA 2F3CE 2QGRA 5DP5A 5C1YA 1Z7KA 4KTUA 3RXHA 1OP2A 2QY0B 4DGJA 3LIWA 1ABJH 4ABIA 4WXVA 1FY4A 1GMCG 2Z6BD 2R2WU 1P2NA 1GI9B 1YLNA 2RA0A 3PROA 2AGGX 1C4V2 2BX3A 2ZHDA 1UO6A 2XNDD 4CREA 2F9OA 1OWDA 3P6ZB 4X8VH 1J14A 4YT6H 1W12U 2PHBA 1CHOG 5AFZH 5PTPA 4A5TS 4YOGA 2FLRH 1CHGA 5EOKA 1O3JA 3P92A 1EKBB 5AHGH 5T6DA 3MU0A 4CR9A 2F91A 2THFB 1V2TT 3ZVGA 2YMSD 3UNSA 2BDBA 1KSNA 3PRBA 1YP9A 1EPTC 2SGFE 1W8BH 2TPIZ 4X2YA 5DKMA 5DP9A 2WV4A 2PKAB 4NWLA 1GBFA 4JYUH 4K69A 1C5MD 1P0SH 1SR5C 1F0TA 4M9FA 3TVJB 1SFIA 4MNXA 4DT4A 1C5NH 2ZTYA 2FYQA 2G8TA 1IQEA 1XXDA 3D23A 2WSSD 2GTBA 1EB1H 1PQAA 3MNXA 4IC5A 1C2FA 3ZZ4A 2BY8X 4CBOA 3BIVH 1LPZB 4WH8A 3TIUA 2BY5X 2BQ7B 1TX6A 1QB1A 4SGBE 2GZ7A 1DICA 1V2LT 1HNEE 1C5UA 4A7IB 1UVSH 1ETTH 1XX9A 4JZEH 1O3IA 4YLQH 3S9CA 1XUKA 1G3DA 2J4IA 1GBIA 4JK5A 2BB4A 2ZHEH 4GVUA 1WSSH 2AYWA 2BXTH 4Y7AA 2H5CA 1QQUA 1W13U 1MH0A 1MZAA 2J5UA 1C1VH 1TE0A 2ZGBH 1K22H 1AFEH 2ZCKP 4ZXYH 1GG6C 1O2IA 4GCHF 4TYDA 2BOKA 2ZFQH 4KP0A 2ZQ1A 1GHAF 7GCHF 1P57B 2XCFA 1O3KA 1GI3A 3NPSA 2XC5A 2BOHB 2V3MA 1S81A 2B5TB 5GNDA 3A84A 3F9HA 3SQHE 2J34A 2SGQE 2XXLA 3TK5A 2OC7A 3GDSA 3RC5A 2VWLA 1QJ7B 2R0KA 5E8EH 2FX4A 5ESBA 1TWXB 3SJOA 3U98H 3EAJA 4OS4A 1HIAA 1DWCH 4ZKOU 2C90B 1O5DH 1ETRH 3W94A 1ELGA 4OS6A 4Y8ZA 1NT1A 4ABAA 3ZVFA 1BMLA 3ZYDA 1AB9B 4A6LA 2PSYA 2Q6GA 1GVKB 1NM6A 2XRCA 3RXUA 2OINA 5T1VA 4Y8YA 2FOHA 4Q4LA 4WF8A 4B2CA 5T6GA 4TSFD 3W95A 3SUFA 2CMYA 5A0AE 2C8ZB 2RDEA 2SNWA 1OSSA 4AGJA 3A7VA 3SGQE 2Y7ZA 2FX6A 2ASUB 3B9FH 4ISHH 1AZZA 3EA7A 1P9SA 4ZMAH 2KCPA 4B76A 3E8LA 3P8OA 3WW7A 3FP7E 1C2MA 5FXLA 1CA0C 1CGIE 1FY1A 3SNCA 2SGDE 3ZVBA 1S82A 4TY7A 4AFQA 3V12A 1HAVB 1GCTC 5ESTE 2ZFTA 3QTOH 3STJA 1QL9A 1XUJA 1JOUB 1WQSA 3DSPA 2O8MA 4ISLA 3P70B 1OX1A 1PYTC 4K2YA 1A3EH 1WOFA 1ZLRA 1N6YA 3MTYA 4Y7BA 4ZKRU 2J98B 1IQKA 1KXEA 3UWJH 2M2AA 1TGNA 3V3MA 1H1BA 4GCHG 3PO1B 1HCGA 1ZMJA 2Y81A 1DUAA 1GHAG 7GCHG 3KEEA 4X8TH 3AVZA 3S0NA 1EPTA 1XUGA 1DSTA 1JRTA 3N7OA 1UVTH 5TJXA 3AK5A 3V7TA 4UFGH 3SGAE 3U28C 5JBCS 2ZG0H 1NC6A 3PMAB 3P95A 3U1IB 2ZF0H 3AW0A 3BN9A 1UTLM 1DE7H 4OS1A 1O5EH 1HXEH 2H9TH 3P17H 3Q3XA 3LONA 5L6NH 2FOFA 5A8XA 2O8UA 2P94A 1V6DA 2ZI2H 4RKJB 1ID5H 3F3BA 1Y3UA 2VU8E 5A8YA 1YPHC 2VWNA 2Z9GA 1BBRE 2OD3B 3MO3A 3SZEA 1A7SA 1FY5A 1ZPBA 1DS2E 3D49H 1DXWA 1HJAC 1QBNA 3ZVAA 4BAMB 4IMZA 1KY9A 2C8YB 4FU7A 1O3PB 1Z6JH 1TIOA 3EYDA 4GPGA 3F2HA 1LKAA 1PPFE 2ZDKA 3BTME 2EI8A 3RXSA 4BAOB 1ELVA 1AIXH 1LVBA 1O5GH 1ZPZA 1UHBA 5EQQA 3DUXH 1O5CB 3BTQE 3M5OA 1O3MA 1O2PA 5CDFE 1BMMH 3LGYA 2QCYA 3K9XB 4A1TA 4FUFA 4ABBA 3KYGA 2ZECA 1O5AB 2GCHF 4AYVB 3VB3A 3RDZA 1GI1A 2IJD1 4ACAA 1SGFA 1RIWB 3VFEA 3KYFA 1AO5A 1NBME 3ZIAD 1Y59T 1WTHD 4Q63A 1DY8A 3KGPA 4Y0ZE 1SQRA 2BZ6H 1IHSH 4NFEA 2PKSC 1W11U 2BQWB 3RXTA 1UK3A 1TYNA 4MG3A 1GBMA 1CE5A 3SJ8A 2ULLA 3GDUA 4ISIH 1SI5H 2Z9JA 3QX5H 1EUFA 3KQDA 4NSYA 4ABFA 3ZV9A 1C2HA 3QZRA 3FP8E 3RUOA 2P3UB 1EZSC 1PPBH 1THPB 3GY3A 3BSQA 2K1QA 5HXFA 1K1IA 1A0HB 2ZFRH 1QZ8A 4ZHAA 1AI8H 1RTKA 3RC6A 5GPIB 2D8WA 2FOGA 1F5RA 2OC0A 2P95A 4FUIA 3A8BA 1WTGH 4Q7XA 2HLDD 3RU4E 3PTBA 1C5XB 4ZROA 3RM0H 1J17T 1OYTH 2A2XH 2BLWA 2HPQH 3QWCH 1MMJN 2WV9A 2SGEE 3MYWA 4E05H 1EZXC 3SV8A 4LZ1H 3S7KB 1E0FD 3E1XB 1W0KD 3MH4A 1EJNA 5AFYH 1C5LH 2FWWA 1TNJA 1EAIA 3QGJA 1O2RA 3K65B 4H6TA 2HLCA 8KME2 3BTFE 3M3SA 5I46H 2BVSH 3E90B 1NPMA 2HNTF 5E0JA 3PWBA 1LPKB 1ANDA 4KTSA 1HBTH 1SGCA 2GCHG 1DWEH 4YXWD 3L33A 3H7OA 4U01A 1F0SA 1A46H 1SGQE 4IS5A 1Q2WA 3M7QA 3FKSD 3GY7A 4KELA 2FP7B 1OXGA 2GMTB 2VIQA 1L4ZA 5E0HA 7KMEH 1O32A 5DN6D 2VIOA 1V2ST 3FANA 5GDSH 1RGQA 2TGAA 1TNLA 2A0QB 1WUNH 1TBQH 1ZMNA 2A4OA 1QRXA 2ZU3A 1J15A 1TFXA 1S0QA 3KF2A 4Y71A 3V0XA 3T29A 3GY5A 3P8FA 4NWKA 1CT0E 3O8RA 3BEUA 4MQAA 3ZZBA 1O34A 1ZPCA 2LNCA 1O2UA 2F83A 3QK1A 1YPHE 3QUMP 3VPKA 2AIQA 5E2PA 2V7QD 2FIRH 1MABB 2OQUA 1O2OA 1YPGH 5DP4A 2H6MA 3PV5A 5JBBS 3A8AA 3A7ZA 3SJ9A 1KLJH 1EAXA 2OBQA 1THRH 3ATIA 1NS3A 2G5NA 5HMAA 2FPZA 4Y0YE 4I7YH 1GJBB 1TMUH 3SNAA 3K6YA 1GJ6A 3SHAH 4D8NA 3KN2A 5KEDA 8GCHF 3ATLA 1BBRK 1P10A 1UJ1A 4XOJA 2TGTA 3BG4B 1QURH 3ESTA 5A8ZA 1N1LA 1MTVA 1YPMH 3R0FA 2UUKB 1G2LA 2JJ1D 1GJCB 2W3KA 2BDYA 5EPYA 4ZKSU 3TGIE 2GCTC 3TJNA 3MNSA 3SO3A 1DXPA 2BX4A 2UWPA 1TGBA 4IMQA 3E6PH 1QJ1B 2BLVA 1TMTH 1N8OB 3E16B 4AFSA 2I6SA 2A31A 1C5VA 1NFWA 1SQTA 4JYTA 3SV7A 3A7WA 1RTFB 3R3GB 3UWIA 4X1NU 1Z1JA 3DD2H 2PGQB 1AE8H 3ODDA 2B8OH 4TWWA 2A4GA 2ZPSA 1CBWB 1UMAH 2NU3E 3EE0B 1XMNB 3RXJA 1KLTA 2B9LA 3TPIZ 1TQ7B 1ZRKA 3BV9B 1C5RA 3PRDA 4D9QA 5EIYA 1SLVB 1Z71A 5BRRE 1LHCH 3SV2H 1K1JA 1UK2A 4J2YB 4AC9A 1YLDA 4CRDA 1PPHE 2QYIA 1GBJA 3LGIA 3RMOH 1EOJA 3TLOA 5GWZA 1J16A 4NGAH 1G2MA 4R0IA 4OGXA 2ZIQH 3F6UH 2STBE 2BDCA 4CRAA 4Y11E 4X2XA 3UY9A 3SOSA 3SV9A 4B2AA 1UTOA 2L6OA 3CS7A 2VWOA 3SV6A 1O3AA 2CHAC 1OS8A 2YMSB 2Z3DA 3N99A 5EW2H 3A7XA 1BJUA 4HGCA 1T31A 5EU8A 4FVDA 3GCHC 2CF9H 1W0JD 3DFLA 2OBOA 3HGNA 3F68H 2A7CA 1QTFA 5B6OA 1HAGE 4YOJA 1O3LA 3QLPH 1T8MA 6CHAB 1NRNH 2ZDLA 2J97A 3T28A 4X2WA 4ZH8A 1TGTA 1W10U 1DVAH 3ZVCA 1CVWH 2OK5A 8GCHG 2Y5FA 1W7XH 1C2DA 1P2MA 2H1UA 1QJ6B 1AWHB 2A4QA 2F4LA 1CA8B 1QL7A 1XVOA 1MQ6A 2V3OH 1JXPA 1NESE 2QXHA 4FU9A 3PV4A 2J2UA 1BHXB 3RXFA 2AGEX 1EAWA 1BT7A 2QXGA 1GDNA 2BY7X 2BQ6B 4X1QU 3ZZ7A 1DLKB 1BTYA 2RA3A 1EFRD 1ARBA 2Y7XA 2C3SA 2M5TA 1MKXK 2ZHWH 3LGTA 4TPYA 1A2CH 1J9CH 3M35A 3RXGA 3VG8A 1RFNA 1KDQB 2QC2A 3G01A 2GX4A 4LZ4B 3W1EA 2ANKH 2FI3E 2TBSA 3OU0A 1HPGA 1HYLA 4BNRA 4CRCA 1GBDA 3M5MA 2GVFA 4BTUB 1CQQA 1UCYE 1A4WH 1AGJA 2V3HH 4MLFB 1D4PB 2R0LA 2ZZUH 4X2VA 1P01A 1V3XA 3PM3A 3GS9A 4RT0A 2ZPQA 2VIPA 1QA7A 1GHVH 2FI5E 1TONA 2Z7FE 1B0FA 1QIXB 2W7SA 3LH3A 1LTOA 1ZHMA 4BTTB 1S84A 1DSUA 5L2YH 1F92A 1G9IE 1EZUC 1D9IA 1DM4B 1XVMA 4E7NA 3EE7A 3MMGA 1MD8A 2QV1A 1VJAU 4HFPB 3PTNA 1SFQB 1SGPE 3GCTF 5A0BA 3UQOA 1SB1H 1EZQA 2VH0A 4H42U 2IPQX 1SQAA 2JDID 3H7TA 3F1SB 5EG4A 4Q7YA 1AVXA 1PPZA 4NA8A 5HIYA 1S6HA 1MTSA 1GBTA 3SNDA 5H4IB 2WZQA 2R2MB 3LJOA 1IOEA 1Z8JB 1VZQH 2AHME 3C1KA 4P02A 4MPXA 1JIMA 2W6JD 2AMQA 1BZXE 5GCHF 5FAHA 4R8TB 4F55A 5T6FA 3GISB 1TA2A 1KXDA 1GJ8B 1W0ZU 3E3TA 4MTBA 1E34B 3ATMA 1ZGVA 1LPGB 5DG6A 2G81E 4INKA 1XUFA 1RXPA 3BEIB 1C5PA 1V2RT 3ATWA 1P2OA 3F9FA 1LKBA 3MI4A 3MOCA 3RMLH 1UK4A 2C93B 1RTLA 1C4U2 2SGAA 1S83A 1YBWA 2P93A 1K1MA 3SW2B 3IITA 1DANH 1AKSA 1IQMA 2AERH 4Q7ZA 2HALA 1TRNA 3E91A 1ZR0A 2FTLE 2B0FA 3OX7U 1GMDF 2BZAA 2GJGA 3QN7A 3ZVEA 1BTUA 5C5NA 1GI4A 1TLDA 4B71A 1O36A 1JBUH 1SQOA 3TNSA 5F53A 1BRUP 3VB7A 3B8JA 2PV9B 3GYLB 1NRPH 5KECA 1HFDA 1V2NT 1C2LA 2SFAA 1TPSA 5LPFA 5IK2D 5JBAS 2UWLA 1QGFA 4K1SA 2D26C 4CH8B 1AB9C 4FETA 3TJUA 1LHFH 2EEKA 2F9VA 1K1LA 2ANYA 2ZKSA 3MU1A 2DUCA 2JKHA 2Y6TA 3A83A 2KCYA 1O2SA 2EQNA 1TGCA 2GKVE 2P3TB 3LPRA 3NWUA 4NIWA 7ESTE 3Q3YA 1AFQB 3A7YA 4DG4A 3M7TA 3ZYEA 1RS0A 5FL7D 1NU9A 2W7UA 3RXQA 4BXWA 1D6RA 1GJ7B 6LPRA 1K0HA 4ZAEA 2L74A 1SG8B 2W6ID 1IQNA 3CS0A 4Y6DA 3GCTG 4I8HA 4AB8A 1UVPA 1KLIH 4TWYA 1EATA 1TNKA 2SNVA 1FQ3A 2KAIB 2Y5HA 1Y5AT 3SUGA 2FS9A 3U1JB 1L2EA 3NUMA 2YOLA 3AW1A 4X6NA 5ABWA 4ASUD 2FO9A 1EJMA 1IQIA 1H9HE 2RG3A 3FOAA 2VINA 1YPLH 2RCEA 1TRYA 3SU1A 3ENSB 1YM0A 5K0HA 4YTAA 4JYVH 1P2IA 1O5FH 1SSXA 4B6EA 1SHYA 1GBEA 5HM2A 1K1PA 1AUTC 3DCLA 1HAZB 2TGPZ 1MCVA 3GY2A 1LMWB 1GBBA 4ZUHA 5GCHG 5EW1H 3RMMH 2ZDMA 3PB1E 1C5YB 3RXEA 1FJSA 3S9AA 3PO1C 4THNH 1O31A 3QZQA 3FP6E 2AEIH 4ABJA 1QBVH 1VGCB 1SOTA 2JETB 3LDXH 2ZC9H 2PKAA 3SJIA 4H6SB 5DJ7A 3U9AH 4NIXA 4OM9A 1BMNH 3M61U 1CGJE 1NBMD 4E06H 4Q80A 1GBLA 1TBRH 2JH5D 1QCPA 2OP9A 1GMDG 2PWXA 4AGKA 3D65E 1GI5A 5J4SA 1QBOA 5K7RA 1NU7B 2XBWA 1ZYOA 2QA9E 1BTPA 5DP6A 1GHBF 3RXVA 4O3TA 4TY6A 1E1QD 1FAKH 3OEED 5GXPA 2GGVB 3F0PA 4FUGA 3BTEE 1H8DH 1O2HA 3ZZ5A 1O2LA 3KL6A 2F43B 1GHYH 1MTNB 3F0OA 3ZZCA 1DY9A 2Q6FA 3RM2H 3ZV8A 3EA8A 3UB0A 4HG6A 1A5GH 1TBZH 5C67A 2GT7A 3LOXA 4FXGH 4BAKB 1K9OE 3SU6A 5KGOA 2PSXA 1P03A 1ESBA 1SGNE 2WYGA 4D9RA 1O2TA 1Z8GA 5FHTA 3OFND 2FESH 5A09A 3DHKH 3RXKA 4X1PU 3VXEH 1YPEH 2O9QA 2ZTZA 5LPRA 2HRVA 4YT7H 1ZOMA 1ZTLA 1RIWC 1FLEE 3K2UA 2IN2A 2Z9LA 3FO8D 1BTZA 2CXVA 3T5FH 2HVYB 2CJIA 1F0UA 1MUEB 5TCCA 4JZDH 2HPPH 3D62A 1BIOA 3U8TH 1TX8A 1BTHH 2BD7A 3QO6A 5HYOA 4U30A 1KTSB 4BANB 2PUXB 2HNTC 1VR1H 1FI8A 1HRTH 3RXDA 5L30H 1WCZA 1C2EA 3KCGH 4GHTA 2AH4X 1HAOH 2CV3A 3LC5A 4NSVA 4OS7A 1PYTD 1QRZA 5C20A 2Q1JA 2WHXA 1O2WA 2FMJA 1FZZA 4AG2A 4KTCA 2R3YA 4BAHB 2VWMA 1BBRH 1H8IH 1NZQH 1O38A 1DITH 1CSOE 2BD5A 1DLEA 3TGKE 1P3CA 1NTPA 1D3PB 1QL8A 1WU1A 1PPEE 3A88A 1AN1E 3IWMA 1BCUH 2KFWA 1C2KA 3MFJA 8LPRA 1LO6A 1Y5BT 2KCAA 4CRGA 2XW9A 5ETXA 1AZ8A 1QA0A 1GI8B 3TH4H 1GGDB 1GHBG 4GSOA 3VEQB 3TNTA 1EQ9A 3UR6A 3NRLA 3SYJA 1L1GA 3NKKA 1C9TA 3BTHE 2A5AA 2OC1A 1QFKH 2CK3D 5LGOA 1AU8A 1C1QA 1GL1A 3KNXA 1K1NA 2FOEA 1AUJA 3Q00A 1THSH 3HKIB 1JRSA 1HAVA 1H9IE 1OWKA 1MQ5A 3T25A 4UONA 1EXFA 2P3FH 1BTXA 1P8VC 2Z3EA 2VVCA 2Z3CA 2ZNKH 3E0PB 1P12E 3GCOA 1ELAA 4IW4E 5EXMA 1ESAA 1NROH 2JIZD 3EQ0H 2A32A 2F9UA 2VGCB 3VGCB 3RP2A 2J98A 1GI0A 1SGDE 1F0RA 4X6PA 1ELBA 3SI4H 2HVXA 2ZFPH 3OTJE 1ZJKA 3QTVH 4IGDA 2QXIA 1V2KT 2TRMA 2V6NA 2AS9A 1IQGA 1EP6A 3O8DA 1NFUA 1ESTA 2XWAA 1ZZZA 4I8KA 2ZU4A 1YLCA 3GDVA 4IC6A 5FPYA 3S69A 1ELFA 2AIPA 4LOYH 4B73A 2GMTC 3MH5A 2F9NA 3I78A 4H4FA 5C17A 3HK6B 2F9BH 3Q77A 4B6FA 3JZ1B 1SC8U 9LPRA 1KXCA 4LXBH 4AN7A 1GBCA 2C4FH 2ZQ2A 1SLUB 5F6MA 1HJ8A 1TB6H 1HAYB 1AVGH 1MU6B 1XKBC 2G5VA 3SUDA 3A89A 1SGTA 2O8WA 5DP3A 5FBEA 1M9UA 1P09A 4MVNA 9ESTA 1GHWH 1HAIH 5FCKA 3BG8A 1G36A 1L4DA 1AMHA 2V0BA 2C8WB 4Z1MD 1F7ZA 1MTUA 4YM9A 3WWFA 2O8TA 2Y5GA 1OYQA 2BD4A 1CGHA 1DT2A 4BAQB 1PQ5A 2K8IA 4KKDA 3PLKA 3AAVA 1K1OA 3A82A 3QGNB 3EGKH 4FUHA 2NU1E 1OKXA 1AQ7A 2XBVA 4MPWA 4FU8A 5LH8A 1SGIB 2ZFSA 4I33A 4VGCC 1PJPA 1ZHPA 3VB6A 4UEHH 1BITA 1O3CA 4K1EA 1T8NA 1G30B 3KQBA 2A7JA 4I8GA 4NFFA 5C0UA 1BUIA 1GBKA 1MKXH 2AGIX 4TPIZ 4RKOB 1CT2E 4DJZB 1NY22 2QF0A 3BG4C 1T8OA 3H5CB 1IQHA 2UWOA 3UREA 1O2XA 2ZGHA 3SU2A 3VB4A 5C5OA 2PTCE 3KQCA 1P02A 1L0ZA 1O2YA 3SU5A 4ESTE 1P2KA 1H9LB 4XDEA 1XUIA 1O3HA 3SGBE 4CH2B 4MDSA 2ODPA 2WPLS 1N8OC 1HJ9A 4JK6A 2WINI 2ALVA 4XRNA 2H9HA 3SZNA 3VXFH 1UVUH 4NIYA 4INHA 2HNTE 3SU0A 4F49A 1SVPA 1TOMH 1BRCE 4FUDA 5A2MH 3A81A 1A5HA 1F2SE 2WUCA 4GUXA 1WYKA 5CHAB 1CBWC 3MWIU 1FY3A 1W0YH 1FIWA 1FONA 1A61H 2EI6A 3TK6A 1FNIA 3RXMA 1ZRBA 3EDXB 4NA9H 1GI2A 3RXLA 1C9PA 1IAUA 2G51A 1MCTA 2BDGA 2KCOA 2HGTH 2ZA5A 2H2ZA 4MNVA 2ZDAH 2OC8A 2QIQA 1MU8B 2ZHFH 4NIVA 2ODQA 1ZSLA 1VITH 3BTDE 4ZHMU 1YC0A 3V13A 4JZIA 2BY6X 3OSYA 2G4UA 4WJG2 1TQ0B 2P8OB 4UFFH 5C0TA 2XBXA 2ZU5A 3UIRA 3PYHA 2GZ8A 1TNHA 3AAUA 2Y80A 1Z8IB 3GOVB 4B74A 4I86A 2YMSC 3RXAA 2I6QA 1CU1A 2Z94A 1ZMLA 1HV7A 3TK9A 3KHVA 1C2GA 1P04A 2ZFFH 2DE9A 1QRWA 2BXUH 2HOBA 1Y8TA 3SN8A 1IQLA 1HAHH 3M7UA 4GAWA 5DPAA 2A4RA 1LQEA 1IHTH 5GJ4B 3ZZ3A 3I77A 6CHAC 4CHAB 1E79D 1ACBE 1C5ZB 2C8XB 1C1NA 2A5IA 2CGAA 2J94A 1AY6H 1TMBH 1S6LA 4FUEA 1MKWK 5C94A 2WPKS 1LQDB 3RXOA 3UUZA 1TOCB 3SHCH 1MD7A 1SOZA 4JZFH 3RLWH 2G4TA 4WMEA 5EODA 4OGYA 5L2ZH 4Q2KA 1NN6A 3A87A 4M7GA 1C1MA 1BDAA 3MU5A 2ZCHP 1BRBE 1EAUA 3MU8A 1DDJA 1HIAB 1W14U 4E7RG 2QE7D 5CMXH 2Z9KA 4X8UH 3EA9A 3L6PA 2QAAA 2QXJA 4O9VA 1VJ9U 2KX4A 5F8XA 2Q6DA 1O30A 3PV2A 1FIZA 1B0EA 3KQEA 1H4WA 3LC3A 3M3TA 4K3JA 4AG1A 4IN1A 1SGRE 2EY4C 2LPRA 1AHTH 2GDDA 3UTUH 2RDLA 4MPVA 3T26A 4DY7B 5F03A 3M37A 5GIBA 1EASA 2FTMA 1IQFA 3ITIA 2BDHA 3GY6A 2VBCA 1C1PA 5FCRA 3SBKA 1LVOA 1GHZA 4NCYA 3OE7D 1G37A 4X1RU 1O2MA 1TX7A 1Q31A 4ISOA 4X0WU 1KXBA 4O3UA 2WPDD 1E38B 1KIGH 3KQ5A 5J4QA 1A0JA 4XBCA 3U8RH 4O03A 4U2WA 3T62A 2D2DA 3LU9B 4LK4A 2XOKD 2WUBA 2FLBH 3HATH 3RMNH 1D3QB 2A45B 4ABDA 5FPTA 1EB2A 5C1UA 3OAAD 1RRKA 1VKYA 2OQ5A 3GY8A 2ZPRA 5B6LA 1KXFA 3SNEA 1JIRA 5DGJA 5JB9S 5JDUB 4X6MA 2D1JA 4YO9A 1O2QA 3KIDU 3P8NA 3F9EA 3WY8A 2IPHA 1W3CA 1ORFA 3U8OH 3DA9B 1BHXF 4NG9H 2GDEH 1TPOA 3ODFA 3T2NA 1ELTA 2BDAA 2BTCE 1LHEH 4FUCA 3UNRA 1EP5A 4Y79A 3DSOA 4CRFA 4Z0KA 2QF3A 1EPTB 3RXIA 3MO9A 2IOTA 2J9NA 3UFAA 1TALA 1PQ7A 2FDAA 3OY5U 2HWLB 1GJ9B 1BMFD 1TPAE 2PLXA 4ABGA 4DIHH 2XC0A 1TPPA 1GHXH 1QY6A 1LCYA 1WV7H 2PW8H 1YGCH 3SU4A 1LHGH 1O3DA 1HAXB 2ZU2A 2FYRA 4A92A 1O3EA 2FODA 1ZSKA 1UCYH 1KXAA 3HK3B 2WYJA 5TCAA 1TNIA 3UNQA 1GI6A 3OYPA 2FM2A 1DFPA 1OPHB 2NU0E 1VCWA 4ISNA 1SLWB 2B7DH 1KYNA 4WVPE 2VNTA 2ANWA 4WH6A 4Y8XA 5FX6A 4AB9A 3PMJA 2AMPA 4DT7B 1UTPA 3U69H 1B5GH 3AASA 3GY4A 2J95A 2R9PA 4P00A 2FOCA 5C3NA 5DSFA 1EOLA 1P11E 3HKJB 2ZU1A 1UHBB 5JB8S 1U6QA 1H8HD 2UUYA 1PPGE 1GG6B 3NZIA 2WPHS 1BOQA 1QHRB 4D76A 4HZHA 2GV6A 1O2KA 1YCPK 1GJAB 1YYY1 1YWUA 1D3TB 6GCHF 2OCVB 4DVAU 1O35A 1TA6A 1K21H 2FS8A 1AFQC 3TH3H 7LPRA 1Y3YA 3SJKA 1OOKB 1ARCA 1Y5UT 4WWYA 5JYIA 4A1XA 2XBYA 3M3VA 4PROA 5LPEA 2BDIA 2GV7A 3BEFB 2AFQB 1E36B 2A1DB 1ELEE 1O33A 1C1WH 2FI4E 1BA8B 5G4BA 1DWDH 1PPCE 1G3CA 1BMAA 3LH1A 2ZGXH 5EGMA 1C1UH 1FPCH 1Q3XA 1DX5M 3PMHB 4I8LA 2W5EA 3MO6A 1GVZA 3BTGE 1KDQA 2H5DA 1O39A 1WAYB 3UOPA 3DFJA 5SGAE 4I31A 3LKWA 4NZLA 4DIIH 1S0RA 1GJ4H 1SGEE 1OWIA 2YNAA 3RU4T 1VCPA 5FPSA 4OS2A 3UPEA 2BD9A 2ZHQH 3PWCA 1XXFA 1LVMA 2VIDA 3FN8A 4RI0A 2NU4E 2ZO3H 1VGCC 2JETC 2ZEBA 1SBWA 1KTTB 2W26A 4WY3A 2NU2E 2QF5A 1TAWA 2BHGA 4DOQA 1IQJA 4B2BA 3CP7A 4CR5A 1CA0B 1P3EA 1V2OT 3FZDA 2JJ2D 1SPJA 3TITA 2OXSA 1Y3XA 1GJDB 1K2I1 2ZDVH 1MBMA 4NA7A 1A5IA 1AE5A 1YKTA 1GCTB 3ATKA 2CF8H 5F8ZA 2WV5A 3GYMA 2TGDA 2BD8A 1MAXA 1CO7E 1O3BA 3PMBB 4UFEH 1C1RA 1GMHF 1DWBH 5JBTA 1DOJA 4MNWA 4Y10E 1QQ4A 1T4UH 1YY3A 2G00A 2VJ1A 3MNBA 5IYTA 1UTJA 1MTNC 4ZKNU 1VCQA 3A80A 1UCYK 2EC9H 5AVDA 1BTWA 6GCHG 4F48B 2ANMH 2QF4A 4XD7D 1GJ5H 1NRRH 1XM1A 1ZJDA 2TIOA 3QDZB 3CENA 1HDTH 3M36A 4I8JA 2XTTB 2GP9B 2JH0D 1LHDH 3O8CA 1KMHB 2G55A 4CRBA 1E35B 3NCLA 1XKAC 2FOMB 1C2JA 1V2QT 4X1SU 3URCA 2WPMS 5DP8A 2LP6A 3MU4A 5E0GA 3RU4D 3ZZ8A 2PP6A 5CE1A 1INCA 6ESTA 1C1OA 3RC4A 1ZSJA 2STAE 3GICB 3F9GA 2KR7A 2CN0H 1HJAB 1ABIH 3NXPA 1O3OA 2VVVA 2BLQA 4D7FA 1A0LA 1GVLA 2O8LA 1FY8E 1HXFH 1SL3A 5EPNA 4SGAE 5I25A 2KZ4A 3HGPA 1SGYE 3RXRA 4DW2U 2BD3A 1OWHA 3NK8A 1O2ZA 1V2UT 1P9UA 3SI3H 2IJOB 1V2PT 1BRAA 1COWD 1QB6A 3B23B 1SMFE 1T8LA 2P59A 5HKKD 1ETSH 1UTMA 5BPEA 3ZZDA 1MBQA 1ANBA 1YPJH 3BIUH 4WMFA 3IG6B 1SGFG 1AD8H 4HI3A 2Z9IA 1C5SA 4WXIA 4XBBA 2P16A 3RXBA 3BTWE 1FN8A 2YNBA 1BJVA 2PKSB 2A2QH 1GGDC 3SUEA 4NZQA 2UUJB 2KAIA 3UR9A 1E1RD 2BLOA 2ZWLH 1GMHG 4IN2A 1W2KH 1P05A 1T32A 4CBNA 1Y3WA 4IBLH 1NRSH 2VVUA 3FVFB 4AYYB 3ZVDA 4UD9H 3SORA 2RFKC 1GWAA 3SQEE 4A1VA 1QR3E 5CHBA 2ZDNA 4K8BA 3LGVA 1C5TA 4INLA 2XWBI 3TGJE 1O37A 1HB0B 1AWFH 2LELA 2EI7A 1GBHA 1RD3B 2A5KA 2VGCC 5DP7A 1FDPA 1VITF 3S9BA 4ACBA 1UVOA 1O2JA 3VGCC 4YESB 1O2GH 1MAYA 1BQYA 3MQKC 3H09A 4FOUC 4K1TA 4KGAA
chains in the Genus database with same CATH topology
1FXYA 1Z6EA 3T27A 4XBDA 3RXCA 1Z8RA 4F4OC 1WBGB 2OLGA 4XE4A 3MHWU 2PR3A 2VB0A 1YPKH 4FUJA 4UDWH 3TJVA 3SU3A 1X7AC 1EJAA 1NRQH 5IDKA 4AX9H 5A0CA 4J1YA 2XNIA 4AFZA 1G32B 1C1TA 4MPUA 1HAPH 4B1TA 1GDQA 1L1NA 1V2JT 2FOBA 1ZHRA 4YZUA 3DT0H 2BD2A 4OS5A 3A85A 5FX5A 1MZDA 4FVBA 3BTTE 3LT3A 3LGWA 1HGTH 2XYAA 1D3DB 1F5KU 2ZP0H 4GHQA 1ZGIA 4DCDA 3MNCA 2PTNA 1G3EA 4JZ1A 1FPHH 1O3GA 1W7GH 2A7HA 4WMDA 1V2MT 3A8DA 2ODYB 1EX3A 1MKWH 1OP8A 1UTKA 4I32A 2PUQH 2VIVA 3E0NB 1S6FA 4HTCH 3OY6U 4JCNA 2VH6A 4Z6AH 4MNYA 3FFGA 1T4VH 1Y3VA 1JMOH 1G3BA 1MTWA 2BVRH 1UTNA 2ILNA 2BMGB 4O97A 1HUTH 2OUAA 4AFUA 4DURA 2V35A 1N6XA 1ANEA 3O8BA 3ZZAA 1GI7B 5EXNA 4AORA 1ZTKA 5DO4H 3BTKE 5EXLA 1TRMA 3ZZ6A 2UUFB 4JMYA 1C1SA 4D7GA 1GCDA 2FZZA 3FAOA 4GLYA 1QNJA 1P2JA 1VITG 3PLPA 4ZHLU 1NFXA 1C4Y2 1ELDE 1GDUA 1DPOA 1PFXC 2BY9X 3MH6A 1GL0E 1FMGA 1B7XB 5F8TA 1LDTT 2VIWA 1NFYA 4VGCB 5HM9A 3K6ZA 2G52A 1TABE 3FZZA 5CHAC 4FUBA 1O0DH 2FEQH 4UE7H 1D6WA 3ELAH 1FAXA 2ZGCA 2BVXH 1L1JA 1A1RA 3Q3KA 4X6OA 3A7TA 4ZXXH 1FV9A 2Y82A 5T3HA 5JPMH 1Z1IA 3HPTB 3TH2H 2ESTE 5EQRA 1NO9H 4AZ2B 1FN6A 4YLUA 1WQVH 1O5BB 1V2WT 1GMCF 2J92A 2GCTB 5HGGA 3URDA 3GCNA 3ZZ9A 3S7HB 3VB5A 4ABEA 1CT4E 2NWNA 3M5LA 2J38A 2SGPE 1C5QA 1O3NA 3RLYH 2GD4B 1ELCA 3JZ2B 2JH6D 1E37B 4YOIA 4ASHA 3BF6H 4Y76A 2AMDA 1DUEA 4QT8C 2P8OC 4UFDH 1BB0B 1F5LA 1T7CA 3C27B 3I29A 2QN5T 1QB9A 1PQ8A 4BOHA 1CHOF 1YF4A 3RXPA 1RJXB 1S85A 3A8CA 2PFEA 3SNBA 2XC4A 2EA3A 1GBAA 1JWTA 1V2VT 2H9EH 2OTVA 2WPJS 5E2OA 1TNGA 4AOQA 3UQVA 4BTIB 4K5ZA 4RSPA 1O2NA 3STIA 1FUJA 5EQSA 2BM2A 4CHAC 4RN6A 1UTQA 3L3TA 4ABHA 2FXRA 2ZCLP 3LGUA 1AVWA 2XCNA 2FOAA 1SLXB 1OP0A 4X8SH 1C5WB 5C2ZA 4K8YA 2F9PA 1AKSB 1YCPM 3MH7A 1C5OH 1P2QA 5FBIA 1HLTH 2ZGJA 1TGSZ 3P8GA 4XSKU 5C1XA 2R3UA 2GZ9A 3UOUA 8ESTE 1ZTJA 1J8AA 4U32A 3M5NA 1A3BH 1OWJA 2CHAB 3PLBA 1O3FA 4B75A 2W3IA 3TU7H 1C2IA 3TJOA 1S5SA 5DK1A 2GT8A 1OWEA 1P06A 1GPZA 1ANCA 3Q76A 3GCHB 4K60A 1SHHB 5AF9H 1YCPH 1K28D 1XUHA 4XFQA 3A86A 2ZTXA 2ALPA 3LJJA 2BYAX 1LVYA 2DE8A 4BXSA 2WPIS 2PGBB 1O2VA 2F3CE 2QGRA 5DP5A 5C1YA 1Z7KA 4KTUA 3RXHA 1OP2A 2QY0B 4DGJA 3LIWA 1ABJH 4ABIA 4WXVA 1FY4A 1GMCG 2Z6BD 2R2WU 1P2NA 1GI9B 2RA0A 3PROA 2AGGX 1C4V2 2BX3A 2ZHDA 1UO6A 4CREA 2F9OA 1OWDA 3P6ZB 4X8VH 1J14A 4YT6H 1W12U 2PHBA 1CHOG 5AFZH 5PTPA 4A5TS 4YOGA 2FLRH 1CHGA 5EOKA 1O3JA 3P92A 1EKBB 5AHGH 5T6DA 3MU0A 4CR9A 2F91A 2THFB 1V2TT 3ZVGA 3UNSA 2BDBA 1KSNA 1YP9A 1EPTC 2SGFE 1W8BH 2TPIZ 4X2YA 5DKMA 5DP9A 2WV4A 2PKAB 4NWLA 1GBFA 4JYUH 4K69A 1C5MD 1P0SH 1SR5C 1F0TA 3TVJB 1SFIA 4MNXA 1C5NH 2ZTYA 2FYQA 2G8TA 1IQEA 1XXDA 3D23A 2GTBA 1EB1H 1PQAA 3MNXA 4IC5A 1C2FA 3ZZ4A 2BY8X 4CBOA 3BIVH 1LPZB 4WH8A 3TIUA 2BY5X 2BQ7B 1TX6A 1QB1A 4SGBE 2GZ7A 1DICA 1V2LT 1HNEE 1C5UA 4A7IB 1UVSH 1ETTH 1XX9A 4JZEH 1O3IA 4YLQH 3S9CA 1XUKA 1G3DA 2J4IA 1GBIA 4JK5A 2BB4A 2ZHEH 4GVUA 1WSSH 2AYWA 2BXTH 4Y7AA 2H5CA 1QQUA 1W13U 1MH0A 1MZAA 1C1VH 1TE0A 2ZGBH 1K22H 1AFEH 2ZCKP 4ZXYH 1GG6C 1O2IA 4GCHF 4TYDA 2BOKA 2ZFQH 4KP0A 2ZQ1A 1GHAF 7GCHF 1P57B 2XCFA 1O3KA 1GI3A 3NPSA 2XC5A 2BOHB 1S81A 2B5TB 3A84A 3F9HA 3SQHE 2J34A 2SGQE 2XXLA 3TK5A 2OC7A 3GDSA 3RC5A 2VWLA 1QJ7B 2R0KA 5E8EH 2FX4A 5ESBA 1TWXB 3SJOA 3U98H 3EAJA 4OS4A 1HIAA 1DWCH 4ZKOU 2C90B 1O5DH 1ETRH 3W94A 1ELGA 4OS6A 4Y8ZA 1NT1A 4ABAA 3ZVFA 1BMLA 3ZYDA 1AB9B 4A6LA 2PSYA 2Q6GA 1GVKB 1NM6A 2XRCA 3RXUA 2OINA 4Y8YA 2FOHA 4WF8A 4B2CA 5T6GA 3W95A 3SUFA 2CMYA 5A0AE 2C8ZB 2SNWA 1OSSA 4AGJA 3A7VA 3SGQE 2Y7ZA 2FX6A 2ASUB 3B9FH 4ISHH 1AZZA 3EA7A 1P9SA 4ZMAH 4B76A 3E8LA 3P8OA 3FP7E 1C2MA 5FXLA 1CA0C 1CGIE 1FY1A 3SNCA 2SGDE 3ZVBA 1S82A 4TY7A 4AFQA 3V12A 1HAVB 1GCTC 5ESTE 2ZFTA 3QTOH 3STJA 1QL9A 1XUJA 1JOUB 1WQSA 2O8MA 4ISLA 3P70B 1OX1A 1PYTC 4K2YA 1A3EH 1WOFA 1ZLRA 1N6YA 3MTYA 4Y7BA 4ZKRU 1IQKA 1KXEA 3UWJH 1TGNA 3V3MA 1H1BA 4GCHG 3PO1B 1HCGA 1ZMJA 2Y81A 1DUAA 1GHAG 7GCHG 3KEEA 4X8TH 3AVZA 3S0NA 1EPTA 1XUGA 1DSTA 1JRTA 3N7OA 1UVTH 5TJXA 3V7TA 4UFGH 3SGAE 5JBCS 2ZG0H 1NC6A 3PMAB 3P95A 3U1IB 2ZF0H 3AW0A 3BN9A 1UTLM 1DE7H 4OS1A 1O5EH 1HXEH 2H9TH 3P17H 3Q3XA 3LONA 5L6NH 2FOFA 5A8XA 2O8UA 2P94A 1V6DA 2ZI2H 4RKJB 1ID5H 1Y3UA 2VU8E 5A8YA 1YPHC 2VWNA 2Z9GA 1BBRE 2OD3B 3MO3A 1A7SA 1FY5A 1ZPBA 1DS2E 3D49H 1DXWA 1HJAC 1QBNA 3ZVAA 4BAMB 4IMZA 1KY9A 2C8YB 4FU7A 1O3PB 1Z6JH 1TIOA 3EYDA 4GPGA 1LKAA 1PPFE 2ZDKA 3BTME 2EI8A 3RXSA 4BAOB 1ELVA 1AIXH 1LVBA 1O5GH 1ZPZA 1UHBA 5EQQA 3DUXH 1O5CB 3BTQE 3M5OA 1O3MA 1O2PA 1BMMH 3LGYA 2QCYA 3K9XB 4A1TA 4FUFA 4ABBA 2ZECA 1O5AB 2GCHF 4AYVB 3VB3A 3RDZA 1GI1A 1SGFA 1RIWB 3VFEA 1AO5A 1Y59T 1WTHD 1DY8A 3KGPA 4Y0ZE 2BZ6H 1IHSH 4NFEA 2PKSC 1W11U 2BQWB 3RXTA 1UK3A 1TYNA 4MG3A 1GBMA 1CE5A 3SJ8A 2ULLA 3GDUA 4ISIH 1SI5H 2Z9JA 3QX5H 1EUFA 3KQDA 4NSYA 4ABFA 3ZV9A 1C2HA 3QZRA 3FP8E 3RUOA 2P3UB 1EZSC 1PPBH 1THPB 3GY3A 3BSQA 2K1QA 5HXFA 1K1IA 1A0HB 2ZFRH 4ZHAA 1AI8H 1RTKA 3RC6A 5GPIB 2D8WA 2FOGA 1F5RA 2OC0A 2P95A 4FUIA 3A8BA 1WTGH 4Q7XA 3RU4E 3PTBA 1C5XB 4ZROA 3RM0H 1J17T 1OYTH 2A2XH 2BLWA 2HPQH 3QWCH 1MMJN 2SGEE 3MYWA 4E05H 1EZXC 3SV8A 4LZ1H 3S7KB 1E0FD 3E1XB 3MH4A 1EJNA 5AFYH 1C5LH 2FWWA 1TNJA 1EAIA 3QGJA 1O2RA 3K65B 4H6TA 2HLCA 8KME2 3BTFE 3M3SA 5I46H 2BVSH 3E90B 1NPMA 2HNTF 5E0JA 3PWBA 1LPKB 1ANDA 4KTSA 1HBTH 1SGCA 2GCHG 1DWEH 3L33A 3H7OA 4U01A 1F0SA 1A46H 1SGQE 4IS5A 1Q2WA 3M7QA 3GY7A 4KELA 2FP7B 1OXGA 2GMTB 2VIQA 1L4ZA 5E0HA 7KMEH 1O32A 2VIOA 1V2ST 3FANA 5GDSH 1RGQA 2TGAA 1TNLA 2A0QB 1WUNH 1TBQH 1ZMNA 2A4OA 1QRXA 2ZU3A 1J15A 1TFXA 1S0QA 3KF2A 4Y71A 3V0XA 3T29A 3GY5A 3P8FA 4NWKA 1CT0E 3O8RA 3BEUA 4MQAA 3ZZBA 1O34A 1ZPCA 2LNCA 1O2UA 2F83A 3QK1A 1YPHE 3QUMP 3VPKA 2AIQA 5E2PA 2FIRH 2OQUA 1O2OA 1YPGH 5DP4A 2H6MA 5JBBS 3A8AA 3A7ZA 3SJ9A 1KLJH 1EAXA 2OBQA 1THRH 3ATIA 1NS3A 2G5NA 5HMAA 2FPZA 4Y0YE 4I7YH 1GJBB 1TMUH 3SNAA 3K6YA 1GJ6A 3SHAH 4D8NA 3KN2A 8GCHF 3ATLA 1BBRK 1P10A 1UJ1A 4XOJA 2TGTA 3BG4B 1QURH 3ESTA 5A8ZA 1N1LA 1MTVA 1YPMH 3R0FA 2UUKB 1G2LA 1GJCB 2W3KA 2BDYA 5EPYA 4ZKSU 3TGIE 2GCTC 3TJNA 3MNSA 3SO3A 1DXPA 2BX4A 2UWPA 1TGBA 4IMQA 3E6PH 1QJ1B 2BLVA 1TMTH 1N8OB 3E16B 4AFSA 2I6SA 2A31A 1C5VA 1NFWA 1SQTA 4JYTA 3SV7A 3A7WA 1RTFB 3R3GB 3UWIA 4X1NU 1Z1JA 3DD2H 2PGQB 1AE8H 3ODDA 2B8OH 4TWWA 2A4GA 2ZPSA 1CBWB 1UMAH 2NU3E 3EE0B 1XMNB 3RXJA 1KLTA 2B9LA 3TPIZ 1TQ7B 1ZRKA 3BV9B 1C5RA 4D9QA 1SLVB 1Z71A 5BRRE 1LHCH 3SV2H 1K1JA 1UK2A 4J2YB 1YLDA 4CRDA 1PPHE 2QYIA 1GBJA 3LGIA 3RMOH 1EOJA 3TLOA 5GWZA 1J16A 4NGAH 1G2MA 4R0IA 4OGXA 2ZIQH 3F6UH 2STBE 2BDCA 4CRAA 4Y11E 4X2XA 3UY9A 3SOSA 3SV9A 4B2AA 1UTOA 3CS7A 2VWOA 3SV6A 1O3AA 2CHAC 1OS8A 2Z3DA 5EW2H 3A7XA 1BJUA 4HGCA 1T31A 5EU8A 4FVDA 3GCHC 2CF9H 3DFLA 2OBOA 3HGNA 3F68H 2A7CA 1QTFA 5B6OA 1HAGE 4YOJA 1O3LA 3QLPH 1T8MA 6CHAB 1NRNH 2ZDLA 3T28A 4X2WA 4ZH8A 1TGTA 1W10U 1DVAH 3ZVCA 1CVWH 8GCHG 2Y5FA 1W7XH 1C2DA 1P2MA 2H1UA 1QJ6B 1AWHB 2A4QA 1CA8B 1QL7A 1XVOA 1MQ6A 2V3OH 1JXPA 1NESE 2QXHA 4FU9A 3PV4A 2J2UA 1BHXB 3RXFA 2AGEX 1EAWA 1BT7A 2QXGA 1GDNA 2BY7X 2BQ6B 4X1QU 3ZZ7A 1DLKB 1BTYA 2RA3A 1ARBA 2Y7XA 2C3SA 2M5TA 1MKXK 2ZHWH 3LGTA 4TPYA 1A2CH 1J9CH 3M35A 3RXGA 1RFNA 1KDQB 2QC2A 3G01A 2GX4A 4LZ4B 2ANKH 2FI3E 2TBSA 3OU0A 1HPGA 1HYLA 4BNRA 4CRCA 1GBDA 3M5MA 2GVFA 4BTUB 1CQQA 1UCYE 1A4WH 1AGJA 2V3HH 4MLFB 1D4PB 2R0LA 2ZZUH 4X2VA 1P01A 1V3XA 3PM3A 2ZPQA 2VIPA 1QA7A 1GHVH 2FI5E 1TONA 2Z7FE 1B0FA 1QIXB 2W7SA 3LH3A 1LTOA 1ZHMA 4BTTB 1S84A 1DSUA 5L2YH 1F92A 1G9IE 1EZUC 1D9IA 1DM4B 1XVMA 4E7NA 3MMGA 1MD8A 2QV1A 1VJAU 4HFPB 3PTNA 1SFQB 1SGPE 3GCTF 5A0BA 3UQOA 1SB1H 1EZQA 2VH0A 4H42U 1SQAA 3H7TA 3F1SB 5EG4A 4Q7YA 1AVXA 1PPZA 4NA8A 1S6HA 1MTSA 1GBTA 3SNDA 5H4IB 2R2MB 3LJOA 1IOEA 1Z8JB 1VZQH 3C1KA 4MPXA 1JIMA 2AMQA 1BZXE 5GCHF 5FAHA 4R8TB 5T6FA 3GISB 1TA2A 1KXDA 1GJ8B 1W0ZU 3E3TA 4MTBA 1E34B 3ATMA 1ZGVA 1LPGB 5DG6A 2G81E 4INKA 1XUFA 1RXPA 3BEIB 1C5PA 1V2RT 3ATWA 1P2OA 3F9FA 1LKBA 3MI4A 3MOCA 3RMLH 1UK4A 2C93B 1RTLA 1C4U2 2SGAA 1S83A 1YBWA 2P93A 1K1MA 3SW2B 3IITA 1DANH 1AKSA 1IQMA 2AERH 4Q7ZA 2HALA 1TRNA 3E91A 1ZR0A 2FTLE 2B0FA 3OX7U 1GMDF