2QV1A

Crystal structure of hcv ns3-4a v36m mutant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
151
structure length
151
Chain Sequence
VEGEVQIMSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords NS3
publication title Phenotypic and Structural Analyses of HCV NS3 Protease Val36 Variants
rcsb
source organism Hepatitis c virus
total genus 35
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qv1A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2qv1A01
2GDEH 1YCPM 1VCWA 3SYJA 2WHXA 1MKXK 3GY4A 3QK1A 2G00A 3T5FH 3ZZ7A 1G3CA 1NRNH 1XXDA 3M3TA 8KME2 4IW4E 1G3DA 3SI3H 4UD9H 1GHZA 5C1XA 1F0RA 3AW0A 2RDLA 4MVNA 1TQ7B 3EAJA 1GHBF 1Z6EA 2ZIQH 3SNAA 4BOHA 1GI8B 1RS0A 1HXEH 5T6GA 1THRH 1Z8IB 2WYGA 2AMPA 2J9NA 1P8VC 2ZHFH 1UO6A 3UNRA 1HAPH 3R0FA 3O8DA 1SPJA 1XX9A 4K2YA 3RC5A 3ZVEA 1SFQB 3RLWH 1AN1E 1TX8A 2HGTH 4OGYA 5FPTA 3GCTF 1PPGE 1E0FD 1PQ5A 4JZEH 1RRKA 1TRMA 2ZDKA 1D4PB 2Y5GA 1GMHF 3LJJA 4AGKA 4TYDA 2XRCA 4FXGH 5DPAA 3GDVA 2SGEE 1GGDB 1QTFA 1GBDA 5G4BA 3M5NA 3ZZCA 3P92A 1BRAA 1A7SA 1OP0A 1G36A 1NN6A 1ARBA 1G9IE 4XBBA 3RXQA 2ZHDA 3QUMP 1TMUH 2XXLA 1QIXB 2JETB 2ODQA 1QBNA 2TBSA 4AZ2B 2ZU2A 2YNBA 2ZFRH 3QGNB 1V2QT 1AWFH 1MCTA 1QQ4A 1XUGA 3N7OA 3BTME 1K1OA 2QA9E 1P04A 1MTNC 2CF9H 2QXHA 5F03A 5FCKA 2ULLA 4X8VH 1O2XA 1P9UA 1PQ7A 3P17H 3H7TA 2XC4A 3BIVH 1O34A 2D1JA 1O3JA 4B73A 1GBAA 4ISHH 4E7RG 6GCHF 1TPPA 1DITH 3OX7U 1S83A 4I8HA 1TMBH 1DVAH 2G5VA 1SLXB 4GUXA 1MD8A 3BTHE 1FLEE 1Y5AT 5EXNA 3V7TA 1GWAA 4CRCA 3SNDA 1O3KA 4LZ4B 2R0LA 4B74A 1DDJA 1DWDH 1KY9A 4ZROA 3RXKA 4VGCB 5TCCA 4RKJB 3RMOH 3URCA 2BOKA 1V2LT 5JYIA 1NS3A 2GV7A 1IOEA 1GJCB 2V0BA 2ZKSA 2R0KA 1Z1JA 3MYWA 2ZF0H 3GY2A 3ATLA 1TGTA 1TAWA 1TNKA 1BRUP 2Q6FA 3KGPA 2ZG0H 3RU4D 4FUIA 1E34B 4TWWA 1CBWB 1TNHA 1XUHA 1EP5A 3HGNA 4TY7A 2G52A 1LKBA 1TBRH 4DG4A 2VIWA 2HNTF 1GJ4H 1SGEE 1C5WB 2FLBH 1O3FA 1VGCB 1SGQE 2EA3A 2GKVE 4R0IA 1Z8JB 1F7ZA 1AWHB 3GY8A 2ZFFH 2VBCA 1FDPA 4B6EA 2BZ6H 3QO6A 1IQEA 4GCHG 3MNSA 1CT4E 4ZHMU 1H1BA 1MTVA 2O8WA 1C2HA 3P70B 3SGAE 3RXBA 1QL8A 2HLCA 1V2ST 2XC5A 5H4IB 1Q3XA 1QQUA 2ZDNA 2Z3DA 2ZTXA 2GX4A 4MG3A 1O5CB 2C8ZB 2BVRH 5FPSA 2C93B 1AKSA 2GDDA 2JH6D 1WTGH 1HAIH 1LVMA 4I31A 4AFZA 4O3TA 1V2NT 1KTSB 4YOIA 2QF0A 7KMEH 4E7NA 1U6QA 4YOJA 4YLQH 2A31A 3BTTE 1O2MA 1Y3WA 1YF4A 1UTKA 4NZLA 4BAKB 3E16B 1H9LB 2A0QB 1OWJA 1XKAC 3QLPH 3TH4H 9ESTA 2A32A 2YOLA 3P8NA 2WV9A 1PPHE 1ELBA 1GJ8B 5EPYA 1ZJDA 2Z9IA 2J34A 1CU1A 2VGCB 3F6UH 1YC0A 5DG6A 1FY3A 4K8BA 1KXCA 4JYVH 1SB1H 1P2KA 3KF2A 1BITA 1E36B 1BMNH 3M7QA 5C1YA 6CHAB 2A5KA 1AFQC 1GBCA 8ESTE 1P9SA 1J16A 1TPOA 3UWJH 4BAMB 5K0HA 1GJAB 1TONA 2GV6A 3RXOA 2W7SA 3NPSA 1HAVB 6ESTA 1EAXA 1W13U 1TALA 5T3HA 2A5IA 1S0QA 3K2UA 2BM2A 1A61H 1GG6C 1O32A 1WYKA 4GVUA 3UPEA 4B2CA 1ZOMA 3D62A 2GCTC 1Q31A 3SJKA 1J14A 3ZYEA 2H9EH 1KXEA 1Z6JH 3MNXA 1SG8B 1TOMH 1QNJA 5C3NA 4Y79A 3ODFA 4ZKSU 1LVOA 7GCHF 5LGOA 5K7RA 2FYRA 4ESTE 4ZXYH 4Q7XA 5HMAA 3ENSB 1MQ6A 1P2IA 1SGFG 2CHAC 1GJDB 3SQEE 1HYLA 4LK4A 3BEFB 4HFPB 3RXTA 4A92A 3MTYA 1B0EA 1W14U 1UMAH 4JMYA 2VIPA 4HTCH 1EUFA 1TLDA 2FO9A 3STIA 3H5CB 1ETRH 4NWKA 5LPEA 1TGCA 4OGXA 5JDUB 2OC7A 2WUCA 3B9FH 4DW2U 7ESTE 4MPWA 1V2TT 5DKMA 4NA9H 1TE0A 1ETSH 1VITG 2ZQ1A 2FXRA 1NTPA 2C8YB 2KAIB 3QTOH 1EAIA 3E0PB 2PKAB 5EU8A 1MU6B 1PPCE 1O2JA 4AGJA 2GT7A 3RP2A 3ZZ5A 1GHVH 1HAHH 1XUJA 1HJAC 2SGDE 3UOPA 4BXSA 4JZDH 2A7JA 2ZU1A 2BD2A 2ZC9H 1TOCB 1DXPA 2QF3A 4NGAH 3TLOA 2H9TH 3MH5A 4NSVA 2NWNA 2BDHA 2P59A 2FP7B 3BTDE 3SUGA 1JIMA 1V2KT 3SU2A 5L2YH 5EW2H 5FXLA 1GJ5H 4UFFH 1ABIH 1K21H 1O3HA 3F9FA 3FZZA 3ELAH 2OC8A 1LQEA 1HBTH 1HDTH 2FWWA 3GY7A 4INLA 2C4FH 1O2GH 1XKBC 3ZVDA 1ZHMA 2XBXA 4YO9A 1BJUA 2SFAA 4Y71A 4IGDA 1WV7H 3UNQA 3BTGE 3SJIA 2TRMA 1RFNA 3SNBA 4B6FA 4WJG2 2Y80A 1C5QA 1MKWH 3WY8A 1C5SA 1O5BB 1MH0A 4Z6AH 2QN5T 1CGIE 1FY8E 4YTAA 3MH7A 4YLUA 4D76A 1F5RA 3BSQA 1P09A 1ESBA 2ZQ2A 1C1TA 3PLKA 2RCEA 1O2ZA 3A83A 4I8LA 2G8TA 2VNTA 1GVZA 3A7TA 4GLYA 3W95A 3M7TA 3LONA 4Q7YA 3RXLA 2VINA 1C5TA 1DXWA 2VVVA 1SQTA 1EQ9A 1A0HB 1IQFA 2C3SA 3T62A 2ZGCA 1EJMA 3ZZ3A 1BOQA 4A7IB 3ZZ4A 2QXIA 3VB5A 1GDQA 5LPFA 2CMYA 1AMHA 5BPEA 2RA0A 4AORA 2BLVA 4E06H 1WUNH 2OP9A 1XXFA 1PFXC 1OWDA 1ZPCA 1ELCA 3S7HB 1O31A 2IPHA 3TPIZ 2WPKS 2Q6GA 1EZQA 1AE5A 1T4UH 1K28D 1O2OA 3QZQA 1GI4A 2Z3CA 4DIHH 1EKBB 1HCGA 2ZGJA 4NFFA 1AIXH 3L6PA 4JYTA 1HRTH 3EQ0H 1O39A 1L1JA 1SMFE 3RXIA 1GBIA 3NUMA 2ZU4A 3U8OH 2V3HH 3MO3A 3BTKE 1RTFB 5A8XA 4GSOA 4ABGA 4WXVA 1HAVA 2THFB 1Y3VA 4JCNA 4CR5A 2GTBA 1K1LA 5C1UA 3RLYH 3AVZA 3RXSA 1XM1A 1O5FH 3I78A 1BMMH 1CHOG 5EQQA 2PKSB 1V2PT 1TNJA 1O3BA 4Y8XA 1DICA 1PJPA 1ZSLA 1YCPK 1ANDA 3MI4A 1C5MD 2NU2E 2FYQA 4WVPE 4A6LA 1D3PB 1TNGA 3GY6A 4NCYA 1V2RT 1DLEA 2M5TA 3A82A 4GCHF 3HKJB 5E0JA 5EG4A 1BTYA 1V3XA 5L2ZH 4O03A 4J2YB 1ELFA 3K6YA 1HAZB 3TK9A 3LGWA 2A4RA 1PYTD 1ZGVA 3OSYA 2ASUB 3V12A 1RIWC 2ANYA 3D49H 4Y0YE 1EASA 3VGCB 5J4QA 1ZTLA 4OS6A 1NRRH 4X1SU 3S9BA 4CR9A 5C20A 1G2LA 3PWBA 3TJOA 1T8NA 1ZSJA 1IQNA 1XUFA 1UJ1A 4YT7H 4CH2B 4WMDA 1THSH 1L2EA 4X1RU 5L6NH 1WQSA 4SGAE 3P95A 2BDBA 2UUJB 1O36A 1C2DA 1C5UA 1W8BH 2QCYA 3BG8A 1UHBA 3PMBB 5A09A 4SGBE 1RJXB 3RMLH 2KAIA 3SI4H 1KLTA 4UE7H 5I46H 2OBOA 2PKAA 2ZCKP 1DLKB 1FPCH 2SGFE 5JBAS 4K8YA 2FOHA 4AYYB 1YPHC 3SU0A 1QRXA 2BLWA 3OY5U 3RXEA 1GBLA 1QJ1B 4LZ1H 2GGVB 1BA8B 1C1VH 2C8XB 2OTVA 3SV2H 1TGBA 2PTCE 5L30H 2W26A 1YYY1 1C5VA 1ORFA 1MKWK 3NWUA 1C5NH 1DUAA 1AY6H 1C5YB 2K1QA 3KHVA 3U98H 2F83A 2OXSA 2FTMA 1H9HE 3O8RA 3A7VA 3LT3A 3ZZDA 1C5RA 3DFJA 1UTOA 2ALVA 2EI8A 2Y7ZA 2EC9H 3MNCA 4CRFA 4AB8A 1N6XA 1PYTC 3TH3H 2ZNKH 2FOEA 4IMZA 1CA8B 3FVFB 3DA9B 1EB1H 1VZQH 4JZ1A 4KTCA 1TMTH 3A8AA 3MO6A 1YLCA 1YPEH 1QRZA 3SNCA 3M7UA 1T8MA 2WUBA 4MLFB 1O3MA 3E6PH 3HK3B 5DP9A 3ZZ8A 2P93A 2AGGX 2ZP0H 4DIIH 3G01A 2BY6X 3RXHA 2HNTE 3OYPA 2ZI2H 1XUIA 1JOUB 4R8TB 2F91A 2ODYB 1W2KH 1O35A 3RU4T 2CN0H 1AE8H 1TRNA 3UFAA 1GI2A 1ELDE 3FP7E 3RXPA 2O8UA 3AW1A 1ELEE 2B7DH 4X0WU 4AFSA 3SN8A 4BNRA 1UCYE 4F4OC 4GHTA 1T32A 4Y76A 3MHWU 3UREA 4CRGA 1E35B 4XSKU 1V2VT 3RDZA 2Z3EA 4E05H 2Y5FA 2BD8A 1VITF 1V2UT 1Y5UT 2BDGA 4ABHA 4YOGA 2A7CA 3NCLA 2F9VA 1DM4B 5FCRA 5A2MH 1LVYA 1C1OA 1KYNA 4Y7AA 4OS5A 1J17T 3SNEA 1P2OA 1NRPH 3GISB 4AG1A 2BQWB 5JPMH 4FU9A 3QGJA 1EPTB 1ZPBA 2A4GA 3TGIE 2LPRA 1K1MA 4ZHLU 1CO7E 2BYAX 1V2JT 3PTNA 3M5MA 1AI8H 1SGPE 1XMNB 2ZU3A 2FOGA 1GVKB 1F5LA 1O2KA 1C4U2 1EX3A 3Q00A 4M7GA 4DVAU 1CA0C 1KLIH 3QN7A 2BZAA 1P2NA 2FPZA 4KKDA 4OS7A 4DURA 5CHAC 1Q2WA 5F8TA 3A8CA 3MU0A 1LVBA 1BRBE 2R9PA 3A88A 2TGPZ 1QURH 5GWZA 1DX5M 2A45B 1GCTC 1NM6A 4ABJA 2VIVA 2O9QA 1AZZA 5A8ZA 3ATKA 1ELAA 1P0SH 2V6NA 3V3MA 2QXJA 3U8RH 1SGCA 1H9IE 1C9TA 2DE8A 5EGMA 3RXUA 3TVJB 2F9NA 2XCFA 3IITA 4ZHAA 1GBFA 1W0ZU 1GI3A 3D23A 1OWIA 1O2HA 2HOBA 1AFQB 4ZUHA 2AFQB 1N8OC 1TPAE 1IQHA 1W12U 2V3OH 4BXWA 3RC6A 2QAAA 1MTUA 3SV9A 2BXUH 3LGUA 1T8LA 4FVBA 5GJ4B 2WINI 2PW8H 3Q77A 1OYQA 1UVUH 4NWLA 3S0NA 3KQCA 5IYTA 1GBBA 3T25A 1S85A 4JZFH 1GG6B 1VCQA 2STAE 1INCA 5FX6A 3ATMA 1MAYA 3P8OA 3K6ZA 1DWBH 4AG2A 2GCTB 2QXGA 4QT8C 5HM9A 1DY9A 1O5AB 2BX3A 1W0YH 3BG4B 1WSSH 2HALA 3CS7A 2A2QH 5LH8A 2V35A 1C2IA 3HPTB 1S81A 4CRBA 1CVWH 1GHXH 1C9PA 4ZKOU 1Y8TA 4ABEA 3BTQE 3O8BA 3LKWA 4FU8A 1GGDC 1K22H 1O2LA 1EOJA 3IWMA 1SQAA 2ANWA 3E1XB 4X6OA 1KDQB 5A8YA 6LPRA 2HVXA 2XNIA 1MAXA 3M5OA 4K3JA 2W7UA 1A46H 7LPRA 1ESAA 1GI6A 1C5PA 1DANH 1J8AA 3UOUA 3MU8A 2XW9A 1TFXA 3A81A 3HGPA 3NKKA 1AGJA 1BTHH 3ZV8A 1ZRBA 1LHCH 3QWCH 1SLUB 3EA8A 2Z9LA 3UR6A 1CHOF 2OUAA 5FHTA 1UCYK 4ZKRU 2BD7A 1YP9A 4YT6H 4FUJA 2ALPA 1D3TB 3ZZ6A 3UY9A 4Y6DA 3LC3A 1C2MA 1TRYA 4B1TA 3RXMA 2ZHQH 1HV7A 2EEKA 1B5GH 2WV4A 1H8DH 2FI4E 1O2WA 4MNYA 4NIWA 4Y8ZA 3ZZAA 4U32A 1AB9B 2BY5X 4ZMAH 3PMHB 4FUFA 2C90B 3TH2H 3K9XB 3ZVFA 1MZDA 1EJNA 2OC1A 1Z8RA 1C1NA 4VGCC 1HAXB 1NT1A 3ATIA 3VXEH 3VFEA 4PROA 1HAGE 1O3OA 4MDSA 1A5HA 1FY4A 2H2ZA 4CBNA 4B71A 1NRSH 4B76A 1C2LA 4CHAB 5E2PA 1OWHA 1KSNA 3JZ2B 3SQHE 2Z9GA 1NC6A 1K2I1 1KXBA 3GYLB 4H42U 3NZIA 4K1TA 3U69H 4H6SB 2WPLS 1BTPA 2ZCLP 3PO1B 2QC2A 2ZPSA 8GCHG 1Z1IA 2H6MA 1P57B 1RTLA 5T6DA 5JBTA 1SGNE 2BB4A 1AUJA 3W94A 4A5TS 1UTQA 1AUTC 1A2CH 4NG9H 1HJ8A 1VGCC 1Z8GA 1EPTA 1TNIA 2WPHS 2H1UA 3GOVB 1F5KU 4NSYA 1MBQA 3RXGA 1C2GA 2BY8X 1KLJH 1EATA 1FNIA 4CREA 3KIDU 2W5EA 2TGDA 2FOCA 1GMDG 1SOTA 1AZ8A 1EZXC 3EGKH 4XFQA 1OP8A 3SJ9A 1ZSKA 2F9PA 1DOJA 1YCPH 1PQAA 4BAOB 2D8WA 2VWNA 3SV6A 5FX5A 1O33A 3LH1A 1UTMA 3EA7A 3HKIB 4JK6A 3RM0H 4X6PA 1E37B 1GI5A 5J4SA 1C2JA 1VJ9U 5EXMA 3H7OA 2FLRH 1BTUA 1TA2A 3A84A 3BTEE 3SU4A 1HJ9A 1Y3XA 4I8JA 2LNCA 2ZTYA 5DP7A 1D6RA 1HAOH 4FVDA 1DS2E 4X1PU 1QCPA 1RD3B 3L3TA 4Y11E 3GY5A 2JH0D 4GPGA 2NU3E 1OYTH 2Q6DA 1E38B 4HZHA 5F8XA 3RXCA 3QZRA 3V13A 1PPFE 1G32B 2UUKB 4X1QU 2VGCC 1W10U 2HRVA 2I6SA 1TB6H 4GHQA 1QA7A 1XUKA 3SV7A 3TK5A 2UWOA 4NFEA 2QYIA 4X8UH 3K65B 1LMWB 4U2WA 3VB3A 4B2BA 2NU1E 8LPRA 1NRQH 4ABBA 1UK2A 1OS8A 2ANMH 1AD8H 1N6YA 1QA0A 2TGTA 1AVXA 5EQSA 5B6OA 5JB9S 4O3UA 3ZZBA 2Z7FE 3MH6A 1AVWA 2ZA5A 3FFGA 3F1SB 3ZZ9A 4X2WA 1MQ5A 4X2VA 3OTPA 1EXFA 2PSYA 4AYVB 1Y5BT 1LHDH 1HB0B 2SGPE 1CGHA 1MCVA 2D26C 1B0FA 1UTLM 2OD3B 2ZZUH 2ZDLA 1QGFA 1AVGH 1ABJH 2FS9A 3C1KA 3ZVAA 1Y3UA 1MBMA 4FUEA 1SHYA 1ESTA 1FPHH 4X6NA 4IMQA 2ZPQA 4D7GA 2UUYA 4D9QA 3B23B 1OP2A 4Q2KA 1YGCH 4JZIA 2G4UA 1OXGA 2VIQA 1YLDA 2TIOA 3O8CA 4UFGH 1C5ZB 3Q3YA 5F6MA 1SGTA 3V0XA 1LPZB 1BJVA 1GVLA 5ESBA 2OLGA 2AERH 3PM3A 1K1IA 1NU9A 3BEIB 3DUXH 1C2FA 1BBRE 1A5GH 3E8LA 3I29A 5DP8A 2P95A 1CSOE 1JBUH 1S82A 1LKAA 2ZU5A 1TPSA 2ZGXH 2ZFTA 4X8SH 1GJBB 2GMTB 4DCDA 1WTHD 1ZHRA 3SGQE 1IQGA 1ZMJA 2ZHWH 1SFIA 4I33A 1HAYB 1L1NA 3SW2B 2P8OB 3L33A 3PYHA 4KP0A 3KEEA 3RXFA 2AGEX 3KL6A 3SORA 1OX1A 3A87A 1HFDA 1T7CA 4ZKNU 3P6ZB 1BTWA 1TYNA 2QIQA 2PFEA 2JH5D 2AIPA 2ANKH 1P02A 1TNLA 3PROA 4B75A 3LGVA 1G3EA 2F3CE 3UTUH 1OOKB 1YKTA 4LXBH 3GCHC 1RGQA 2OCVB 3UR9A 1O3IA 1QL9A 2ZFPH 1J15A 3R3GB 1BHXB 1JXPA 1LHEH 2G55A 4IN1A 3PV2A 1BCUH 1UTPA 2C8WB 4BTUB 1DT2A 1PPEE 4HGCA 1O2NA 4IS5A 2BY7X 3MWIU 3LC5A 3KQEA 5AFYH 2AH4X 4WH8A 1C4V2 1GHWH 1YPJH 1BTZA 3F68H 3ITIA 1TQ0B 4MTBA 3DHKH 2F9BH 5FPYA 1WOFA 4TPYA 1GBJA 2XWAA 1LCYA 1BDAA 2ZPRA 3MU1A 1N1LA 5HM2A 4M9FA 2J38A 3PLPA 4ISNA 2Z6BD 5DK1A 3CENA 3LGYA 1O30A 1CT2E 3PLBA 4UEHH 1SSXA 1V2MT 3TU7H 2YNAA 1O3PB 1Z7KA 4WWYA 4ASHA 1HUTH 2DUCA 5BRRE 2FI3E 3E90B 1FZZA 3GDUA 3KNXA 1SI5H 2BHGA 4INHA 3LPRA 1EOLA 4KTUA 3RXAA 4IN2A 1NESE 2PWXA 3LH3A 3E0NB 4A1VA 2ZWLH 2J2UA 1LDTT 1MTNB 1WBGB 3MO9A 2BVSH 2P3UB 1H8IH 4UONA 2FM2A 3BEUA 3U8TH 1OWEA 4ABAA 3SU3A 4F49A 1ELTA 1GMCG 3LGIA 3U1JB 1LTOA 5HGGA 2EI6A 1C1SA 1F0SA 1MTWA 1OKXA 2Y82A 4Z0KA 1NFUA 1ZMLA 2ZHEH 3DFLA 1HIAB 3E3TA 1ZMNA 8GCHF 1ELVA 3MU4A 1GCTB 1AKSB 2FIRH 1SGDE 2OINA 1SQOA 1CGJE 1C1UH 2BOHB 2BXTH 2R2WU 2XTTB 4XBDA 4NIVA 3RXRA 2PKSC 2Y7XA 3UQVA 1F0UA 4DJZB 1EZSC 4Q80A 2FMJA 1Z71A 2P3TB 3A85A 5EQRA 1SGRE 1FJSA 1V6DA 1L1GA 2P16A 3SO3A 1DFPA 2F9OA 1N8OB 3A8BA 1GMDF 3GCOA 1UCYH 3ODDA 4I8GA 2FS8A 1P3CA 4WXIA 1FONA 3SZNA 5C5OA 3SJOA 2B9LA 3VGCC 1A5IA 3RC4A 3PTBA 1SGFA 2BQ6B 1A0LA 3SU1A 2UWLA 4FUBA 4A1TA 4DY7B 1AQ7A 2SGAA 5A0AE 3A7XA 1DUEA 3ZVGA 5I25A 1XVOA 2AMQA 2WPIS 1B7XB 4FUDA 5EW1H 4BAQB 3VB6A 3BF6H 1OPHB 1GI9B 3STJA 2WPJS 1K1NA 1O3AA 3ATWA 2BLQA 3RXDA 3TNSA 1UVSH 2NU0E 4CRDA 4X6MA 3OU0A 3FZDA 2HPQH 4ABIA 2JKHA 3S7KB 2OC0A 3ESTA 2FDAA 1DWEH 3RUOA 3TGKE 1NZQH 2OQ5A 1SL3A 4AN7A 2GCHG 4IBLH 3TJVA 1O2RA 1SBWA 1JMOH 2HNTC 1GBMA 1O3CA 2Y5HA 1F92A 1P3EA 3GYMA 1GHAG 1FMGA 5TJXA 2HWLB 3PV4A 4UFDH 1BHXF 1PQ8A 1SGIB 4U30A 2BMGB 1DSTA 3F9HA 1V2WT 4RI0A 1ZLRA 4Q7ZA 1A3BH 3RXVA 5T1VA 2CGAA 3GDSA 3LOXA 1P03A 1C1MA 3TITA 2EI7A 5FAHA 1FAKH 2D2DA 4IC6A 2UWPA 5ETXA 3QDZB 2A5AA 3DT0H 3EDXB 1GBTA 2PSXA 4ZAEA 3PMAB 1ACBE 1C1QA 3FP6E 1NU7B 1D3DB 4LOYH 2AEIH 2ZTZA 3E91A 1ZTKA 3RMMH 2FODA 1GI7B 1CE5A 3BN9A 5DP4A 1C5OH 2BVXH 3LDXH 4X1NU 1MU8B 3SOSA 1G30B 1FIWA 3UWIA 1DY8A 2ZDVH 3T2NA 4TY6A 2STBE 2O8LA 2CF8H 4FUCA 1DSUA 1JWTA 3U1IB 1IQJA 4FU7A 2G4TA 3LU9B 4WF8A 4CBOA 4XDEA 2VB0A 4CRAA 2WYJA 4MNWA 4YESB 5DP6A 1TBQH 3SUDA 1W7XH 3VEQB 2PLXA 1ZRKA 5TCAA 3LGTA 2W3KA 5PTPA 1W3CA 2FESH 5DO4H 1A1RA 1O2YA 3AAVA 1EZUC 1UTNA 5DJ7A 3SUFA 3TK6A 1H4WA 3RU4E 2ZGHA 3SU5A 1BTXA 4INKA 3D65E 4WY3A 3UIRA 3A89A 3H09A 3A86A 1IHSH 2R3UA 2Z94A 1O3EA 4JK5A 2CHAB 4ZXXH 1P2JA 1FAXA 1GJ7B 3M3VA 2J4IA 1ELGA 1FXYA 2SNWA 4NIYA 2AMDA 2XBVA 1HXFH 1SGYE 1GJ9B 1SOZA 2H5CA 5JBCS 1JIRA 3KCGH 2TGAA 3URDA 1VCPA 4ZH8A 1S5SA 2VIDA 4AB9A 1LQDB 1NROH 1S6HA 2JETC 4AFQA 5EOKA 1L4ZA 4ISIH 4XBCA 1EPTC 1O3DA 3T28A 1O3LA 2QY0B 3BTFE 2VVCA 3EE0B 1RTKA 1C1PA 1P01A 2G81E 2P3FH 1TX6A 1MZAA 1JRTA 2F4LA 4H6TA 1YPLH 1HIAA 3AK5A 4BAHB 4WMFA 2VU8E 1F2SE 1W11U 3TGJE 5B6LA 1P12E 4MPUA 1THPB 4I8KA 5GCHG 2PV9B 1BMLA 1ANCA 2XWBI 2QV1A 1O2VA 5HYOA 1FN8A 1O2SA 4Y7BA 2PHBA 1HJAB 1IQLA 2BDYA 3JZ1B 3BIUH 2A7HA 1FN6A 2IJD1 1S84A 3A7YA 3I77A 2BQ7B 1DE7H 1BUIA 5AFZH 1SVPA 1QFKH 5FBIA 1UK4A 1RXPA 1TA6A 4JYUH 3PV5A 1S0RA 1FQ3A 2BD3A 1QJ6B 2XBWA 5F8ZA 3SHCH 4MNVA 1IQMA 1C2KA 4I7YH 3PB1E 1SLVB 1Y3YA 2O8MA 4Y0ZE 3S9CA 3FP8E 1O2IA 3LJOA 1YPGH 1C5LH 3UNSA 4NA8A 2GZ7A 1HNEE 1CBWC 3VXFH 3VB7A 5GPIB 1YPMH 2BX4A 1IAUA 3SBKA 2WPMS 1YM0A 1IQKA 1LHFH 5T6FA 3VB4A 1GBEA 3ZV9A 1C2EA 1ZPZA 3QTVH 3AASA 4FUGA 3ZVBA 2FX6A 2GVFA 1KXAA 4ABFA 1GI1A 1EP6A 3BG4C 2FZZA 3B8JA 1WAYB 2WV5A 5AVDA 1O3GA 1WXRA 1ZR0A 2ESTE 2PGBB 5C5NA 3T26A 1TGNA 1BIOA 2R2MB 5E2OA 1QB9A 2ILNA 1O37A 2FEQH 1OWKA 4UDWH 4AX9H 2BDIA 2VWLA 1GHBG 3SJ8A 2RG3A 5A0BA 1A3EH 1EB2A 1GMCF 2SNVA 2ODPA 3IG6B 2VH6A 1MMJN 1ANEA 3QX5H 2ZGBH 4K60A 5DP5A 1O5DH 3DD2H 4RN6A 1SHHB 2CJIA 1UK3A 5EXLA 3GCTG 2BD4A 4KGAA 1ANBA 3LIWA 1P06A 1CT0E 4NA7A 2BDCA 1GMHG 1AO5A 1GJ6A 1HLTH 1BQYA 2F9UA 1A4WH 4MNXA 4WH6A 3M5LA 3KQBA 1K1PA 1D9IA 1UHBB 2GZ8A 1C1RA 5AF9H 1O2UA 3P8FA 3TNTA 2ZDAH 1LO6A 2ZFSA 2FOFA 2UUFB 2CV3A 1BZXE 4MQAA 1GDUA 4RKOB 3RXJA 2BD5A 1K9OE 1AB9C 4U01A 2PTNA 2IOTA 4KELA 2GT8A 1TBZH 3P8GA 6CHAC 4MPXA 1GL0E 4DOQA 2Y81A 3M37A 5EPNA 3UQOA 4DGJA 1WQVH 2GZ9A 1GBHA 2Q1JA 2QGRA 1BT7A 1NO9H 4GAWA 3GCHB 2XC0A 1X7AC 4O97A 4CHAC 5JB8S 6GCHG 1Y59T 2FTLE 4XE4A 3KQDA 1GPZA 1BRCE 2PR3A 1FI8A 1NFXA 1QB6A 4RSPA 2H5DA 1J9CH 4BANB 1QL7A 1RIWB 2FOAA 3EA9A 5LPRA 3PO1C 1KDQA 1GBKA 2VIOA 1WCZA 1GI0A 3A7ZA 1O2TA 3HK6B 1FY5A 1EJAA 2GCHF 3M36A 1QJ7B 2BLOA 5E8EH 5SGAE 2ZECA 2J92A 4Y8YA 3S69A 1V2OT 2IJOB 2W3IA 4J1YA 1P2MA 3A8DA 1O2QA 1GHAF 1SC8U 1G37A 1O38A 2FOBA 2PGQB 4K69A 4A1XA 2VWMA 5E0HA 4YM9A 1NFWA 1MTSA 1PPZA 2OQUA 1QY6A 1C4Y2 1QR3E 2FX4A 3RM2H 5GNDA 4TWYA 2B5TB 1P2QA 1FY1A 3PWCA 1T4VH 3BV9B 5A0CA 3M35A 1BBRH 1VJAU 3OTJE 1O3NA 2VJ1A 1IQIA 3NK8A 1MKXH 5FBEA 5C2ZA 2G51A 1O0DH 1NPMA 2NU4E 2XYAA 3MU5A 2SGQE 1GCDA 1IHTH 3SU6A 1HGTH 1FV9A 1K1JA 3GICB 1ETTH 3TJUA 3F9EA 4AOQA 1ZYOA 2WZQA 2ZFQH 2XCNA 2A4OA 1ARCA 2B0FA 1EAUA 3Q76A 1KXFA 1MD7A 1D3QB 3EYDA 1CHGA 4OM9A 2AIQA 3U9AH 3VPKA 2I6QA 4OS4A 2A2XH 4BTIB 1GL1A 4DT7B 5GIBA 3PMJA 1T8OA 2HPPH 1ZGIA 1D6WA 2ZEBA 1G2MA 5AHGH 4X2XA 3Q3KA 1P10A 1ID5H 1A0JA 1LPKB 1KXDA 3Q3XA 5GDSH 4D7FA 1QBOA 2ZDMA 2AYWA 4OS2A 3SZEA 2H9HA 1SLWB 1YBWA 1YPHE 1AHTH 2BD9A 3FAOA 3SV8A 1WU1A 3SHAH 3MFJA 4AFUA 1VITH 1FUJA 4D9RA 1FIZA 1L0ZA 3ZYDA 1KIGH 3FANA 5EODA 3A80A 1F0TA 2BDAA 1VR1H 3T29A 1G3BA 1DWCH 1TGSZ 1OSSA 2IN2A 3MH4A 1LHGH 2VVUA 2P94A 4UFEH 5ABWA 2PUQH 1ZJKA 3M61U 5GXPA 5DGJA 4XOJA 4CH8B 3CP7A 1PPBH 3NXPA 2OBQA 2VH0A 3GCNA 1QRWA 1SR5C 4ABDA 4NZQA 4NIXA 4BTTB 3OY6U 3UUZA 1BMAA 3RMNH 1XVMA 1JRSA 5E0GA 2RA3A 2VWOA 5JBBS 2XBYA 3BTWE 4FUHA 1NY22 5CE1A 3SGBE 1CQQA 2OK5A 1LPGB 5GCHF 1KTTB 4IC5A 3SUEA 2TPIZ 1S6FA 2PUXB 4THNH 1NFYA 1BB0B 1MUEB 2BTCE 2G5NA 3KN2A 1GDNA 1P05A 1EAWA 2DE9A 2J94A 1UVOA 3MMGA 4MPVA 3TIUA 3A7WA 3AAUA 2BY9X 2J95A 4K5ZA 2Z9JA 1UTJA 2R3YA 2A4QA 4Y10E 5HXFA 5IDKA 1ZZZA 1TABE 2FI5E 3F9GA 1ZHPA 2ZCHP 4K1SA 2CXVA 4X8TH 5CMXH 7GCHG 1QBVH 2A1DB 2AS9A 3C27B 5C67A 1UVPA 2Z9KA 1CA0B 1C5XB 5DP3A 4TPIZ 3T27A 4D8NA 1UVTH 1O5GH 1AFEH 3GY3A 1P11E 1TWXB 2GMTC 2O8TA 3CS0A 4WMEA 1GHYH 5CHAB 4ISLA 4O9VA 3TJNA 1DPOA 3ZVCA 2P8OC 1TIOA 2ZO3H 3MOCA 1QHRB 4YZUA 3HATH 9LPRA 1QB1A 3M3SA 1AU8A 4HI3A 2AGIX 1YPKH 1M9UA 1HPGA 2Y6TA 2GP9B 4X2YA 3MNBA 1L4DA 1TX7A 1O5EH 4KTSA 4OS1A 4I32A 1T31A 2FOMB 4H4FA 2GD4B 5ESTE 4B2AA 1C1WH 1ZTJA 4ISOA 3S9AA 1W7GH 2B8OH 4K1EA 1O2PA 1BBRK
chains in the Genus database with same CATH superfamily
2GDEH 1YCPM 1VCWA 3SYJA 2WHXA 1MKXK 3GY4A 3QK1A 2G00A 3T5FH 3ZZ7A 1G3CA 1NRNH 1XXDA 3M3TA 8KME2 4IW4E 1G3DA 3SI3H 4UD9H 1GHZA 5C1XA 1F0RA 3AW0A 2RDLA 4MVNA 1TQ7B 3EAJA 1GHBF 1Z6EA 2ZIQH 3SNAA 4BOHA 1GI8B 1RS0A 1HXEH 5T6GA 1THRH 3FKSD 1Z8IB 2WYGA 2AMPA 4AC9A 2J9NA 1P8VC 2ZHFH 1UO6A 3UNRA 1HAPH 3U28C 3R0FA 3O8DA 1SPJA 1XX9A 4K2YA 3RC5A 3ZVEA 1SFQB 3RLWH 1AN1E 1TX8A 2HGTH 4OGYA 5FPTA 3GCTF 1PPGE 1E0FD 1PQ5A 4JZEH 1RRKA 1TRMA 2ZDKA 1D4PB 2Y5GA 1GMHF 3LJJA 4AGKA 4TYDA 2XRCA 4FXGH 5DPAA 3GDVA 2SGEE 1GGDB 1QTFA 1GBDA 5G4BA 3M5NA 3ZZCA 1WDIA 3P92A 2L6OA 1BRAA 1VKYA 1A7SA 1OP0A 1G36A 1NN6A 1ARBA 1G9IE 4XBBA 3RXQA 2ZHDA 3QUMP 1TMUH 2XXLA 1QIXB 2JETB 2ODQA 1QBNA 2TBSA 4AZ2B 2ZU2A 2YNBA 2ZFRH 3QGNB 1V2QT 1AWFH 1MCTA 1QQ4A 1XUGA 3N7OA 3BTME 1K1OA 2QA9E 1P04A 3WWFA 1MTNC 2CF9H 2QXHA 5F03A 5FCKA 2ULLA 4X8VH 1O2XA 1P9UA 1PQ7A 3P17H 3H7TA 2XC4A 3BIVH 1O34A 2D1JA 1O3JA 4B73A 1GBAA 4ISHH 4E7RG 6GCHF 1TPPA 1DITH 3OX7U 1S83A 4I8HA 1TMBH 1DVAH 2G5VA 2WSSD 1SLXB 4GUXA 1MD8A 3BTHE 1FLEE 1Y5AT 5EXNA 3V7TA 1GWAA 4CRCA 3SNDA 1O3KA 4LZ4B 2R0LA 4B74A 1DDJA 1DWDH 1KY9A 4ZROA 3RXKA 4VGCB 5TCCA 4RKJB 3RMOH 3URCA 2BOKA 1V2LT 5JYIA 1NS3A 2GV7A 1IOEA 1GJCB 2V0BA 2ZKSA 2R0KA 1Z1JA 3MYWA 2ZF0H 3GY2A 3ATLA 1TGTA 1TAWA 5EJZA 1TNKA 1BRUP 2Q6FA 3KGPA 2ZG0H 3RU4D 4FUIA 1E34B 4TWWA 1CBWB 1TNHA 1XUHA 1EP5A 3HGNA 4TY7A 2G52A 1LKBA 4I86A 1TBRH 4DG4A 2VIWA 2HNTF 1GJ4H 1SGEE 1C5WB 2FLBH 1O3FA 1VGCB 1SGQE 2EA3A 2GKVE 4R0IA 1Z8JB 1F7ZA 1COWD 1AWHB 3CNRA 3GY8A 2ZFFH 2V7QD 2VBCA 1FDPA 4B6EA 2BZ6H 3QO6A 1IQEA 4GCHG 3MNSA 1CT4E 4ZHMU 1H1BA 1MTVA 2O8WA 1C2HA 3P70B 3SGAE 3RXBA 1QL8A 2HLCA 1V2ST 2XC5A 5H4IB 1Q3XA 1QQUA 2ZDNA 2Z3DA 2ZTXA 2GX4A 4MG3A 1O5CB 2C8ZB 2BVRH 5FPSA 2C93B 1AKSA 2GDDA 3KQ5A 2JH6D 1WTGH 1HAIH 1LVMA 4I31A 4AFZA 4O3TA 2J5UA 1V2NT 1KTSB 4YOIA 2QF0A 7KMEH 4E7NA 1U6QA 4YOJA 4YLQH 2A31A 3BTTE 1O2MA 1Y3WA 1YF4A 1UTKA 4FETA 4NZLA 4BAKB 3E16B 1H9LB 2A0QB 1OWJA 1XKAC 3QLPH 3TH4H 9ESTA 2A32A 2YOLA 3P8NA 2WV9A 1PPHE 1ELBA 1GJ8B 5EPYA 1ZJDA 2Z9IA 2J34A 1CU1A 2VGCB 3F6UH 1YC0A 5DG6A 1FY3A 4K8BA 1KXCA 4JYVH 1SB1H 1P2KA 3KF2A 1BITA 1E36B 1BMNH 3M7QA 5C1YA 6CHAB 2A5KA 1AFQC 1GBCA 8ESTE 1P9SA 1J16A 1TPOA 3UWJH 2EQNA 4BAMB 5K0HA 1GJAB 1TONA 2GV6A 3RXOA 2W7SA 3NPSA 1HAVB 6ESTA 1EAXA 5DN6D 1W13U 1TALA 5T3HA 2A5IA 3W1EA 1S0QA 3F3BA 3K2UA 2BM2A 1A61H 1GG6C 1O32A 1WYKA 4GVUA 3UPEA 4B2CA 1ZOMA 3D62A 2GCTC 1Q31A 3SJKA 1J14A 3ZYEA 2H9EH 1KXEA 1Z6JH 3MNXA 1SG8B 1TOMH 1QNJA 2JDID 5C3NA 4Y79A 3ODFA 4ZKSU 1LVOA 7GCHF 5LGOA 5K7RA 2FYRA 4ESTE 4ZXYH 4Q7XA 5HMAA 3ENSB 1MQ6A 1P2IA 1SGFG 2CHAC 1GJDB 3SQEE 1HYLA 2M2AA 4LK4A 3BEFB 4HFPB 3RXTA 4A92A 3MTYA 1B0EA 1W14U 1UMAH 4JMYA 4F55A 2VIPA 4HTCH 1EUFA 1OHHD 1TLDA 2FO9A 3STIA 3H5CB 1ETRH 4NWKA 5LPEA 1TGCA 4OGXA 5JDUB 2OC7A 2WUCA 3B9FH 4DW2U 7ESTE 4MPWA 1V2TT 5DKMA 4NA9H 1TE0A 1ETSH 1VITG 2ZQ1A 2FXRA 1NTPA 2C8YB 2KAIB 3QTOH 1EAIA 3E0PB 2PKAB 5EU8A 1MU6B 1PPCE 1O2JA 4AGJA 2GT7A 3RP2A 3ZZ5A 1GHVH 1HAHH 1XUJA 1HJAC 2SGDE 3UOPA 4BXSA 4JZDH 2A7JA 2ZU1A 2BD2A 2ZC9H 1TOCB 1DXPA 2QF3A 4NGAH 3TLOA 2H9TH 3MH5A 3DSGA 5C17A 4NSVA 2NWNA 2BDHA 2P59A 2FP7B 3BTDE 3SUGA 1JIMA 1V2KT 3SU2A 5L2YH 5EW2H 5FXLA 1GJ5H 4UFFH 1ABIH 1K21H 1O3HA 3F9FA 3FZZA 3ELAH 2OC8A 1LQEA 1HBTH 1HDTH 2FWWA 3GY7A 4INLA 2C4FH 1O2GH 1XKBC 3ZVDA 1ZHMA 2XBXA 4YO9A 3PRBA 1BJUA 2SFAA 1E1RD 4IGDA 4Y71A 1WV7H 3UNQA 3BTGE 3SJIA 2TRMA 1RFNA 3SNBA 4B6FA 4WJG2 2Y80A 1C5QA 1MKWH 3EE7A 3WY8A 1C5SA 1O5BB 1MH0A 4Z6AH 2QN5T 1CGIE 1FY8E 4YTAA 3MH7A 4YLUA 4D76A 1F5RA 3BSQA 1P09A 1ESBA 2ZQ2A 1C1TA 3PLKA 1H8HD 2RCEA 1O2ZA 3A83A 4I8LA 2G8TA 2VNTA 1GVZA 3A7TA 4GLYA 3W95A 3M7TA 3LONA 4Q7YA 3RXLA 2VINA 1C5TA 1DXWA 2VVVA 1SQTA 1EQ9A 1A0HB 1IQFA 2C3SA 3T62A 2ZGCA 1EJMA 3ZZ3A 1BOQA 4A7IB 3ZZ4A 2QXIA 3VB5A 1GDQA 5LPFA 2CMYA 1AMHA 5BPEA 2RA0A 4AORA 2BLVA 4E06H 1WUNH 2OP9A 1XXFA 1PFXC 1OWDA 1ZPCA 1ELCA 2QF5A 3S7HB 1O31A 1KMHB 2IPHA 2WPKS 2Q6GA 3TPIZ 1EZQA 1AE5A 1T4UH 1K28D 1O2OA 3QZQA 1GI4A 2Z3CA 4DIHH 1EKBB 1HCGA 2ZGJA 4NFFA 1AIXH 3L6PA 2YMSB 4JYTA 1HRTH 3EQ0H 1O39A 1L1JA 1SMFE 3RXIA 1GBIA 3NUMA 2ZU4A 3U8OH 2V3HH 3MO3A 3BTKE 1RTFB 5A8XA 4GSOA 4ABGA 4WXVA 1HAVA 4DT4A 2THFB 1Y3VA 4JCNA 2LELA 4CR5A 2GTBA 1K1LA 5C1UA 3RLYH 3AVZA 3RXSA 1XM1A 1O5FH 3I78A 1BMMH 1CHOG 5EQQA 2PKSB 1S6LA 1V2PT 1TNJA 1O3BA 4Y8XA 1DICA 1PJPA 4RT0A 1ZSLA 1YCPK 1ANDA 3MI4A 1C5MD 2NU2E 2FYQA 3F2FA 4WVPE 3F2HA 1D3PB 4A6LA 1TNGA 2AHME 3GY6A 4NCYA 1V2RT 1DLEA 2M5TA 3A82A 4GCHF 3HKJB 5E0JA 5EG4A 1BTYA 1V3XA 4YXWD 5L2ZH 4O03A 4J2YB 1ELFA 3K6YA 1HAZB 3TK9A 3LGWA 2A4RA 1PYTD 1ZGVA 3OSYA 1SQRA 2ASUB 1RIWC 2ANYA 3V12A 3D49H 5HKKD 4Y0YE 1EASA 3VGCB 5J4QA 1ZTLA 4OS6A 1NRRH 4X1SU 3S9BA 4CR9A 5C20A 1G2LA 3PWBA 3TJOA 1T8NA 1ZSJA 1IQNA 1XUFA 1UJ1A 4YT7H 4CH2B 4WMDA 1THSH 1L2EA 4X1RU 2KZ4A 5L6NH 1WQSA 4SGAE 3P95A 2BDBA 2UUJB 1O36A 1C2DA 1C5UA 1W8BH 2QCYA 3BG8A 1UHBA 3PMBB 5A09A 4SGBE 1RJXB 3RMLH 2KAIA 3SI4H 1KLTA 4UE7H 5I46H 2OBOA 2PKAA 2ZCKP 1DLKB 1FPCH 2SGFE 5JBAS 4K8YA 2FOHA 4AYYB 1YPHC 3SU0A 1QRXA 2BLWA 3OY5U 3RXEA 1GBLA 1QJ1B 4LZ1H 2GGVB 1BA8B 1C1VH 2C8XB 2OTVA 3SV2H 1TGBA 2PTCE 5L30H 2W26A 1YYY1 1C5VA 1ORFA 1MKWK 3NWUA 3ZIAD 1C5NH 1DUAA 1AY6H 1C5YB 2K1QA 3KHVA 3U98H 2F83A 2OXSA 2FTMA 1H9HE 3O8RA 3A7VA 3LT3A 3ZZDA 1C5RA 3DFJA 1UTOA 2ALVA 2EI8A 2Y7ZA 2EC9H 3MNCA 4CRFA 4AB8A 1N6XA 1PYTC 3TH3H 3F0PA 2ZNKH 2FOEA 4IMZA 1CA8B 3FO8D 3FVFB 2WPDD 3DA9B 1EB1H 1VZQH 5KEDA 4JZ1A 4KTCA 1TMTH 3A8AA 3MO6A 1YLCA 1YPEH 1QRZA 3SNCA 3M7UA 1T8MA 2WUBA 4MLFB 1O3MA 3E6PH 3HK3B 5C0UA 5DP9A 3ZZ8A 2P93A 2AGGX 2ZP0H 4DIIH 3G01A 2BY6X 3RXHA 2HNTE 3OYPA 2ZI2H 1XUIA 1JOUB 4R8TB 2F91A 2ODYB 1W2KH 1O35A 3FOAA 3RU4T 2CN0H 1AE8H 1TRNA 3UFAA 2LP6A 2CK3D 1GI2A 1ELDE 3FP7E 3RXPA 2O8UA 3AW1A 1ELEE 2KX4A 2B7DH 4X0WU 4AFSA 3SN8A 4BNRA 1UCYE 4F4OC 4GHTA 1T32A 4Y76A 3MHWU 3UREA 4CRGA 1E35B 4XSKU 1V2VT 3RDZA 2Z3EA 4E05H 2Y5FA 2QE7D 2BD8A 1VITF 1V2UT 1Y5UT 2BDGA 4ABHA 4YOGA 2A7CA 3NCLA 2F9VA 1DM4B 5FCRA 5A2MH 1LVYA 1C1OA 1KYNA 4Y7AA 4OS5A 1J17T 3SNEA 1P2OA 1NRPH 3GISB 4AG1A 2BQWB 5JPMH 4FU9A 5C94A 3QGJA 1EPTB 1ZPBA 2A4GA 3TGIE 2LPRA 1K1MA 4ZHLU 1CO7E 2BYAX 1V2JT 3PTNA 3M5MA 1AI8H 1SGPE 1XMNB 2ZU3A 2FOGA 1GVKB 1F5LA 1O2KA 1C4U2 2EY4C 1EX3A 3Q00A 4M7GA 4DVAU 1CA0C 1KLIH 3QN7A 2BZAA 1P2NA 2FPZA 4KKDA 4OS7A 4DURA 5CHAC 1Q2WA 5F8TA 3A8CA 3MU0A 1LVBA 1BRBE 2R9PA 3A88A 2TGPZ 1QURH 5GWZA 1DX5M 2A45B 1GCTC 1NM6A 4ABJA 2VIVA 2O9QA 1AZZA 5A8ZA 3ATKA 1ELAA 1P0SH 2V6NA 3V3MA 2QXJA 3U8RH 1SGCA 1H9IE 1C9TA 2DE8A 5EGMA 3RXUA 1E79D 2F9NA 3TVJB 2XCFA 3IITA 4ZHAA 1GBFA 1W0ZU 4ZCNA 1GI3A 3D23A 1OWIA 1O2HA 2HOBA 1AFQB 4ZUHA 2AFQB 1N8OC 1TPAE 1IQHA 1W12U 2V3OH 4BXWA 3RC6A 2QAAA 1MTUA 3SV9A 2BXUH 3LGUA 1T8LA 4FVBA 5GJ4B 2WINI 2PW8H 3Q77A 1OYQA 1UVUH 4NWLA 3S0NA 3KQCA 5IYTA 1GBBA 3T25A 1S85A 4JZFH 1GG6B 1VCQA 2STAE 3VG8A 1INCA 5FX6A 3ATMA 1MAYA 3P8OA 3K6ZA 1DWBH 4AG2A 2GCTB 2QXGA 4QT8C 1W0KD 5HM9A 1DY9A 1O5AB 2BX3A 1W0YH 3BG4B 1WSSH 2J98B 2HALA 3CS7A 2A2QH 5LH8A 2V35A 1C2IA 3HPTB 1S81A 4CRBA 1CVWH 1GHXH 1C9PA 4ZKOU 1Y8TA 4ABEA 3BTQE 3O8BA 3LKWA 4FU8A 5DSFA 1GGDC 1K22H 1O2LA 1EOJA 3IWMA 1SQAA 2ANWA 3E1XB 4X6OA 1KDQB 5A8YA 6LPRA 2HVXA 2XNIA 1MAXA 3M5OA 4ACAA 4K3JA 2W7UA 1A46H 7LPRA 1ESAA 1GI6A 1C5PA 1DANH 1J8AA 3UOUA 3MU8A 2XW9A 1TFXA 3A81A 3HGPA 3NKKA 1AGJA 1BTHH 1H8ED 3ZV8A 1ZRBA 1LHCH 3QWCH 1SLUB 3EA8A 3F0OA 2Z9LA 3UR6A 1CHOF 2OUAA 5FHTA 1UCYK 4ZKRU 5FL7D 2BD7A 1YP9A 4YT6H 4FUJA 2ALPA 1D3TB 3ZZ6A 3UAIC 3UY9A 4Y6DA 3LC3A 1C2MA 1TRYA 5EJLA 4B1TA 2RDEA 3RXMA 2ZHQH 1HV7A 2EEKA 1B5GH 2WV4A 1H8DH 2FI4E 3OFND 1O2WA 4MNYA 4NIWA 4Y8ZA 3ZZAA 4U32A 1AB9B 2BY5X 4ZMAH 3PMHB 4FUFA 2C90B 3TH2H 3K9XB 3ZVFA 1MZDA 1EJNA 1FX0B 2OC1A 4TT3D 1Z8RA 1C1NA 4VGCC 1HAXB 1NT1A 3ATIA 3VXEH 3VFEA 4PROA 1HAGE 1O3OA 4MDSA 1A5HA 1FY4A 2H2ZA 4CBNA 4B71A 1NRSH 4ACBA 1C2LA 4B76A 5E2PA 4CHAB 1OWHA 1KSNA 3JZ2B 3SQHE 2Z9GA 1NC6A 1K2I1 1KXBA 3GYLB 4H42U 3NZIA 4K1TA 3U69H 4H6SB 2WPLS 1BTPA 2ZCLP 3PO1B 2QC2A 2ZPSA 8GCHG 1Z1IA 2H6MA 1P57B 1RTLA 5T6DA 5JBTA 1SGNE 2BB4A 1AUJA 3W94A 4A5TS 1UTQA 1AUTC 2KCPA 1A2CH 4NG9H 1HJ8A 1VGCC 1Z8GA 1EFRD 1EPTA 1TNIA 2WPHS 2H1UA 3GOVB 1F5KU 4NSYA 1MBQA 3RXGA 1C2GA 2BY8X 1KLJH 1EATA 1FNIA 4CREA 3KIDU 2W5EA 1SKYE 2TGDA 2FOCA 1GMDG 1SOTA 1AZ8A 1EZXC 3EGKH 4XFQA 1OP8A 3SJ9A 1ZSKA 2F9PA 1DOJA 1YCPH 1PQAA 4BAOB 2D8WA 2VWNA 5KECA 3SV6A 5FX5A 1O33A 3LH1A 1UTMA 3EA7A 3HKIB 4JK6A 2K0QA 3RM0H 4X6PA 1E37B 1GI5A 5J4SA 1C2JA 1VJ9U 5EXMA 3H7OA 2FLRH 1BTUA 1TA2A 3A84A 3BTEE 3SU4A 1HJ9A 1Y3XA 4I8JA 2LNCA 2ZTYA 5DP7A 1D6RA 1HAOH 4FVDA 1DS2E 4X1PU 1QCPA 1RD3B 2K8IA 3L3TA 4Y11E 3GY5A 2JH0D 4GPGA 2NU3E 1OYTH 2Q6DA 1E38B 4HZHA 5F8XA 3RXCA 3QZRA 3V13A 1PPFE 1G32B 2UUKB 4X1QU 2VGCC 1W10U 2HRVA 2I6SA 4TSFD 1TB6H 4GHQA 1QA7A 1XUKA 3SV7A 3TK5A 2UWOA 2KCOA 4NFEA 2QYIA 4X8UH 3K65B 1LMWB 4U2WA 3VB3A 4B2BA 2NU1E 8LPRA 1NRQH 4ABBA 1UK2A 2J98A 1OS8A 2ANMH 1AD8H 1N6YA 1QA0A 2TGTA 1AVXA 5EQSA 2L74A 5B6OA 5JB9S 4O3UA 3ZZBA 2Z7FE 3MH6A 1YLNA 1AVWA 2ZA5A 3FFGA 3F1SB 3ZZ9A 4X2WA 1MQ5A 2JJ2D 3OTPA 1EXFA 2PSYA 4X2VA 2W6JD 4AYVB 4FOUC 1Y5BT 1LHDH 1HB0B 2SGPE 1CGHA 1MCVA 2D26C 1B0FA 1UTLM 2OD3B 2ZZUH 2ZDLA 1QGFA 1AVGH 1ABJH 2FS9A 3C1KA 3ZVAA 1Y3UA 1MBMA 4FUEA 1SHYA 1ESTA 1FPHH 4X6NA 4IMQA 2ZPQA 4D7GA 2UUYA 4D9QA 3B23B 1OP2A 4Q2KA 1YGCH 4JZIA 2G4UA 1OXGA 2VIQA 1YLDA 2TIOA 5F53A 3O8CA 4UFGH 1NBME 1C5ZB 2XOKD 3Q3YA 5F6MA 1SGTA 3V0XA 1LPZB 1BJVA 1GVLA 5ESBA 2OLGA 2AERH 3PM3A 1K1IA 1NU9A 3BEIB 3DUXH 2V3MA 1C2FA 1BBRE 1A5GH 3E8LA 3I29A 5DP8A 2P95A 1CSOE 1JBUH 1S82A 1LKAA 2ZU5A 1TPSA 2ZGXH 2ZFTA 4X8SH 1GJBB 2GMTB 4DCDA 1WTHD 1ZHRA 3SGQE 1IQGA 1ZMJA 2ZHWH 1SFIA 4I33A 4Q63A 1HAYB 1L1NA 3SW2B 2P8OB 3L33A 3PYHA 4KP0A 3KEEA 3RXFA 2AGEX 3KL6A 3SORA 1OX1A 3A87A 1HFDA 1T7CA 4ZKNU 3P6ZB 1BTWA 1TYNA 2QIQA 2PFEA 2JH5D 2AIPA 2ANKH 1P02A 1TNLA 3PROA 4B75A 3LGVA 1G3EA 2F3CE 3UTUH 1OOKB 1YKTA 4LXBH 3GCHC 1RGQA 2OCVB 3UR9A 1O3IA 2YMSD 1QL9A 2ZFPH 1J15A 3R3GB 1BHXB 1JXPA 1LHEH 2G55A 3PV2A 4IN1A 1BCUH 1UTPA 2C8WB 4BTUB 1DT2A 1PPEE 4HGCA 1O2NA 4IS5A 2BY7X 3MWIU 3LC5A 3KQEA 5AFYH 2AH4X 4WH8A 1C4V2 1GHWH 1YPJH 1BTZA 3F68H 3ITIA 1TQ0B 4MTBA 3DHKH 2F9BH 5FPYA 2RFKC 1WOFA 4TPYA 1GBJA 2XWAA 1LCYA 1BDAA 2ZPRA 3MU1A 1N1LA 4M9FA 5HM2A 2J38A 3PLPA 4ISNA 5HIZA 2Z6BD 5DK1A 3CENA 3LGYA 1O30A 1CT2E 3PLBA 4UEHH 1SSXA 1V2MT 3N99A 3TU7H 2YNAA 1O3PB 1Z7KA 4WWYA 4ASHA 2W6ID 2DUCA 1HUTH 5BRRE 2FI3E 3E90B 1FZZA 3GDUA 3KNXA 1SI5H 2JIZD 5CDFE 2BHGA 4INHA 3LPRA 1EOLA 4KTUA 3RXAA 4IN2A 1NESE 2PWXA 3LH3A 3E0NB 4A1VA 2ZWLH 2J2UA 1LDTT 1MTNB 1WBGB 3MO9A 2BVSH 2P3UB 1H8IH 2YMSC 4UONA 2FM2A 3BEUA 3U8TH 1OWEA 4ABAA 3SU3A 4F49A 1ELTA 1GMCG 3LGIA 3U1JB 1LTOA 5HGGA 2EI6A 1C1SA 1F0SA 1MTWA 1OKXA 2Y82A 4Z0KA 1NFUA 1ZMLA 2ZHEH 3DFLA 3KYGA 1HIAB 3E3TA 1ZMNA 8GCHF 1ELVA 3MU4A 1GCTB 1AKSB 2FIRH 1SGDE 2OINA 1SQOA 1CGJE 1C1UH 2BOHB 2BXTH 2R2WU 2XTTB 4XBDA 4NIVA 3RXRA 2PKSC 2Y7XA 3UQVA 1F0UA 4DJZB 1EZSC 4Q80A 2FMJA 1Z71A 2P3TB 3A85A 5EQRA 1SGRE 1FJSA 2GJGA 1V6DA 1L1GA 2P16A 3SO3A 1DFPA 2F9OA 1N8OB 3A8BA 1GMDF 3GCOA 1UCYH 3ODDA 4I8GA 2FS8A 1P3CA 4WXIA 1FONA 3SZNA 5C5OA 3SJOA 2B9LA 3DSOA 3VGCC 1A5IA 3RC4A 3PTBA 1SGFA 2BQ6B 1A0LA 3SU1A 2UWLA 4FUBA 4A1TA 4DY7B 1AQ7A 2SGAA 5A0AE 3A7XA 1DUEA 3ZVGA 5I25A 1XVOA 2AMQA 2WPIS 1B7XB 4FUDA 5EW1H 2HVYB 4BAQB 3VB6A 3BF6H 1OPHB 2IPQX 1GI9B 3STJA 2WPJS 1K1NA 1O3AA 3ATWA 2BLQA 3RXDA 3TNSA 1UVSH 2NU0E 4CRDA 4X6MA 3OU0A 3FZDA 2HPQH 4ABIA 2JKHA 3S7KB 2OC0A 3ESTA 2FDAA 1DWEH 3RUOA 3TGKE 1NZQH 2OQ5A 1SL3A 4AN7A 2GCHG 4IBLH 3TJVA 1O2RA 1SBWA 3NRLA 1JMOH 2HNTC 1GBMA 1O3CA 2Y5HA 1F92A 1P3EA 3GYMA 1GHAG 1FMGA 5TJXA 2HWLB 3PV4A 4UFDH 1BHXF 3MQKC 1PQ8A 1SGIB 4U30A 2BMGB 1DSTA 3F9HA 1V2WT 4RI0A 1ZLRA 4Q7ZA 1A3BH 5T1VA 3RXVA 2CGAA 2JJ1D 3GDSA 3LOXA 1P03A 1C1MA 3TITA 2EI7A 5FAHA 1FAKH 2D2DA 4IC6A 2UWPA 5ETXA 3QDZB 2A5AA 1YY3A 3DT0H 3EDXB 1GBTA 2PSXA 4ZAEA 3PMAB 1ACBE 1C1QA 3FP6E 1NU7B 1BMFD 1D3DB 4LOYH 2AEIH 2ZTZA 3E91A 1ZTKA 3RMMH 2FODA 1GI7B 1CE5A 2KCAA 3BN9A 5DP4A 1C5OH 2BVXH 3LDXH 4X1NU 1MU8B 3SOSA 1G30B 3OEED 1FIWA 3UWIA 1DY8A 2ZDVH 3T2NA 4TY6A 2STBE 2O8LA 2CF8H 4FUCA 1DSUA 1JWTA 3U1IB 1IQJA 4FU7A 2G4TA 3LU9B 3OEHD 4WF8A 4CBOA 4XDEA 2VB0A 4CRAA 2WYJA 4MNWA 4YESB 5DP6A 1TBQH 3SUDA 1W7XH 3VEQB 2PLXA 1ZRKA 5TCAA 3LGTA 2W3KA 5PTPA 1W3CA 2FESH 5DO4H 1A1RA 1O2YA 3AAVA 1EZUC 1UTNA 5DJ7A 3SUFA 3TK6A 1H4WA 3RU4E 2ZGHA 3SU5A 1BTXA 4INKA 3D65E 4WY3A 3UIRA 3A89A 3H09A 4Z1MD 3A86A 1IHSH 3UB0A 2R3UA 2Z94A 1O3EA 4JK5A 2CHAB 2F43B 4ZXXH 1P2JA 1FAXA 1GJ7B 3M3VA 2J4IA 1ELGA 1FXYA 2SNWA 4NIYA 2AMDA 2XBVA 4P02A 1HXFH 1SGYE 1GJ9B 1SOZA 2H5CA 5JBCS 1JIRA 3KCGH 2TGAA 3URDA 1VCPA 4ZH8A 1S5SA 2VIDA 4AB9A 1LQDB 1NROH 1S6HA 2JETC 2KFWA 5EOKA 1L4ZA 4AFQA 1K0HA 4ISIH 4XBCA 1EPTC 1O3DA 2KM0A 3T28A 1O3LA 3OAAD 2QY0B 3BTFE 2VVCA 3EE0B 1RTKA 1C1PA 1P01A 2G81E 2P3FH 1TX6A 1MZAA 1JRTA 2F4LA 4H6TA 1YPLH 1HIAA 3AK5A 4BAHB 4WMFA 2PP6A 2VU8E 1F2SE 1W11U 1W0JD 3TGJE 5B6LA 1P12E 4MPUA 1THPB 5C0TA 4I8KA 5GCHG 2PV9B 5EIYA 1BMLA 1ANCA 2XWBI 2QV1A 3PRDA 1O2VA 5HYOA 1FN8A 1O2SA 4Y7BA 2PHBA 1HJAB 1IQLA 2BDYA 3JZ1B 3BIUH 2A7HA 1FN6A 2IJD1 1S84A 3A7YA 3I77A 2BQ7B 1DE7H 1BUIA 5AFZH 1SVPA 1QFKH 5FBIA 1UK4A 1RXPA 1TA6A 3PV5A 4JYUH 1S0RA 1FQ3A 2BD3A 1QJ6B 2XBWA 5F8ZA 3SHCH 4MNVA 1IQMA 1C2KA 4I7YH 3PB1E 3FN8A 1SLVB 1Y3YA 2O8MA 4Y0ZE 3S9CA 3FP8E 1O2IA 3LJOA 1YPGH 1C5LH 4XD7D 3UNSA 4NA8A 2GZ7A 1HNEE 1CBWC 3VXFH 3VB7A 5GPIB 1YPMH 2BX4A 1IAUA 3SBKA 2WPMS 1YM0A 1IQKA 1LHFH 5T6FA 2KR7A 3VB4A 1GBEA 3ZV9A 1C2EA 1ZPZA 3QTVH 3AASA 4FUGA 3ZVBA 2FX6A 2GVFA 1KXAA 4ABFA 1GI1A 1EP6A 3BG4C 2FZZA 3B8JA 1WAYB 2WV5A 5AVDA 1O3GA 1WXRA 1ZR0A 2ESTE 2PGBB 5C5NA 3T26A 1TGNA 1QZ8A 1BIOA 2R2MB 5E2OA 1QB9A 2ILNA 1O37A 2FEQH 1OWKA 4UDWH 4AX9H 2BDIA 2VWLA 1GHBG 3SJ8A 2RG3A 5A0BA 1A3EH 1EB2A 1GMCF 2SNVA 2ODPA 3IG6B 2VH6A 1MMJN 1ANEA 3QX5H 2ZGBH 4K60A 5DP5A 1O5DH 3DD2H 4RN6A 1SHHB 2CJIA 1UK3A 5EXLA 3GCTG 2BD4A 4KGAA 1ANBA 3LIWA 1P06A 5EJ1A 1CT0E 4NA7A 2BDCA 1GMHG 1UW7A 1AO5A 1GJ6A 1HLTH 1BQYA 2F9UA 1A4WH 4MNXA 4WH6A 3M5LA 3KQBA 1K1PA 1D9IA 1UHBB 2GZ8A 1C1RA 5AF9H 1O2UA 3P8FA 3TNTA 2ZDAH 1LO6A 2ZFSA 2FOFA 2UUFB 2CV3A 1BZXE 4MQAA 1GDUA 2QF4A 4RKOB 3RXJA 2BD5A 1K9OE 1AB9C 3KYFA 2PTNA 4U01A 2HLDD 2IOTA 4KELA 2GT8A 1TBZH 3P8GA 6CHAC 4MPXA 1GL0E 4DOQA 2Y81A 3M37A 5EPNA 3UQOA 4DGJA 1WQVH 2GZ9A 1GBHA 4ASUD 2Q1JA 2QGRA 1BT7A 1NO9H 4GAWA 3GCHB 2XC0A 1X7AC 4O97A 4CHAC 5JB8S 6GCHG 1Y59T 2FTLE 1MABB 4XE4A 3KQDA 1GPZA 1BRCE 2PR3A 1FI8A 1NFXA 1QB6A 4RSPA 2H5DA 1J9CH 4BANB 1QL7A 1RIWB 2FOAA 3EA9A 5LPRA 3PO1C 1KDQA 1GBKA 3DCLA 2VIOA 1WCZA 1GI0A 4F48B 3A7ZA 1O2TA 3HK6B 5CHBA 1FY5A 1EJAA 2GCHF 3M36A 1E1QD 1QJ7B 2BLOA 5E8EH 5SGAE 2ZECA 3GS9A 2J92A 4Y8YA 3S69A 1V2OT 2IJOB 2W3IA 4J1YA 1P2MA 3A8DA 1O2QA 1GHAF 1SC8U 1G37A 1NBMD 1O38A 2FOBA 2PGQB 4K69A 4A1XA 2VWMA 5E0HA 4YM9A 1NFWA 1MTSA 1PPZA 2OQUA 1QY6A 5KGOA 1C4Y2 1QR3E 2FX4A 3RM2H 5GNDA 4TWYA 2B5TB 1P2QA 1FY1A 3PWCA 1T4VH 3BV9B 5A0CA 3M35A 1BBRH 1VJAU 3OTJE 1O3NA 2VJ1A 1IQIA 3NK8A 1MKXH 5FBEA 5C2ZA 2G51A 1O0DH 1NPMA 2NU4E 2XYAA 5IK2D 3MU5A 2SGQE 1GCDA 1IHTH 3SU6A 1HGTH 1FV9A 1K1JA 3GICB 1ETTH 3TJUA 3F9EA 4AOQA 1ZYOA 2WZQA 2ZFQH 2XCNA 2A4OA 1ARCA 2B0FA 1EAUA 3Q76A 1KXFA 1MD7A 1D3QB 3EYDA 1CHGA 4OM9A 2AIQA 3U9AH 3VPKA 2I6QA 4OS4A 2A2XH 4BTIB 1GL1A 3WWBA 4DT7B 5GIBA 3PMJA 1T8OA 2HPPH 1ZGIA 4P00A 1D6WA 2ZEBA 1G2MA 5AHGH 4X2XA 4HG6A 3Q3KA 1P10A 1ID5H 1A0JA 1LPKB 1KXDA 3Q3XA 5GDSH 4D7FA 1QBOA 2ZDMA 2AYWA 4OS2A 3SZEA 2H9HA 1SLWB 1YBWA 1YPHE 1AHTH 2XNDD 2BD9A 3FAOA 3SV8A 1WU1A 3SHAH 3MFJA 4AFUA 1VITH 1FUJA 4D9RA 1FIZA 1L0ZA 3ZYDA 1KIGH 3FANA 5EODA 3A80A 1F0TA 2BDAA 1VR1H 3T29A 1G3BA 3F2GA 1DWCH 1TGSZ 1OSSA 2IN2A 3MH4A 1LHGH 2VVUA 2P94A 4UFEH 5ABWA 2PUQH 1ZJKA 3M61U 5GXPA 5DGJA 4XOJA 4CH8B 3CP7A 1PPBH 3NXPA 2OBQA 2VH0A 3GCNA 1QRWA 1SR5C 4ABDA 4NZQA 4NIXA 4BTTB 3OY6U 3UUZA 1BMAA 3RMNH 1XVMA 1JRSA 5E0GA 2RA3A 2VWOA 5JBBS 2XBYA 3BTWE 4Q4LA 4FUHA 1NY22 5CE1A 5HIYA 3OE7D 1CQQA 3SGBE 2OK5A 1LPGB 5GCHF 1KTTB 3N7DA 4IC5A 3SUEA 2TPIZ 1S6FA 2PUXB 4THNH 1NFYA 2KCYA 1BB0B 1MUEB 2BTCE 2G5NA 3KN2A 1GDNA 1P05A 1EAWA 2DE9A 2J94A 1UVOA 3MMGA 4MPVA 3TIUA 3A7WA 3AAUA 2BY9X 2J95A 4K5ZA 2Z9JA 1UTJA 2R3YA 2A4QA 3WW7A 4Y10E 5HXFA 5IDKA 1ZZZA 2J97A 1TABE 3N7EA 2FI5E 3F9GA 1ZHPA 2ZCHP 4K1SA 2CXVA 4X8TH 5CMXH 7GCHG 1QBVH 4XRNA 2A1DB 2AS9A 3C27B 5C67A 1UVPA 2Z9KA 1CA0B 1C5XB 5DP3A 4TPIZ 3T27A 4D8NA 1UVTH 1O5GH 1AFEH 3GY3A 1P11E 1TWXB 2GMTC 2O8TA 3CS0A 4WMEA 1GHYH 5CHAB 4ISLA 4O9VA 3TJNA 1DPOA 3ZVCA 2P8OC 1TIOA 2ZO3H 3DSPA 4RT1A 3MOCA 1QHRB 4YZUA 3HATH 9LPRA 1QB1A 3M3SA 1AU8A 4HI3A 2AGIX 1YPKH 1M9UA 1HPGA 2Y6TA 2GP9B 4X2YA 3MNBA 1L4DA 1TX7A 1O5EH 4KTSA 4OS1A 4I32A 1T31A 2FOMB 1YWUA 4H4FA 2GD4B 5ESTE 4B2AA 1C1WH 1ZTJA 4ISOA 3S9AA 1W7GH 2B8OH 4K1EA 1O2PA 1BBRK
chains in the Genus database with same CATH topology
2GDEH 1YCPM 1VCWA 3SYJA 2WHXA 1MKXK 3GY4A 3QK1A 2G00A 3T5FH 3ZZ7A 1G3CA 1NRNH 1XXDA 3M3TA 8KME2 4IW4E 1G3DA 3SI3H 4UD9H 1GHZA 5C1XA 1F0RA 3AW0A 2RDLA 4MVNA 1TQ7B 3EAJA 1GHBF 1Z6EA 2ZIQH 3SNAA 4BOHA 1GI8B 1RS0A 1HXEH 5T6GA 1THRH 3FKSD 1Z8IB 2WYGA 2AMPA 2J9NA 1P8VC 2ZHFH 1UO6A 3UNRA 1HAPH 3R0FA 3O8DA 1SPJA 1XX9A 4K2YA 3RC5A 3ZVEA 1SFQB 3RLWH 1AN1E 1TX8A 2HGTH 4OGYA 5FPTA 3GCTF 1PPGE 1E0FD 1PQ5A 4JZEH 1RRKA 1TRMA 2ZDKA 1D4PB 2Y5GA 1GMHF 3LJJA 4AGKA 4TYDA 2XRCA 4FXGH 5DPAA 3GDVA 2SGEE 1GGDB 1QTFA 1GBDA 5G4BA 3M5NA 3ZZCA 3P92A 2L6OA 1BRAA 1A7SA 1OP0A 1G36A 1NN6A 1ARBA 1G9IE 4XBBA 3RXQA 2ZHDA 3QUMP 1TMUH 2XXLA 1QIXB 2JETB 2ODQA 1QBNA 2TBSA 4AZ2B 2ZU2A 2YNBA 2ZFRH 3QGNB 1V2QT 1AWFH 1MCTA 1QQ4A 1XUGA 3N7OA 3BTME 1K1OA 2QA9E 1P04A 3WWFA 1MTNC 2CF9H 2QXHA 5F03A 5FCKA 2ULLA 4X8VH 1O2XA 1P9UA 1PQ7A 3P17H 3H7TA 2XC4A 3BIVH 1O34A 2D1JA 1O3JA 4B73A 1GBAA 4ISHH 4E7RG 6GCHF 1TPPA 1DITH 3OX7U 1S83A 4I8HA 1TMBH 1DVAH 2G5VA 2WSSD 1SLXB 4GUXA 1MD8A 3BTHE 1FLEE 1Y5AT 5EXNA 3V7TA 1GWAA 4CRCA 3SNDA 1O3KA 4LZ4B 2R0LA 4B74A 1DDJA 1DWDH 1KY9A 4ZROA 3RXKA 4VGCB 5TCCA 4RKJB 3RMOH 3URCA 2BOKA 1V2LT 5JYIA 1NS3A 2GV7A 1IOEA 1GJCB 2V0BA 2ZKSA 2R0KA 1Z1JA 3MYWA 2ZF0H 3GY2A 3ATLA 1TGTA 1TAWA 1TNKA 1BRUP 2Q6FA 3KGPA 2ZG0H 3RU4D 4FUIA 1E34B 4TWWA 1CBWB 1TNHA 1XUHA 1EP5A 3HGNA 4TY7A 2G52A 1LKBA 1TBRH 4DG4A 2VIWA 2HNTF 1GJ4H 1SGEE 1C5WB 2FLBH 1O3FA 1VGCB 1SGQE 2EA3A 2GKVE 4R0IA 1Z8JB 1F7ZA 1COWD 1AWHB 3GY8A 2ZFFH 2V7QD 2VBCA 1FDPA 4B6EA 2BZ6H 3QO6A 1IQEA 4GCHG 3MNSA 1CT4E 4ZHMU 1H1BA 1MTVA 2O8WA 1C2HA 3P70B 3SGAE 3RXBA 1QL8A 2HLCA 1V2ST 2XC5A 5H4IB 1Q3XA 1QQUA 2ZDNA 2Z3DA 2ZTXA 2GX4A 4MG3A 1O5CB 2C8ZB 2BVRH 5FPSA 2C93B 1AKSA 2GDDA 2JH6D 1WTGH 1HAIH 1LVMA 4I31A 4AFZA 4O3TA 2J5UA 1V2NT 1KTSB 4YOIA 2QF0A 7KMEH 4E7NA 1U6QA 4YOJA 4YLQH 2A31A 3BTTE 1O2MA 1Y3WA 1YF4A 1UTKA 4FETA 4NZLA 4BAKB 3E16B 1H9LB 2A0QB 1OWJA 1XKAC 3QLPH 3TH4H 9ESTA 2A32A 2YOLA 3P8NA 2WV9A 1PPHE 1ELBA 1GJ8B 5EPYA 1ZJDA 2Z9IA 2J34A 1CU1A 2VGCB 3F6UH 1YC0A 5DG6A 1FY3A 4K8BA 1KXCA 4JYVH 1SB1H 1P2KA 3KF2A 1BITA 1E36B 1BMNH 3M7QA 5C1YA 6CHAB 2A5KA 1AFQC 1GBCA 8ESTE 1P9SA 1J16A 1TPOA 3UWJH 4BAMB 5K0HA 1GJAB 1TONA 2GV6A 3RXOA 2W7SA 3NPSA 1HAVB 6ESTA 1EAXA 5DN6D 1W13U 1TALA 5T3HA 2A5IA 3W1EA 1S0QA 3F3BA 3K2UA 2BM2A 1A61H 1GG6C 1O32A 1WYKA 4GVUA 3UPEA 4B2CA 1ZOMA 3D62A 2GCTC 1Q31A 3SJKA 1J14A 3ZYEA 2H9EH 1KXEA 1Z6JH 3MNXA 1SG8B 1TOMH 1QNJA 5C3NA 2JDID 4Y79A 3ODFA 4ZKSU 1LVOA 7GCHF 5LGOA 5K7RA 2FYRA 4ESTE 4ZXYH 4Q7XA 5HMAA 3ENSB 1MQ6A 1P2IA 1SGFG 2CHAC 1GJDB 3SQEE 1HYLA 4LK4A 2M2AA 3BEFB 4HFPB 3RXTA 4A92A 3MTYA 1B0EA 1W14U 1UMAH 4JMYA 4F55A 2VIPA 4HTCH 1EUFA 1OHHD 1TLDA 2FO9A 3STIA 3H5CB 1ETRH 4NWKA 5LPEA 1TGCA 4OGXA 5JDUB 2OC7A 2WUCA 3B9FH 4DW2U 7ESTE 4MPWA 1V2TT 5DKMA 4NA9H 1TE0A 1ETSH 1VITG 2ZQ1A 2FXRA 1NTPA 2C8YB 2KAIB 3QTOH 1EAIA 3E0PB 2PKAB 5EU8A 1MU6B 1PPCE 1O2JA 4AGJA 2GT7A 3RP2A 3ZZ5A 1GHVH 1HAHH 1XUJA 1HJAC 2SGDE 3UOPA 4BXSA 4JZDH 2A7JA 2ZU1A 2BD2A 2ZC9H 1TOCB 1DXPA 2QF3A 4NGAH 3TLOA 2H9TH 3MH5A 5C17A 4NSVA 2NWNA 2BDHA 2P59A 2FP7B 3BTDE 3SUGA 1JIMA 1V2KT 3SU2A 5L2YH 5EW2H 5FXLA 1GJ5H 4UFFH 1ABIH 1K21H 1O3HA 3F9FA 3FZZA 3ELAH 2OC8A 1LQEA 1HBTH 1HDTH 2FWWA 3GY7A 4INLA 2C4FH 1O2GH 1XKBC 3ZVDA 1ZHMA 2XBXA 4YO9A 3PRBA 1BJUA 2SFAA 4Y71A 4IGDA 1E1RD 1WV7H 3UNQA 3BTGE 3SJIA 2TRMA 1RFNA 3SNBA 4B6FA 4WJG2 2Y80A 1C5QA 1MKWH 3WY8A 1C5SA 1O5BB 1MH0A 4Z6AH 2QN5T 1CGIE 1FY8E 4YTAA 3MH7A 4YLUA 4D76A 1F5RA 3BSQA 1P09A 1ESBA 2ZQ2A 1C1TA 3PLKA 1H8HD 2RCEA 1O2ZA 3A83A 4I8LA 2G8TA 2VNTA 1GVZA 3A7TA 4GLYA 3W95A 3M7TA 3LONA 4Q7YA 3RXLA 2VINA 1C5TA 1DXWA 2VVVA 1SQTA 1EQ9A 1A0HB 1IQFA 2C3SA 3T62A 2ZGCA 1EJMA 3ZZ3A 1BOQA 4A7IB 3ZZ4A 2QXIA 3VB5A 1GDQA 5LPFA 2CMYA 1AMHA 5BPEA 2RA0A 4AORA 2BLVA 4E06H 1WUNH 2OP9A 1XXFA 1PFXC 1OWDA 1ZPCA 1ELCA 3S7HB 2QF5A 1O31A 2IPHA 3TPIZ 2WPKS 2Q6GA 1KMHB 1EZQA 1AE5A 1T4UH 1K28D 1O2OA 3QZQA 1GI4A 2Z3CA 4DIHH 1EKBB 1HCGA 2ZGJA 4NFFA 1AIXH 3L6PA 4JYTA 2YMSB 1HRTH 3EQ0H 1O39A 1L1JA 1SMFE 3RXIA 1GBIA 3NUMA 2ZU4A 3U8OH 2V3HH 3MO3A 3BTKE 1RTFB 5A8XA 4GSOA 4ABGA 4WXVA 1HAVA 4DT4A 2THFB 1Y3VA 4JCNA 2LELA 4CR5A 2GTBA 1K1LA 5C1UA 3RLYH 3AVZA 3RXSA 1XM1A 1O5FH 3I78A 1BMMH 1CHOG 5EQQA 2PKSB 1S6LA 1V2PT 1TNJA 1O3BA 4Y8XA 1DICA 1PJPA 1ZSLA 1YCPK 1ANDA 3MI4A 1C5MD 2NU2E 2FYQA 4WVPE 3F2FA 4A6LA 1D3PB 3F2HA 1TNGA 2AHME 3GY6A 4NCYA 1V2RT 1DLEA 2M5TA 3A82A 4GCHF 3HKJB 5E0JA 5EG4A 1BTYA 1V3XA 4YXWD 5L2ZH 4O03A 4J2YB 1ELFA 3K6YA 1HAZB 3TK9A 3LGWA 2A4RA 1PYTD 1ZGVA 3OSYA 2ASUB 3V12A 1RIWC 2ANYA 3D49H 5HKKD 4Y0YE 1EASA 3VGCB 5J4QA 1ZTLA 4OS6A 1NRRH 4X1SU 3S9BA 4CR9A 5C20A 1G2LA 3PWBA 3TJOA 1T8NA 1ZSJA 1IQNA 1XUFA 1UJ1A 4YT7H 4CH2B 4WMDA 1THSH 1L2EA 4X1RU 2KZ4A 5L6NH 1WQSA 4SGAE 3P95A 2BDBA 2UUJB 1O36A 1C2DA 1C5UA 1W8BH 2QCYA 3BG8A 1UHBA 3PMBB 5A09A 4SGBE 1RJXB 3RMLH 2KAIA 3SI4H 1KLTA 4UE7H 5I46H 2OBOA 2PKAA 2ZCKP 1DLKB 1FPCH 2SGFE 5JBAS 4K8YA 2FOHA 4AYYB 1YPHC 3SU0A 1QRXA 2BLWA 3OY5U 3RXEA 1GBLA 1QJ1B 4LZ1H 2GGVB 1BA8B 1C1VH 2C8XB 2OTVA 3SV2H 1TGBA 2PTCE 5L30H 2W26A 1YYY1 1C5VA 1ORFA 1MKWK 3NWUA 3ZIAD 1C5NH 1DUAA 1AY6H 1C5YB 2K1QA 3KHVA 3U98H 2F83A 2OXSA 2FTMA 1H9HE 3O8RA 3A7VA 3LT3A 3ZZDA 1C5RA 3DFJA 1UTOA 2ALVA 2EI8A 2Y7ZA 2EC9H 3MNCA 4CRFA 4AB8A 1N6XA 1PYTC 3TH3H 3F0PA 2ZNKH 2FOEA 4IMZA 1CA8B 3FVFB 3FO8D 2WPDD 3DA9B 1EB1H 1VZQH 4JZ1A 4KTCA 1TMTH 3A8AA 3MO6A 1YLCA 1YPEH 1QRZA 3SNCA 3M7UA 1T8MA 2WUBA 4MLFB 1O3MA 3E6PH 3HK3B 5C0UA 5DP9A 3ZZ8A 2P93A 2AGGX 2ZP0H 4DIIH 3G01A 2BY6X 3RXHA 2HNTE 3OYPA 2ZI2H 1XUIA 1JOUB 4R8TB 2F91A 2ODYB 1W2KH 1O35A 3RU4T 3FOAA 2CN0H 1AE8H 1TRNA 3UFAA 2CK3D 1GI2A 1ELDE 3FP7E 3RXPA 2O8UA 3AW1A 1ELEE 2B7DH 4X0WU 4AFSA 3SN8A 4BNRA 1UCYE 4F4OC 4GHTA 1T32A 4Y76A 3MHWU 3UREA 4CRGA 1E35B 4XSKU 1V2VT 3RDZA 2Z3EA 4E05H 2Y5FA 2QE7D 2BD8A 1VITF 1V2UT 1Y5UT 2BDGA 4ABHA 4YOGA 2A7CA 3NCLA 2F9VA 1DM4B 5FCRA 5A2MH 1LVYA 1C1OA 1KYNA 4Y7AA 4OS5A 1J17T 3SNEA 1P2OA 1NRPH 3GISB 4AG1A 2BQWB 5JPMH 4FU9A 3QGJA 1EPTB 1ZPBA 2A4GA 3TGIE 2LPRA 1K1MA 4ZHLU 1CO7E 2BYAX 1V2JT 3PTNA 3M5MA 1AI8H 1SGPE 1XMNB 2ZU3A 2FOGA 1GVKB 1F5LA 1O2KA 1C4U2 1EX3A 3Q00A 4M7GA 4DVAU 1CA0C 1KLIH 3QN7A 2BZAA 1P2NA 2FPZA 4KKDA 4OS7A 4DURA 5CHAC 1Q2WA 5F8TA 3A8CA 3MU0A 1LVBA 1BRBE 2R9PA 3A88A 2TGPZ 1QURH 5GWZA 1DX5M 2A45B 1GCTC 1NM6A 4ABJA 2VIVA 2O9QA 1AZZA 5A8ZA 3ATKA 1ELAA 1P0SH 2V6NA 3V3MA 2QXJA 3U8RH 1SGCA 1H9IE 1C9TA 2DE8A 5EGMA 3RXUA 3TVJB 2F9NA 1E79D 2XCFA 3IITA 4ZHAA 1GBFA 1W0ZU 4ZCNA 1GI3A 3D23A 1OWIA 1O2HA 2HOBA 1AFQB 4ZUHA 2AFQB 1N8OC 1TPAE 1IQHA 1W12U 2V3OH 4BXWA 3RC6A 2QAAA 1MTUA 3SV9A 2BXUH 3LGUA 1T8LA 4FVBA 5GJ4B 2WINI 2PW8H 3Q77A 1OYQA 1UVUH 4NWLA 3S0NA 3KQCA 5IYTA 1GBBA 3T25A 1S85A 4JZFH 1GG6B 1VCQA 2STAE 3VG8A 1INCA 5FX6A 3ATMA 1MAYA 3P8OA 3K6ZA 1DWBH 4AG2A 2GCTB 2QXGA 4QT8C 1W0KD 5HM9A 1DY9A 1O5AB 2BX3A 1W0YH 3BG4B 1WSSH 2HALA 3CS7A 2A2QH 5LH8A 2V35A 1C2IA 3HPTB 1S81A 4CRBA 1CVWH 1GHXH 1C9PA 4ZKOU 1Y8TA 4ABEA 3BTQE 3O8BA 3LKWA 4FU8A 5DSFA 1GGDC 1K22H 1O2LA 1EOJA 3IWMA 1SQAA 2ANWA 3E1XB 4X6OA 1KDQB 5A8YA 6LPRA 2HVXA 2XNIA 1MAXA 3M5OA 4K3JA 2W7UA 1A46H 7LPRA 1ESAA 1GI6A 1C5PA 1DANH 1J8AA 3UOUA 3MU8A 2XW9A 1TFXA 3A81A 3HGPA 3NKKA 1AGJA 1BTHH 3ZV8A 1H8ED 1ZRBA 1LHCH 3QWCH 1SLUB 3EA8A 3F0OA 2Z9LA 3UR6A 1CHOF 2OUAA 5FHTA 1UCYK 4ZKRU 5FL7D 2BD7A 1YP9A 4YT6H 4FUJA 2ALPA 1D3TB 3ZZ6A 3UY9A 4Y6DA 3LC3A 1C2MA 1TRYA 4B1TA 3RXMA 2ZHQH 1HV7A 2EEKA 1B5GH 2WV4A 1H8DH 2FI4E 3OFND 1O2WA 4MNYA 4NIWA 4Y8ZA 3ZZAA 4U32A 1AB9B 2BY5X 4ZMAH 3PMHB 4FUFA 2C90B 3TH2H 3K9XB 3ZVFA 1MZDA 1EJNA 2OC1A 1FX0B 4TT3D 1Z8RA 1C1NA 4VGCC 1HAXB 1NT1A 3ATIA 3VXEH 3VFEA 4PROA 1HAGE 1O3OA 4MDSA 1A5HA 1FY4A 2H2ZA 4CBNA 4B71A 1NRSH 4B76A 1C2LA 4CHAB 5E2PA 1OWHA 1KSNA 3JZ2B 3SQHE 2Z9GA 1NC6A 1K2I1 1KXBA 3GYLB 4H42U 3NZIA 4K1TA 3U69H 4H6SB 2WPLS 1BTPA 2ZCLP 3PO1B 2QC2A 2ZPSA