3E16B

X-ray structure of human prostasin in complex with benzoxazole warhead peptidomimic, lysine in p3
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
247
structure length
247
Chain Sequence
ITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPISLPAAQASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNSLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASWIQSKVTELQPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of inhibitors of the channel-activating protease prostasin (CAP1/PRSS8) utilizing structure-based design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Prostasin
total genus 50
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.-:
pdb deposition date 2008-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3e16B02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3e16B01
3GISB 5HYOA 2GCHF 2PKSC 1C5RA 1GJ8B 5FAHA 1TQ0B 3V3MA 1QFKH 4GLYA 1ELCA 3A7ZA 5C5NA 4X8SH 4NWKA 5ESTE 3RXTA 2FLRH 2XBWA 6GCHG 5IYTA 4B76A 1HJAB 2ZQ1A 4YLUA 2QYIA 5C1YA 1D6RA 2O9QA 1ELDE 3IITA 2Z3DA 3AW1A 1RIWC 3PV4A 3Q3KA 4DT7B 4DURA 5GXPA 1TQ7B 3TGKE 1S82A 3SI4H 1HAIH 1CBWC 1HGTH 4X6MA 5B6OA 2OC8A 2JKHA 1UJ1A 2G5NA 2XWBI 3ZVEA 2XBVA 4YOIA 1HFDA 3MU0A 2A31A 3FP6E 1HAOH 2BVXH 1TRYA 2ZHEH 2A4GA 3RU4E 1P57B 3VGCC 3U98H 4DVAU 2BDIA 2ZWLH 3SUGA 1DFPA 2J34A 3U1JB 1BITA 3ZZCA 2Q1JA 1IQIA 2ZQ2A 3MYWA 4O9VA 2XYAA 2QAAA 1DWBH 1GJ5H 1E35B 2A0QB 1FY1A 4DY7B 3GY2A 1TNLA 5DP4A 2F9UA 1AQ7A 1ZMJA 2BMGB 1MTVA 4AX9H 1GHXH 1TONA 4WWYA 1GL0E 3UR9A 1O32A 1ZJDA 3RMLH 1EZQA 1TNIA 3VXEH 1P03A 1PPHE 3SUDA 3LIWA 3I29A 1C1MA 1HAHH 2SGPE 1X7AC 1AE8H 2ZHWH 1THSH 1PPGE 3DT0H 2D8WA 1XKBC 3ZYEA 1AN1E 1O30A 4TWYA 1P2NA 2A7HA 1HCGA 2VINA 1O3KA 1QBVH 2HRVA 3O8BA 4JYVH 5FHTA 3ZVFA 2Z3EA 3MMGA 4K8BA 1ELFA 4I7YH 5I46H 3M36A 4I8GA 4K1SA 4K3JA 1UK2A 1RTFB 2W7UA 2VGCC 3RXMA 1AGJA 1MKWK 1EAWA 2F91A 3BTME 3OYPA 2BD2A 1GBDA 5E0JA 4DJZB 1W0YH 2ZZUH 2AEIH 1O2HA 2UUKB 1YF4A 4NIYA 5AVDA 3UQOA 2KAIA 5TJXA 3SNBA 1CGIE 1CT0E 1BTWA 2XC4A 3LJOA 4OGXA 4SGAE 3RU4T 3WY8A 1LCYA 5J4SA 3E3TA 3S9CA 1EUFA 2UUJB 2ZP0H 1SBWA 3HKIB 1OX1A 5A0AE 2BX4A 2R9PA 3BEUA 4ZROA 1C5VA 1DY8A 4YOJA 1TLDA 1P01A 2FX4A 1MBQA 2LPRA 2O8MA 3AAVA 1U6QA 3W94A 3U8TH 2A7JA 1FN8A 2WPJS 1O5FH 2F9PA 1QL7A 3P8OA 1HYLA 1SB1H 4X1RU 1W7XH 1KLIH 2BX3A 4BTUB 3Q3YA 4K2YA 3VEQB 5A8XA 3T29A 4MVNA 3I77A 5C67A 1UCYK 3LH1A 2A4OA 2AGIX 3FVFB 3SV7A 1FONA 1NPMA 2DE8A 1TPPA 4JYUH 3MU4A 1S83A 4NA8A 4O3UA 1D3PB 4UFGH 1V2LT 2OXSA 2BDCA 3LPRA 5EXLA 1YPLH 5FPSA 1EATA 3GY6A 1FY5A 1O3LA 2WV4A 7LPRA 4Y7AA 2ESTE 4ABBA 3BTGE 1EB2A 3ATLA 3DA9B 1O38A 2ZPSA 4ZKRU 4ZAEA 2XW9A 1XXFA 2J92A 2UUFB 1SLVB 4IBLH 1D9IA 4BAMB 3BG4C 1BRUP 4FUIA 3RMOH 2GZ7A 3EA9A 1S0QA 2B7DH 2QGRA 3E16B 1OSSA 2ZFRH 3VB7A 1QHRB 2RDLA 1EAIA 4DCDA 3MH5A 1NRNH 1UHBA 1WYKA 1W8BH 3QX5H 1QB9A 2OQ5A 3LGIA 3DUXH 1LVYA 2ZDKA 3BV9B 1MCTA 3GCTG 5E2PA 3PO1C 1HJAC 1GJ6A 3RP2A 2VJ1A 1NO9H 3RXJA 1VITH 2A45B 2QY0B 2JETC 2O8UA 2UUYA 1ZLRA 1MD7A 3CS0A 2ODQA 4IC6A 2FYRA 5DK1A 1FY8E 3DFJA 2SGDE 1AMHA 3ZZ3A 1BBRH 3C27B 2Z9IA 1W14U 3ELAH 1GI3A 2NU4E 1ESAA 3OY5U 2GZ8A 1K21H 5EXMA 1FAXA 3AVZA 3TH2H 1O3CA 1TYNA 3F1SB 3GCHB 3VGCB 1GDNA 2O8LA 4X1NU 1GVLA 1FLEE 2H1UA 1C5NH 4F4OC 1KXCA 1DOJA 1DUEA 3GCOA 1PPFE 2GVFA 4DGJA 1QA7A 2GDDA 4MDSA 3SORA 5IDKA 1ZSKA 5AF9H 3BTTE 3O8CA 1A3BH 2VNTA 3GDSA 5F8TA 3M37A 1DUAA 4FUHA 3NCLA 3LGYA 3MU1A 2P93A 3T25A 2JH5D 2XBXA 3ZZ8A 3UY9A 1ABIH 1SR5C 1V2NT 1LVBA 3RXRA 1XXDA 3CS7A 1Y5BT 2PUXB 1HPGA 1GGDB 2SGAA 1A1RA 2GP9B 1O3FA 2PR3A 3UOPA 2J2UA 4VGCB 4ABEA 1NY22 3MNSA 4UDWH 3RXOA 2FI5E 4NZQA 1G30B 4MNYA 1KXAA 3QLPH 2EI8A 1Q3XA 3UIRA 1Y8TA 1H9IE 5GIBA 4OS7A 2PGQB 4X2XA 1MKWH 4GHQA 3VXFH 1G2MA 1TGTA 2YNBA 1ZTLA 2C90B 3SBKA 2TGPZ 2FOFA 3STJA 1Z71A 2XTTB 1V3XA 1P0SH 3QUMP 4X6PA 2OP9A 2VIQA 4BNRA 1KLJH 4JZ1A 4BXWA 1ORFA 4ZH8A 1TX6A 1MTNC 2BY7X 1P04A 1GBTA 2OQUA 4U2WA 3D49H 2BLQA 3T2NA 5GWZA 1HAXB 3KN2A 3HKJB 5DJ7A 1P3EA 5EW2H 3BN9A 2VH0A 1ETRH 3ENSB 1QJ6B 4B2AA 1SGFA 2OC7A 1TMTH 3NWUA 4FUCA 1EJAA 2AYWA 2BDAA 2UWPA 1DVAH 1N6XA 1F92A 1K28D 1ZTKA 1MCVA 3F9HA 1O2UA 1QGFA 1MMJN 1AVXA 1CSOE 3LT3A 3ZZBA 2VWNA 2ZGXH 3ZZAA 3RXPA 1TNGA 2V3OH 4Y8XA 3B9FH 4D8NA 5DO4H 3M5OA 1W11U 1BDAA 1MUEB 4YESB 1T4VH 1G3BA 2VIWA 3A8AA 2CHAB 2QXGA 3VB3A 4ABJA 1GHVH 1BMNH 3P70B 1D3DB 1V2TT 3UR6A 1CGHA 3A83A 4NFEA 1Q31A 2CF9H 2JETB 4MQAA 2QXJA 3MU8A 3E1XB 1OYTH 4AYVB 1S81A 1PPZA 1GHZA 3EYDA 4A1TA 4Q80A 4WXVA 1BIOA 1BZXE 4MNXA 4Q7ZA 4WF8A 3AASA 3SHAH 4JZDH 3SQEE 1W2KH 2FP7B 2GMTB 4FU7A 1CE5A 1P06A 3T5FH 4AG2A 4JYTA 4U01A 1DE7H 3M5LA 1GMDG 3TJNA 4FU9A 3OX7U 2UWLA 3RC4A 2ANWA 4CRBA 3RXDA 3ZV9A 3RC6A 1V2UT 3I78A 2SFAA 3KQCA 2BD4A 1O36A 3NXPA 4X2YA 8GCHF 2BQ7B 2OBOA 2ZTZA 1NN6A 1EZSC 1K1OA 1O37A 2R3YA 2GT8A 4AB8A 1J9CH 4INHA 4TYDA 2R2MB 1RS0A 1KSNA 1O3BA 2PW8H 2Y80A 1P2JA 5L2ZH 5F6MA 1UTOA 5DP8A 1TOCB 1P09A 2BDHA 1D3TB 3ZZ4A 2R0KA 1BTUA 5JB9S 3BIUH 3JZ2B 1TNHA 4PROA 3UNQA 2P3TB 2ZHDA 5H4IB 1BA8B 2H9EH 4AORA 1GJAB 3QTOH 5L30H 1KYNA 6CHAB 4XFQA 2VGCB 3RLWH 2ZDVH 2RCEA 1B7XB 3QWCH 1DM4B 2QF0A 3MFJA 1TAWA 2HALA 3RXVA 1DWEH 1INCA 7ESTE 1EASA 3A86A 2A4QA 2V6NA 1MU8B 1BHXB 4ZHMU 2FS8A 1K22H 2GCTB 2B8OH 1QJ7B 4H42U 3RUOA 1TRNA 3MWIU 3SV6A 5FCRA 1V2KT 2F9OA 2HGTH 1T7CA 1P02A 2OC1A 2J95A 3A7YA 1J16A 3SJ9A 5EXNA 4QT8C 4Y76A 2QN5T 1ANCA 1O2TA 1C2DA 4FUGA 1EX3A 2VVCA 1C5UA 1O3GA 7KMEH 1L4ZA 1BBRE 1GBHA 3LGTA 5C5OA 4ESTE 4FUFA 4X8UH 1SL3A 1HAPH 2Z9KA 1W7GH 1XUJA 5LGOA 3TNSA 2BDGA 1OYQA 1HAVB 3H7TA 2SGEE 2A7CA 4KELA 4E06H 4THNH 3GYLB 2Q6GA 4AFQA 5K0HA 2ZFSA 2FLBH 3NK8A 4CH2B 4ZXXH 2WYGA 2WPKS 3KIDU 2C3SA 1C9TA 1ZOMA 1ZHMA 1EAUA 3L6PA 5DP9A 3A8DA 2O8WA 4ZXYH 1KXBA 4BAQB 1TNKA 3BTWE 4ZKOU 1OWJA 3SN8A 4RSPA 1LMWB 4MNVA 1CQQA 1NRQH 4J1YA 5FBEA 5A2MH 4ZUHA 1V2OT 1G3EA 3PTNA 3RXQA 1O2VA 3SU2A 5FX6A 2PHBA 2EC9H 2ZU3A 4RKJB 1LQEA 3M3VA 4ZHLU 2XNIA 4E7NA 3BEIB 1TE0A 1VR1H 4CR5A 1YC0A 2BLVA 4B75A 3MTYA 2ZIQH 3VB5A 1DPOA 1FV9A 1BBRK 2BDYA 1P9UA 4WH8A 2D2DA 2OC0A 3ZVGA 1VITG 1GBKA 5T6GA 1L2EA 3U8OH 2QIQA 1QBOA 1ZGVA 3FZDA 2BVRH 4RKOB 3D23A 1LKBA 1UVSH 2H5DA 2J9NA 8ESTE 3EDXB 1YPMH 3ZVBA 6LPRA 4XE4A 2XXLA 3P17H 1JXPA 3STIA 1P2OA 5JBCS 1JOUB 1S85A 1UTNA 1GL1A 5A8ZA 2FESH 3E91A 1GJ7B 1SQOA 1Z1JA 4Y0YE 2W7SA 2CV3A 1A46H 1SGFG 1P3CA 3BTDE 2YOLA 4B73A 1WUNH 4BAOB 1GPZA 5GCHG 1SGQE 3SU0A 1CVWH 3SJOA 4B2CA 3BTFE 3RXIA 2WUBA 1J17T 1AVGH 1CBWB 3KGPA 1T8NA 5C20A 5BRRE 1GBJA 2ZHQH 1NZQH 1SLXB 2HOBA 2BY5X 4YM9A 1O2PA 2XBYA 6GCHF 5BPEA 1GWAA 1TBZH 3KNXA 1K1LA 3P92A 2B0FA 2GKVE 1O2NA 3LC3A 1QQ4A 1SQAA 4NFFA 5PTPA 1TGNA 4NIXA 2BOHB 1IQNA 4UD9H 4NSVA 1FPCH 3PTBA 5DP6A 4CHAB 2HNTE 1TX7A 1MQ6A 3FAOA 1PQAA 2H9HA 1UTJA 4Y8YA 1SMFE 2A5IA 2ZPRA 5CHAC 1O2LA 1UK4A 4NIWA 3SOSA 4Q7XA 3JZ1B 4JCNA 1QRWA 1GI0A 1EB1H 1LVMA 1VJ9U 3TNTA 2A1DB 4FVDA 4VGCC 1RXPA 1DDJA 2ZEBA 1NFYA 3GDVA 1NESE 2ZFQH 4NWLA 2BD9A 1PPBH 4I31A 2I6SA 3SU3A 1ANDA 5ETXA 5I25A 4UEHH 1GCTC 5SGAE 4WH6A 1QNJA 1MKXK 3QGJA 1QCPA 3UTUH 2ODPA 1DY9A 3LGVA 1IQKA 1P9SA 4O97A 4BTIB 3AAUA 1CA0C 5T3HA 1MTWA 3CENA 2Z6BD 2VU8E 3SU5A 3OTJE 2GTBA 1S84A 1LHFH 2YNAA 3S9AA 4Y11E 5EQRA 4Y6DA 4K69A 1D4PB 4JMYA 2ZPQA 2QA9E 3GY5A 3K9XB 4GAWA 1OWDA 1BJVA 3BTHE 5E0HA 1VCWA 2WPMS 4WMDA 5C1XA 1WV7H 2A4RA 4TWWA 4Y71A 3ZVCA 2CGAA 1GMHF 4GCHG 3A80A 4F49A 1AKSB 4LK4A 3SU4A 3AW0A 4AB9A 3FP8E 2FXRA 1O2XA 4D9RA 1TOMH 3PO1B 1LDTT 1O3HA 1QL9A 1Z6EA 4H6SB 2CXVA 1SC8U 3LGUA 1EP5A 2HLCA 3LU9B 1D6WA 1UVOA 4HI3A 3FANA 5HMAA 1MAXA 1SGCA 3KQDA 4ZHAA 3MHWU 2F9BH 1CGJE 1S5SA 1O3PB 1SGNE 4ISIH 1O2KA 3S0NA 8LPRA 2ASUB 1XMNB 2Y6TA 1ID5H 4J2YB 1C2LA 3E0PB 2IJOB 1GMCG 1VGCC 2EI6A 3A88A 3P95A 3URDA 4IC5A 1S0RA 1NRSH 2BQ6B 2SNVA 2Y7ZA 4WY3A 1O2GH 2ZECA 4I8LA 4NA7A 1WU1A 3TK5A 1ANEA 5A09A 4IN2A 2WPIS 5JDUB 3RDZA 1G3DA 2P3UB 2G8TA 3QN7A 2BXUH 1O5DH 1AUTC 2GV7A 2R2WU 3ATMA 2TGDA 2PV9B 2ZU1A 4UE7H 1A0LA 1SLUB 1AE5A 1DX5M 1UTLM 1OP0A 3LJJA 2FMJA 3VFEA 3NZIA 1G32B 1PYTD 2FZZA 2FEQH 1YCPH 4WJG2 1CHOF 3TU7H 3E6PH 1SGEE 5EQQA 3PLPA 1V2JT 3SUFA 1TFXA 4MPUA 1SOZA 1WTHD 4B71A 2ZU4A 3M61U 2BZ6H 1ETSH 4ABFA 1QQUA 1O2JA 4ASHA 1UTMA 1FJSA 3RU4D 1SHYA 1RGQA 1Y3WA 1OWKA 1SOTA 3SNEA 1DT2A 1IOEA 3KCGH 3VB4A 4KTCA 4CRAA 3RXGA 1ELAA 1ZRKA 1XM1A 1QURH 4D7GA 3QK1A 1EZUC 1GI6A 2BDBA 1EOJA 1ESTA 1Y59T 2TRMA 1QBNA 1V2MT 3V13A 5HXFA 1MQ5A 3E8LA 4Y0ZE 3A82A 4AFUA 1KY9A 1KLTA 4E05H 4ABAA 3UNSA 1ANBA 2GX4A 1QA0A 2STAE 3SI3H 5EGMA 3IWMA 1QY6A 3HK6B 1GI7B 1MBMA 1H8IH 2HVXA 5JBAS 5E2OA 3SJ8A 1UMAH 1NFXA 1AFEH 1N1LA 1O2QA 1O2RA 3GY8A 2G4TA 3F9EA 4Y8ZA 1GBEA 1C2IA 4DW2U 2FOGA 2ZCHP 1AB9B 4D76A 1HXFH 1C1QA 1TMBH 4MTBA 3M3SA 1K1PA 4JZIA 1HNEE 1J15A 4HTCH 2Z3CA 3KHVA 4BXSA 1O3MA 4KKDA 4XBDA 1UTPA 1C2EA 2RG3A 4CRFA 2ZU2A 1DICA 4Z6AH 5FBIA 1O3NA 2C4FH 1GBMA 2XCFA 1O3JA 4CR9A 2AMPA 1GI9B 2C93B 4WMEA 1P11E 3F6UH 3G01A 3Q77A 1AO5A 1HV7A 1O33A 1LHGH 1EPTC 1BCUH 4UFEH 1G36A 3A7TA 4AGKA 1RTLA 2ZTYA 1KTSB 3UWJH 1NS3A 3NKKA 1O3DA 1O2YA 3PMHB 4HZHA 1FAKH 2PLXA 2PWXA 3U1IB 3TITA 4AYYB 3RXFA 3QGNB 4A92A 2RA3A 4IMZA 2ZHFH 3MNBA 1C2HA 4YLQH 1FPHH 5FCKA 1PQ7A 3RXKA 4Y10E 1L1GA 2ZCLP 1JWTA 2BY6X 2NU2E 1ZMLA 1V2ST 3A89A 2C8WB 2WPLS 3F68H 1HUTH 1QB1A 1PFXC 1AWFH 2H5CA 1GJCB 3HPTB 1LPZB 1F0UA 1T8MA 3MO6A 4ISLA 3MU5A 1K1IA 3TK6A 2P3FH 5C1UA 2PKAB 3URCA 2M5TA 2FWWA 1NC6A 1BQYA 4GSOA 4A6LA 3PWCA 3LH3A 1W12U 2GT7A 2FOMB 1K1NA 1AY6H 2FM2A 1Z6JH 4TPYA 7GCHF 1VGCB 1BOQA 1GHWH 1GI8B 3SV2H 2SGQE 5AHGH 5DP5A 5JPMH 1RIWB 1A0JA 4GVUA 1L1JA 2BD7A 3A7WA 4I8KA 4OGYA 1JIMA 3BSQA 1UO6A 1GCTB 4Q7YA 1G37A 2R0LA 1SGRE 3ODFA 1O5GH 3R0FA 1P2QA 3A8CA 4ISHH 5ABWA 1PYTC 1JBUH 1S6HA 2VWOA 4XOJA 2PTCE 1SVPA 4FU8A 3FFGA 1MZDA 1BRBE 3RXEA 4YTAA 1C1NA 1F5LA 1YPJH 1OPHB 2HWLB 1CU1A 2FS9A 4AFZA 1K9OE 1ZSLA 3F9FA 1F7ZA 1HJ8A 1GI5A 1RJXB 4I32A 4IN1A 1B5GH 4CRCA 1ACBE 2G4UA 1CHGA 1YPHC 1DITH 2H6MA 2BYAX 5C2ZA 2PSXA 7GCHG 1HAZB 1CT4E 2VVUA 4B2BA 2OINA 1C5PA 1GHYH 1V2QT 1XX9A 4U32A 3D62A 1FIZA 1F5RA 3GY3A 4WXIA 3ZZ5A 5EG4A 1GMCF 2ZFTA 1SHHB 1C5QA 2BD3A 1GBBA 2W5EA 3MH6A 3RXBA 1ZR0A 1P2MA 1V2VT 1ELBA 1GHBF 1GGDC 2ZI2H 3S9BA 1AUJA 5JBBS 1YKTA 2NU3E 1HB0B 4ISOA 1C5XB 4R8TB 1PQ5A 3SV9A 1AFQC 1KIGH 3BTQE 3HGPA 1IQHA 4D9QA 3RXCA 4X6OA 2A32A 1BMLA 4IW4E 3DHKH 1O5BB 2HNTF 1GJ9B 1L4DA 1HXEH 3SNCA 3GCNA 3SJIA 5FPYA 5LPFA 4X8TH 1HIAB 1ZHPA 2FPZA 2ZDNA 5T6FA 1LPKB 1C1WH 2BVSH 4D7FA 2ZGHA 2OCVB 2Q6FA 2ZTXA 3GCHC 5A0BA 5L2YH 2VH6A 3Q3XA 5CHAB 2XC0A 2OBQA 2H9TH 1W10U 3E0NB 1C1RA 3V0XA 1OXGA 1QB6A 1F5KU 1BUIA 1EKBB 2ZO3H 3UUZA 2NWNA 2AMDA 3ZYDA 4IGDA 1GVKB 2Y7XA 3SHCH 4AG1A 5GPIB 4X0WU 3L33A 1K1MA 3D65E 3EA8A 3B23B 1ELVA 2GZ9A 4XBCA 4XBBA 5LPRA 1QR3E 1A5HA 2NU1E 2FO9A 1K1JA 2BXTH 1BRAA 1YPEH 4X2VA 2FOHA 1AD8H 4I8JA 1BMAA 3TJOA 1SG8B 3A7VA 3C1KA 1NRPH 1LQDB 2B9LA 3MNXA 3ZZ9A 3UQVA 2AS9A 1FMGA 1AHTH 5DP3A 1C5SA 2VIDA 1DLKB 4YZUA 1A2CH 3PMAB 3SGBE 2F9NA 1YPHE 2F3CE 2Z9LA 3BG4B 1AWHB 1WQSA 5DGJA 2A5KA 3GOVB 1NRRH 4AFSA 1MAYA 9LPRA 1O3AA 1OWEA 1FY3A 4FUBA 3TVJB 1VCPA 2FODA 1KXEA 1TB6H 1ZPBA 2J4IA 1KDQA 2BTCE 4AZ2B 4TY6A 4FXGH 1C2JA 1DWCH 1J14A 3SNDA 1XVMA 1SSXA 2JH6D 2FTMA 1VITF 5TCAA 1DS2E 1O0DH 4ZKSU 1N8OB 1Y3UA 3ZZ7A 2W3KA 4FUJA 3RM2H 1GG6C 2D1JA 3KF2A 4FUEA 2B5TB 1OWHA 1PQ8A 2ALVA 5CE1A 1JRSA 2ZDMA 1IHSH 1TIOA 1C2FA 3LOXA 1BHXF 5HGGA 1C1OA 1TGBA 1EPTB 3GCTF 4CREA 4CH8B 4NA9H 3LKWA 3T62A 4K5ZA 1T31A 2DUCA 2GCTC 1DXPA 4AN7A 1GJDB 1DWDH 1VZQH 3P8NA 1FY4A 3SZNA 3KQEA 3EE0B 4A7IB 1H9HE 4ZKNU 1O2WA 2FTLE 4DOQA 3SJKA 1O2SA 1G2LA 1AZZA 2VWLA 1TX8A 4UFDH 1AI8H 4LOYH 2EI7A 1SLWB 3S7KB 2ZA5A 3P8GA 1O31A 3OY6U 5F8ZA 1F0SA 3TPIZ 1ARBA 4NG9H 1Z1IA 1GHAF 1C2MA 4IS5A 1T4UH 3RMMH 4Z0KA 3HK3B 5A0CA 4NSYA 1IQGA 1LHEH 2QV1A 1GG6B 1SPJA 1UK3A 2V0BA 2XC5A 3BTEE 1VCQA 1UVPA 2F83A 4NCYA 1YLCA 4BOHA 3TIUA 3W95A 2BY9X 1EOLA 1YLDA 2J38A 3SNAA 1WBGB 2R3UA 3NPSA 1UVTH 3VB6A 1GVZA 2Q6DA 1YCPM 1K2I1 3TGJE 1QRXA 3O8DA 3LDXH 3M5MA 1ABJH 1AVWA 1GJ4H 1EJMA 4I8HA 1ARCA 5DP7A 3GY4A 2GDEH 5EOKA 4YT7H 2G00A 1XUHA 3UOUA 3RXSA 3MH4A 1MH0A 2PTNA 1HAYB 1HLTH 1H4WA 1HIAA 5E0GA 2EA3A 2P94A 1TALA 1XUFA 1MZAA 1NU7B 1L1NA 1DXWA 2XRCA 4GHTA 2PUQH 1HAGE 3QZQA 4KP0A 3RLYH 6CHAC 2J94A 4A1VA 1LPGB 4MPXA 5EW1H 3BEFB 5EU8A 1FIWA 2OD3B 4Y79A 1O2ZA 1ZSJA 2ZNKH 1W3CA 2AIPA 1T8OA 3MH7A 1LTOA 1MTSA 1TA6A 5EPYA 3VPKA 2Y81A 1XUGA 1Y3YA 2TIOA 1YPGH 2BZAA 3BG8A 3EAJA 3A8BA 3UWIA 1LO6A 3FP7E 1FXYA 3SQHE 3PMBB 2Y82A 1G9IE 2ZGBH 2PKAA 1A5GH 1GDQA 4CBNA 3RXAA 2C8XB 1P8VC 2ZG0H 1J8AA 3QZRA 2GGVB 2ZDLA 1TPOA 2BLWA 1CA0B 1IQLA 1MD8A 1QL8A 4XSKU 2UWOA 3A7XA 1GI1A 1EJNA 1UTQA 4AOQA 1CHOG 2PSYA 4HGCA 1C5TA 1XKAC 4RN6A 3TLOA 3ATWA 1PPEE 2K1QA 2A5AA 5C3NA 4YO9A 1CT2E 1FQ3A 1TGCA 2BQWB 1OP2A 1TPAE 2PGBB 3H5CB 1THRH 1P05A 5T6DA 1BTYA 1A0HB 2I6QA 1UTKA 3PWBA 3K6ZA 2NU0E 1GI4A 2CN0H 3KEEA 3ODDA 4TPIZ 4K1TA 2FX6A 2VB0A 2Z9GA 2CHAC 1PPCE 3F9GA 1BT7A 4JZEH 2ZDAH 2AERH 1OS8A 1F2SE 1HRTH 3ATKA 5EPNA 2FI4E 3V12A 2G81E 2D26C 1BJUA 4YT6H 3TH3H 4ABGA 1SFQB 3MNCA 2ANMH 3NUMA 2G51A 1GBFA 2EEKA 1W13U 3PLKA 2QXHA 5TCCA 2OLGA 3OSYA 1YCPK 1VJAU 2P8OB 5JYIA 1T32A 5DG6A 3E90B 1YM0A 1A61H 2FIRH 3UNRA 4XDEA 1GBAA 1HJ9A 1NU9A 3HATH 1Z8IB 2ANYA 1TGSZ 1TNJA 1C2KA 3BTKE 1Z8GA 2C8YB 4MLFB 1A3EH 1C1UH 1GMHG 2W26A 1A5IA 2P8OC 1C5WB 3LC5A 2BHGA 2BY8X 2VVVA 4H6TA 1HDTH 4HFPB 3K65B 2A2QH 1MTNB 1FUJA 3RMNH 2Y5GA 3IG6B 2AGGX 3EGKH 3A87A 4SGBE 2F9VA 5HM2A 2ZC9H 2DE9A 3BF6H 3ZVAA 2Z94A 3SU6A 3Q76A 1WCZA 1W0ZU 1C4U2 1OP8A 1GBCA 1ZMNA 2G52A 2GCHG 1O34A 2VWMA 3SU1A 2JH0D 3GYMA 1IAUA 1P10A 2FI3E 5GJ4B 1ELEE 3L3TA 1C4Y2 4B1TA 3V7TA 3M5NA 3DD2H 2WUCA 3SGQE 1YYY1 5F8XA 4H4FA 1EQ9A 3H7OA 3SUEA 1TMUH 3N7OA 1O2OA 1ZRBA 4MNWA 4CRDA 2AMQA 1ZGIA 3GY7A 3TH4H 3PM3A 1C1PA 3ZZDA 4KGAA 1GJBB 1XVOA 1WOFA 1TPSA 2TGTA 1C2GA 1O3EA 4IMQA 1E36B 4ZMAH 1IQJA 4X1QU 2ILNA 1GBIA 1E0FD 3ESTA 2WYJA 2IPHA 4O03A 1OWIA 2LNCA 4X6NA 3LONA 4JZFH 3S7HB 2XWAA 2VIPA 3SO3A 2V3HH 1V2PT 1LHDH 2TGAA 1FNIA 5ESBA 1KDQB 1E38B 2CJIA 3U8RH 1JRTA 1P2KA 2QCYA 3TGIE 4A5TS 4UONA 1AB9C 1O5EH 3O8RA 2OUAA 4E7RG 5FPTA 1NM6A 2BD8A 3OU0A 2QC2A 1O2MA 1TRMA 2AIQA 2H2ZA 1H8DH 4MPWA 4LZ1H 1GHBG 1ZPCA 3EQ0H 1NFUA 2G55A 4YOGA 3A85A 1F0TA 1KXFA 1TABE 1GHAG 2GV6A 4K60A 1YBWA 1C5ZB 1QRZA 3BIVH 1BB0B 4MG3A 4BTTB 3M7TA 1NT1A 4KTUA 1UVUH 3LGWA 1A7SA 3DFLA 2A2XH 1RTKA 1LHCH 2ANKH 4KTSA 3S69A 1BTZA 1CO7E 1P12E 3PLBA 2TBSA 4INKA 5FX5A 4A1XA 1B0FA 4GCHF 1Y3VA 3KL6A 2ZCKP 1WQVH 1ZHRA 4GPGA 1C1VH 1QJ1B 2P59A 3R3GB 1EAXA 5FXLA 1ESBA 1CA8B 1O5AB 8GCHG 1M9UA 4UFFH 1XUKA 1NTPA 4DIHH 3CP7A 4OS2A 1WSSH 3KQBA 9ESTA 1MTUA 3A81A 2BB4A 4DIIH 1C5OH 3ZZ6A 5F03A 2IOTA 1O3IA 1GMDF 2ZF0H 1RRKA 4Y7BA 4CRGA 3MI4A 3P6ZB 1UCYE 3M7QA 4ABHA 2ZFFH 1V2RT 2BLOA 2Y5FA 1A4WH 3GICB 1ZYOA 1H1BA 1S6FA 3HGNA 3T26A 2FYQA 2SNWA 3M3TA 1O35A 1C5LH 2FOEA 4O3TA 4U30A 1ZPZA 3PMJA 4OS4A 3P8FA 4INLA 2HPPH 5LPEA 1DANH 1GDUA 2VIOA 1Y5UT 1IHTH 2HNTC 1SI5H 1HAVA 2W3IA 2BD5A 3Q00A 4TY7A 1O5CB 3RXHA 1UCYH 5GDSH 2Z7FE 3RC5A 1GCDA 4R0IA 4I33A 1E34B 5G4BA 1G3CA 3T27A 3UREA 1YP9A 1TBQH 2PFEA 1P2IA 4BANB 5JB8S 1ZJKA 5L6NH 1PJPA 1AU8A 1C5YB 1MU6B 1NFWA 2GMTC 1V2WT 3FZZA 1TBRH 3TK9A 3ZVDA 1L0ZA 1QTFA 2WPHS 3TJUA 5K7RA 1XUIA 1AKSA 1N8OC 2ZFPH 3QDZB 3SW2B 1IQMA 3MO9A 1C1SA 1HBTH 4WMFA 3RXUA 3A84A 1GBLA 2AH4X 4OS1A 5CMXH 2FDAA 2WV5A 4OS6A 5A8YA 1BMMH 2AGEX 1C1TA 1EXFA 3ZV8A 3T28A 1OKXA 1EP6A 2ALPA 2ZGCA 1C4V2 2RA0A 2AFQB 3PYHA 4NZLA 3SGAE 1F0RA 1THPB 1DSTA 2QF3A 2WINI 1YPKH 4K1EA 4ABDA 2FOAA 2G5VA 2CMYA 2ZKSA 3U9AH 1DLEA 4WVPE 1ZZZA 1N6YA 4K8YA 1GI2A 1OOKB 1E37B 4OS5A 1JMOH 1SGTA 3UFAA 4X1PU 2ULLA 1IQFA 1QIXB 1V6DA 5JBTA 1UHBB 4LXBH 4JK6A 1WTGH 2BM2A 1BRCE 2ODYB 1ELGA 2IN2A 1AIXH 4X8VH 1EPTA 5EQSA 1SGIB 3ITIA 4BAHB 2Y5HA 5DKMA 1KXDA 6ESTA 1O3OA 1Z8RA 3QO6A 4B74A 2THFB 1LKAA 4JK5A 2CF8H 2P95A 3TJVA 1ZTJA 5AFYH 1AZ8A 5E8EH 1TWXB 4FUDA 3K2UA 3U69H 2FOCA 2PKSB 4M7GA 4ISNA 2KAIB 1Z7KA 2VIVA 1SGDE 1Y5AT 4BAKB 1ELTA 4ABIA 1WAYB 2P16A 1FDPA 1SQTA 5EODA 1O39A 3MO3A 2BOKA 2Z9JA 3B8JA 1FI8A 5LH8A 1Y3XA 2HPQH 1KTTB 1BTPA 1SGPE 1BTXA 1NROH 3EA7A 4GUXA 1C9PA 1B0EA 2FOBA 3M35A 4CHAC 2SGFE 2OTVA 3ATIA 4DG4A 3GDUA 3PB1E 1TA2A 4X1SU 2ZU5A 5AFZH 1C5MD 2C8ZB 5HM9A 4MPVA 2QXIA 5DPAA 2ZGJA 1SFIA 5J4QA 3SV8A 1AFQB 4AGJA 1FZZA 4NIVA 4Q2KA 2V35A 1IQEA 3MOCA 4LZ4B 2O8TA 1Z8JB 3RM0H 2XCNA 5GCHF 2GD4B 1ETTH 8KME2 1FN6A 3RXLA 4CBOA 1RFNA 3PROA 1T8LA 2STBE 1MKXH 1DSUA 3UPEA 1H9LB 1JIRA 1RD3B 3K6YA 4NGAH 1LVOA 1D3QB 4FVBA 3QTVH 1EZXC 2TPIZ 1BTHH 3M7UA 1O2IA 4X2WA 1Q2WA 1YGCH 1SGYE
chains in the Genus database with same CATH superfamily
3GISB 5HYOA 2GCHF 2PKSC 2JJ2D 1C5RA 1GJ8B 5C0UA 1EFRD 5FAHA 1TQ0B 3V3MA 1QFKH 4GLYA 1ELCA 3A7ZA 5C5NA 4X8SH 4NWKA 5ESTE 5KECA 3RXTA 2FLRH 2XBWA 6GCHG 5IYTA 4B76A 1HJAB 2ZQ1A 4YLUA 2QYIA 5C1YA 1D6RA 2O9QA 1ELDE 3IITA 2Z3DA 3AW1A 1RIWC 3PV4A 3Q3KA 4DT7B 4DURA 5GXPA 1TQ7B 3TGKE 1S82A 3SI4H 1HAIH 1CBWC 1HGTH 4X6MA 5B6OA 2OC8A 2JKHA 1UJ1A 2G5NA 2XWBI 3ZVEA 2XBVA 4YOIA 1HFDA 3MU0A 2A31A 3FP6E 1HAOH 2BVXH 1TRYA 2ZHEH 2A4GA 3RU4E 1P57B 3VGCC 3U98H 4DVAU 2BDIA 3CNRA 2ZWLH 3SUGA 1K0HA 1DFPA 2J34A 3U1JB 1BITA 3ZZCA 2Q1JA 1IQIA 2ZQ2A 3MYWA 4O9VA 2XYAA 2QAAA 1DWBH 1GJ5H 1E35B 2A0QB 1FY1A 4DY7B 3GY2A 3DSGA 1TNLA 5DP4A 3KYGA 2F9UA 1AQ7A 1ZMJA 2BMGB 1MTVA 2F43B 4AX9H 1GHXH 1TONA 4WWYA 1GL0E 3UR9A 1O32A 1ZJDA 3RMLH 1EZQA 1TNIA 3VXEH 1P03A 1PPHE 3SUDA 3LIWA 3W1EA 3I29A 1C1MA 1HAHH 2SGPE 1X7AC 1AE8H 2ZHWH 1THSH 1PPGE 3DT0H 2D8WA 1XKBC 3ZYEA 1AN1E 1O30A 4TWYA 1P2NA 2A7HA 1HCGA 2VINA 1O3KA 1QBVH 2HRVA 3O8BA 4JYVH 5FHTA 3ZVFA 2Z3EA 3GS9A 3MMGA 4K8BA 1ELFA 4I7YH 5I46H 3M36A 2K0QA 4I8GA 4K1SA 4K3JA 1UK2A 1NBME 1RTFB 2W7UA 3F3BA 2VGCC 3RXMA 1AGJA 1MKWK 1EAWA 2F91A 3BTME 3OYPA 2BD2A 1GBDA 5E0JA 4DJZB 1W0YH 2ZZUH 2AEIH 1O2HA 2UUKB 1YF4A 4NIYA 5AVDA 3UQOA 2KAIA 5TJXA 3SNBA 1CGIE 1CT0E 2RFKC 2PP6A 1BTWA 2XC4A 1NBMD 3LJOA 4OGXA 4SGAE 3RU4T 3WY8A 1LCYA 5J4SA 3E3TA 3S9CA 1EUFA 2UUJB 2ZP0H 1SBWA 3HKIB 1OX1A 5A0AE 2BX4A 2R9PA 3BEUA 4ZROA 1C5VA 1DY8A 4YOJA 1TLDA 1P01A 2FX4A 1MBQA 2LPRA 2O8MA 3AAVA 5DSFA 1U6QA 3W94A 3U8TH 2A7JA 1FN8A 2F9PA 1O5FH 2WPJS 1QL7A 3P8OA 1HYLA 1SB1H 4X1RU 5F53A 1W7XH 1KLIH 2BX3A 4BTUB 3Q3YA 4K2YA 3KYFA 3VEQB 5A8XA 3T29A 4MVNA 3I77A 2L74A 5C67A 1UCYK 3LH1A 2A4OA 2AGIX 3FVFB 3SV7A 1FONA 1NPMA 2DE8A 1TPPA 4JYUH 3MU4A 3UB0A 1S83A 4NA8A 4O3UA 1D3PB 4UFGH 1V2LT 2OXSA 2BDCA 3LPRA 5EXLA 5T1VA 1YPLH 5FPSA 1EATA 3GY6A 1FY5A 1O3LA 2WV4A 7LPRA 4Y7AA 2ESTE 4ABBA 1OHHD 3BTGE 1EB2A 3ATLA 3DA9B 1O38A 2ZPSA 4ZKRU 4ZAEA 2XW9A 1XXFA 2J92A 2UUFB 1SLVB 4IBLH 1D9IA 4BAMB 3BG4C 1BRUP 4FUIA 3RMOH 2GZ7A 3EA9A 1S0QA 2B7DH 2QGRA 3E16B 1OSSA 2ZFRH 3VB7A 1QHRB 2RDLA 1EAIA 4DCDA 3MH5A 1NRNH 1UHBA 1WYKA 1W8BH 3QX5H 1QB9A 2OQ5A 3LGIA 3DUXH 1LVYA 2VBCA 2ZDKA 3BV9B 1MCTA 3GCTG 5E2PA 3PO1C 1HJAC 1GJ6A 3RP2A 2VJ1A 1NO9H 3RXJA 1VITH 2EY4C 2A45B 2QY0B 2JETC 2O8UA 2UUYA 1ZLRA 5IK2D 1MD7A 3CS0A 5C94A 2ODQA 4IC6A 5GNDA 2FYRA 5DK1A 1FY8E 3DFJA 2SGDE 1AMHA 3ZZ3A 1BBRH 3C27B 2Z9IA 1W14U 3ELAH 1GI3A 2NU4E 1ESAA 3OY5U 2GZ8A 1K21H 5EXMA 1FAXA 3AVZA 3TH2H 1O3CA 1TYNA 3F1SB 3GCHB 4Z1MD 3VGCB 1GDNA 2O8LA 4X1NU 1GVLA 1FLEE 2H1UA 1C5NH 4F4OC 1KXCA 1DOJA 1DUEA 3GCOA 1PPFE 2GVFA 4DGJA 1QA7A 2GDDA 4MDSA 3SORA 5IDKA 2J98A 1ZSKA 5AF9H 3BTTE 3O8CA 1A3BH 2VNTA 3GDSA 5F8TA 3M37A 1DUAA 4FUHA 3NCLA 3LGYA 3MU1A 2P93A 3T25A 2JH5D 2XBXA 3ZZ8A 3UY9A 1ABIH 4HG6A 1SR5C 1V2NT 5EJLA 1LVBA 3RXRA 1XXDA 3CS7A 1Y5BT 2PUXB 1HPGA 2L6OA 2SGAA 1GGDB 1A1RA 2GP9B 1O3FA 2PR3A 3UOPA 2J2UA 4VGCB 4ABEA 1NY22 3MNSA 4UDWH 3RXOA 2FI5E 4NZQA 1G30B 4MNYA 1KXAA 3QLPH 2EI8A 1Q3XA 3UIRA 1Y8TA 1H9IE 5GIBA 4OS7A 2PGQB 3SYJA 4X2XA 1MKWH 1BMFD 4GHQA 1W0JD 3VXFH 1G2MA 1TGTA 2YNBA 1ZTLA 2C90B 3SBKA 2TGPZ 1H8ED 2FOFA 3STJA 1Z71A 2XTTB 1V3XA 1P0SH 3QUMP 4X6PA 2OP9A 2VIQA 4BNRA 1KLJH 4JZ1A 4BXWA 1ORFA 4ZH8A 1TX6A 1MTNC 2BY7X 1P04A 1GBTA 2OQUA 4U2WA 3D49H 2BLQA 3T2NA 5GWZA 1HAXB 3KN2A 3HKJB 5DJ7A 4TT3D 1P3EA 5EW2H 3OEHD 3BN9A 2VH0A 1ETRH 3ENSB 1QJ6B 4B2AA 1SGFA 2OC7A 1TMTH 3NWUA 4FUCA 1EJAA 2AYWA 2BDAA 3PV2A 2UWPA 1DVAH 1N6XA 1F92A 1K28D 1ZTKA 1MCVA 3F9HA 1O2UA 1QGFA 1MMJN 1AVXA 1CSOE 4OM9A 3LT3A 3ZZBA 2VWNA 2ZGXH 3ZZAA 3RXPA 1TNGA 2V3OH 4Y8XA 3B9FH 4D8NA 5DO4H 3M5OA 1W11U 1BDAA 1MUEB 4YESB 1T4VH 1G3BA 2VIWA 3A8AA 2CHAB 2QXGA 3VB3A 4ABJA 1GHVH 1BMNH 3P70B 1D3DB 1V2TT 3UR6A 1CGHA 3A83A 4NFEA 1Q31A 2CF9H 5B6LA 2JETB 4MQAA 2QXJA 3MU8A 3E1XB 1OYTH 4AYVB 1S81A 1PPZA 1GHZA 3EYDA 4A1TA 4Q80A 4WXVA 1BIOA 1BZXE 4MNXA 4Q7ZA 4WF8A 3AASA 3SHAH 4JZDH 3SQEE 1W2KH 2FP7B 2GMTB 4FU7A 1CE5A 1P06A 3T5FH 4AG2A 4JYTA 4U01A 1DE7H 3M5LA 1GMDG 3TJNA 4FU9A 3OX7U 2UWLA 3RC4A 2ANWA 4CRBA 3RXDA 3ZV9A 3RC6A 1V2UT 3I78A 2SFAA 3KQCA 2BD4A 1WXRA 1O36A 3NXPA 4X2YA 8GCHF 2BQ7B 2OBOA 2ZTZA 1NN6A 1EZSC 1K1OA 1O37A 2R3YA 2GT8A 4AB8A 1J9CH 4INHA 4TYDA 2R2MB 1RS0A 1KSNA 1O3BA 2PW8H 2Y80A 1P2JA 5L2ZH 5F6MA 1UTOA 5DP8A 1TOCB 1P09A 2BDHA 1D3TB 3ZZ4A 2R0KA 1BTUA 5JB9S 3BIUH 3JZ2B 1TNHA 4PROA 3UNQA 2P3TB 2ZHDA 5H4IB 1BA8B 2H9EH 4AORA 1GJAB 3QTOH 5L30H 1KYNA 6CHAB 4XFQA 2VGCB 2QE7D 3RLWH 2ZDVH 2RCEA 1B7XB 3QWCH 1DM4B 2QF0A 3MFJA 1TAWA 2HALA 2IJD1 3RXVA 1DWEH 1INCA 7ESTE 1EASA 3A86A 2A4QA 2J5UA 1W0KD 1MU8B 2V6NA 1BHXB 5KGOA 4F55A 4ZHMU 2FS8A 4Q4LA 5EJZA 1K22H 2GCTB 2B8OH 1QJ7B 4H42U 3RUOA 1TRNA 3MWIU 3SV6A 5FCRA 1V2KT 3DSOA 2F9OA 2HGTH 1T7CA 4AC9A 1P02A 2OC1A 2J95A 3A7YA 1J16A 3SJ9A 5EXNA 4QT8C 4Y76A 2QN5T 1ANCA 1O2TA 1C2DA 1S6LA 4FUGA 1EX3A 2VVCA 3PRDA 1C5UA 1O3GA 7KMEH 1L4ZA 1BBRE 1GBHA 3LGTA 3OTPA 5C5OA 4ESTE 4FUFA 4X8UH 1SL3A 1HAPH 2Z9KA 1W7GH 1XUJA 5LGOA 3TNSA 2BDGA 1OYQA 1HAVB 3H7TA 2SGEE 2A7CA 4KELA 4E06H 4THNH 3GYLB 2Q6GA 4AFQA 5K0HA 2ZFSA 2QF4A 2FLBH 3NK8A 4CH2B 4ZXXH 2WYGA 2WPKS 3KIDU 2C3SA 1C9TA 1ZOMA 1ZHMA 1EAUA 3L6PA 5DP9A 3A8DA 2O8WA 4ZXYH 1KXBA 4BAQB 1TNKA 3BTWE 4ZKOU 1OWJA 3SN8A 4RSPA 1LMWB 4MNVA 3PV5A 1CQQA 1NRQH 4J1YA 5FBEA 5A2MH 4ZUHA 3F0OA 1V2OT 1G3EA 3PTNA 3RXQA 1O2VA 3SU2A 5FX6A 2PHBA 2EC9H 2ZU3A 4RKJB 1LQEA 3M3VA 4ZHLU 2XNIA 4E7NA 3BEIB 1TE0A 1VR1H 4CR5A 1YC0A 2BLVA 4B75A 3MTYA 2ZIQH 3VB5A 1DPOA 1FV9A 1BBRK 2BDYA 1P9UA 4WH8A 2D2DA 2OC0A 3ZVGA 3F2HA 1VITG 1GBKA 5T6GA 1L2EA 3U8OH 2QIQA 1QBOA 1ZGVA 3FZDA 2BVRH 4RKOB 3D23A 1LKBA 1UVSH 2H5DA 2J9NA 3NRLA 3EDXB 8ESTE 3U28C 1YPMH 3OE7D 3ZVBA 6LPRA 4XE4A 2XXLA 3P17H 1JXPA 3STIA 1P2OA 5JBCS 1JOUB 1S85A 1UTNA 1GL1A 5A8ZA 2FESH 3E91A 1GJ7B 1SQOA 1Z1JA 4Y0YE 2W7SA 2CV3A 5EJ1A 1A46H 1SGFG 1P3CA 3BTDE 2YOLA 4B73A 1WUNH 4BAOB 1GPZA 5GCHG 1SGQE 3SU0A 1CVWH 3SJOA 3WWBA 4B2CA 3BTFE 3RXIA 1H8HD 2WUBA 1J17T 1AVGH 1CBWB 3KGPA 1T8NA 5C20A 5BRRE 1GBJA 2ZHQH 1NZQH 2J98B 1SLXB 2HOBA 2BY5X 2WHXA 1O2PA 2XBYA 4YM9A 5BPEA 6GCHF 1GWAA 1TBZH 3KNXA 1K1LA 3P92A 2B0FA 2GKVE 1O2NA 3LC3A 1QQ4A 1SQAA 4NFFA 5PTPA 1TGNA 4NIXA 2BOHB 1IQNA 4UD9H 4NSVA 1FPCH 3PTBA 5DP6A 4CHAB 2HNTE 1TX7A 1MQ6A 3FAOA 1PQAA 2H9HA 1UTJA 3N99A 4Y8YA 1SMFE 2A5IA 2ZPRA 5CHAC 1O2LA 1UK4A 4NIWA 3SOSA 4Q7XA 3JZ1B 4JCNA 1QRWA 1GI0A 1EB1H 1LVMA 1VJ9U 3TNTA 2A1DB 2WPDD 4FVDA 4VGCC 1RXPA 1DDJA 2ZEBA 1NFYA 3GDVA 1NESE 2ZFQH 4NWLA 2BD9A 1PPBH 4I31A 2I6SA 3SU3A 1ANDA 5ETXA 5I25A 4FETA 4UEHH 1GCTC 5SGAE 4WH6A 1QNJA 3OFND 1MKXK 3QGJA 1QCPA 3UTUH 2ODPA 1DY9A 3LGVA 1IQKA 1P9SA 4O97A 3OEED 4BTIB 3AAUA 1CA0C 5T3HA 1MTWA 3CENA 2Z6BD 2VU8E 3SU5A 3OTJE 2GTBA 1S84A 1LHFH 2YNAA 3S9AA 4Y11E 5EQRA 4Y6DA 4K69A 1D4PB 4RI0A 4JMYA 2ZPQA 2QA9E 3GY5A 3K9XB 4GAWA 1OWDA 1BJVA 3BTHE 5E0HA 2K8IA 1VCWA 2WPMS 4WMDA 5C1XA 2M2AA 1WV7H 2A4RA 4TWWA 4Y71A 3ZVCA 2CGAA 1GMHF 4GCHG 3A80A 4F49A 3OAAD 1AKSB 2HLDD 4LK4A 2WZQA 3KQ5A 3SU4A 3AW0A 4AB9A 3FP8E 2FXRA 1O2XA 4D9RA 1TOMH 3PO1B 1LDTT 1O3HA 1QL9A 1Z6EA 4H6SB 2CXVA 1SC8U 3LGUA 1EP5A 2HLCA 3LU9B 1D6WA 1UVOA 4HI3A 3FANA 5HMAA 1MAXA 1SGCA 3KQDA 4ZHAA 3MHWU 2F9BH 1CGJE 5C0TA 1S5SA 1O3PB 1SGNE 2YMSB 1O2KA 4ISIH 3S0NA 2GJGA 8LPRA 3F2FA 1MABB 2ASUB 1XMNB 2Y6TA 1ID5H 4J2YB 1C2LA 3E0PB 2IJOB 1GMCG 1VGCC 2EI6A 3A88A 3P95A 3URDA 4IC5A 1S0RA 1NRSH 2BQ6B 4I86A 2SNVA 2RDEA 2Y7ZA 4WY3A 1O2GH 2ZECA 4I8LA 4NA7A 1WU1A 3TK5A 1ANEA 5A09A 4IN2A 2WPIS 5JDUB 3RDZA 1G3DA 2P3UB 2G8TA 2IPQX 2BXUH 3QN7A 4B6FA 1O5DH 1AUTC 2GV7A 2R2WU 3ATMA 2TGDA 2PV9B 2ZU1A 4UE7H 1A0LA 1SLUB 1AE5A 1DX5M 1UTLM 3FKSD 1OP0A 3LJJA 2FMJA 3VFEA 3NZIA 1G32B 1PYTD 2FZZA 2FEQH 1YCPH 4WJG2 1CHOF 2EQNA 3TU7H 3E6PH 1SGEE 5EQQA 3PLPA 1V2JT 3SUFA 1TFXA 4MPUA 1SOZA 1WTHD 4B71A 4P00A 2ZU4A 3M61U 2BZ6H 1ETSH 4ABFA 1QQUA 1O2JA 4ASHA 1UTMA 1FJSA 3RU4D 1SHYA 1RGQA 1Y3WA 1OWKA 1SOTA 3SNEA 1DT2A 1IOEA 3KCGH 5C17A 3VB4A 4KTCA 4CRAA 3RXGA 1ELAA 1ZRKA 1XM1A 1QURH 4D7GA 3QK1A 1EZUC 1GI6A 2BDBA 1EOJA 1ESTA 1Y59T 2TRMA 1QBNA 1V2MT 3V13A 5HXFA 1MQ5A 3E8LA 4Y0ZE 3A82A 4AFUA 1KY9A 1KLTA 4E05H 4ABAA 3UNSA 1ANBA 2GX4A 1QA0A 2STAE 3SI3H 5EGMA 3IWMA 1QY6A 3HK6B 1GI7B 1MBMA 1H8IH 2HVXA 5JBAS 5E2OA 3SJ8A 1UMAH 1NFXA 1AFEH 1N1LA 1O2QA 1O2RA 3GY8A 2G4TA 3F9EA 4Y8ZA 1GBEA 1C2IA 4DW2U 2FOGA 2ZCHP 1AB9B 4D76A 1HXFH 1C1QA 1TMBH 4MTBA 3M3SA 1K1PA 4JZIA 1HNEE 1J15A 4HTCH 2Z3CA 3KHVA 4BXSA 1O3MA 4KKDA 4XBDA 1UTPA 1C2EA 2RG3A 4CRFA 2ZU2A 1DICA 4Z6AH 5FBIA 1O3NA 2C4FH 1GBMA 2XCFA 1O3JA 4CR9A 2AMPA 1GI9B 2C93B 4WMEA 1P11E 3F6UH 3G01A 3Q77A 1AO5A 1HV7A 1O33A 1LHGH 1EPTC 1BCUH 4UFEH 1G36A 3A7TA 4AGKA 1RTLA 2ZTYA 1KTSB 3UWJH 1NS3A 3NKKA 1O3DA 1O2YA 3PMHB 4HZHA 1FAKH 2PLXA 2PWXA 4DT4A 3U1IB 3TITA 4AYYB 3RXFA 3QGNB 4A92A 2RA3A 4IMZA 2ZHFH 3MNBA 1C2HA 4YLQH 1FPHH 5FCKA 1PQ7A 3RXKA 4Y10E 1L1GA 2ZCLP 1E79D 1JWTA 2BY6X 2NU2E 1ZMLA 1V2ST 3A89A 2C8WB 2WPLS 3F68H 1HUTH 1QB1A 1PFXC 1AWFH 2H5CA 1GJCB 3HPTB 1LPZB 1F0UA 1T8MA 3MO6A 4ISLA 3MU5A 1K1IA 3TK6A 2P3FH 5C1UA 2PKAB 3URCA 2M5TA 2FWWA 1NC6A 1BQYA 4GSOA 4A6LA 2HVYB 3PWCA 3LH3A 1W12U 3H09A 2GT7A 2FOMB 1K1NA 1AY6H 2FM2A 1Z6JH 4TPYA 7GCHF 1VGCB 1BOQA 1GHWH 1GI8B 3SV2H 2SGQE 4RT1A 5AHGH 5DP5A 5JPMH 1RIWB 1A0JA 4GVUA 1L1JA 2BD7A 3FN8A 3A7WA 4I8KA 4OGYA 1JIMA 3BSQA 1UO6A 1GCTB 4Q7YA 1G37A 2R0LA 1SGRE 3ODFA 1O5GH 3R0FA 1P2QA 3A8CA 4ISHH 5ABWA 1PYTC 1JBUH 1S6HA 2VWOA 4XOJA 2PTCE 1SVPA 4FU8A 3FFGA 1MZDA 1BRBE 3RXEA 4YTAA 1C1NA 3MQKC 3FOAA 1F5LA 1YPJH 1OPHB 2HWLB 1CU1A 2FS9A 4AFZA 1K9OE 1ZSLA 3F9FA 1F7ZA 2KX4A 1HJ8A 1GI5A 1RJXB 4I32A 4IN1A 1B5GH 4CRCA 4YXWD 1ACBE 2G4UA 1CHGA 1YPHC 1DITH 2H6MA 2BYAX 5C2ZA 2PSXA 2XOKD 1HAZB 7GCHG 1CT4E 2VVUA 4B2BA 2OINA 1C5PA 1GHYH 1V2QT 1XX9A 4U32A 3D62A 1FIZA 1F5RA 3GY3A 4WXIA 3ZZ5A 5EG4A 1GMCF 2ZFTA 1SHHB 1C5QA 2BD3A 1GBBA 2W5EA 3MH6A 3RXBA 1ZR0A 1P2MA 1V2VT 1ELBA 1GHBF 1GGDC 2ZI2H 3S9BA 1AUJA 5JBBS 1YKTA 2NU3E 2OK5A 1HB0B 4ISOA 1C5XB 1VKYA 4R8TB 1PQ5A 3SV9A 1AFQC 1KIGH 3BTQE 3HGPA 1IQHA 4D9QA 3RXCA 5CHBA 4X6OA 1FX0B 2A32A 2QF5A 1BMLA 4IW4E 3DHKH 1O5BB 2HNTF 1GJ9B 1L4DA 1HXEH 3SNCA 3GCNA 3SJIA 5FPYA 5LPFA 4X8TH 1HIAB 1ZHPA 2FPZA 2ZDNA 5T6FA 1LPKB 1C1WH 3UAIC 2BVSH 4D7FA 2ZGHA 2KM0A 2OCVB 2Q6FA 2ZTXA 3GCHC 5A0BA 5L2YH 2VH6A 3Q3XA 5CHAB 2XC0A 2OBQA 2H9TH 1W10U 3E0NB 1C1RA 3V0XA 1OXGA 1QB6A 1F5KU 1BUIA 1EKBB 2ZO3H 3UUZA 2NWNA 2AMDA 3ZYDA 2J97A 4IGDA 1GVKB 2Y7XA 3SHCH 4AG1A 5GPIB 4X0WU 3L33A 4ZCNA 1K1MA 3D65E 3EA8A 3B23B 1ELVA 2GZ9A 4XBCA 4XBBA 5LPRA 1QR3E 1A5HA 2NU1E 2FO9A 1K1JA 2BXTH 5CDFE 1BRAA 1YPEH 4X2VA 2FOHA 1AD8H 4I8JA 1BMAA 3TJOA 1SG8B 3A7VA 3C1KA 1NRPH 1LQDB 2B9LA 3MNXA 3ZZ9A 3UQVA 2JDID 2AS9A 1FMGA 1AHTH 5DP3A 2W6JD 1C5SA 4RT0A 2VIDA 1DLKB 4YZUA 1A2CH 3PMAB 3SGBE 2F9NA 1YPHE 2F3CE 2Z9LA 3BG4B 1AWHB 1WQSA 5DGJA 2A5KA 3GOVB 3VG8A 1NRRH 4AFSA 1MAYA 9LPRA 1O3AA 4ASUD 1OWEA 1FY3A 4FUBA 3TVJB 1VCPA 2FODA 1KXEA 1TB6H 1ZPBA 2J4IA 1KDQA 2BTCE 4AZ2B 4TY6A 4FXGH 1C2JA 1DWCH 1J14A 3SNDA 1XVMA 1SSXA 2JH6D 2FTMA 1VITF 5TCAA 1SQRA 1DS2E 1O0DH 4ZKSU 1N8OB 1Y3UA 3ZZ7A 2W3KA 4FUJA 3RM2H 1GG6C 2D1JA 2KZ4A 3KF2A 4FUEA 2B5TB 1OWHA 1PQ8A 2ALVA 2KCOA 5CE1A 1JRSA 2ZDMA 1UW7A 1IHSH 1TIOA 1C2FA 3LOXA 1BHXF 5HGGA 1C1OA 1TGBA 1EPTB 3GCTF 4CREA 4CH8B 4NA9H 3LKWA 3T62A 4K5ZA 1T31A 1E1RD 2DUCA 2GCTC 1DXPA 4AN7A 1GJDB 1DWDH 1VZQH 3P8NA 1FY4A 1COWD 3SZNA 3KQEA 3EE0B 4A7IB 1H9HE 4ZKNU 1O2WA 3N7DA 2FTLE 4DOQA 3SJKA 1O2SA 1G2LA 1AZZA 2VWLA 1TX8A 4UFDH 1AI8H 4LOYH 2EI7A 1SLWB 3S7KB 2ZA5A 3P8GA 1O31A 3OY6U 5F8ZA 1F0SA 3TPIZ 1ARBA 4NG9H 1Z1IA 1GHAF 1C2MA 4IS5A 1T4UH 3RMMH 4Z0KA 1QZ8A 3HK3B 5A0CA 4NSYA 1IQGA 1LHEH 2QV1A 1GG6B 1SPJA 1UK3A 2V0BA 2XC5A 3BTEE 1VCQA 1UVPA 2F83A 4NCYA 1YLCA 4XD7D 4BOHA 3TIUA 3W95A 2BY9X 1EOLA 1YLDA 2J38A 3SNAA 1WBGB 2R3UA 3NPSA 3WW7A 1UVTH 3VB6A 1GVZA 2Q6DA 1YCPM 1K2I1 3TGJE 1QRXA 3O8DA 3LDXH 3M5MA 1ABJH 1AVWA 1GJ4H 1EJMA 4I8HA 1ARCA 5DP7A 3GY4A 2GDEH 5EOKA 4YT7H 2G00A 1XUHA 3UOUA 3RXSA 3MH4A 1MH0A 2PTNA 1HAYB 1HLTH 1H4WA 1HIAA 5E0GA 2EA3A 2P94A 1TALA 1XUFA 1MZAA 1NU7B 1L1NA 1DXWA 1WDIA 2XRCA 4GHTA 2LELA 2PUQH 1HAGE 3QZQA 4KP0A 3AK5A 3RLYH 6CHAC 5KEDA 2J94A 4A1VA 1LPGB 4MPXA 5EW1H 3BEFB 5EU8A 1FIWA 2OD3B 4Y79A 1O2ZA 1ZSJA 2ZNKH 1W3CA 2AIPA 1T8OA 3MH7A 1LTOA 1MTSA 3SZEA 1TA6A 5EPYA 3VPKA 2Y81A 1XUGA 1Y3YA 2TIOA 1YPGH 2BZAA 3BG8A 3EAJA 3A8BA 3UWIA 1LO6A 3FP7E 1FXYA 2LP6A 3SQHE 3PMBB 2Y82A 1G9IE 2ZGBH 2PKAA 1A5GH 1GDQA 4CBNA 3RXAA 2C8XB 1P8VC 2ZG0H 1J8AA 3QZRA 2GGVB 2ZDLA 1TPOA 2BLWA 1CA0B 1IQLA 1MD8A 1QL8A 5DN6D 4XSKU 2UWOA 3A7XA 1GI1A 1EJNA 1UTQA 4AOQA 1CHOG 2PSYA 4HGCA 1C5TA 1XKAC 4RN6A 3TLOA 3ATWA 1PPEE 2K1QA 2A5AA 5C3NA 4YO9A 1CT2E 1FQ3A 1TGCA 2BQWB 1OP2A 1TPAE 2PGBB 3H5CB 1THRH 1P05A 5T6DA 1BTYA 1A0HB 2I6QA 1UTKA 3PWBA 3K6ZA 2NU0E 1GI4A 2CN0H 3KEEA 3ODDA 4TPIZ 4K1TA 2FX6A 2VB0A 2Z9GA 4TSFD 2CHAC 1PPCE 3F9GA 4ACAA 1BT7A 4JZEH 2ZDAH 2AERH 1OS8A 1F2SE 1HRTH 3ATKA 3EE7A 5EPNA 2FI4E 3V12A 2G81E 2D26C 1BJUA 4YT6H 3TH3H 4ABGA 1SFQB 3MNCA 3DCLA 2ANMH 3NUMA 2G51A 1GBFA 2EEKA 1W13U 3PLKA 2QXHA 5TCCA 2OLGA 3OSYA 1YCPK 1VJAU 2P8OB 5JYIA 1T32A 5DG6A 3E90B 1YM0A 1A61H 2FIRH 3UNRA 4XDEA 1GBAA 1HJ9A 1NU9A 3HATH 1Z8IB 2ANYA 1TGSZ 1TNJA 1C2KA 3BTKE 1Z8GA 2C8YB 4MLFB 1A3EH 1C1UH 1GMHG 2W26A 3ZIAD 1A5IA 2P8OC 1C5WB 3LC5A 2BHGA 2BY8X 2VVVA 4H6TA 1HDTH 4HFPB 3K65B 2A2QH 1MTNB 1FUJA 3RMNH 2Y5GA 3IG6B 2AGGX 3EGKH 3A87A 4SGBE 2F9VA 5HM2A 2ZC9H 2DE9A 3BF6H 3ZVAA 2Z94A 2W6ID 3SU6A 3Q76A 1WCZA 1W0ZU 1C4U2 5HKKD 1OP8A 1YY3A 1GBCA 1ZMNA 2G52A 2GCHG 1O34A 2VWMA 3SU1A 2JH0D 3GYMA 1IAUA 1P10A 2FI3E 5GJ4B 1ELEE 3L3TA 1C4Y2 4B1TA 3V7TA 3M5NA 2JJ1D 3DD2H 2WUCA 3SGQE 1YYY1 5F8XA 4H4FA 1EQ9A 3H7OA 3SUEA 2KCYA 1TMUH 3N7OA 1O2OA 1ZRBA 4MNWA 4CRDA 2AMQA 1ZGIA 3GY7A 3TH4H 3PM3A 1C1PA 3ZZDA 4KGAA 2V3MA 1GJBB 1XVOA 1WOFA 1TPSA 2TGTA 1C2GA 1O3EA 1YLNA 4IMQA 1E36B 4ZMAH 1IQJA 4X1QU 2ILNA 1GBIA 1E0FD 3ESTA 2WYJA 2IPHA 4O03A 1OWIA 2LNCA 4X6NA 3LONA 4JZFH 3S7HB 2XWAA 2VIPA 3SO3A 2V3HH 1V2PT 1LHDH 2TGAA 1FNIA 5ESBA 1KDQB 1E38B 2CJIA 3U8RH 1JRTA 1P2KA 2QCYA 4P02A 3DSPA 3TGIE 4A5TS 4UONA 2KCPA 1AB9C 1O5EH 3O8RA 2OUAA 4E7RG 5FPTA 1NM6A 2BD8A 3OU0A 2QC2A 1O2MA 1TRMA 2AIQA 2H2ZA 5EIYA 1H8DH 4MPWA 4LZ1H 1GHBG 1ZPCA 3EQ0H 1NFUA 2G55A 4YOGA 3A85A 1F0TA 1KXFA 1TABE 1GHAG 2GV6A 4K60A 1YBWA 1C5ZB 1QRZA 3BIVH 1BB0B 4MG3A 4BTTB 3M7TA 1NT1A 4KTUA 1UVUH 3LGWA 1A7SA 3DFLA 2A2XH 3F2GA 1RTKA 1LHCH 2ANKH 4KTSA 3S69A 1BTZA 1CO7E 1P12E 3PLBA 2TBSA 4INKA 5FX5A 4A1XA 1B0FA 4GCHF 1Y3VA 3KL6A 2ZCKP 1WQVH 1ZHRA 4GPGA 2XNDD 1C1VH 1QJ1B 2P59A 3R3GB 1EAXA 5FXLA 1ESBA 1CA8B 1O5AB 8GCHG 2WV9A 1M9UA 4UFFH 1XUKA 1NTPA 4DIHH 3CP7A 4OS2A 1WSSH 3KQBA 3N7EA 9ESTA 2WSSD 1MTUA 3A81A 2BB4A 4DIIH 1C5OH 3ZZ6A 5F03A 2IOTA 1O3IA 1GMDF 2ZF0H 1RRKA 4Y7BA 4CRGA 3MI4A 3P6ZB 1UCYE 3M7QA 4ABHA 2ZFFH 1V2RT 2BLOA 2Y5FA 1A4WH 3GICB 1ZYOA 1H1BA 1S6FA 3HGNA 3T26A 2JIZD 2FYQA 2SNWA 3M3TA 1O35A 1C5LH 2FOEA 4O3TA 4U30A 1ZPZA 3PMJA 2AHME 4OS4A 3P8FA 4B6EA 4INLA 2HPPH 5LPEA 1DANH 2KCAA 2V7QD 2KFWA 1GDUA 2VIOA 1Y5UT 1IHTH 2HNTC 1SI5H 1HAVA 2W3IA 2BD5A 3Q00A 4TY7A 1O5CB 3RXHA 1UCYH 5GDSH 2Z7FE 3RC5A 1GCDA 4R0IA 4I33A 1E34B 5G4BA 1G3CA 3T27A 3UREA 1YP9A 1TBQH 2PFEA 1P2IA 4BANB 5JB8S 1ZJKA 5HIZA 5L6NH 1PJPA 4ACBA 1AU8A 2GMTC 1C5YB 1MU6B 1NFWA 1V2WT 3FZZA 1TBRH 3TK9A 3ZVDA 1L0ZA 3PRBA 1QTFA 2WPHS 3TJUA 5K7RA 1XUIA 1AKSA 1N8OC 2ZFPH 3QDZB 3SW2B 1IQMA 3MO9A 1C1SA 1HBTH 4WMFA 3RXUA 3A84A 1GBLA 2AH4X 4OS1A 5CMXH 2FDAA 2WV5A 4OS6A 5A8YA 1BMMH 4FOUC 1SKYE 2AGEX 1C1TA 1EXFA 3ZV8A 3T28A 1OKXA 1EP6A 2ALPA 4M9FA 2ZGCA 1C4V2 2RA0A 2AFQB 3PYHA 4NZLA 3SGAE 1F0RA 1THPB 1DSTA 2QF3A 2WINI 1YPKH 4K1EA 4XRNA 4ABDA 2FOAA 2G5VA 2CMYA 2ZKSA 3U9AH 1DLEA 4WVPE 1ZZZA 1N6YA 4K8YA 1GI2A 1OOKB 4F48B 1E37B 4OS5A 1JMOH 1SGTA 4Q63A 3UFAA 4X1PU 2ULLA 1IQFA 1QIXB 1V6DA 5JBTA 1UHBB 4LXBH 4JK6A 2YMSC 1WTGH 2BM2A 1BRCE 2ODYB 1ELGA 2IN2A 1AIXH 4X8VH 1EPTA 5EQSA 1YWUA 1SGIB 3ITIA 4BAHB 2Y5HA 5DKMA 1KXDA 6ESTA 1O3OA 1Z8RA 3QO6A 4B74A 2THFB 1LKAA 4JK5A 2CF8H 2P95A 3TJVA 1ZTJA 5AFYH 1AZ8A 5E8EH 1TWXB 4FUDA 3K2UA 3U69H 2FOCA 2PKSB 4M7GA 2YMSD 4ISNA 2KAIB 1Z7KA 2VIVA 1SGDE 1Y5AT 4BAKB 1ELTA 3F0PA 4ABIA 1WAYB 2P16A 1FDPA 1SQTA 5EODA 1O39A 3MO3A 2BOKA 2Z9JA 3B8JA 1FI8A 5LH8A 1Y3XA 2HPQH 1KTTB 1BTPA 1SGPE 1BTXA 1NROH 3EA7A 4GUXA 1C9PA 1B0EA 2FOBA 3M35A 4CHAC 5HIYA 2SGFE 2OTVA 3ATIA 4DG4A 3GDUA 1KMHB 3PB1E 1TA2A 4X1SU 2ZU5A 5AFZH 1C5MD 2C8ZB 5HM9A 4MPVA 2QXIA 5DPAA 2ZGJA 1SFIA 5J4QA 3SV8A 1AFQB 4AGJA 1FZZA 4NIVA 4Q2KA 2V35A 1IQEA 3MOCA 4LZ4B 2CK3D 2O8TA 1Z8JB 3RM0H 2XCNA 5GCHF 2GD4B 1ETTH 8KME2 1FN6A 3WWFA 5FL7D 3RXLA 4CBOA 1RFNA 3PROA 1E1QD 1T8LA 2STBE 1MKXH 1DSUA 3UPEA 1H9LB 1JIRA 1RD3B 2F4LA 3K6YA 4NGAH 3FO8D 1LVOA 1D3QB 4FVBA 3QTVH 1EZXC 2TPIZ 1BTHH 3M7UA 1O2IA 2KR7A 4X2WA 1Q2WA 1YGCH 1SGYE
chains in the Genus database with same CATH topology
3GISB 5HYOA 2GCHF 2PKSC 1C5RA 1GJ8B 5FAHA 1TQ0B 3V3MA 1QFKH 4GLYA 1ELCA 3A7ZA 5C5NA 4X8SH 4NWKA 5ESTE 3RXTA 2FLRH 2XBWA 6GCHG 5IYTA 4B76A 1HJAB 2ZQ1A 4YLUA 2QYIA 5C1YA 1D6RA 2O9QA 1ELDE 3IITA 2Z3DA 3AW1A 1RIWC 3PV4A 3Q3KA 4DT7B 4DURA 5GXPA 1TQ7B 3TGKE 1S82A 3SI4H 1HAIH 1CBWC 1HGTH 4X6MA 5B6OA 2OC8A 2JKHA 1UJ1A 2G5NA 2XWBI 3ZVEA 2XBVA 4YOIA 1HFDA 3MU0A 2A31A 3FP6E 1HAOH 2BVXH 1TRYA 2ZHEH 2A4GA 3RU4E 1P57B 3VGCC 3U98H 4DVAU 2BDIA 2ZWLH 3SUGA 1DFPA 2J34A 3U1JB 1BITA 3ZZCA 2Q1JA 1IQIA 2ZQ2A 3MYWA 4O9VA 2XYAA 2QAAA 1DWBH 1GJ5H 1E35B 2A0QB 1FY1A 4DY7B 3GY2A 1TNLA 5DP4A 2F9UA 1AQ7A 1ZMJA 2BMGB 1MTVA 4AX9H 1GHXH 1TONA 4WWYA 1GL0E 3UR9A 1O32A 1ZJDA 3RMLH 1EZQA 1TNIA 3VXEH 1P03A 1PPHE 3SUDA 3LIWA 3I29A 1C1MA 1HAHH 2SGPE 1X7AC 1AE8H 2ZHWH 1THSH 1PPGE 3DT0H 2D8WA 1XKBC 3ZYEA 1AN1E 1O30A 4TWYA 1P2NA 2A7HA 1HCGA 2VINA 1O3KA 1QBVH 2HRVA 3O8BA 4JYVH 5FHTA 3ZVFA 2Z3EA 3MMGA 4K8BA 1ELFA 4I7YH 5I46H 3M36A 4I8GA 4K1SA 4K3JA 1UK2A 1RTFB 2W7UA 2VGCC 3RXMA 1AGJA 1MKWK 1EAWA 2F91A 3BTME 3OYPA 2BD2A 1GBDA 5E0JA 4DJZB 1W0YH 2ZZUH 2AEIH 1O2HA 2UUKB 1YF4A 4NIYA 5AVDA 3UQOA 2KAIA 5TJXA 3SNBA 1CGIE 1CT0E 1BTWA 2XC4A 3LJOA 4OGXA 4SGAE 3RU4T 3WY8A 1LCYA 5J4SA 3E3TA 3S9CA 1EUFA 2UUJB 2ZP0H 1SBWA 3HKIB 1OX1A 5A0AE 2BX4A 2R9PA 3BEUA 4ZROA 1C5VA 1DY8A 4YOJA 1TLDA 1P01A 2FX4A 1MBQA 2LPRA 2O8MA 3AAVA 1U6QA 3W94A 3U8TH 2A7JA 1FN8A 2WPJS 1O5FH 2F9PA 1QL7A 3P8OA 1HYLA 1SB1H 4X1RU 1W7XH 1KLIH 2BX3A 4BTUB 3Q3YA 4K2YA 3VEQB 5A8XA 3T29A 4MVNA 3I77A 5C67A 1UCYK 3LH1A 2A4OA 2AGIX 3FVFB 3SV7A 1FONA 1NPMA 2DE8A 1TPPA 4JYUH 3MU4A 1S83A 4NA8A 4O3UA 1D3PB 4UFGH 1V2LT 2OXSA 2BDCA 3LPRA 5EXLA 1YPLH 5FPSA 1EATA 3GY6A 1FY5A 1O3LA 2WV4A 7LPRA 4Y7AA 2ESTE 4ABBA 3BTGE 1EB2A 3ATLA 3DA9B 1O38A 2ZPSA 4ZKRU 4ZAEA 2XW9A 1XXFA 2J92A 2UUFB 1SLVB 4IBLH 1D9IA 4BAMB 3BG4C 1BRUP 4FUIA 3RMOH 2GZ7A 3EA9A 1S0QA 2B7DH 2QGRA 3E16B 1OSSA 2ZFRH 3VB7A 1QHRB 2RDLA 1EAIA 4DCDA 3MH5A 1NRNH 1UHBA 1WYKA 1W8BH 3QX5H 1QB9A 2OQ5A 3LGIA 3DUXH 1LVYA 2ZDKA 3BV9B 1MCTA 3GCTG 5E2PA 3PO1C 1HJAC 1GJ6A 3RP2A 2VJ1A 1NO9H 3RXJA 1VITH 2A45B 2QY0B 2JETC 2O8UA 2UUYA 1ZLRA 1MD7A 3CS0A 2ODQA 4IC6A 2FYRA 5DK1A 1FY8E 3DFJA 2SGDE 1AMHA 3ZZ3A 1BBRH 3C27B 2Z9IA 1W14U 3ELAH 1GI3A 2NU4E 1ESAA 3OY5U 2GZ8A 1K21H 5EXMA 1FAXA 3AVZA 3TH2H 1O3CA 1TYNA 3F1SB 3GCHB 3VGCB 1GDNA 2O8LA 4X1NU 1GVLA 1FLEE 2H1UA 1C5NH 4F4OC 1KXCA 1DOJA 1DUEA 3GCOA 1PPFE 2GVFA 4DGJA 1QA7A 2GDDA 4MDSA 3SORA 5IDKA 1ZSKA 5AF9H 3BTTE 3O8CA 1A3BH 2VNTA 3GDSA 5F8TA 3M37A 1DUAA 4FUHA 3NCLA 3LGYA 3MU1A 2P93A 3T25A 2JH5D 2XBXA 3ZZ8A 3UY9A 1ABIH 1SR5C 1V2NT 1LVBA 3RXRA 1XXDA 3CS7A 1Y5BT 2PUXB 1HPGA 1GGDB 2SGAA 1A1RA 2GP9B 1O3FA 2PR3A 3UOPA 2J2UA 4VGCB 4ABEA 1NY22 3MNSA 4UDWH 3RXOA 2FI5E 4NZQA 1G30B 4MNYA 1KXAA 3QLPH 2EI8A 1Q3XA 3UIRA 1Y8TA 1H9IE 5GIBA 4OS7A 2PGQB 4X2XA 1MKWH 4GHQA 3VXFH 1G2MA 1TGTA 2YNBA 1ZTLA 2C90B 3SBKA 2TGPZ 2FOFA 3STJA 1Z71A 2XTTB 1V3XA 1P0SH 3QUMP 4X6PA 2OP9A 2VIQA 4BNRA 1KLJH 4JZ1A 4BXWA 1ORFA 4ZH8A 1TX6A 1MTNC 2BY7X 1P04A 1GBTA 2OQUA 4U2WA 3D49H 2BLQA 3T2NA 5GWZA 1HAXB 3KN2A 3HKJB 5DJ7A 1P3EA 5EW2H 3BN9A 2VH0A 1ETRH 3ENSB 1QJ6B 4B2AA 1SGFA 2OC7A 1TMTH 3NWUA 4FUCA 1EJAA 2AYWA 2BDAA 2UWPA 1DVAH 1N6XA 1F92A 1K28D 1ZTKA 1MCVA 3F9HA 1O2UA 1QGFA 1MMJN 1AVXA 1CSOE 3LT3A 3ZZBA 2VWNA 2ZGXH 3ZZAA 3RXPA 1TNGA 2V3OH 4Y8XA 3B9FH 4D8NA 5DO4H 3M5OA 1W11U 1BDAA 1MUEB 4YESB 1T4VH 1G3BA 2VIWA 3A8AA 2CHAB 2QXGA 3VB3A 4ABJA 1GHVH 1BMNH 3P70B 1D3DB 1V2TT 3UR6A 1CGHA 3A83A 4NFEA 1Q31A 2CF9H 2JETB 4MQAA 2QXJA 3MU8A 3E1XB 1OYTH 4AYVB 1S81A 1PPZA 1GHZA 3EYDA 4A1TA 4Q80A 4WXVA 1BIOA 1BZXE 4MNXA 4Q7ZA 4WF8A 3AASA 3SHAH 4JZDH 3SQEE 1W2KH 2FP7B 2GMTB 4FU7A 1CE5A 1P06A 3T5FH 4AG2A 4JYTA 4U01A 1DE7H 3M5LA 1GMDG 3TJNA 4FU9A 3OX7U 2UWLA 3RC4A 2ANWA 4CRBA 3RXDA 3ZV9A 3RC6A 1V2UT 3I78A 2SFAA 3KQCA 2BD4A 1O36A 3NXPA 4X2YA 8GCHF 2BQ7B 2OBOA 2ZTZA 1NN6A 1EZSC 1K1OA 1O37A 2R3YA 2GT8A 4AB8A 1J9CH 4INHA 4TYDA 2R2MB 1RS0A 1KSNA 1O3BA 2PW8H 2Y80A 1P2JA 5L2ZH 5F6MA 1UTOA 5DP8A 1TOCB 1P09A 2BDHA 1D3TB 3ZZ4A 2R0KA 1BTUA 5JB9S 3BIUH 3JZ2B 1TNHA 4PROA 3UNQA 2P3TB 2ZHDA 5H4IB 1BA8B 2H9EH 4AORA 1GJAB 3QTOH 5L30H 1KYNA 6CHAB 4XFQA 2VGCB 3RLWH 2ZDVH 2RCEA 1B7XB 3QWCH 1DM4B 2QF0A 3MFJA 1TAWA 2HALA 3RXVA 1DWEH 1INCA 7ESTE 1EASA 3A86A 2A4QA 2V6NA 1MU8B 1BHXB 4ZHMU 2FS8A 1K22H 2GCTB 2B8OH 1QJ7B 4H42U 3RUOA 1TRNA 3MWIU 3SV6A 5FCRA 1V2KT 2F9OA 2HGTH 1T7CA 1P02A 2OC1A 2J95A 3A7YA 1J16A 3SJ9A 5EXNA 4QT8C 4Y76A 2QN5T 1ANCA 1O2TA 1C2DA 4FUGA 1EX3A 2VVCA 1C5UA 1O3GA 7KMEH 1L4ZA 1BBRE 1GBHA 3LGTA 5C5OA 4ESTE 4FUFA 4X8UH 1SL3A 1HAPH 2Z9KA 1W7GH 1XUJA 5LGOA 3TNSA 2BDGA 1OYQA 1HAVB 3H7TA 2SGEE 2A7CA 4KELA 4E06H 4THNH 3GYLB 2Q6GA 4AFQA 5K0HA 2ZFSA 2FLBH 3NK8A 4CH2B 4ZXXH 2WYGA 2WPKS 3KIDU 2C3SA 1C9TA 1ZOMA 1ZHMA 1EAUA 3L6PA 5DP9A 3A8DA 2O8WA 4ZXYH 1KXBA 4BAQB 1TNKA 3BTWE 4ZKOU 1OWJA 3SN8A 4RSPA 1LMWB 4MNVA 1CQQA 1NRQH 4J1YA 5FBEA 5A2MH 4ZUHA 1V2OT 1G3EA 3PTNA 3RXQA 1O2VA 3SU2A 5FX6A 2PHBA 2EC9H 2ZU3A 4RKJB 1LQEA 3M3VA 4ZHLU 2XNIA 4E7NA 3BEIB 1TE0A 1VR1H 4CR5A 1YC0A 2BLVA 4B75A 3MTYA 2ZIQH 3VB5A 1DPOA 1FV9A 1BBRK 2BDYA 1P9UA 4WH8A 2D2DA 2OC0A 3ZVGA 1VITG 1GBKA 5T6GA 1L2EA 3U8OH 2QIQA 1QBOA 1ZGVA 3FZDA 2BVRH 4RKOB 3D23A 1LKBA 1UVSH 2H5DA 2J9NA 8ESTE 3EDXB 1YPMH 3ZVBA 6LPRA 4XE4A 2XXLA 3P17H 1JXPA 3STIA 1P2OA 5JBCS 1JOUB 1S85A 1UTNA 1GL1A 5A8ZA 2FESH 3E91A 1GJ7B 1SQOA 1Z1JA 4Y0YE 2W7SA 2CV3A 1A46H 1SGFG 1P3CA 3BTDE 2YOLA 4B73A 1WUNH 4BAOB 1GPZA 5GCHG 1SGQE 3SU0A 1CVWH 3SJOA 4B2CA 3BTFE 3RXIA 2WUBA 1J17T 1AVGH 1CBWB 3KGPA 1T8NA 5C20A 5BRRE 1GBJA 2ZHQH 1NZQH 1SLXB 2HOBA 2BY5X 4YM9A 1O2PA 2XBYA 6GCHF 5BPEA 1GWAA 1TBZH 3KNXA 1K1LA 3P92A 2B0FA 2GKVE 1O2NA 3LC3A 1QQ4A 1SQAA 4NFFA 5PTPA 1TGNA 4NIXA 2BOHB 1IQNA 4UD9H 4NSVA 1FPCH 3PTBA 5DP6A 4CHAB 2HNTE 1TX7A 1MQ6A 3FAOA 1PQAA 2H9HA 1UTJA 4Y8YA 1SMFE 2A5IA 2ZPRA 5CHAC 1O2LA 1UK4A 4NIWA 3SOSA 4Q7XA 3JZ1B 4JCNA 1QRWA 1GI0A 1EB1H 1LVMA 1VJ9U 3TNTA 2A1DB 4FVDA 4VGCC 1RXPA 1DDJA 2ZEBA 1NFYA 3GDVA 1NESE 2ZFQH 4NWLA 2BD9A 1PPBH 4I31A 2I6SA 3SU3A 1ANDA 5ETXA 5I25A 4UEHH 1GCTC 5SGAE 4WH6A 1QNJA 1MKXK 3QGJA 1QCPA 3UTUH 2ODPA 1DY9A 3LGVA 1IQKA 1P9SA 4O97A 4BTIB 3AAUA 1CA0C 5T3HA 1MTWA 3CENA 2Z6BD 2VU8E 3SU5A 3OTJE 2GTBA 1S84A 1LHFH 2YNAA 3S9AA 4Y11E 5EQRA 4Y6DA 4K69A 1D4PB 4JMYA 2ZPQA 2QA9E 3GY5A 3K9XB 4GAWA 1OWDA 1BJVA 3BTHE 5E0HA 1VCWA 2WPMS 4WMDA 5C1XA 1WV7H 2A4RA 4TWWA 4Y71A 3ZVCA 2CGAA 1GMHF 4GCHG 3A80A 4F49A 1AKSB 4LK4A 3SU4A 3AW0A 4AB9A 3FP8E 2FXRA 1O2XA 4D9RA 1TOMH 3PO1B 1LDTT 1O3HA 1QL9A 1Z6EA 4H6SB 2CXVA 1SC8U 3LGUA 1EP5A 2HLCA 3LU9B 1D6WA 1UVOA 4HI3A 3FANA 5HMAA 1MAXA 1SGCA 3KQDA 4ZHAA 3MHWU 2F9BH 1CGJE 1S5SA 1O3PB 1SGNE 4ISIH 1O2KA 3S0NA 8LPRA 2ASUB 1XMNB 2Y6TA 1ID5H 4J2YB 1C2LA 3E0PB 2IJOB 1GMCG 1VGCC 2EI6A 3A88A 3P95A 3URDA 4IC5A 1S0RA 1NRSH 2BQ6B 2SNVA 2Y7ZA 4WY3A 1O2GH 2ZECA 4I8LA 4NA7A 1WU1A 3TK5A 1ANEA 5A09A 4IN2A 2WPIS 5JDUB 3RDZA 1G3DA 2P3UB 2G8TA 3QN7A 2BXUH 1O5DH 1AUTC 2GV7A 2R2WU 3ATMA 2TGDA 2PV9B 2ZU1A 4UE7H 1A0LA 1SLUB 1AE5A 1DX5M 1UTLM 1OP0A 3LJJA 2FMJA 3VFEA 3NZIA 1G32B 1PYTD 2FZZA 2FEQH 1YCPH 4WJG2 1CHOF 3TU7H 3E6PH 1SGEE 5EQQA 3PLPA 1V2JT 3SUFA 1TFXA 4MPUA 1SOZA 1WTHD 4B71A 2ZU4A 3M61U 2BZ6H 1ETSH 4ABFA 1QQUA 1O2JA 4ASHA 1UTMA 1FJSA 3RU4D 1SHYA 1RGQA 1Y3WA 1OWKA 1SOTA 3SNEA 1DT2A 1IOEA 3KCGH 3VB4A 4KTCA 4CRAA 3RXGA 1ELAA 1ZRKA 1XM1A 1QURH 4D7GA 3QK1A 1EZUC 1GI6A 2BDBA 1EOJA 1ESTA 1Y59T 2TRMA 1QBNA 1V2MT 3V13A 5HXFA 1MQ5A 3E8LA 4Y0ZE 3A82A 4AFUA 1KY9A 1KLTA 4E05H 4ABAA 3UNSA 1ANBA 2GX4A 1QA0A 2STAE 3SI3H 5EGMA 3IWMA 1QY6A 3HK6B 1GI7B 1MBMA 1H8IH 2HVXA 5JBAS 5E2OA 3SJ8A 1UMAH 1NFXA 1AFEH 1N1LA 1O2QA 1O2RA 3GY8A 2G4TA 3F9EA 4Y8ZA 1GBEA 1C2IA 4DW2U 2FOGA 2ZCHP 1AB9B 4D76A 1HXFH 1C1QA 1TMBH 4MTBA 3M3SA 1K1PA 4JZIA 1HNEE 1J15A 4HTCH 2Z3CA 3KHVA 4BXSA 1O3MA 4KKDA 4XBDA 1UTPA 1C2EA 2RG3A 4CRFA 2ZU2A 1DICA 4Z6AH 5FBIA 1O3NA 2C4FH 1GBMA 2XCFA 1O3JA 4CR9A 2AMPA 1GI9B 2C93B 4WMEA 1P11E 3F6UH