1CE5A

Bovine pancreas beta-trypsin in complex with benzamidine
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEIN (TRYPSIN)
publication title Non-Boltzmann thermodynamic integration (NBTI) for macromolecular systems: relative free energy of binding of trypsin to benzamidine and benzylamine.
pubmed doi rcsb
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ce5A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ce5A02
1TMTH 4YOGA 6GCHF 4D76A 4U30A 3GYLB 3RXTA 3GCNA 1ZSLA 5LGOA 1VITF 5EOKA 1GMCF 1P06A 4WMEA 5F6MA 1GBKA 3TJNA 1BTXA 1GHWH 1IQHA 1DLKB 1GI4A 2OUAA 1UTLM 3LDXH 3VFEA 1DSUA 2VNTA 4K8YA 1N8OC 1BOQA 2ZHFH 3SU0A 1BUIA 1GMHG 1QA0A 1YCPK 1K21H 2FOEA 2ZU3A 2BY6X 1Z8RA 2BYAX 3V7TA 4B76A 2PTCE 1WCZA 2V6NA 4KP0A 4Y76A 1G32B 1HJAC 1YCPH 1IHTH 1AE8H 1GBHA 3UOPA 2FTLE 3ATKA 3A82A 1GI1A 3U1IB 3ZZBA 5JB8S 1OS8A 4SGBE 3TGJE 1YYY1 4YLQH 1GJBB 1K1IA 1E0FD 1W13U 1HLTH 1EZXC 2OCVB 2XBVA 1ZRKA 4RKJB 1HXFH 3VB6A 2ZDMA 1VGCC 3MU1A 2A7HA 1GHAG 1T8NA 1XUIA 4YOJA 1A4WH 3ZVAA 1BZXE 1DS2E 1THRH 2VVCA 6LPRA 2ZHWH 1S82A 1HAXB 1C2FA 1WAYB 5GXPA 1VCWA 1TPOA 1YLDA 4AYYB 3UOUA 5GIBA 3RXCA 1TA6A 1J17T 4AZ2B 3I29A 1BTZA 3Q00A 1AUJA 3A87A 1A0JA 2TGAA 1DWDH 2XCFA 2ZHQH 1PJPA 2H9EH 1FPCH 1S5SA 1W0ZU 1C2JA 1GI0A 5EXMA 3UPEA 4CBNA 1DOJA 3RU4T 2ZHDA 1C9TA 3U98H 1KXCA 2Z9LA 1D3TB 1OWHA 3HGPA 2XC0A 3BIVH 2OBOA 1EAIA 1RS0A 3OTJE 2GDDA 4BXWA 5DO4H 4BAOB 4MTBA 5CMXH 5E0HA 4BTIB 2UWLA 3GY4A 3GY6A 2O8UA 3C27B 1AU8A 2ALVA 1D6RA 1TIOA 1GMHF 1QHRB 1GI2A 1BCUH 2BD3A 5ETXA 1EB2A 4CRCA 1G2LA 4FUIA 1TABE 1BTPA 3K6YA 3SU4A 2R0LA 4CRGA 2WPLS 4NFEA 3RXMA 2AGEX 3MU0A 3PO1B 4WWYA 3QTVH 3TJVA 5EPNA 3WY8A 3TH4H 2BX4A 3JZ1B 1SLXB 2ZTYA 4TY7A 3HPTB 1A0HB 1Y3WA 3SQHE 4GAWA 2UUYA 1LPZB 2A0QB 1A7SA 1TLDA 4FUJA 1SGFG 2NU3E 3SNAA 1XMNB 3TPIZ 2VIOA 3UREA 3SHCH 4MNYA 3MTYA 3A83A 3ZVDA 5A8XA 1PPEE 3SI4H 2HVXA 1Z8GA 1C5QA 2VIWA 4UEHH 2PKSC 2ZFTA 1ZHMA 1CBWB 1H8DH 1DWCH 2AMDA 1SQTA 2B8OH 3GDSA 3MMGA 1LQDB 1OKXA 1SLVB 2SNVA 1SQAA 3K6ZA 1S81A 2P8OB 1C5XB 5A0AE 4B2CA 2QXGA 5ABWA 1MAXA 3RC4A 2OC0A 2W5EA 4NSYA 3ZZ6A 2A2QH 1XX9A 2EC9H 1F0RA 3FP8E 1SI5H 4XFQA 4TPIZ 2F9NA 1OPHB 4BNRA 3A80A 4ISLA 4FUBA 1INCA 2H9HA 2PSYA 3CP7A 1DX5M 2CF9H 1C4V2 4X8TH 1P2MA 1GDNA 2BLQA 4GVUA 3A84A 4NWLA 5FPSA 1AN1E 2W7SA 3GY8A 3ZZ8A 1QJ6B 4X2XA 4X6NA 1SVPA 2C8WB 1NS3A 5C1XA 1YM0A 4Z6AH 2RG3A 4JZIA 4CR9A 1YPMH 1T4UH 3UUZA 1THSH 4AFZA 1P2IA 2P95A 1QRZA 3BTFE 1TOMH 3SU2A 2VGCB 1LKAA 1TBZH 1CT0E 1QCPA 4GSOA 1EQ9A 2QYIA 1KTSB 3BTEE 1W12U 2UUJB 5A0CA 3B23B 3VGCC 2CHAB 1SGQE 4NA9H 1EXFA 4CH8B 3UNSA 1TPAE 1E36B 1GWAA 1WU1A 1GI8B 1BRAA 2A7CA 2OD3B 4DIHH 5K7RA 2HNTC 1V2KT 1QBNA 3RP2A 2WPHS 1XKBC 1SGFA 4ISHH 4XBBA 1MTSA 3VEQB 3VXFH 2BXTH 1SOZA 1ZJDA 2BD9A 1P57B 2WUBA 3KN2A 4CH2B 4MVNA 4O3TA 1N6XA 3UTUH 3LC3A 3TITA 1KXEA 1BJUA 1C2LA 1LVOA 2P3TB 3KIDU 1DVAH 5K0HA 2W26A 2C4FH 4MPWA 3QUMP 1AMHA 1EZUC 2NU2E 2PKAA 2Y6TA 3N7OA 2V35A 5FX6A 1GBJA 1DFPA 3EA9A 3BEIB 3SQEE 1QQUA 1WV7H 2G8TA 2ZPSA 4K5ZA 1OYQA 4ZH8A 1YPGH 1AVGH 4MPUA 1TNIA 1BRCE 1MU8B 4HGCA 1LPGB 4FXGH 2UWOA 1Y59T 2XYAA 4Y7BA 3V13A 2WYJA 1BITA 2ZFRH 1RGQA 1V2PT 3U8OH 1Z8JB 2FMJA 2OC8A 2FI4E 4MLFB 1O39A 1HAVA 1ZMJA 4XOJA 1NO9H 2Y7XA 3SGQE 1PQAA 4VGCB 1AKSA 1S83A 4ASHA 2F9UA 3GCHB 4UDWH 2FESH 1QRWA 4A6LA 3GYMA 5IDKA 1UMAH 1ESTA 2ZI2H 3KL6A 1DPOA 3D23A 5GCHF 4MPXA 1TFXA 1WQVH 1ZYOA 1FNIA 2VWLA 2ZP0H 4FUFA 1SHYA 2QY0B 2JETC 1HJ9A 2R3YA 2VIPA 3BIUH 3GOVB 5C67A 5PTPA 2R2MB 4E7NA 3LH1A 3ZVCA 3BTME 3Q3KA 2ZO3H 1T8OA 4OGXA 3M7UA 2KAIB 2AS9A 4ZROA 3R3GB 1BTHH 1SC8U 5FX5A 1O5DH 1ZMLA 3GCOA 4JZEH 2A7JA 2ZDKA 6CHAB 5T6GA 2O8WA 4AOQA 1ELTA 2ZNKH 3A8AA 1ZMNA 2WPJS 1MCVA 5SGAE 2NU1E 4B2AA 1RTKA 4XSKU 3RUOA 4U2WA 3LC5A 3M7QA 4O03A 3S9BA 4NZLA 1E38B 2AEIH 1DY8A 5F8ZA 3LJOA 1Z8IB 4BAKB 1SGPE 1ELFA 1ABIH 2ZU2A 1XVOA 3ODFA 1W14U 2TGDA 1Q31A 1ANCA 4B2BA 1WSSH 3BF6H 2YOLA 1C1MA 3B9FH 2Y7ZA 2AMQA 2GZ7A 2JH5D 3ODDA 1UVUH 2D2DA 1PPCE 3QK1A 2FX4A 5F8XA 1LCYA 1XUJA 3PMJA 3E1XB 4FVDA 2HWLB 1BHXB 3STJA 4CHAB 2VIQA 1GJDB 3DHKH 1TALA 1C2KA 1CHOG 3VB5A 4IN2A 2SNWA 4FVBA 3EA8A 4NA7A 1CVWH 2G5VA 2HGTH 1F0UA 4BTUB 1C5RA 1P9UA 1W8BH 3QWCH 1ZTJA 1TGTA 1BTWA 2GCTC 5GWZA 4YTAA 1O3EA 3ITIA 3UR6A 1YGCH 4Y10E 1H9HE 2AGGX 1NFXA 2ZGXH 2XWAA 3CS7A 3NUMA 1JOUB 1MTNC 1GJ7B 2ZCLP 2F83A 2UUKB 3W94A 2CGAA 4AORA 1ZOMA 2A2XH 5JYIA 4INHA 4MQAA 3AAUA 3V0XA 1C1WH 3FFGA 3O8CA 1PQ8A 3SV2H 1K1OA 2PUQH 1GMDG 1GDUA 2RA0A 1TX8A 3TK6A 4BTTB 4F49A 1HNEE 3NPSA 3UQOA 3BEUA 1QJ1B 4R0IA 1S6FA 1C4U2 4ZKSU 1QR3E 2PR3A 4JZDH 1ZPZA 1Y5AT 2GD4B 1P02A 4X2YA 4Y0YE 1BMAA 1P04A 2Q6DA 2G51A 5DG6A 4Y71A 1C5PA 1UTPA 1TONA 2PHBA 2ILNA 1MTVA 1O3OA 1FY3A 5C5OA 2F9OA 1AD8H 2FODA 4H6TA 4OS7A 1K1NA 2QV1A 1TRYA 1GI3A 3HK3B 1P03A 1UVOA 2WPKS 1YP9A 1ETSH 3P92A 1A46H 4OGYA 3UQVA 5DP4A 3GCTG 3KHVA 5C3NA 1Z71A 4X1RU 3FVFB 1O5FH 2PWXA 1C1OA 4WH8A 4D8NA 2W3KA 3LGIA 1SOTA 1Q3XA 2JKHA 4X1PU 1S0QA 1TA2A 1U6QA 3LGUA 3ZZDA 3M3TA 1T8MA 1NTPA 1OXGA 4NWKA 1PYTC 1S0RA 1S84A 2AIPA 7GCHG 1GGDB 2Q1JA 1O5GH 2SFAA 3MHWU 1YC0A 1Y5BT 2RDLA 3K2UA 4B73A 2R2WU 1NFUA 1GJ8B 3RU4E 4X8VH 3TGIE 1GMDF 1FUJA 5DKMA 1MQ6A 1QA7A 1CSOE 1RTFB 2SGQE 1EPTB 1MD7A 3BN9A 2J95A 1GBMA 3EAJA 2PW8H 1O2YA 1P0SH 4ZUHA 1JRSA 3PWBA 2H5CA 4HI3A 1LVMA 1AIXH 3SJ8A 1L2EA 3E8LA 1GJ4H 1JBUH 1O33A 3S9AA 2ZDVH 1ZGIA 2OC7A 1FI8A 1THPB 4WJG2 3BG4B 1K1JA 2HRVA 3RXFA 4XBDA 3KQDA 5HMAA 1KIGH 2B9LA 1IQLA 2PKAB 4K1EA 5EXLA 4CREA 1TWXB 1J8AA 3OYPA 4GHTA 2Y5FA 4A1TA 4PROA 4NSVA 1LKBA 4BXSA 2H2ZA 3PMAB 2XCNA 3RDZA 1TE0A 2BDBA 4I8GA 1C1PA 3T62A 1UHBB 2QF0A 4AG2A 4B74A 1DXWA 3RXHA 1GI6A 1K28D 3PTBA 1ABJH 2SGDE 1FAXA 1C2MA 1CE5A 1QJ7B 1V2TT 2ANYA 1YPKH 1O2SA 3LH3A 1G37A 4JMYA 2BD7A 1GCTC 3EQ0H 2EEKA 2ZPQA 4CRDA 1GBFA 3PB1E 3F9GA 2QN5T 4ABIA 2A4OA 4X1QU 1CA0C 1MU6B 5BRRE 3SORA 5EGMA 1S6HA 3SHAH 2QXIA 3A89A 4K60A 4ABJA 4DT7B 3SN8A 1LHDH 2ZG0H 4IMZA 2SGFE 2FOBA 2RCEA 1K2I1 4A92A 2F9BH 4IW4E 1ACBE 2HNTE 2PUXB 3RXKA 4NCYA 5DP8A 1C2HA 2BD2A 1V2LT 2FLBH 2AGIX 3A7YA 1RJXB 1AGJA 5EQSA 5EG4A 1C1UH 4LZ1H 1GPZA 4WH6A 2R3UA 5GDSH 2JH6D 2GZ8A 3V3MA 2A5KA 2PLXA 3NK8A 3FP7E 2XBXA 3QGNB 1YBWA 3DUXH 2ZEBA 4AX9H 1ETRH 2Z9KA 5A8YA 1KYNA 5L6NH 2BQ6B 2C8ZB 3BSQA 3Q3XA 1YLCA 4TPYA 3P8GA 3A7TA 1DXPA 1Z6EA 1SGCA 2A4RA 3H5CB 1FY1A 2CN0H 5EQRA 2XBWA 7KMEH 1ARBA 2C8XB 1L4ZA 1C5ZB 1SFIA 1V6DA 1EJNA 3QX5H 5IYTA 3TLOA 4B75A 1OWJA 1SMFE 1AE5A 1AY6H 4XDEA 1O30A 3PWCA 3MH5A 3ZZCA 1QY6A 3SBKA 3TU7H 3MOCA 1V2NT 1EP6A 1KXDA 1GHBG 1BBRH 1O2HA 1RTLA 1HIAB 5FPTA 2VU8E 2ZKSA 2GMTC 2P93A 3A88A 3ATLA 3RXPA 1NU9A 1Z1IA 3LJJA 1MKXK 4FUCA 5FCRA 5JB9S 4KGAA 3SV6A 1O3CA 1Y3VA 4HFPB 3PMHB 4NA8A 5FCKA 2ANWA 4CRFA 1MKXH 3L33A 4YO9A 5DP5A 8KME2 4I8KA 1Z7KA 1D4PB 2TIOA 3EGKH 4ZHMU 1OYTH 3A8BA 2QAAA 4NIWA 3HKIB 4MPVA 2B0FA 1TNKA 5DP3A 3LGTA 1Z6JH 2HNTF 3SI3H 3AAVA 3DFLA 2ODYB 5LH8A 4B1TA 3OY5U 4X2VA 3RXUA 1AVWA 3KNXA 4ABGA 1GCDA 3OX7U 4YLUA 3O8RA 1F0TA 2BVRH 4D7FA 1O34A 3PMBB 3QLPH 4DW2U 2FOCA 2OC1A 1H9LB 1WYKA 1QGFA 5A09A 2Z9JA 1QB6A 3LGYA 3ZZ3A 3SJOA 2ZFQH 1BRBE 1C2DA 1GHAF 1YF4A 2BD8A 1C5WB 1VCQA 5L30H 3KQCA 2ZU1A 3RU4D 3MO6A 5FBIA 1UCYH 4Y8ZA 2GZ9A 2ULLA 1GVLA 3EE0B 4ZXXH 4KELA 4LOYH 5TJXA 1W2KH 4LXBH 2IJOB 2WINI 4Y8XA 4X2WA 1C5MD 3PROA 3IITA 4X6MA 2R0KA 4KTUA 4K1SA 3UWJH 2G55A 5HGGA 3RM2H 1SB1H 1NM6A 5E8EH 1ELCA 4A1XA 1GHBF 5CE1A 1C2IA 2VB0A 2ZIQH 1P2KA 1A3BH 1N8OB 3RXLA 3A86A 3ZZAA 1O35A 1YPHC 2BY5X 1DE7H 1T8LA 1W7GH 4WY3A 1GBAA 1LO6A 5EODA 1HJAB 3VB7A 1WTHD 2C90B 3MNXA 1TGSZ 2CXVA 3SNDA 1O2VA 2UWPA 1BTYA 4O9VA 3NXPA 1DUAA 3PM3A 1RIWC 4A7IB 1AFQC 1IQNA 1KXBA 4BANB 1EJMA 1ZTLA 4ZKNU 4OS4A 3D62A 3H7TA 1DDJA 3M7TA 1VGCB 2F9PA 1UVPA 3ZZ7A 3SOSA 5DJ7A 3E3TA 1C5OH 4JYVH 1G9IE 2BD5A 3CS0A 3BTHE 2W3IA 3LONA 2SGEE 3SJKA 2FOAA 1C1SA 4JYTA 1G3EA 4R8TB 1G3DA 2WPMS 2BDCA 1MQ5A 1KDQA 2P3UB 1MCTA 3BTKE 1L0ZA 3FANA 3AW0A 4Z0KA 1A5GH 2BLOA 3MU8A 1SL3A 5FBEA 1BJVA 3FP6E 4H6SB 1OOKB 3BTTE 2QIQA 1ARCA 3PYHA 1P05A 1DICA 1KXAA 3O8DA 2TGPZ 3TJUA 3M3SA 3RXOA 1HAIH 1LHEH 2QXJA 3EA7A 3FZDA 2BVSH 4RN6A 2V0BA 5C5NA 1A1RA 3MO9A 1FQ3A 1QL7A 2AYWA 1OWIA 3F6UH 1XXDA 4U01A 1TOCB 1FIWA 1FJSA 4NIVA 1XKAC 1QRXA 1W10U 3RXVA 3VXEH 2AERH 3ZZ9A 1GI7B 2HALA 4LK4A 1F92A 1O2RA 3L3TA 3KQEA 4UD9H 1O5AB 2C3SA 1GG6C 2G00A 1ZSJA 3MNSA 1C5LH 1ZRBA 5DGJA 3RXBA 2A45B 1TNHA 1MZDA 3MWIU 2ESTE 1IQFA 3RLYH 3BTGE 2O8TA 1OP0A 3RMNH 1HXEH 3UIRA 9LPRA 4Y7AA 1NFWA 1TBRH 3TH2H 1T7CA 1QL9A 2NU4E 1SLUB 4IBLH 2ZHEH 4H42U 1O2IA 1GJAB 3MI4A 3QZRA 4K69A 2ZFPH 1NY22 1TMUH 3ZYDA 3IG6B 1TX7A 3H7OA 2PKSB 2G52A 1C1RA 2GV6A 3U1JB 2GGVB 2Z3CA 4Q7ZA 4K1TA 1TMBH 1VZQH 1DT2A 2ZGCA 3AVZA 3T29A 2W7UA 3A7WA 1JWTA 3STIA 2J38A 1JIRA 2FIRH 4DVAU 2AH4X 4NIYA 3UWIA 3TJOA 3TK9A 4KTCA 2WV5A 1ELEE 4X6OA 3T25A 4IGDA 3DD2H 4A5TS 1EUFA 1L1GA 1UJ1A 2ANKH 3KEEA 3ZZ4A 1UTKA 1P01A 5FHTA 2XNIA 3ESTA 3JZ2B 1NRSH 4CBOA 2IN2A 1IHSH 1EZSC 3OU0A 3RXSA 1O36A 1UVTH 1P3EA 2P59A 3ZYEA 1DANH 2M5TA 2AMPA 2BOKA 2YNAA 3A7XA 4Y6DA 1GBEA 3RMMH 1FY8E 2BXUH 3MNBA 2FM2A 1O38A 1UTNA 3U8TH 1AB9C 5CHAC 5EPYA 4ZKRU 7LPRA 4I31A 1TPPA 7ESTE 5E2PA 1O2ZA 2ZA5A 1T32A 1PFXC 1ANEA 1C2GA 1Y3XA 3VGCB 2Q6FA 2J4IA 2XTTB 3TVJB 1B0FA 1V3XA 1UVSH 1DWBH 1CQQA 1CO7E 1D3PB 1A3EH 2PFEA 1WBGB 4FU7A 2O8MA 1BMNH 1ORFA 3PV4A 2OXSA 2ZECA 1GL0E 2VIVA 1D6WA 1O3IA 2K1QA 1J14A 2QC2A 1D3QB 1JMOH 2XWBI 3P17H 1FIZA 4ABAA 4M7GA 1NPMA 2WPIS 2BVXH 3MH6A 1HAHH 1HB0B 2FEQH 4Q80A 4SGAE 3CENA 3F1SB 1V2MT 1O5CB 1Y3UA 2FLRH 1C5UA 2VINA 1MBQA 1O3FA 3LPRA 4XE4A 5C1UA 5DPAA 4I32A 4TYDA 1LHGH 1O3HA 3GDUA 4E06H 1JXPA 1EAWA 5EU8A 1LTOA 1P2JA 2OQ5A 4NFFA 5LPEA 1C1VH 3SJIA 1HAOH 3PLPA 1TNJA 2Y5HA 1QNJA 2VWNA 1SG8B 1FN8A 2VWOA 1PPBH 1QB1A 2ASUB 2FDAA 5EXNA 1C4Y2 3TIUA 2ZFSA 1O31A 2ODQA 3A85A 5LPFA 1QTFA 1GHXH 3P8NA 4X8UH 1TNGA 1TQ7B 2PTNA 2A32A 2OLGA 1QBOA 3EDXB 4MNVA 1FY5A 4ZXYH 2ODPA 4FUGA 3SU6A 2FI5E 2BHGA 2GCHG 1IQJA 2ZGJA 2Z94A 2OINA 4ZHAA 3FZZA 1GBCA 1YPLH 4AYVB 1X7AC 1NU7B 3W95A 2FI3E 2FS8A 1CHOF 1B0EA 4INLA 3TGKE 1BBRE 3RM0H 5A0BA 1F2SE 3KCGH 2FO9A 3VPKA 2HPQH 2ZDNA 3L6PA 1IQMA 4OS1A 3ZVEA 4AFUA 2GP9B 4YESB 2NWNA 3PLBA 2H1UA 1P09A 8GCHG 1LDTT 1O3KA 2FOFA 3D49H 4I8LA 1ELAA 3MNCA 1NN6A 1KSNA 2VJ1A 1ESBA 2XC4A 2Y5GA 2VH6A 1GVZA 2PV9B 4AG1A 5DP6A 2IPHA 1O3LA 1J16A 4AFSA 1SGRE 3RC5A 2R9PA 2BY8X 2DE8A 3UR9A 1V2RT 4CRBA 3A8DA 3V12A 2ALPA 8LPRA 1EKBB 1VITG 2ZPRA 1GMCG 1L1JA 3M5NA 2PGQB 4UE7H 5LPRA 1OWEA 2VVVA 1AVXA 4YM9A 5AHGH 4FUEA 3UNRA 2G81E 4ZMAH 4IC5A 5I25A 2CMYA 3S9CA 1AFEH 1MKWH 3ENSB 1YPHE 3M3VA 1P9SA 3E0PB 1XUGA 1UCYE 1P2NA 3SU3A 5E2OA 2BDGA 2F91A 2THFB 4OS2A 2DE9A 1AQ7A 1O2NA 4UFEH 3RXQA 3LIWA 2GCHF 2FXRA 3T27A 2P3FH 1XM1A 2GCTB 3E91A 1VJ9U 2H5DA 2D1JA 3GCTF 3VB4A 3GY7A 1W3CA 1AZZA 1TAWA 5JPMH 1NROH 3ZVBA 1SFQB 1GJ6A 1MTNB 1HAVB 2FP7B 3PO1C 5JBAS 2QXHA 1ZLRA 3G01A 1WTGH 2XRCA 1AKSB 1G30B 1VR1H 2XC5A 1PPHE 1KLJH 1QB9A 5AVDA 4KKDA 5JDUB 4CRAA 3UNQA 1QFKH 2ZU4A 4ABHA 1NT1A 2ZGHA 1MTUA 1BT7A 3MU4A 4Y0ZE 7GCHF 1TGCA 3RLWH 5A8ZA 5JBCS 3SV8A 1MMJN 1BDAA 1QURH 2ZGBH 2TGTA 4WXVA 3LGVA 4GLYA 1B7XB 1C5YB 2V3OH 4HZHA 4JCNA 4NZQA 2IOTA 4AB9A 1K1MA 1CBWC 5FPYA 1A61H 4GHQA 5C1YA 3RXAA 1BQYA 2EI7A 2OBQA 1SSXA 1O2LA 1ELVA 1HAGE 1SR5C 1ID5H 1O5BB 1MBMA 1A5IA 1FV9A 4MNWA 2CF8H 2P8OC 2Z3EA 4FU9A 4K2YA 3T2NA 4WMFA 1TPSA 1ESAA 2J34A 2RA3A 4UFDH 1NESE 3M36A 3BTDE 3FAOA 2A4GA 3M35A 3RMLH 1O37A 1KLIH 1UTOA 2ZF0H 4K8BA 3B8JA 4B71A 3T26A 3SGAE 4BOHA 2A1DB 5GJ4B 3E90B 1PPZA 1KLTA 3DT0H 1SGIB 1LPKB 3F9EA 1OWKA 3QGJA 1SGTA 3SUEA 1CT2E 1BBRK 2GVFA 1C1QA 4BAMB 1FXYA 1SGYE 3GY3A 1V2QT 1T31A 2KAIA 5HM2A 2VGCC 1DSTA 1ZTKA 2SGAA 2BQWB 3PLKA 1ZSKA 1TGBA 2G5NA 2GX4A 3A8CA 1KY9A 2CHAC 1CA8B 5JBBS 1CGJE 2UUFB 1OX1A 1XXFA 1NC6A 3A7VA 1EP5A 3HK6B 4GCHG 5H4IB 2D26C 3BEFB 1O2GH 2V3HH 3IWMA 1C5NH 2GV7A 3BTQE 2Y80A 5J4QA 4ZHLU 2C93B 3ATWA 1A5HA 4J2YB 1BHXF 6ESTA 2FWWA 3SNBA 1PPFE 1ZPBA 5HYOA 1BIOA 1D9IA 1OP8A 4Q2KA 2EA3A 1ETTH 3ZV8A 1SGNE 3BTWE 2A5IA 4DURA 2HPPH 1IQGA 1O2UA 4O3UA 2ZDLA 5E0GA 1VITH 2SGPE 1K1LA 1MD8A 1O3DA 2FOMB 2VIDA 1TNLA 1BA8B 1GBBA 1GVKB 1UCYK 3SV9A 4DIIH 4Y8YA 3E0NB 1DUEA 4O97A 3RXGA 1C5SA 2F3CE 4LZ4B 4I33A 3SUGA 1HYLA 1EJAA 1CT4E 1Q2WA 2OQUA 3ELAH 1V2VT 3C1KA 1DITH 1GBTA 2FPZA 3UY9A 1RRKA 3NCLA 2BM2A 3A7ZA 1DY9A 2Q6GA 1UTQA 1GCTB 1YCPM 1T4VH 1G2MA 3K65B 4I8HA 2A31A 1P12E 2Y82A 4IN1A 1GBIA 2EI6A 2ZU5A 4VGCC 2O8LA 5EW1H 3GCHC 5TCCA 1LVBA 4QT8C 1CA0B 5FAHA 4GUXA 4MDSA 1NRNH 2F9VA 1JRTA 1FONA 2FOGA 2ZC9H 2BZ6H 1ELGA 1FPHH 5G4BA 1AO5A 1NZQH 4DCDA 3SUFA 2QA9E 1L1NA 1F7ZA 3RMOH 1EATA 3SU5A 1TX6A 3QO6A 1CGIE 1W0YH 3MH7A 2FYRA 4GCHF 4Q7XA 1AWHB 4THNH 4YOIA 1PQ5A 4MG3A 2Y81A 1HDTH 5AFYH 6CHAC 3UFAA 2G4UA 2GT8A 4F4OC 3K9XB 2GKVE 2ZTXA 4YT7H 4XBCA 3BV9B 3S69A 1F0SA 3GDVA 8ESTE 1GJCB 4X1SU 5E0JA 1WQSA 3NWUA 3ZVFA 2ZCHP 1HRTH 1LVYA 3I78A 2CJIA 1WUNH 1FN6A 1TQ0B 5A2MH 1C5VA 1O32A 1ZZZA 1CHGA 1O3PB 1MAYA 1SPJA 3MH4A 1HUTH 3S7HB 3T28A 4ISIH 4ISNA 1O5EH 3TNTA 4WF8A 2AFQB 2ZDAH 4GPGA 3QN7A 1O2PA 2Z7FE 4ABFA 1HCGA 1W7XH 1TGNA 2GMTB 2BTCE 4CHAC 2VVUA 5I46H 1O2QA 3NZIA 4INKA 2BQ7B 3HGNA 5GCHG 1EX3A 3MYWA 3M61U 3A81A 1SQOA 4IC6A 3I77A 1V2ST 4U32A 3SJ9A 5B6OA 4X6PA 2BB4A 3MO3A 2PSXA 2WUCA 1G3CA 2ZFFH 2TBSA 2ZCKP 3D65E 4Q7YA 1WOFA 1O3MA 4NIXA 1O3NA 1EASA 1LMWB 1HJ8A 5DP7A 3O8BA 1EPTA 4JZ1A 4YZUA 3LU9B 2GT7A 4BAQB 1C9PA 3RXRA 5DK1A 1XUHA 4IMQA 4DGJA 1RD3B 1NRPH 1O2TA 2LNCA 4FU8A 1NRRH 4TY6A 1E35B 1S85A 5L2ZH 5HM9A 2FYQA 3ATMA 1HAZB 2QCYA 3P8FA 1VCPA 4ISOA 1HAYB 3QZQA 3NKKA 1QBVH 5AF9H 2TRMA 3RXIA 2CV3A 2D8WA 4YT6H 2OTVA 1HPGA 2ZWLH 9ESTA 4AB8A 2A4QA 2JH0D 2DUCA 3SW2B 1IQEA 4E7RG 1L4DA 1BRUP 1YKTA 4ZAEA 2AIQA 2BDYA 3QTOH 3P6ZB 1UTJA 3DA9B 1JIMA 1AWFH 1GHVH 1QQ4A 1UHBA 2BLVA 2BY7X 2EI8A 1O3AA 3VB3A 5JBTA 3U8RH 1MH0A 2H6MA 1BMMH 1E34B 1SLWB 1M9UA 1F5RA 4OS6A 1Z1JA 4K3JA 2GDEH 4AFQA 1F5KU 5EQQA 1DM4B 1AZ8A 3T5FH 1LQEA 4UONA 2LPRA 1H4WA 3SGBE 1PQ7A 4FUDA 1UO6A 1C1NA 2Z6BD 1UK3A 2XW9A 1NFYA 1EOLA 1GJ5H 3M5MA 1XUKA 2Z9IA 3AASA 3RXJA 3P95A 3HATH 3U9AH 2ZTZA 2B7DH 2XBYA 4IS5A 2I6QA 4Y79A 1EAUA 2VH0A 1ZGVA 1OWDA 3OY6U 1UK4A 3URDA 3ZVGA 1SHHB 2QF3A 4AGKA 5L2YH 3SZNA 1RIWB 1AFQB 1VJAU 2FTMA 4TWWA 1ZHPA 4Y11E 1GGDC 4FUHA 1O2XA 4JZFH 2J94A 5C2ZA 1ZHRA 4I7YH 1A2CH 1O0DH 1E37B 1TYNA 3ZV9A 5T6FA 1SGEE 1V2UT 2P94A 3E6PH 3GY5A 1KXFA 1ELBA 1C5TA 3S7KB 1HBTH 1EPTC 4D7GA 2FX6A 1YPJH 3OSYA 4RSPA 5C20A 2FOHA 5GPIB 1H8IH 3HKJB 1UK2A 1DWEH 4WVPE 2J92A 1IAUA 1K22H 1SBWA 1CGHA 1O2OA 2ZZUH 2FZZA 1TRNA 3BG4C 1ZJKA 1N6YA 3M5LA 1HIAA 5TCAA 4ZKOU 3KQBA 2QGRA 1ELDE 4I8JA 2TPIZ 3ZZ5A 1RFNA 2Z9GA 4DY7B 4D9QA 2B5TB 1MZAA 1HFDA 4A1VA 1XVMA 1J9CH 2PGBB 2BD4A 1P3CA 5J4SA 1O3JA 1GDQA 1P8VC 3LOXA 4X1NU 5F03A 3GY2A 3LKWA 4AGJA 1GG6B 1GBLA 4ABEA 2BDIA 1PPGE 3BG8A 1G3BA 2STAE 4TWYA 1G36A 1AI8H 1BMLA 1GHZA 1ANDA 2BZAA 1UTMA 3PTNA 5T6DA 3R0FA 1N1LA 4JK5A 1IQIA 3SUDA 1FY4A 2BOHB 3KGPA 5ESTE 3F9FA 3Q76A 1O2MA 1IQKA 1P2OA 1P11E 2O9QA 3TH3H 1HGTH 1V2OT 1AHTH 1H9IE 1K9OE 2JETB 4ESTE 1SGDE 2BDAA 1IOEA 1O3BA 4E05H 2GTBA 2BY9X 1O2JA 4NG9H 4OS5A 2NU0E 2ANMH 4UFGH 2H9TH 3SU1A 4DG4A 2A5AA 1PYTD 1C1TA 2BX3A 3U69H 1A0LA 3TNSA 2C8YB 4MNXA 3SO3A 1D3DB 1KDQB 2HLCA 3RC6A 1XUFA 2WYGA 5EW2H 1F5LA 2BDHA 3MU5A 5HXFA 1Y3YA 1J15A 2J2UA 1DLEA 1FMGA 1EAXA 1QL8A 5ESBA 3SV7A 1ZR0A 1CU1A 1FAKH 1MUEB 1HAPH 4ABDA 6GCHG 1LHCH 4JYUH 2ZQ1A 3QDZB 1O3GA 2VWMA 1QIXB 3GISB 1GI9B 1TRMA 1H1BA 4ABBA 3ATIA 1P10A 2J9NA 4DOQA 3DFJA 3P8OA 1MKWK 1AUTC 1AB9B 1BB0B 5CHAB 1FZZA 3M37A 3S0NA 4H4FA 3GICB 1EB1H 3EYDA 1Y5UT 3Q3YA 4X8SH 3TK5A 1C2EA 1EOJA 1TB6H 5BPEA 1V2JT 3URCA 3MFJA 3P70B 4DJZB 2G4TA 1K1PA 2OP9A 4J1YA 1OSSA 5T3HA 1Y8TA 1TBQH 4KTSA 1OP2A 3Q77A 1YPEH 1GBDA 1KTTB 3LT3A 1W11U 1RXPA 2P16A 4UFFH 2ZQ2A 1P2QA 3F9HA 5F8TA 3RXDA 5DP9A 2STBE 3AW1A 2XXLA 3KF2A 1V2WT 1FLEE 3E16B 4X0WU 3M5OA 3SNCA 2YNBA 4WXIA 1BTUA 3F68H 1LHFH 2HOBA 4RKOB 1ANBA 1GHYH 1HV7A 3RXEA 1GI5A 4JK6A 4BAHB 1EZQA 5AFZH 2Z3DA 1O2WA 1MTWA 1NRQH 8GCHF 4NGAH 4WMDA 3LGWA 3SNEA 4D9RA 2BLWA 2I6SA 4HTCH 2BMGB 2WV4A 2FS9A 5FXLA 1ZPCA 1B5GH 1FDPA 1GL1A 1GJ9B 1O2KA 4CR5A 4AN7A
chains in the Genus database with same CATH superfamily
1TMTH 4YOGA 6GCHF 4D76A 4U30A 3GYLB 3RXTA 3GCNA 1ZSLA 5LGOA 1VITF 5EOKA 1GMCF 1P06A 4WMEA 5F6MA 1GBKA 3TJNA 1BTXA 1GHWH 1IQHA 1DLKB 1GI4A 1UTLM 2OUAA 3LDXH 3VFEA 1DSUA 2VNTA 4K8YA 1N8OC 1BOQA 2ZHFH 3SU0A 1BUIA 1GMHG 1QA0A 1YCPK 1K21H 2FOEA 2ZU3A 2BY6X 1Z8RA 2BYAX 3V7TA 4B76A 2PTCE 1WCZA 2V6NA 4KP0A 4Y76A 1G32B 1HJAC 1YCPH 1IHTH 1AE8H 1GBHA 3UOPA 2LP6A 2FTLE 3ATKA 3A82A 1GI1A 3U1IB 3ZZBA 5JB8S 1OS8A 4SGBE 3TGJE 1YYY1 4YLQH 1GJBB 1K1IA 1E0FD 1W13U 1HLTH 1EZXC 2OCVB 2XBVA 1ZRKA 4RKJB 1HXFH 3VB6A 2ZDMA 1VGCC 3MU1A 2A7HA 5DN6D 1GHAG 1T8NA 1XUIA 4YOJA 1A4WH 3ZVAA 1BZXE 1DS2E 1THRH 2VVCA 6LPRA 2ZHWH 1S82A 2KCOA 5T1VA 1E79D 1C2FA 1HAXB 1WAYB 5GXPA 1VCWA 1KMHB 2V7QD 1TPOA 1YLDA 4AC9A 4AYYB 3UOUA 5GIBA 3RXCA 1TA6A 1J17T 4AZ2B 3I29A 1BTZA 3Q00A 1AUJA 3A87A 1A0JA 2TGAA 1DWDH 5KGOA 2XCFA 2ZHQH 1PJPA 2CK3D 2H9EH 1FPCH 1S5SA 1W0ZU 1C2JA 1GI0A 5EXMA 3UPEA 4CBNA 1DOJA 3RU4T 2ZHDA 1C9TA 3U98H 1KXCA 2Z9LA 1D3TB 1OWHA 3HGPA 2XC0A 3BIVH 2OBOA 1EAIA 1RS0A 3OTJE 2GDDA 4BXWA 5DO4H 4BAOB 4MTBA 5CMXH 3N7DA 5E0HA 4BTIB 2UWLA 3GY4A 3GY6A 2O8UA 3C27B 1AU8A 2ALVA 1D6RA 1TIOA 1GMHF 1QHRB 1GI2A 1BCUH 2XNDD 2BD3A 5ETXA 3F2HA 1EB2A 4CRCA 1G2LA 4FUIA 1TABE 1BTPA 3K6YA 3SU4A 2R0LA 4CRGA 2WPLS 4NFEA 3RXMA 2AGEX 3MU0A 3PO1B 4WWYA 3QTVH 3TJVA 5EPNA 3WY8A 3TH4H 2BX4A 3JZ1B 1SLXB 2ZTYA 4TY7A 3HPTB 1A0HB 1Y3WA 3SQHE 4GAWA 2UUYA 1LPZB 2A0QB 1A7SA 1TLDA 2RDEA 4FUJA 1SGFG 2NU3E 3SNAA 1XMNB 3TPIZ 2VIOA 1WXRA 3UREA 3SHCH 2KX4A 4MNYA 3MTYA 3A83A 3ZVDA 5A8XA 1PPEE 3SI4H 2HVXA 1Z8GA 1C5QA 2VIWA 4UEHH 2PKSC 2ZFTA 1ZHMA 1CBWB 1H8DH 1DWCH 2AMDA 1SQTA 3OFND 2B8OH 3GDSA 2KZ4A 3GS9A 3MMGA 3N7EA 1LQDB 1OKXA 1SLVB 2SNVA 1SQAA 3W1EA 3K6ZA 1S81A 2P8OB 1C5XB 5A0AE 4B2CA 2QXGA 5ABWA 1MAXA 3RC4A 2OC0A 2W5EA 4NSYA 3ZZ6A 2A2QH 1XX9A 2EC9H 1F0RA 3FP8E 1SI5H 4XFQA 4TPIZ 2F9NA 1OPHB 4BNRA 3A80A 4ISLA 4FUBA 1INCA 2H9HA 2PSYA 3CP7A 1DX5M 2CF9H 1C4V2 4X8TH 1P2MA 1GDNA 2BLQA 4GVUA 3A84A 4NWLA 5FPSA 1AN1E 2W7SA 1YY3A 3GY8A 3ZZ8A 1QJ6B 4X2XA 4X6NA 1SVPA 2C8WB 1NS3A 5C1XA 1YM0A 4Z6AH 2RG3A 4JZIA 4CR9A 1YPMH 1T4UH 3UUZA 1THSH 4AFZA 1P2IA 2P95A 1QRZA 3BTFE 1TOMH 3SU2A 2VGCB 1LKAA 1TBZH 1CT0E 1QCPA 3N99A 4GSOA 1EQ9A 2QYIA 1KTSB 3BTEE 1W12U 2UUJB 5A0CA 3B23B 3VGCC 2CHAB 1SGQE 4NA9H 1EXFA 4CH8B 3UNSA 1TPAE 1E36B 1GWAA 1WU1A 1GI8B 1BRAA 2A7CA 2OD3B 4DIHH 3EE7A 5K7RA 2HNTC 1V2KT 1QBNA 3RP2A 2WPHS 1XKBC 1SGFA 4ISHH 4XBBA 1MTSA 2GJGA 3VEQB 3VXFH 3DSPA 5EJZA 2BXTH 2YMSD 1SOZA 1ZJDA 2BD9A 1P57B 2WUBA 3KN2A 4CH2B 4MVNA 4O3TA 1N6XA 3UTUH 3LC3A 3TITA 1KXEA 5KEDA 1BJUA 1C2LA 1LVOA 2P3TB 3KIDU 1DVAH 5K0HA 2W26A 2C4FH 2IPQX 4MPWA 3QUMP 1AMHA 1EZUC 2NU2E 2PKAA 2Y6TA 3N7OA 2V35A 5FX6A 1GBJA 1DFPA 3EA9A 3BEIB 3SQEE 1QQUA 1WV7H 2G8TA 2KCAA 2ZPSA 3F2FA 5F53A 4K5ZA 1OYQA 5C0TA 4ZH8A 1YPGH 1AVGH 4MPUA 1TNIA 1BRCE 1MU8B 4HGCA 1LPGB 4FXGH 2UWOA 1Y59T 2XYAA 4Y7BA 3V13A 2WYJA 1BITA 2ZFRH 1RGQA 1V2PT 3U8OH 1Z8JB 2FMJA 2OC8A 2FI4E 2QE7D 4MLFB 1O39A 1HAVA 1ZMJA 3OTPA 4XOJA 3OE7D 1NO9H 2Y7XA 3SGQE 1PQAA 4VGCB 1AKSA 1S83A 4ASHA 2F9UA 3GCHB 4UDWH 2FESH 1QRWA 4A6LA 3GYMA 5EJLA 5IDKA 1UMAH 1ESTA 2ZI2H 3KL6A 1DPOA 3D23A 5GCHF 4MPXA 1TFXA 1WQVH 1MABB 1FNIA 1ZYOA 2VWLA 2ZP0H 4FUFA 1SHYA 2QY0B 2JETC 1HJ9A 2R3YA 2VIPA 3BIUH 3GOVB 5C67A 5PTPA 2R2MB 4E7NA 3LH1A 3ZVCA 3BTME 3Q3KA 2ZO3H 1T8OA 4OGXA 3M7UA 2KAIB 2AS9A 1OHHD 2KFWA 4ZROA 3R3GB 1BTHH 1SC8U 5FX5A 1O5DH 1ZMLA 3GCOA 4JZEH 2A7JA 2ZDKA 6CHAB 5T6GA 1S6LA 2O8WA 4AOQA 1ELTA 2ZNKH 3A8AA 5CHBA 1ZMNA 5C0UA 3FO8D 2WPJS 1MCVA 5SGAE 2NU1E 4B2AA 1RTKA 4XSKU 3RUOA 4U2WA 3LC5A 3M7QA 4O03A 4OM9A 3S9BA 4NZLA 1E38B 2AEIH 1DY8A 5F8ZA 3LJOA 1Z8IB 4BAKB 1SGPE 1ELFA 1ABIH 2ZU2A 1XVOA 3ODFA 5EIYA 1W14U 2TGDA 1Q31A 1ANCA 4B2BA 1SQRA 1WSSH 3BF6H 2YOLA 1C1MA 3B9FH 2Y7ZA 2AMQA 2GZ7A 2JH5D 3FN8A 3ODDA 1UVUH 2D2DA 1PPCE 3F0OA 3QK1A 2FX4A 5F8XA 1LCYA 1XUJA 3PMJA 3E1XB 4FVDA 2HWLB 1BHXB 3STJA 4CHAB 2VIQA 1GJDB 3DHKH 1TALA 1C2KA 1CHOG 3VB5A 4IN2A 2SNWA 4FVBA 3EA8A 4NA7A 1CVWH 2G5VA 2HGTH 1F0UA 4BTUB 1C5RA 1P9UA 1W8BH 3QWCH 1ZTJA 1TGTA 1BTWA 2GCTC 5GWZA 4YTAA 1O3EA 3ITIA 3UR6A 1YGCH 2V3MA 4Y10E 1H9HE 2AGGX 1NFXA 2ZGXH 2XWAA 2HVYB 3CS7A 3NUMA 1JOUB 1MTNC 1GJ7B 2XOKD 2ZCLP 2F83A 2UUKB 2WPDD 3W94A 2CGAA 4AORA 1ZOMA 2A2XH 5JYIA 4INHA 4MQAA 3AAUA 3V0XA 1C1WH 3FFGA 3O8CA 1PQ8A 3SV2H 1K1OA 2PUQH 1GMDG 1GDUA 2RA0A 1TX8A 3TK6A 4BTTB 4F49A 1HNEE 3NPSA 3UQOA 3BEUA 1QJ1B 4R0IA 1S6FA 1C4U2 4ZKSU 1QR3E 2PR3A 4JZDH 2VBCA 1ZPZA 1Y5AT 2GD4B 1P02A 4X2YA 4Y0YE 1BMAA 1P04A 3PV5A 2Q6DA 2G51A 5DG6A 4Y71A 1C5PA 1UTPA 1QZ8A 1TONA 2PHBA 2ILNA 1MTVA 1O3OA 1FY3A 5C5OA 2F9OA 1AD8H 2FODA 4H6TA 4OS7A 1K1NA 2QV1A 3WW7A 1TRYA 1GI3A 3HK3B 1P03A 1UVOA 2WPKS 3OEHD 2HLDD 1YP9A 1BMFD 1ETSH 3MQKC 3P92A 1A46H 4OGYA 3UQVA 5DP4A 3GCTG 3KHVA 5C3NA 1Z71A 4X1RU 3FVFB 1O5FH 2PWXA 1C1OA 4WH8A 4D8NA 2W3KA 3LGIA 1SOTA 1Q3XA 2JKHA 4X1PU 1S0QA 1TA2A 1U6QA 3KYFA 3LGUA 3ZZDA 3M3TA 1T8MA 1NTPA 1OXGA 4NWKA 1PYTC 1S0RA 1S84A 2AIPA 7GCHG 1GGDB 2Q1JA 1O5GH 2SFAA 3MHWU 1YC0A 1Y5BT 2RDLA 3K2UA 5GNDA 4B73A 2R2WU 1NFUA 1GJ8B 3RU4E 4X8VH 3TGIE 1GMDF 1FUJA 5DKMA 1MQ6A 1QA7A 1CSOE 1RTFB 2SGQE 1EPTB 1MD7A 2W6JD 3BN9A 2J95A 1GBMA 3EAJA 2PW8H 1O2YA 1P0SH 4ZUHA 1JRSA 3PWBA 2H5CA 4HI3A 1LVMA 3PV2A 1WDIA 1AIXH 3SJ8A 1L2EA 3E8LA 1GJ4H 1JBUH 1O33A 3S9AA 2ZDVH 1ZGIA 2OC7A 1FI8A 2J98B 1THPB 4WJG2 3BG4B 1K1JA 2HRVA 3RXFA 4XBDA 3KQDA 5HMAA 1KIGH 1SKYE 2B9LA 1IQLA 2PKAB 4K1EA 5EXLA 4CREA 1TWXB 1J8AA 1FX0B 3OYPA 4GHTA 2Y5FA 4A1TA 4PROA 4NSVA 1LKBA 4BXSA 2H2ZA 3PMAB 2XCNA 2F43B 3RDZA 1TE0A 2BDBA 4I8GA 1C1PA 3T62A 1UHBB 2QF0A 4AG2A 4B74A 1DXWA 3RXHA 1GI6A 1K28D 3PTBA 1ABJH 2SGDE 1FAXA 1C2MA 1CE5A 1QJ7B 1V2TT 2ANYA 1YPKH 1O2SA 3LH3A 1G37A 4JMYA 2BD7A 1GCTC 3EQ0H 2LELA 2OK5A 2EEKA 2ZPQA 4CRDA 1GBFA 3PB1E 3F9GA 2QN5T 4ABIA 2A4OA 4X1QU 1CA0C 1MU6B 5BRRE 3SORA 5EGMA 1S6HA 3SHAH 2QXIA 3A89A 4K60A 4ABJA 4B6FA 4DT7B 3SN8A 1LHDH 2ZG0H 4IMZA 2SGFE 2FOBA 2RCEA 1K2I1 4A92A 4RT1A 2F9BH 4IW4E 1ACBE 2HNTE 2PUXB 3RXKA 4NCYA 5DP8A 1C2HA 2BD2A 1V2LT 2FLBH 2AGIX 3A7YA 1RJXB 1AGJA 5EQSA 5EG4A 1C1UH 4LZ1H 1GPZA 4WH6A 2R3UA 5GDSH 2JH6D 2GZ8A 3V3MA 2A5KA 2PLXA 3NRLA 3NK8A 3FP7E 2XBXA 3QGNB 1YBWA 3DUXH 2ZEBA 3SZEA 1ETRH 2Z9KA 5DSFA 1KYNA 4AX9H 5A8YA 5L6NH 2BQ6B 2C8ZB 3BSQA 3Q3XA 1VKYA 1YLCA 4TPYA 3P8GA 3A7TA 1DXPA 1Z6EA 4FETA 1SGCA 2A4RA 3H5CB 1FY1A 2CN0H 5EQRA 2XBWA 7KMEH 1ARBA 2C8XB 1L4ZA 1C5ZB 1SFIA 1V6DA 1EJNA 3QX5H 5IYTA 3TLOA 4B75A 1E1RD 1OWJA 1SMFE 1AE5A 1AY6H 4XDEA 1O30A 3PWCA 3MH5A 3ZZCA 5CDFE 1QY6A 3SBKA 3TU7H 3MOCA 1V2NT 1EP6A 1KXDA 1GHBG 1BBRH 1O2HA 1RTLA 1HIAB 2EY4C 5FPTA 2VU8E 2ZKSA 2GMTC 2P93A 4HG6A 3A88A 3ATLA 3RXPA 1NU9A 1Z1IA 3LJJA 1MKXK 4FUCA 5FCRA 5JB9S 4KGAA 3SV6A 1O3CA 1Y3VA 4HFPB 3PMHB 4NA8A 5FCKA 2ANWA 4CRFA 1MKXH 3L33A 4YO9A 5DP5A 8KME2 4I8KA 1Z7KA 1D4PB 2TIOA 3EGKH 4ZHMU 1OYTH 3A8BA 2QAAA 4NIWA 3VG8A 3HKIB 4MPVA 2B0FA 1TNKA 5DP3A 3LGTA 1Z6JH 2HNTF 3SI3H 3AAVA 3DFLA 2ODYB 5LH8A 4B1TA 3OY5U 4X2VA 3RXUA 1AVWA 3KNXA 4ABGA 1GCDA 3OX7U 4YLUA 3O8RA 1F0TA 2BVRH 4D7FA 1O34A 3PMBB 3QLPH 4P02A 4DW2U 5HKKD 2FOCA 2OC1A 3DCLA 1H9LB 1WYKA 1QGFA 5A09A 2Z9JA 1QB6A 3LGYA 3ZZ3A 3SJOA 2ZFQH 1BRBE 1C2DA 1GHAF 1YF4A 2BD8A 1C5WB 1VCQA 5L30H 3KQCA 2ZU1A 3RU4D 3MO6A 5FBIA 1UCYH 4Y8ZA 2GZ9A 2ULLA 1GVLA 3EE0B 4ZXXH 3H09A 4KELA 4LOYH 1W2KH 4LXBH 5TJXA 2IJOB 2WINI 4Y8XA 4X2WA 1C5MD 3PROA 3IITA 4X6MA 2R0KA 4KTUA 5HIZA 4K1SA 3UWJH 2G55A 5HGGA 3RM2H 1SB1H 1NM6A 5E8EH 1ELCA 4A1XA 1GHBF 2L6OA 5CE1A 1C2IA 2VB0A 2ZIQH 1P2KA 1A3BH 1N8OB 3RXLA 3A86A 4TSFD 3ZZAA 1O35A 1YPHC 2BY5X 1DE7H 1T8LA 1W7GH 4WY3A 1GBAA 1LO6A 5EODA 1HJAB 3VB7A 1WTHD 2C90B 3MNXA 1TGSZ 2CXVA 3SNDA 1O2VA 2UWPA 1BTYA 4O9VA 3NXPA 1DUAA 3PM3A 1RIWC 4A7IB 1AFQC 1IQNA 1KXBA 4BANB 1EJMA 1ZTLA 4ZKNU 4OS4A 3D62A 3H7TA 1DDJA 2QF5A 3M7TA 1VGCB 4DT4A 2F9PA 1UVPA 3SYJA 3ZZ7A 2WSSD 3SOSA 5DJ7A 3E3TA 1C5OH 4JYVH 1G9IE 4F55A 2KCYA 2BD5A 3CS0A 3BTHE 2W3IA 3LONA 2SGEE 3SJKA 2FOAA 1C1SA 4JYTA 1G3EA 4R8TB 1G3DA 2WPMS 2BDCA 1MQ5A 1KDQA 2P3UB 2KR7A 1MCTA 3BTKE 1L0ZA 3FANA 3AW0A 4Q4LA 4Z0KA 1A5GH 2BLOA 3MU8A 1SL3A 4RI0A 5KECA 5FBEA 1BJVA 3FP6E 4H6SB 1OOKB 3BTTE 2QIQA 1ARCA 3PYHA 1P05A 1DICA 1KXAA 3O8DA 2TGPZ 3TJUA 3M3SA 3RXOA 1HAIH 1LHEH 2QXJA 3EA7A 3FZDA 2BVSH 4RN6A 2V0BA 5C5NA 1A1RA 3MO9A 1FQ3A 1H8ED 1QL7A 2AYWA 1OWIA 3F6UH 1XXDA 4U01A 1TOCB 1FIWA 1FJSA 3CNRA 4NIVA 1XKAC 1QRXA 1W10U 3RXVA 3VXEH 2AERH 3ZZ9A 1GI7B 2HALA 4LK4A 1F92A 1O2RA 2YMSC 3L3TA 3KQEA 4UD9H 1O5AB 2C3SA 1GG6C 2G00A 1ZSJA 3MNSA 1C5LH 1ZRBA 5DGJA 3RXBA 3U28C 2A45B 2WZQA 1TNHA 1MZDA 3MWIU 2ESTE 1IQFA 3RLYH 3BTGE 2O8TA 1OP0A 3RMNH 1HXEH 3UIRA 9LPRA 4Y7AA 1NFWA 1TBRH 3TH2H 1T7CA 1QL9A 2NU4E 1SLUB 4IBLH 2ZHEH 4H42U 1O2IA 1GJAB 3MI4A 3QZRA 4K69A 2ZFPH 1NY22 1TMUH 3ZYDA 3IG6B 1TX7A 3H7OA 2PKSB 2G52A 1C1RA 2GV6A 3U1JB 2GGVB 2Z3CA 4Q7ZA 4K1TA 1TMBH 1VZQH 1DT2A 2ZGCA 3AVZA 3T29A 2W7UA 3A7WA 1JWTA 3STIA 2J38A 1JIRA 2FIRH 4DVAU 2AH4X 4NIYA 3UWIA 3TJOA 3TK9A 4KTCA 2WV5A 1ELEE 4X6OA 3T25A 4IGDA 2K0QA 3DD2H 4A5TS 1EUFA 1L1GA 1UJ1A 2ANKH 3KEEA 3ZZ4A 1UTKA 1P01A 5FHTA 2XNIA 3ESTA 3JZ2B 1NRSH 4CBOA 2IN2A 1IHSH 1EZSC 3OU0A 3RXSA 1O36A 1UVTH 1P3EA 2P59A 3ZYEA 1DANH 2M5TA 2AMPA 2BOKA 2YNAA 3A7XA 4Y6DA 1GBEA 3RMMH 1FY8E 2BXUH 3MNBA 2FM2A 1O38A 1UTNA 3U8TH 1AB9C 5CHAC 5EPYA 4Q63A 4ZKRU 7LPRA 4I31A 1TPPA 7ESTE 5E2PA 1O2ZA 2ZA5A 1T32A 1PFXC 1ANEA 1C2GA 1Y3XA 3VGCB 2Q6FA 2J4IA 2XTTB 3TVJB 1B0FA 1V3XA 1UVSH 1E1QD 3UAIC 1DWBH 1CQQA 1CO7E 1D3PB 1A3EH 2PFEA 1WBGB 4FU7A 2O8MA 1BMNH 1ORFA 3PV4A 2OXSA 2IJD1 2ZECA 1GL0E 2VIVA 1D6WA 1O3IA 2K1QA 1J14A 2QC2A 1D3QB 1JMOH 2XWBI 3P17H 1FIZA 4ABAA 4M7GA 1NPMA 2WPIS 2BVXH 3MH6A 1HAHH 1HB0B 2FEQH 4Q80A 4SGAE 3CENA 3F1SB 1V2MT 1O5CB 1Y3UA 2FLRH 1C5UA 2VINA 1MBQA 1O3FA 3LPRA 4XD7D 4XE4A 5C1UA 5DPAA 4I32A 4TYDA 1LHGH 1O3HA 3GDUA 4E06H 1JXPA 1EAWA 5EU8A 1LTOA 1P2JA 2OQ5A 4NFFA 5LPEA 1C1VH 3F0PA 5HIYA 3SJIA 1HAOH 3PLPA 1TNJA 2Y5HA 1QNJA 2VWNA 1SG8B 1YLNA 1FN8A 2VWOA 1PPBH 3DSGA 1QB1A 2ASUB 2FDAA 5EXNA 1C4Y2 3TIUA 2ZFSA 1O31A 2ODQA 3A85A 5LPFA 1QTFA 1GHXH 3P8NA 4X8UH 1TNGA 4ZCNA 1TQ7B 2PTNA 2A32A 2OLGA 1QBOA 3EDXB 4MNVA 2EQNA 1FY5A 4ZXYH 2ODPA 4FUGA 3SU6A 2FI5E 2BHGA 2GCHG 4XRNA 1IQJA 2ZGJA 2Z94A 2OINA 4RT0A 4ZHAA 3FZZA 1GBCA 1YPLH 4AYVB 1X7AC 1NU7B 3W95A 2FI3E 2FS8A 1CHOF 2JJ2D 1B0EA 4INLA 3TGKE 1BBRE 3RM0H 5A0BA 1F2SE 3KCGH 2FO9A 3VPKA 2HPQH 2ZDNA 3L6PA 1IQMA 3UB0A 4OS1A 3ZVEA 4AFUA 2GP9B 1H8HD 4YESB 2NWNA 3PLBA 2H1UA 1P09A 8GCHG 1LDTT 1O3KA 2FOFA 1UW7A 3D49H 4I8LA 1ELAA 3MNCA 1NN6A 1KSNA 2VJ1A 1ESBA 2XC4A 2Y5GA 2VH6A 1GVZA 2PV9B 4AG1A 5DP6A 2IPHA 1O3LA 1J16A 4AFSA 2RFKC 1SGRE 3RC5A 2R9PA 2BY8X 2DE8A 3UR9A 1V2RT 4CRBA 3A8DA 4P00A 3V12A 2ALPA 8LPRA 1EKBB 1VITG 2ZPRA 1GMCG 1L1JA 3M5NA 2PGQB 4UE7H 5LPRA 3PRDA 1OWEA 2VVVA 1AVXA 4YM9A 5AHGH 4FUEA 3UNRA 3FOAA 2G81E 4ZMAH 4IC5A 5I25A 2CMYA 3S9CA 3DSOA 1AFEH 1MKWH 3ENSB 2L74A 1YPHE 3M3VA 1P9SA 3E0PB 1XUGA 1UCYE 1P2NA 3SU3A 5E2OA 2BDGA 2F91A 2THFB 4OS2A 2DE9A 1AQ7A 1O2NA 4UFEH 3RXQA 5EJ1A 3LIWA 2GCHF 2FXRA 3T27A 2P3FH 1XM1A 2GCTB 3E91A 3F2GA 1VJ9U 2H5DA 2D1JA 3GCTF 3VB4A 3GY7A 1W3CA 1AZZA 4ASUD 1TAWA 5JPMH 1NROH 3ZVBA 1SFQB 1GJ6A 2KM0A 1MTNB 1HAVB 2FP7B 3PO1C 5JBAS 2QXHA 1ZLRA 3G01A 1WTGH 2XRCA 1AKSB 1G30B 1VR1H 2XC5A 1PPHE 1KLJH 1QB9A 5AVDA 4KKDA 5JDUB 4CRAA 3UNQA 1QFKH 5IK2D 2ZU4A 4ABHA 1NT1A 2ZGHA 1MTUA 1BT7A 3MU4A 4Y0ZE 7GCHF 1TGCA 3RLWH 5A8ZA 5JBCS 3SV8A 1MMJN 1BDAA 1QURH 2ZGBH 2TGTA 4WXVA 3LGVA 4GLYA 1B7XB 1C5YB 2V3OH 4HZHA 4JCNA 4NZQA 1K0HA 2IOTA 4AB9A 1K1MA 1CBWC 5FPYA 1A61H 4GHQA 5C1YA 3RXAA 1BQYA 2EI7A 2OBQA 1SSXA 1O2LA 1ELVA 1HAGE 1SR5C 1ID5H 1O5BB 1MBMA 1A5IA 1FV9A 4MNWA 2CF8H 2P8OC 2Z3EA 4FU9A 4K2YA 1NBME 3T2NA 4WMFA 1TPSA 1ESAA 3KQ5A 4ACBA 2J34A 4TT3D 2RA3A 4UFDH 1NESE 3M36A 3BTDE 3FAOA 4I86A 2A4GA 3M35A 3RMLH 1O37A 4M9FA 1KLIH 1UTOA 2ZF0H 4K8BA 3B8JA 4B71A 3T26A 3SGAE 4BOHA 2A1DB 5GJ4B 3E90B 1PPZA 1KLTA 3DT0H 1SGIB 1LPKB 3F9EA 1OWKA 3OAAD 3QGJA 1SGTA 3SUEA 1CT2E 1BBRK 2GVFA 1C1QA 4BAMB 1FXYA 1SGYE 3GY3A 1V2QT 1T31A 2KAIA 5HM2A 2VGCC 1DSTA 1ZTKA 2SGAA 2BQWB 3PLKA 1ZSKA 1TGBA 2G5NA 2GX4A 3A8CA 1KY9A 2CHAC 1CA8B 5JBBS 1CGJE 2UUFB 1OX1A 1XXFA 1NC6A 3A7VA 1EP5A 3HK6B 4GCHG 5H4IB 2D26C 3BEFB 1O2GH 2V3HH 3IWMA 1C5NH 2GV7A 3BTQE 2Y80A 5J4QA 4ZHLU 2C93B 3ATWA 1A5HA 4J2YB 1BHXF 6ESTA 2FWWA 3SNBA 1PPFE 1ZPBA 5HYOA 1BIOA 1D9IA 1OP8A 4Q2KA 2EA3A 1ETTH 3ZV8A 1SGNE 3BTWE 2A5IA 4DURA 2HPPH 1IQGA 1O2UA 4O3UA 2ZDLA 5E0GA 1VITH 2SGPE 1K1LA 1MD8A 1O3DA 2FOMB 2VIDA 1TNLA 1BA8B 2JIZD 1GBBA 1GVKB 1UCYK 3SV9A 4DIIH 4Y8YA 3E0NB 1DUEA 4O97A 3RXGA 1C5SA 2F3CE 4LZ4B 4I33A 3SUGA 1HYLA 1EJAA 1CT4E 1Q2WA 2OQUA 3ELAH 1V2VT 3C1KA 1DITH 1GBTA 2FPZA 3UY9A 1RRKA 3NCLA 2BM2A 3A7ZA 1DY9A 2Q6GA 1UTQA 1GCTB 1YCPM 1T4VH 1G2MA 3K65B 4I8HA 2A31A 1P12E 5C94A 2Y82A 4IN1A 1GBIA 2EI6A 2ZU5A 4VGCC 2O8LA 1COWD 5EW1H 3GCHC 5TCCA 1LVBA 4QT8C 1CA0B 5FAHA 4GUXA 4MDSA 1NRNH 2F9VA 1JRTA 1FONA 2K8IA 3F3BA 2FOGA 2ZC9H 2BZ6H 1ELGA 1FPHH 5G4BA 1AO5A 1NZQH 4DCDA 3SUFA 2QA9E 1L1NA 1F7ZA 3RMOH 1EATA 3SU5A 1TX6A 4FOUC 3QO6A 2QF4A 1CGIE 1W0YH 3MH7A 2FYRA 4GCHF 4Q7XA 1AWHB 4THNH 4YOIA 1PQ5A 4MG3A 2Y81A 1HDTH 5AFYH 6CHAC 3UFAA 2G4UA 2GT8A 1EFRD 4F4OC 3K9XB 2GKVE 2ZTXA 4YT7H 4XBCA 3BV9B 3S69A 1F0SA 3GDVA 8ESTE 1GJCB 4X1SU 5E0JA 1WQSA 3NWUA 3ZVFA 2ZCHP 1HRTH 1LVYA 3I78A 2CJIA 1WUNH 1FN6A 1TQ0B 3AK5A 5A2MH 1C5VA 1O32A 1ZZZA 1CHGA 1O3PB 1MAYA 1SPJA 3MH4A 1HUTH 3S7HB 3T28A 4ISIH 4ISNA 1O5EH 2J5UA 3TNTA 4WF8A 4F48B 2AFQB 2ZDAH 4GPGA 3QN7A 3ZIAD 1O2PA 2Z7FE 4ABFA 1HCGA 1W7XH 1TGNA 2GMTB 2BTCE 4CHAC 2VVUA 5I46H 1O2QA 3NZIA 4INKA 2BQ7B 3HGNA 5GCHG 1EX3A 3MYWA 3M61U 3A81A 1SQOA 4IC6A 3I77A 1V2ST 4U32A 1W0KD 3SJ9A 5B6OA 4X6PA 2BB4A 1NBMD 3MO3A 2PSXA 2WUCA 1G3CA 2ZFFH 2TBSA 2ZCKP 4Z1MD 3D65E 4Q7YA 1WOFA 1O3MA 4NIXA 1O3NA 1EASA 1LMWB 2JDID 1HJ8A 5DP7A 3O8BA 1EPTA 4JZ1A 4YZUA 3LU9B 2GT7A 4BAQB 1C9PA 3RXRA 5DK1A 1XUHA 4IMQA 4DGJA 1RD3B 1NRPH 1O2TA 2LNCA 4FU8A 1NRRH 4TY6A 2M2AA 1E35B 1S85A 5L2ZH 5B6LA 5HM9A 2FYQA 2J98A 3ATMA 1HAZB 2QCYA 3P8FA 3WWBA 1VCPA 4B6EA 4ISOA 1HAYB 3QZQA 3NKKA 1QBVH 5AF9H 2TRMA 3RXIA 2CV3A 2D8WA 4YT6H 2OTVA 1HPGA 2ZWLH 9ESTA 4AB8A 2A4QA 2JH0D 2DUCA 3SW2B 1IQEA 4E7RG 1L4DA 2F4LA 1BRUP 1YKTA 4ZAEA 2AIQA 2BDYA 3QTOH 3P6ZB 1UTJA 3DA9B 1JIMA 1AWFH 1GHVH 1QQ4A 1UHBA 2BLVA 2BY7X 2EI8A 1O3AA 3VB3A 5JBTA 3U8RH 1MH0A 2H6MA 1BMMH 1E34B 1SLWB 1M9UA 1F5RA 4OS6A 1Z1JA 4K3JA 2GDEH 4AFQA 1F5KU 5EQQA 3OEED 1DM4B 1AZ8A 3T5FH 1LQEA 4UONA 2LPRA 1H4WA 3SGBE 1PQ7A 4FUDA 1UO6A 1C1NA 2Z6BD 1UK3A 2XW9A 1NFYA 1EOLA 1GJ5H 3M5MA 1W0JD 1XUKA 2Z9IA 3AASA 3RXJA 3P95A 3HATH 3U9AH 2ZTZA 2B7DH 2XBYA 4IS5A 2I6QA 4Y79A 1EAUA 2VH0A 1ZGVA 1OWDA 3OY6U 1UK4A 3URDA 3ZVGA 1SHHB 2QF3A 2WHXA 4AGKA 5L2YH 3SZNA 1RIWB 1AFQB 1VJAU 2FTMA 4TWWA 1ZHPA 4Y11E 1GGDC 4FUHA 1O2XA 4JZFH 2J94A 5C2ZA 1ZHRA 4I7YH 1A2CH 1O0DH 1E37B 1TYNA 3ZV9A 5T6FA 1SGEE 1V2UT 2P94A 3E6PH 3GY5A 1KXFA 1ELBA 1C5TA 3S7KB 1HBTH 1EPTC 4D7GA 2FX6A 1YPJH 3OSYA 4RSPA 5C20A 5C17A 2FOHA 5GPIB 1H8IH 3HKJB 1UK2A 4YXWD 1DWEH 4WVPE 2J92A 1IAUA 1K22H 1SBWA 1CGHA 1O2OA 2ZZUH 1YWUA 2FZZA 1TRNA 3BG4C 1ZJKA 1N6YA 3M5LA 1HIAA 5TCAA 4ZKOU 3KQBA 2QGRA 1ELDE 4I8JA 2TPIZ 3ZZ5A 1RFNA 2Z9GA 2W6ID 4DY7B 4D9QA 3WWFA 2B5TB 1MZAA 1HFDA 4A1VA 1XVMA 1J9CH 2PGBB 2BD4A 1P3CA 5J4SA 1O3JA 1GDQA 1P8VC 3LOXA 2AHME 4X1NU 2YMSB 5F03A 3GY2A 3LKWA 4AGJA 1GG6B 1GBLA 4ABEA 2BDIA 1PPGE 3BG8A 1G3BA 2STAE 4TWYA 1G36A 1AI8H 1BMLA 1GHZA 1ANDA 2BZAA 1UTMA 3PTNA 5T6DA 3R0FA 1N1LA 4JK5A 2PP6A 1IQIA 3SUDA 1FY4A 2BOHB 3KGPA 5ESTE 3F9FA 3Q76A 1O2MA 1IQKA 1P2OA 1P11E 2O9QA 3TH3H 1HGTH 2WV9A 1V2OT 1AHTH 1H9IE 1K9OE 2JETB 3PRBA 4ESTE 1SGDE 2BDAA 1IOEA 1O3BA 4E05H 2GTBA 2BY9X 1O2JA 4NG9H 4OS5A 2NU0E 2ANMH 4UFGH 2H9TH 3SU1A 2KCPA 4DG4A 2A5AA 1PYTD 1C1TA 2BX3A 3U69H 1A0LA 3TNSA 2C8YB 4MNXA 3SO3A 1D3DB 1KDQB 2HLCA 3RC6A 1XUFA 2WYGA 5EW2H 1F5LA 2BDHA 3MU5A 5HXFA 1Y3YA 1J15A 2J2UA 1DLEA 2J97A 1FMGA 1EAXA 1QL8A 5ESBA 3SV7A 1ZR0A 1CU1A 1FAKH 1MUEB 1HAPH 4ABDA 6GCHG 1LHCH 4JYUH 2ZQ1A 3QDZB 1O3GA 2VWMA 1QIXB 3GISB 1GI9B 1TRMA 1H1BA 4ABBA 3ATIA 1P10A 2J9NA 4DOQA 3DFJA 3P8OA 1MKWK 1AUTC 1AB9B 1BB0B 5CHAB 1FZZA 4ACAA 3M37A 3S0NA 4H4FA 3GICB 1EB1H 3EYDA 1Y5UT 3Q3YA 4X8SH 3TK5A 1C2EA 1EOJA 1TB6H 5BPEA 1V2JT 3URCA 3MFJA 3P70B 4DJZB 2G4TA 1K1PA 2OP9A 4J1YA 1OSSA 5T3HA 1Y8TA 1TBQH 4KTSA 3KYGA 1OP2A 3Q77A 1YPEH 1GBDA 1KTTB 3LT3A 1W11U 1RXPA 2P16A 4UFFH 2ZQ2A 1P2QA 3F9HA 5F8TA 3RXDA 5DP9A 2STBE 3AW1A 2XXLA 3KF2A 1V2WT 1FLEE 3E16B 2JJ1D 4X0WU 3M5OA 3SNCA 2YNBA 4WXIA 1BTUA 3F68H 1LHFH 2HOBA 4RKOB 1ANBA 1GHYH 1HV7A 3RXEA 1GI5A 4JK6A 4BAHB 1EZQA 5AFZH 2Z3DA 1O2WA 1MTWA 1NRQH 8GCHF 4NGAH 3FKSD 4WMDA 3LGWA 3SNEA 4D9RA 2BLWA 2I6SA 4HTCH 2BMGB 2WV4A 2FS9A 5FXLA 1ZPCA 1B5GH 1FDPA 1GL1A 5FL7D 1GJ9B 1O2KA 4CR5A 4AN7A
chains in the Genus database with same CATH topology
1TMTH 4YOGA 6GCHF 4D76A 4U30A 3GYLB 3RXTA 3GCNA 1ZSLA 5LGOA 1VITF 5EOKA 1GMCF 1P06A 4WMEA 5F6MA 1GBKA 3TJNA 1BTXA 1GHWH 1IQHA 1DLKB 1GI4A 2OUAA 1UTLM 3LDXH 3VFEA 1DSUA 2VNTA 4K8YA 1N8OC 1BOQA 2ZHFH 3SU0A 1BUIA 1GMHG 1QA0A 1YCPK 1K21H 2FOEA 2ZU3A 2BY6X 1Z8RA 2BYAX 3V7TA 4B76A 2PTCE 1WCZA 2V6NA 4KP0A 4Y76A 1G32B 1HJAC 1YCPH 1IHTH 1AE8H 1GBHA 3UOPA 2FTLE 3ATKA 3A82A 1GI1A 3U1IB 3ZZBA 5JB8S 1OS8A 4SGBE 3TGJE 1YYY1 4YLQH 1GJBB 1K1IA 1E0FD 1W13U 1HLTH 1EZXC 2OCVB 2XBVA 1ZRKA 4RKJB 1HXFH 3VB6A 2ZDMA 1VGCC 3MU1A 2A7HA 1GHAG 1T8NA 1XUIA 4YOJA 1A4WH 3ZVAA 1BZXE 1DS2E 1THRH 2VVCA 6LPRA 2ZHWH 1S82A 1HAXB 1C2FA 1WAYB 5GXPA 1VCWA 1TPOA 1YLDA 4AYYB 3UOUA 5GIBA 3RXCA 1TA6A 1J17T 4AZ2B 3I29A 1BTZA 3Q00A 1AUJA 3A87A 1A0JA 2TGAA 1DWDH 2XCFA 2ZHQH 1PJPA 2H9EH 1FPCH 1S5SA 1W0ZU 1C2JA 1GI0A 5EXMA 3UPEA 4CBNA 1DOJA 3RU4T 2ZHDA 1C9TA 3U98H 1KXCA 2Z9LA 1D3TB 1OWHA 3HGPA 2XC0A 3BIVH 2OBOA 1EAIA 1RS0A 3OTJE 2GDDA 4BXWA 5DO4H 4BAOB 4MTBA 5CMXH 5E0HA 4BTIB 2UWLA 3GY4A 3GY6A 2O8UA 3C27B 1AU8A 2ALVA 1D6RA 1TIOA 1GMHF 1QHRB 1GI2A 1BCUH 2BD3A 5ETXA 1EB2A 4CRCA 1G2LA 4FUIA 1TABE 1BTPA 3K6YA 3SU4A 2R0LA 4CRGA 2WPLS 4NFEA 3RXMA 2AGEX 3MU0A 3PO1B 4WWYA 3QTVH 3TJVA 5EPNA 3WY8A 3TH4H 2BX4A 3JZ1B 1SLXB 2ZTYA 4TY7A 3HPTB 1A0HB 1Y3WA 3SQHE 4GAWA 2UUYA 1LPZB 2A0QB 1A7SA 1TLDA 4FUJA 1SGFG 2NU3E 3SNAA 1XMNB 3TPIZ 2VIOA 3UREA 3SHCH 4MNYA 3MTYA 3A83A 3ZVDA 5A8XA 1PPEE 3SI4H 2HVXA 1Z8GA 1C5QA 2VIWA 4UEHH 2PKSC 2ZFTA 1ZHMA 1CBWB 1H8DH 1DWCH 2AMDA 1SQTA 2B8OH 3GDSA 3MMGA 1LQDB 1OKXA 1SLVB 2SNVA 1SQAA 3K6ZA 1S81A 2P8OB 1C5XB 5A0AE 4B2CA 2QXGA 5ABWA 1MAXA 3RC4A 2OC0A 2W5EA 4NSYA 3ZZ6A 2A2QH 1XX9A 2EC9H 1F0RA 3FP8E 1SI5H 4XFQA 4TPIZ 2F9NA 1OPHB 4BNRA 3A80A 4ISLA 4FUBA 1INCA 2H9HA 2PSYA 3CP7A 1DX5M 2CF9H 1C4V2 4X8TH 1P2MA 1GDNA 2BLQA 4GVUA 3A84A 4NWLA 5FPSA 1AN1E 2W7SA 3GY8A 3ZZ8A 1QJ6B 4X2XA 4X6NA 1SVPA 2C8WB 1NS3A 5C1XA 1YM0A 4Z6AH 2RG3A 4JZIA 4CR9A 1YPMH 1T4UH 3UUZA 1THSH 4AFZA 1P2IA 2P95A 1QRZA 3BTFE 1TOMH 3SU2A 2VGCB 1LKAA 1TBZH 1CT0E 1QCPA 4GSOA 1EQ9A 2QYIA 1KTSB 3BTEE 1W12U 2UUJB 5A0CA 3B23B 3VGCC 2CHAB 1SGQE 4NA9H 1EXFA 4CH8B 3UNSA 1TPAE 1E36B 1GWAA 1WU1A 1GI8B 1BRAA 2A7CA 2OD3B 4DIHH 5K7RA 2HNTC 1V2KT 1QBNA 3RP2A 2WPHS 1XKBC 1SGFA 4ISHH 4XBBA 1MTSA 3VEQB 3VXFH 2BXTH 1SOZA 1ZJDA 2BD9A 1P57B 2WUBA 3KN2A 4CH2B 4MVNA 4O3TA 1N6XA 3UTUH 3LC3A 3TITA 1KXEA 1BJUA 1C2LA 1LVOA 2P3TB 3KIDU 1DVAH 5K0HA 2W26A 2C4FH 4MPWA 3QUMP 1AMHA 1EZUC 2NU2E 2PKAA 2Y6TA 3N7OA 2V35A 5FX6A 1GBJA 1DFPA 3EA9A 3BEIB 3SQEE 1QQUA 1WV7H 2G8TA 2ZPSA 4K5ZA 1OYQA 4ZH8A 1YPGH 1AVGH 4MPUA 1TNIA 1BRCE 1MU8B 4HGCA 1LPGB 4FXGH 2UWOA 1Y59T 2XYAA 4Y7BA 3V13A 2WYJA 1BITA 2ZFRH 1RGQA 1V2PT 3U8OH 1Z8JB 2FMJA 2OC8A 2FI4E 4MLFB 1O39A 1HAVA 1ZMJA 4XOJA 1NO9H 2Y7XA 3SGQE 1PQAA 4VGCB 1AKSA 1S83A 4ASHA 2F9UA 3GCHB 4UDWH 2FESH 1QRWA 4A6LA 3GYMA 5IDKA 1UMAH 1ESTA 2ZI2H 3KL6A 1DPOA 3D23A 5GCHF 4MPXA 1TFXA 1WQVH 1ZYOA 1FNIA 2VWLA 2ZP0H 4FUFA 1SHYA 2QY0B 2JETC 1HJ9A 2R3YA 2VIPA 3BIUH 3GOVB 5C67A 5PTPA 2R2MB 4E7NA 3LH1A 3ZVCA 3BTME 3Q3KA 2ZO3H 1T8OA 4OGXA 3M7UA 2KAIB 2AS9A 4ZROA 3R3GB 1BTHH 1SC8U 5FX5A 1O5DH 1ZMLA 3GCOA 4JZEH 2A7JA 2ZDKA 6CHAB 5T6GA 2O8WA 4AOQA 1ELTA 2ZNKH 3A8AA 1ZMNA 2WPJS 1MCVA 5SGAE 2NU1E 4B2AA 1RTKA 4XSKU 3RUOA 4U2WA 3LC5A 3M7QA 4O03A 3S9BA 4NZLA 1E38B 2AEIH 1DY8A 5F8ZA 3LJOA 1Z8IB 4BAKB 1SGPE 1ELFA 1ABIH 2ZU2A 1XVOA 3ODFA 1W14U 2TGDA 1Q31A 1ANCA 4B2BA 1WSSH 3BF6H 2YOLA 1C1MA 3B9FH 2Y7ZA 2AMQA 2GZ7A 2JH5D 3ODDA 1UVUH 2D2DA 1PPCE 3QK1A 2FX4A 5F8XA 1LCYA 1XUJA 3PMJA 3E1XB 4FVDA 2HWLB 1BHXB 3STJA 4CHAB 2VIQA 1GJDB 3DHKH 1TALA 1C2KA 1CHOG 3VB5A 4IN2A 2SNWA 4FVBA 3EA8A 4NA7A 1CVWH 2G5VA 2HGTH 1F0UA 4BTUB 1C5RA 1P9UA 1W8BH 3QWCH 1ZTJA 1TGTA 1BTWA 2GCTC 5GWZA 4YTAA 1O3EA 3ITIA 3UR6A 1YGCH 4Y10E 1H9HE 2AGGX 1NFXA 2ZGXH 2XWAA 3CS7A 3NUMA 1JOUB 1MTNC 1GJ7B 2ZCLP 2F83A 2UUKB 3W94A 2CGAA 4AORA 1ZOMA 2A2XH 5JYIA 4INHA 4MQAA 3AAUA 3V0XA 1C1WH 3FFGA 3O8CA 1PQ8A 3SV2H 1K1OA 2PUQH 1GMDG 1GDUA 2RA0A 1TX8A 3TK6A 4BTTB 4F49A 1HNEE 3NPSA 3UQOA 3BEUA 1QJ1B 4R0IA 1S6FA 1C4U2 4ZKSU 1QR3E 2PR3A 4JZDH 1ZPZA 1Y5AT 2GD4B 1P02A 4X2YA 4Y0YE 1BMAA 1P04A 2Q6DA 2G51A 5DG6A 4Y71A 1C5PA 1UTPA 1TONA 2PHBA 2ILNA 1MTVA 1O3OA 1FY3A 5C5OA 2F9OA 1AD8H 2FODA 4H6TA 4OS7A 1K1NA 2QV1A 1TRYA 1GI3A 3HK3B 1P03A 1UVOA 2WPKS 1YP9A 1ETSH 3P92A 1A46H 4OGYA 3UQVA 5DP4A 3GCTG 3KHVA 5C3NA 1Z71A 4X1RU 3FVFB 1O5FH 2PWXA 1C1OA 4WH8A 4D8NA 2W3KA 3LGIA 1SOTA 1Q3XA 2JKHA 4X1PU 1S0QA 1TA2A 1U6QA 3LGUA 3ZZDA 3M3TA 1T8MA 1NTPA 1OXGA 4NWKA 1PYTC 1S0RA 1S84A 2AIPA 7GCHG 1GGDB 2Q1JA 1O5GH 2SFAA 3MHWU 1YC0A 1Y5BT 2RDLA 3K2UA 4B73A 2R2WU 1NFUA 1GJ8B 3RU4E 4X8VH 3TGIE 1GMDF 1FUJA 5DKMA 1MQ6A 1QA7A 1CSOE 1RTFB 2SGQE 1EPTB 1MD7A 3BN9A 2J95A 1GBMA 3EAJA 2PW8H 1O2YA 1P0SH 4ZUHA 1JRSA 3PWBA 2H5CA 4HI3A 1LVMA 1AIXH 3SJ8A 1L2EA 3E8LA 1GJ4H 1JBUH 1O33A 3S9AA 2ZDVH 1ZGIA 2OC7A 1FI8A 1THPB 4WJG2 3BG4B 1K1JA 2HRVA 3RXFA 4XBDA 3KQDA 5HMAA 1KIGH 2B9LA 1IQLA 2PKAB 4K1EA 5EXLA 4CREA 1TWXB 1J8AA 3OYPA 4GHTA 2Y5FA 4A1TA 4PROA 4NSVA 1LKBA 4BXSA 2H2ZA 3PMAB 2XCNA 3RDZA 1TE0A 2BDBA 4I8GA 1C1PA 3T62A 1UHBB 2QF0A 4AG2A 4B74A 1DXWA 3RXHA 1GI6A 1K28D 3PTBA 1ABJH 2SGDE 1FAXA 1C2MA 1CE5A 1QJ7B 1V2TT 2ANYA 1YPKH 1O2SA 3LH3A 1G37A 4JMYA 2BD7A 1GCTC 3EQ0H 2EEKA 2ZPQA 4CRDA 1GBFA 3PB1E 3F9GA 2QN5T 4ABIA 2A4OA 4X1QU 1CA0C 1MU6B 5BRRE 3SORA 5EGMA 1S6HA 3SHAH 2QXIA 3A89A 4K60A 4ABJA 4DT7B 3SN8A 1LHDH 2ZG0H 4IMZA 2SGFE 2FOBA 2RCEA 1K2I1 4A92A 2F9BH 4IW4E 1ACBE 2HNTE 2PUXB 3RXKA 4NCYA 5DP8A 1C2HA 2BD2A 1V2LT 2FLBH 2AGIX 3A7YA 1RJXB 1AGJA 5EQSA 5EG4A 1C1UH 4LZ1H 1GPZA 4WH6A 2R3UA 5GDSH 2JH6D 2GZ8A 3V3MA 2A5KA 2PLXA 3NK8A 3FP7E 2XBXA 3QGNB 1YBWA 3DUXH 2ZEBA 4AX9H 1ETRH 2Z9KA 5A8YA 1KYNA 5L6NH 2BQ6B 2C8ZB 3BSQA 3Q3XA 1YLCA 4TPYA 3P8GA 3A7TA 1DXPA 1Z6EA 1SGCA 2A4RA 3H5CB 1FY1A 2CN0H 5EQRA 2XBWA 7KMEH 1ARBA 2C8XB 1L4ZA 1C5ZB 1SFIA 1V6DA 1EJNA 3QX5H 5IYTA 3TLOA 4B75A 1OWJA 1SMFE 1AE5A 1AY6H 4XDEA 1O30A 3PWCA 3MH5A 3ZZCA 1QY6A 3SBKA 3TU7H 3MOCA 1V2NT 1EP6A 1KXDA 1GHBG 1BBRH 1O2HA 1RTLA 1HIAB 5FPTA 2VU8E 2ZKSA 2GMTC 2P93A 3A88A 3ATLA 3RXPA 1NU9A 1Z1IA 3LJJA 1MKXK 4FUCA 5FCRA 5JB9S 4KGAA 3SV6A 1O3CA 1Y3VA 4HFPB 3PMHB 4NA8A 5FCKA 2ANWA 4CRFA 1MKXH 3L33A 4YO9A 5DP5A 8KME2 4I8KA 1Z7KA 1D4PB 2TIOA 3EGKH 4ZHMU 1OYTH 3A8BA 2QAAA 4NIWA 3HKIB 4MPVA 2B0FA 1TNKA 5DP3A 3LGTA 1Z6JH 2HNTF 3SI3H 3AAVA 3DFLA 2ODYB 5LH8A 4B1TA 3OY5U 4X2VA 3RXUA 1AVWA 3KNXA 4ABGA 1GCDA 3OX7U 4YLUA 3O8RA 1F0TA 2BVRH 4D7FA 1O34A 3PMBB 3QLPH 4DW2U 2FOCA 2OC1A 1H9LB 1WYKA 1QGFA 5A09A 2Z9JA 1QB6A 3LGYA 3ZZ3A 3SJOA 2ZFQH 1BRBE 1C2DA 1GHAF 1YF4A 2BD8A 1C5WB 1VCQA 5L30H 3KQCA 2ZU1A 3RU4D 3MO6A 5FBIA 1UCYH 4Y8ZA 2GZ9A 2ULLA 1GVLA 3EE0B 4ZXXH 4KELA 4LOYH 5TJXA 1W2KH 4LXBH 2IJOB 2WINI 4Y8XA 4X2WA 1C5MD 3PROA 3IITA 4X6MA 2R0KA 4KTUA 4K1SA 3UWJH 2G55A 5HGGA 3RM2H 1SB1H 1NM6A 5E8EH 1ELCA 4A1XA 1GHBF 5CE1A 1C2IA 2VB0A 2ZIQH 1P2KA 1A3BH 1N8OB 3RXLA 3A86A 3ZZAA 1O35A 1YPHC 2BY5X 1DE7H 1T8LA 1W7GH 4WY3A 1GBAA 1LO6A 5EODA 1HJAB 3VB7A 1WTHD 2C90B 3MNXA 1TGSZ 2CXVA 3SNDA 1O2VA 2UWPA 1BTYA 4O9VA 3NXPA 1DUAA 3PM3A 1RIWC 4A7IB 1AFQC 1IQNA 1KXBA 4BANB 1EJMA 1ZTLA 4ZKNU 4OS4A 3D62A 3H7TA 1DDJA 3M7TA 1VGCB 2F9PA 1UVPA 3ZZ7A 3SOSA 5DJ7A 3E3TA 1C5OH 4JYVH 1G9IE 2BD5A 3CS0A 3BTHE 2W3IA 3LONA 2SGEE 3SJKA 2FOAA 1C1SA 4JYTA 1G3EA 4R8TB 1G3DA 2WPMS 2BDCA 1MQ5A 1KDQA 2P3UB 1MCTA 3BTKE 1L0ZA 3FANA 3AW0A 4Z0KA 1A5GH 2BLOA 3MU8A 1SL3A 5FBEA 1BJVA 3FP6E 4H6SB 1OOKB 3BTTE 2QIQA 1ARCA 3PYHA 1P05A 1DICA 1KXAA 3O8DA 2TGPZ 3TJUA 3M3SA 3RXOA 1HAIH 1LHEH 2QXJA 3EA7A 3FZDA 2BVSH 4RN6A 2V0BA 5C5NA 1A1RA 3MO9A 1FQ3A 1QL7A 2AYWA 1OWIA 3F6UH 1XXDA 4U01A 1TOCB 1FIWA 1FJSA 4NIVA 1XKAC 1QRXA 1W10U 3RXVA 3VXEH 2AERH 3ZZ9A 1GI7B 2HALA 4LK4A 1F92A 1O2RA 3L3TA 3KQEA 4UD9H 1O5AB 2C3SA 1GG6C 2G00A 1ZSJA 3MNSA 1C5LH 1ZRBA 5DGJA 3RXBA 2A45B 1TNHA 1MZDA 3MWIU 2ESTE 1IQFA 3RLYH 3BTGE 2O8TA 1OP0A 3RMNH 1HXEH 3UIRA 9LPRA 4Y7AA 1NFWA 1TBRH 3TH2H 1T7CA 1QL