2QV1A

Crystal structure of hcv ns3-4a v36m mutant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
151
structure length
151
Chain Sequence
VEGEVQIMSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Phenotypic and Structural Analyses of HCV NS3 Protease Val36 Variants
rcsb
source organism Hepatitis c virus
molecule tags Hydrolase
molecule keywords NS3
total genus 35
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qv1A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2qv1A01
1FY8E 2JH0D 1V2VT 4NFEA 1CA0C 4Y6DA 3M5LA 4WMEA 2PUXB 3GCNA 2QGRA 1QY6A 2A45B 1S81A 4BTUB 1O3NA 1QHRB 1V2LT 1GI1A 2W3KA 1O3MA 2DE8A 4ASHA 2PSXA 1TX7A 3SNAA 1K1LA 1ZZZA 2CN0H 1THRH 3MU0A 3SBKA 3QWCH 2PV9B 2V0BA 1G2MA 2FI5E 3VXEH 2W7SA 1VITH 2FLRH 1HJAC 1L1JA 4K1SA 1OS8A 1FXYA 1GCDA 2P95A 1PPZA 1V2WT 4NIYA 2Q1JA 1O3HA 2XCNA 1XUIA 2FTMA 1LVBA 3A84A 3MNXA 1BZXE 2OC7A 5IYTA 4X0WU 1FUJA 5GCHG 1Y3YA 5E2PA 1ABJH 5FBIA 4GAWA 4LXBH 9ESTA 1A3BH 2ZA5A 3RXMA 1JRTA 2M5TA 1TRYA 2BY9X 3VB3A 1N8OC 1T8OA 5DP9A 4NIVA 4ZMAH 5L30H 3R3GB 1C5NH 4DIIH 3MI4A 1NFXA 4JZFH 4HZHA 3ZZDA 3A7XA 4Y11E 2WYGA 2VINA 4YLQH 2F9NA 3OY5U 1T4UH 3OYPA 4BAKB 1Z8GA 3PLBA 1TA2A 2HNTF 5A2MH 2CF9H 3SV6A 3V13A 4F49A 3EE0B 4TYDA 1TABE 2ZIQH 4FU7A 2GVFA 2PUQH 2FWWA 4ISHH 2GTBA 1WAYB 3K2UA 2EA3A 2P3TB 1PYTC 1GWAA 2I6QA 3E1XB 1NU7B 1OPHB 5T1VA 3L3TA 1UTLM 1OYQA 3BIVH 3EA8A 1DANH 1XUKA 2JETC 1UTKA 1ZHPA 3SUDA 3HPTB 4GHTA 2NWNA 2BM2A 1MD8A 4JCNA 3QLPH 5AFZH 3T26A 4Y8XA 4I7YH 2ANKH 2B8OH 3LC5A 4IGDA 1NC6A 3RMMH 1AMHA 1O5AB 3TJUA 2F9VA 4X1RU 4KTSA 1O2XA 2BDCA 1XUHA 4X1QU 2Z9IA 1P8VC 4BNRA 3GDSA 1SR5C 4WJG2 1WXRA 2RG3A 2PKAB 2BQ6B 1DE7H 2ZG0H 9LPRA 2C8WB 1GMDF 2BDIA 1C5UA 1Y5UT 3V3MA 1AWHB 2HPQH 1QCPA 4UFDH 4K1TA 1FY4A 1IQNA 1WV7H 5DP5A 2ZF0H 1GBCA 3RXEA 4I8GA 3ZV8A 3SI3H 2TPIZ 1UHBA 1BMNH 2TGPZ 1EAWA 3SGQE 1EZXC 3SU0A 3MH4A 1KDQA 1NY22 3BG4C 1KSNA 1QL7A 4X8UH 4B74A 2AGEX 1QRWA 1TGSZ 2SGQE 2XYAA 1LPGB 3RXQA 1IAUA 4FUGA 1LHEH 1Z7KA 2PGQB 1J9CH 3P17H 5FCRA 4NIWA 2AMPA 1ANBA 7ESTE 1V2PT 3PTBA 1PFXC 4YTAA 1BTHH 4X2XA 3A7ZA 1PPBH 2FIRH 4BOHA 4AN7A 1GBFA 2H6MA 2D8WA 1GVLA 1TRNA 1OKXA 4J1YA 1DITH 2A5IA 1YLDA 1C1PA 1GHWH 4UFFH 4CHAC 4AGJA 1LQDB 1NS3A 4X8VH 1W14U 4ZXYH 2D2DA 1MKXH 5ABWA 3S0NA 4ZHMU 3C1KA 3QUMP 3SN8A 1SFQB 1SLVB 1LHFH 3RUOA 1FIZA 1MU8B 5C5OA 1P2OA 2FOFA 5EQRA 3TH4H 2C93B 2ZHDA 1G32B 1O5CB 2FOGA 5HYOA 2J34A 3ITIA 1AE8H 3ZZ7A 2BVXH 1FY5A 1VZQH 2VIVA 5HMAA 3TU7H 2Z6BD 3LKWA 4KTUA 3P95A 2PSYA 1IQEA 3URCA 4ZH8A 2K1QA 4B2BA 3VB4A 1MQ6A 4JYTA 1EAXA 1N1LA 3RXIA 4RN6A 1IOEA 1MZAA 2ZI2H 1V2KT 1T32A 2VIQA 3T28A 1O2KA 1F2SE 2F3CE 1DY8A 1P12E 4ISIH 3S9BA 1SL3A 4FXGH 4CR5A 1A4WH 1JOUB 1FV9A 1GL0E 1P57B 5FPSA 1EUFA 1S0RA 1O2MA 2VVCA 1HAVA 1Q2WA 3K6ZA 2Q6FA 3EGKH 2FX6A 3RXOA 2A31A 1ETRH 2ZFRH 4ZAEA 2QN5T 5GWZA 2F9PA 2ZU5A 2H2ZA 4CHAB 1KXEA 1ARCA 1LPZB 2J95A 4WMFA 1GJ9B 2J4IA 2KAIA 1ZPCA 4TY7A 1A46H 2J9NA 1PPFE 3UTUH 1AGJA 1CHGA 1TLDA 2WZQA 1TBZH 8LPRA 4YT7H 4IBLH 1BTXA 1GJ7B 4K8YA 4IMZA 3GY3A 1TMTH 2CMYA 4WMDA 2OCVB 1EJMA 2VIDA 4YESB 1FNIA 3AASA 1QURH 3A7TA 3EA7A 4ZHLU 1BTUA 2W26A 2ZKSA 1IQGA 1DSUA 3F9EA 1CGJE 2XBWA 1O5DH 1PPHE 2NU3E 5CMXH 1DWEH 5A0BA 2HRVA 1TA6A 1RXPA 4MNWA 3MNSA 2SGAA 3HK3B 4AFUA 2BDAA 2PFEA 1C1RA 2ZFSA 4RKJB 1ELCA 3H5CB 2ZTXA 1C5TA 4TPIZ 1GJ6A 1WTGH 4AFZA 3FZDA 1O5EH 2FXRA 1F0TA 4CRDA 1C1TA 1O32A 1HJ8A 3KQCA 1FPHH 2Z94A 1C2KA 1O2QA 1GG6B 1DVAH 3ZYDA 1C1UH 3SUEA 1AWFH 2ANYA 1EAUA 1GBMA 1C5YB 2VIWA 1V2NT 1GBAA 2J2UA 3BG4B 5GDSH 5GPIB 1GHBF 3TJVA 1DDJA 2ZU2A 5AF9H 4INLA 5DKMA 3MYWA 4JYUH 2Z3DA 1GI3A 4Y0YE 4WVPE 2WPHS 1GL1A 3JZ2B 4O3UA 1BBRH 2P8OB 2UUJB 4ZXXH 1X7AC 4AGKA 3QTVH 1D3PB 3M7TA 5HXFA 4U2WA 4HGCA 1AKSA 2BD2A 1TNJA 2WV4A 2Z9KA 3BTEE 1K2I1 3MH5A 1GMDG 1KXCA 4Y10E 5TJXA 3JZ1B 3ODFA 2XCFA 2QYIA 1CGHA 1H1BA 4AFQA 1C5MD 1EZQA 3DFLA 1B5GH 1ABIH 1ELGA 1GJAB 1KXFA 4CRCA 1F5KU 1EAIA 1GHAF 4I32A 4KELA 2GCHF 1QL9A 1FDPA 1W7XH 2HLCA 1UK3A 1HAZB 1BUIA 1G3BA 3ZZ5A 1OWIA 1HB0B 2BY5X 1O2ZA 2CF8H 2BLQA 2AGGX 1GDNA 2A7HA 1XKAC 1AN1E 1BRUP 4NWLA 2IJD1 2DUCA 1O3IA 1KTTB 3SJOA 1ACBE 1GJDB 4ZKOU 1THSH 3HGPA 4FUFA 1UMAH 5HM2A 1JWTA 3MTYA 4ABGA 2A4QA 2VVUA 1SGEE 1CHOG 4DGJA 2JH6D 2FOMB 1FZZA 1TBQH 2Y6TA 5LPEA 2GMTB 1SGFG 1QQ4A 4AB8A 2C3SA 3SV7A 3M5OA 2BOHB 2QF3A 3FFGA 3VB7A 1H8IH 4X6MA 4UONA 5CE1A 1UVOA 4MG3A 1VR1H 2HALA 1RRKA 3ODDA 1MCTA 1HRTH 1HAIH 3A8CA 2HNTC 5ESBA 2VGCB 2WHXA 1SMFE 1NPMA 1BCUH 2FEQH 1ANCA 1CBWC 4MDSA 3HATH 4X6NA 8GCHG 4JZ1A 1FY1A 1Z71A 2XW9A 4ISOA 2FS9A 1TGBA 1Z8JB 4B6EA 1DX5M 4LZ4B 1T31A 1NU9A 2PGBB 1P0SH 2TRMA 2P94A 5J4QA 4MNVA 1IQFA 3SO3A 4VGCC 4MVNA 1ZPBA 3IITA 2P3FH 4IMQA 4AG2A 5HM9A 2GGVB 1F5RA 2QA9E 1C2IA 2IOTA 1RTKA 3FP6E 4GSOA 3TNTA 3ZZ6A 5A0CA 3EA9A 4D76A 3KIDU 2TGTA 3RXAA 1FMGA 1S85A 4XOJA 2OTVA 1ESBA 4YT6H 5JBAS 2ANMH 3UQVA 4AYVB 1TNIA 1RFNA 3K6YA 2AIPA 4NCYA 2FO9A 5BPEA 3RM0H 1E37B 5C1YA 3RXDA 1BA8B 1O33A 1O2GH 2BLWA 1O2LA 1P06A 1DFPA 5FX6A 3ZZ8A 1AUJA 2VH6A 3GY8A 3RMOH 1QL8A 3C27B 2A32A 2HWLB 2D1JA 1XUJA 2ZU1A 1MU6B 4Q7YA 2ZTZA 1A61H 5HGGA 1W0YH 1AE5A 1O37A 3QK1A 1C5WB 3LC3A 3MU1A 3SJKA 1AB9C 2ESTE 1O2UA 3GY2A 2A2QH 1YGCH 3QZRA 2OBOA 1OWJA 2FI4E 3SJ9A 1YPHE 5FHTA 2EI7A 3PO1C 3A7VA 3SV9A 1Y3UA 2TBSA 3T5FH 3LJOA 2P3UB 4JK6A 5F8TA 1FLEE 1GHYH 1BHXB 1CBWB 3KNXA 2BD4A 2QV1A 3TGJE 5LGOA 2G52A 1TPOA 3AVZA 3A86A 1OXGA 1DXPA 1O3GA 3LJJA 1SG8B 1N6XA 4WH6A 4UEHH 3P70B 1P2IA 1HFDA 3F6UH 1GI0A 1UTMA 1V2OT 4VGCB 3NXPA 2IPHA 5JBTA 2V3OH 5DP8A 3T27A 2W3IA 3A89A 3RXRA 3BTFE 1ZHMA 1ELVA 1P11E 1BMMH 1F5LA 1TPSA 2I6SA 2VIPA 2P93A 5JB9S 2GT7A 1T4VH 4KP0A 1S83A 1PPEE 2FZZA 2ULLA 3UNQA 1V6DA 3U1IB 3GYLB 4TPYA 3GY6A 1A2CH 3L33A 1RTFB 1Y3WA 3P6ZB 1KXDA 4DG4A 2ODPA 2STAE 5EPNA 1WU1A 2PKSC 2ZHWH 1EZUC 3FAOA 2FS8A 3M37A 4D7GA 1TNLA 4NG9H 2R0LA 2OINA 4CBNA 1MD7A 3BEUA 4J2YB 3GY4A 3T25A 1NT1A 4U32A 3RXUA 1O2IA 3SGBE 3ATMA 4FUIA 3SU3A 1FIWA 1A0JA 1O3BA 2Z7FE 3BEIB 1IQIA 1EATA 1UO6A 2ZQ1A 4AOQA 1ELEE 1DLKB 4MTBA 1J17T 1H8DH 1YKTA 2WPIS 3RC6A 2PTCE 3M3TA 3O8CA 3P8FA 1K1JA 2C90B 2OQUA 3FP7E 5JBCS 4ISLA 2QXIA 4YO9A 1LTOA 2XXLA 3NWUA 1MAXA 1P9UA 5G4BA 5AHGH 1C4U2 1SGPE 3TITA 3TK5A 2WUCA 1DPOA 4ZROA 4DIHH 2WV9A 3DT0H 3EYDA 4F4OC 1P2NA 3E8LA 3TK6A 3UREA 1YPEH 1SGYE 1HIAB 3S69A 4CREA 1GI5A 3SNDA 1XVOA 4BTTB 6CHAB 1VCWA 1H4WA 3LONA 1F0UA 1EOLA 2FI3E 3A81A 3BIUH 1SLXB 1TQ0B 4MPXA 1G3CA 2AS9A 1AD8H 1LCYA 3SJ8A 1BBRK 4AFSA 1A5HA 2AEIH 2OUAA 1YLCA 1DUAA 3BEFB 5AFYH 1JXPA 3LGVA 3I29A 3R0FA 1CA0B 2A1DB 2C8ZB 2PHBA 1O2PA 1UTJA 1LMWB 1G3DA 3PLKA 1EJNA 1F7ZA 1ELFA 3LH1A 1GGDB 4XBDA 3RXPA 1V2ST 4O9VA 2G81E 1MTWA 1Z8RA 1HDTH 5B6OA 1E34B 3KQDA 1MQ5A 2B0FA 1KTSB 1RS0A 5LPRA 3MH6A 1YPGH 5K0HA 4NSVA 3ATLA 5I25A 1Z1JA 1KLIH 3LGWA 4OS6A 2QXJA 3ZVAA 4BAOB 1GMHG 3PMAB 3E90B 2V3HH 3O8BA 2AFQB 3SU6A 7GCHG 1YF4A 1ZTKA 1XM1A 3DA9B 2BDGA 1ELBA 1O2HA 2EC9H 3D65E 2UUFB 2Q6DA 1WOFA 4D9RA 5BRRE 1EKBB 2ZCKP 3T29A 1D3TB 1SLWB 2CHAC 1BTWA 3Q76A 4U30A 3PTNA 1O3DA 1V2QT 1W11U 3MO9A 1ZPZA 4ABHA 1P2QA 3PLPA 2SFAA 1GBKA 2G51A 2TGDA 5PTPA 3MO6A 2OC8A 2XWAA 5F8ZA 1LKBA 1W2KH 3CENA 1VJAU 4ABEA 3A8AA 2ZEBA 1EB2A 4O03A 1V3XA 1BMAA 4U01A 1C5QA 3AW1A 1SSXA 4X6OA 3D62A 3RC5A 3KQBA 2FTLE 3QDZB 1SPJA 1J8AA 1IHSH 1QIXB 3OU0A 4NGAH 1GI9B 1OWHA 1L1NA 2ALVA 1GJ4H 2OC1A 1G36A 1NRRH 3PWCA 4HFPB 2GX4A 2GZ7A 4NSYA 2H9EH 1AY6H 1GHVH 1K1IA 3LH3A 1AFEH 1S84A 1OWEA 4M9FA 4X1PU 5EPYA 3ATIA 1TOCB 2XTTB 1A0LA 3A8DA 2XRCA 3Q3YA 3HK6B 1SBWA 1VGCB 1EPTB 4B2CA 2FP7B 1D3QB 3ZZ4A 1EZSC 1QBOA 2VNTA 1BQYA 1QB9A 3E0PB 3GICB 1GHAG 2ZFFH 2O8WA 3PB1E 1BTYA 5EQSA 3VB5A 4DT7B 2ZQ2A 1YC0A 1F0RA 3IG6B 5A8XA 4ABFA 2VU8E 1GHXH 2A4GA 3ZYEA 1LKAA 2WPJS 4B71A 3BSQA 2F4LA 3TPIZ 4E05H 1C9TA 1O3CA 1XUGA 3UR9A 3SI4H 2BDBA 2BVRH 4AYYB 5C5NA 1XKBC 1YCPK 3F9HA 1DY9A 3TGKE 4XFQA 1V2RT 2BLOA 1UVSH 4UE7H 3NZIA 2R2MB 1ZHRA 3QN7A 2W7UA 2GD4B 1K22H 3KEEA 1AVGH 1C1OA 1THPB 2B5TB 1C5OH 3LT3A 3U8TH 5JPMH 1TX8A 4I31A 4D7FA 2XWBI 1Q3XA 4Y76A 3A87A 4FU8A 1O31A 3KGPA 2H1UA 2QXGA 2AIQA 1SVPA 2BDHA 3BTTE 4O3TA 1UK4A 5FCKA 1HXFH 1GCTB 1FPCH 4WF8A 1K1NA 2QCYA 3T62A 1FN8A 1HV7A 4TWYA 3UWJH 3O8DA 1NTPA 4CBOA 2R3YA 1TGNA 1CO7E 2ZZUH 3TIUA 1FONA 1P01A 1WQSA 1SI5H 2O9QA 1ZRKA 2CGAA 1K1MA 2QF0A 5DO4H 2GV6A 5EODA 4YOJA 3U1JB 1DLEA 4BAHB 1NRNH 2VWNA 2QC2A 1GBLA 3NPSA 3ATWA 3QO6A 2GCHG 1HAXB 3A82A 3Q3KA 4KTCA 1GI2A 1W12U 1Y59T 1O30A 1PQ5A 3A7WA 3QZQA 1D3DB 1LHGH 1W10U 1G30B 2ZGJA 1ZGIA 4INKA 2P59A 2VH0A 4X2YA 1TOMH 2WYJA 2F9UA 7LPRA 3SUFA 2BZ6H 3BV9B 6GCHF 3L6PA 1BRCE 1C5VA 2Y81A 3SGAE 1S0QA 1SC8U 2OD3B 2ZFPH 1JIMA 3AAUA 4K60A 2BVSH 4IN1A 1P3EA 2A4OA 3RU4E 1ZRBA 1AVWA 1MBMA 4LK4A 4GHQA 3LIWA 2BTCE 4B76A 5FBEA 4HI3A 3B9FH 1O2YA 1J14A 3MNCA 1QJ7B 5DGJA 1E36B 5TCAA 1SFIA 1EPTC 2ZCLP 1DWDH 1QBVH 1P2JA 1C1WH 3SW2B 4ABAA 1LVYA 2FOHA 3PO1B 1O5GH 1XXDA 3VB6A 1O34A 1CVWH 4DVAU 3ZVEA 5A8ZA 2YNBA 2ZPQA 4WXIA 3V7TA 1VJ9U 5FX5A 1DWBH 1P04A 1XXFA 2F91A 1S6FA 4DOQA 2D26C 3KF2A 4OS4A 1P2MA 4BANB 1TWXB 2GZ9A 4Q2KA 2FX4A 2R2WU 1KIGH 1C2EA 4SGBE 4X1SU 3M35A 4B73A 3PMBB 3H09A 2AH4X 2EI6A 4AG1A 1W13U 4PROA 2G5NA 1EOJA 3PM3A 1D4PB 1A1RA 2HOBA 3ZV9A 4BAMB 2BD9A 3FANA 1GDQA 5EXMA 3K9XB 1QB6A 2G4TA 3GCOA 1D9IA 1TYNA 2KAIB 1NROH 1QGFA 1TE0A 3W95A 2Z3CA 3UFAA 2P16A 1AIXH 2AMQA 4DY7B 1L0ZA 1JBUH 3TJNA 1M9UA 4Y8YA 1AO5A 4ABJA 1L2EA 1HCGA 2UUKB 3P92A 1OWKA 3F1SB 2BD5A 2OBQA 1SQOA 3E3TA 3LGUA 2UUYA 1N8OB 5I46H 1CU1A 1CT0E 2PR3A 2AGIX 3DHKH 1SGNE 5A0AE 1EPTA 4JYVH 5A09A 4B1TA 3RXCA 3RMLH 4DCDA 2H5DA 3A80A 1S82A 1C1VH 4MQAA 1KY9A 1SQTA 3ZZBA 3TGIE 3KCGH 4D8NA 2LNCA 3MHWU 8ESTE 7KMEH 3FZZA 4B2AA 3P8GA 4AX9H 2XC4A 1QJ1B 2Z3EA 2Y5HA 1NRPH 1TRMA 5F8XA 3RM2H 3MFJA 2UWPA 3F9FA 4WY3A 2R0KA 3A83A 1P03A 3NUMA 1GBIA 1BMLA 2VJ1A 1P02A 1E35B 1A0HB 1UTQA 3BN9A 5DJ7A 2BYAX 1QB1A 2RCEA 3ZVFA 4CRBA 3UR6A 2Y5GA 2A7JA 2ZGHA 1P10A 3KN2A 3RXSA 3MWIU 4BXWA 1Z6JH 1EP5A 1ELDE 2HNTE 2FOCA 1LQEA 1L4DA 1GBDA 5GJ4B 1O3AA 2Y80A 2ZHEH 4GCHG 3SJIA 3S9CA 1TONA 1RTLA 2BMGB 2SGDE 1Z1IA 4CR9A 2GDDA 4KGAA 2ZDLA 1HAPH 2YNAA 1J16A 1TMBH 1UVTH 2WPMS 2ZGBH 3ESTA 1EASA 1GBEA 1D6WA 1KLJH 4FUBA 1HAOH 1ZOMA 4ABDA 1K1PA 1NRSH 1GPZA 2WINI 1FI8A 1UVUH 4E7NA 1BDAA 2ZDVH 4MNXA 4Y8ZA 4THNH 1GGDC 1SGIB 1V2MT 5DP7A 1ZMLA 3A88A 5EG4A 1IQLA 1ZR0A 2O8MA 4XDEA 1VCPA 5E2OA 1YM0A 2ODYB 1PJPA 4INHA 2J92A 3T2NA 4M7GA 3U8RH 4MPWA 3BTGE 3SHCH 1GI8B 1AKSB 4I8HA 1W3CA 1AI8H 2J38A 2C8YB 3B23B 1TGCA 1KXBA 4H4FA 1YPHC 2PKAA 1RJXB 5CHAB 3UY9A 3M5NA 2STBE 3SV2H 3UWIA 4FVBA 1GG6C 3TK9A 1VITG 3BTHE 1S6HA 1MBQA 1E38B 1TMUH 1HXEH 4HTCH 1GMCF 2ZTYA 1C5XB 2CHAB 4MPUA 3UUZA 3MH7A 3LGTA 4FUDA 1TALA 5C67A 2VVVA 1Y5BT 2JKHA 1U6QA 1UCYH 1SGRE 3V12A 4AB9A 4H42U 2P8OC 3AAVA 3ZVGA 3I78A 1UTPA 3AW0A 4H6SB 1AQ7A 1OWDA 1Z6EA 4SGAE 2BZAA 5AVDA 2OQ5A 3GDVA 1BITA 1O3PB 3UPEA 1MKWK 2NU2E 4YLUA 1W8BH 1O3OA 4A1XA 2Y82A 1TQ7B 1AFQC 1SGTA 4R0IA 1ZTLA 3SQEE 3GDUA 3DD2H 4B75A 1MH0A 3V0XA 1O3KA 1H9HE 2HVXA 2Z9LA 4NA8A 1RD3B 1C1QA 1O35A 1O5BB 1WSSH 5FXLA 3IWMA 1HPGA 1P2KA 4ABIA 1GI7B 4RSPA 1AZZA 1NN6A 2GP9B 4K8BA 3VFEA 1CQQA 3RP2A 3W94A 2VGCC 2XBXA 3E6PH 3MO3A 1MKXK 2WV5A 4I8KA 2FMJA 4MPVA 1FQ3A 1OP0A 4UD9H 1A7SA 1CT2E 1SGQE 2EEKA 1NM6A 5E0HA 1G2LA 3HGNA 3M5MA 5EW1H 5F6MA 1SOZA 1TNKA 1AU8A 2G55A 2ZP0H 2VWMA 1ZTJA 4TY6A 4X8SH 1QFKH 1UK2A 2ZWLH 1GJBB 2LPRA 1C1NA 3STJA 5A8YA 3CS0A 1HAGE 1QTFA 3RXGA 4AZ2B 1MTUA 2WUBA 3D49H 1RIWC 4YOIA 1BIOA 1GVKB 3PV4A 4X2VA 1BRBE 1K21H 5JBBS 4ZUHA 2ALPA 5DP4A 2BY7X 3OY6U 1IQHA 4CRAA 1CGIE 5FPYA 1GJCB 1C5RA 5T6GA 3VEQB 3RLYH 5B6LA 2J94A 1C5ZB 1UHBB 3SNEA 3ZZCA 2ZO3H 3RLWH 1EB1H 3SYJA 4X2WA 1SGFA 3RDZA 1VITF 1SGDE 3U9AH 2F9OA 1C5PA 4JZIA 1O3FA 7GCHF 1DICA 1W0ZU 2Z9JA 5J4SA 1VGCC 1LO6A 4OS5A 2H9HA 4O97A 4E7RG 1ORFA 1Y5AT 4R8TB 1JMOH 1WQVH 4NA9H 3SZEA 1D6RA 3MU4A 2Y7ZA 1LHDH 4ABBA 2G8TA 1ZJDA 1YP9A 1SB1H 2FM2A 1L4ZA 1LDTT 3ZVBA 3BTKE 3ZVCA 2GV7A 1SQAA 3SV8A 2R9PA 3SNBA 3TH3H 3TH2H 1S5SA 4ESTE 1O2RA 3TNSA 4RKOB 2ZDMA 5EOKA 3CS7A 3RXFA 1IQJA 5TCCA 2FODA 4IN2A 2B7DH 3Q00A 2XC0A 1UTNA 1C2GA 4OS1A 1WTHD 2SGPE 5DP6A 2A7CA 5K7RA 6GCHG 3KL6A 1DWCH 5DG6A 1IQMA 1CA8B 4I8LA 4Z0KA 3GCHB 1P05A 4NWKA 1ESTA 1OP2A 3UNRA 1SLUB 2XC5A 3ZZ3A 4GPGA 3LOXA 3S7KB 1SOTA 1O0DH 1AHTH 1QA0A 2BQ7B 4ZKRU 1AUTC 3M3VA 2Y5FA 5FPTA 2RA0A 1HJ9A 2QY0B 1PQAA 2GDEH 1GCTC 1XVMA 3F68H 2ZDAH 3N7OA 4X6PA 1BTPA 1PYTD 1O2WA 4JZDH 1C2JA 1YPJH 1NZQH 1O38A 2A5KA 4JMYA 8KME2 5H4IB 1UVPA 1TAWA 1T8MA 3LGYA 4WWYA 3UNSA 2ZPRA 3BTQE 3AK5A 1GI4A 1YPLH 2ZHFH 3M61U 4MNYA 2OP9A 1BT7A 2ZECA 3DUXH 1Y3VA 2UWLA 1HAVB 3FVFB 3TVJB 1B7XB 2BY8X 2UWOA 2VB0A 4YOGA 1ZSLA 1KXAA 1GI6A 2BHGA 5EXNA 1O2VA 4Y7BA 2ZFTA 1HJAB 2FPZA 4ZKSU 1YBWA 4OGXA 3RXVA 3MU5A 3LGIA 4IW4E 1LHCH 3OTPA 1HAYB 2FOAA 4B6FA 3STIA 3M7QA 2BXTH 4FVDA 1DUEA 5ESTE 1XX9A 2G4UA 1O2SA 2EI8A 1KDQB 3EAJA 4K3JA 2ZPSA 2XBYA 4A1VA 5E0GA 5T6FA 3GCTF 3H7TA 2GCTB 3GCHC 4GUXA 1ZMNA 3SZNA 1B0FA 2SNVA 1LVOA 1G37A 3BTME 2CXVA 4K1EA 1QQUA 3PMHB 1MMJN 2G5VA 1JRSA 2NU4E 2W5EA 1TPPA 2SGEE 4UFGH 4TWWA 3SNCA 2NU0E 3PWBA 2HGTH 3LU9B 1HIAA 2ZU4A 3RMNH 2BY6X 5DK1A 3EDXB 3SHAH 5GCHF 4A92A 5IDKA 2DE9A 2RA3A 1O5FH 1QNJA 3GY7A 3MMGA 3M36A 1OP8A 5L6NH 1XMNB 4LZ1H 1UTOA 4RI0A 3BTWE 4XBBA 1GHZA 4LOYH 2WPLS 4YZUA 5JYIA 3HKJB 1A5GH 5GXPA 5C20A 4FUEA 1WYKA 1GJ5H 1ANEA 2V35A 4CH2B 3D23A 5JDUB 4ZHAA 1QA7A 5JB8S 3RXKA 4X1NU 4UDWH 2VIOA 3U8OH 2WPKS 2BX3A 1OYTH 2JETB 3VPKA 2GMTC 1IQKA 1HYLA 2ZGXH 2ZDNA 1MTVA 4E06H 3P8NA 2BQWB 3SU1A 3P8OA 5T3HA 2A0QB 2GZ8A 2BOKA 4IC5A 3URDA 4QT8C 1YYY1 2GT8A 1A5IA 3RXBA 1O2JA 1C2DA 3RU4D 5DP3A 1BJUA 2AMDA 1TPAE 1C2MA 1Y3XA 3VXFH 3QGNB 1FY3A 4WXVA 1UCYK 4Y79A 1A3EH 2TGAA 1ELAA 1AZ8A 3S9AA 1HBTH 2PWXA 5LH8A 1H9LB 1HUTH 2BD8A 3KHVA 1FN6A 1Y8TA 1MKWH 1AB9B 3CP7A 4XBCA 1YPKH 1Z8IB 1ZLRA 4Y7AA 4ZKNU 3WY8A 1DT2A 4BTIB 3ZVDA 5C3NA 2F9BH 1V2TT 5EQQA 1OOKB 2F83A 3SOSA 4CH8B 5EW2H 3VGCC 2H9TH 2IN2A 5FAHA 1O3EA 3MOCA 1IHTH 1PPCE 4NFFA 1TX6A 1BB0B 1CSOE 1FAXA 2PLXA 2ZDKA 4DJZB 3GCTG 4I8JA 1V2UT 1B0EA 1OX1A 1ZSKA 3I77A 2OXSA 1DS2E 2O8UA 3KQEA 4BXSA 4A5TS 4K2YA 1C2HA 2Y7XA 2ASUB 4WH8A 2O8TA 3UQOA 2BD7A 1K9OE 1F0SA 3ELAH 2QXHA 4A7IB 2FOEA 2FYRA 2GCTC 2ZGCA 1MZDA 1K1OA 3E91A 5E8EH 1PQ8A 4Q80A 1PPGE 1C1SA 4JK5A 3ZZ9A 1MTSA 2Z9GA 1QRZA 3O8RA 3QX5H 1NFWA 1V2JT 1WCZA 1T7CA 3B8JA 3BF6H 4CRFA 3A7YA 1CHOF 4NIXA 2JH5D 5T6DA 2TIOA 3BG8A 1O36A 3F9GA 1ETSH 1C2LA 2XBVA 1O3LA 1NFUA 5CHAC 1FJSA 2OK5A 2SNWA 3FP8E 2ZNKH 4GVUA 4OS7A 3RXHA 4IS5A 1O3JA 1MTNC 1TBRH 1OSSA 3M3SA 1CT4E 4XSKU 3NCLA 5EXLA 1EP6A 1CE5A 2THFB 4KKDA 2HPPH 3EQ0H 1BTZA 1DM4B 3RC4A 4BAQB 1EJAA 4H6TA 2R3UA 2VWLA 3Q3XA 2ILNA 2GKVE 2YOLA 1YCPM 1Q31A 4UFEH 2C8XB 1WUNH 1EQ9A 1BRAA 1KYNA 1NO9H 1GBTA 1TGTA 1PQ7A 2H5CA 1TNGA 3NKKA 4X8TH 1GBHA 1QR3E 4NZQA 6ESTA 1O39A 1O2NA 1RGQA 1AFQB 1DXWA 2V6NA 4OS2A 3ATKA 2C4FH 1YCPH 2PTNA 3ZZAA 1P09A 1P9SA 3SQHE 3QGJA 4D9QA 2PW8H 2FESH 5EU8A 2ZHQH 4CRGA 1TIOA 3SUGA 1VCQA 2FDAA 1UJ1A 3SORA 1BJVA 2CJIA 5DPAA 2BXUH 3SU4A 3U69H 1GJ8B 1E0FD 3RXJA 1ZSJA 4Q7ZA 4FUHA 2ZCHP 2FYQA 2O8LA 2OLGA 2ZFQH 1ID5H 1T8LA 1SGCA 1EX3A 2ZC9H 1DOJA 1C5LH 4DW2U 1C1MA 1ZGVA 3TJOA 2A4RA 5L2YH 1ZYOA 1KLTA 1RIWB 2A2XH 5C2ZA 1GBBA 1ZJKA 1C4V2 2QAAA 1INCA 2XNIA 3OSYA 5EGMA 2ZU3A 3TLOA 1QBNA 1TNHA 2G00A 5L2ZH 1UCYE 1C2FA 1MUEB 1AVXA 1ZMJA 1NESE 3GOVB 1YPMH 5E0JA 4Y71A 1NRQH 5C1XA 4Y0ZE 1G3EA 2NU1E 8GCHF 5C1UA 1HAHH 3ENSB 1GDUA 2A5AA 3K65B 1QRXA 4K69A 1ETTH 1F92A 1GMCG 4OM9A 1BOQA 4Z6AH 2CV3A 1GVZA 4A1TA 1C4Y2 3E16B 3LPRA 2PKSB 4FU9A 3UOUA 1ELTA 5GIBA 1ANDA 2SGFE 1LVMA 3A85A 1SHYA 2ODQA 3Q77A 2Q6GA 4GLYA 1J15A 3A8BA 1GBJA 6LPRA 1GMHF 4OGYA 5F03A 3SU2A 4A6LA 3RXTA 2VWOA 3VGCB 1FAKH 1O2TA 1TB6H 3HKIB 2BX4A 1GHBG 2BLVA 2BB4A 1T8NA 1H9IE 1BBRE 4NZLA 1HLTH 2FOBA 2RDLA 3OX7U 4K5ZA 4MLFB 3LDXH 2QIQA 3M7UA 3MNBA 4JZEH 1MAYA 3NK8A 4GCHF 3U98H 3GYMA 1C9PA 4I33A 2AERH 3MU8A 4XE4A 3GISB 1LPKB 1EXFA 4NA7A 4DURA 3RU4T 3QTOH 1C5SA 5LPFA 1WBGB 3E0NB 3OTJE 3GY5A 2BD3A 1NFYA 3RXLA 5GNDA 2FLBH 1BHXF 1L1GA 1TFXA 3UIRA 4FUCA 3S7HB 1ESAA 1DSTA 1QJ6B 5ETXA 4IC6A 6CHAC 3G01A 3UOPA 5SGAE 2IJOB 3PV2A 1W7GH 1K28D 3PV5A 1XUFA 3DFJA 1MTNB 4FUJA 2BDYA 2AYWA 4YM9A 2VBCA 3PROA 3BTDE 4ISNA 3SU5A 1G9IE 1O2OA 1JIRA 1SHHB 3H7OA 3PMJA 4Q7XA 1ARBA 2ANWA 1N6YA 3PYHA 2OC0A 2B9LA 4AORA 1HNEE 1MCVA 1P3CA 1HGTH
chains in the Genus database with same CATH superfamily
1FY8E 2JH0D 1E1RD 1V2VT 4NFEA 1CA0C 4Y6DA 3M5LA 4WMEA 2PUXB 3GCNA 2QGRA 1QY6A 2A45B 1S81A 4BTUB 1O3NA 1QHRB 1V2LT 1GI1A 2W3KA 1O3MA 2DE8A 4ASHA 2PSXA 1TX7A 3F0PA 1K1LA 1ZZZA 3SNAA 2CN0H 1THRH 3MU0A 3SBKA 3QWCH 2PV9B 2V0BA 1G2MA 2FI5E 5EJLA 2W7SA 3VXEH 1VITH 2FLRH 1HJAC 1L1JA 4K1SA 1OS8A 1FXYA 1GCDA 2P95A 1PPZA 3PRDA 1V2WT 4NIYA 2Q1JA 1O3HA 2XCNA 1XUIA 2FTMA 1LVBA 3A84A 3MNXA 1BZXE 3F2FA 2OC7A 5IYTA 4X0WU 1FUJA 5GCHG 5KGOA 1Y3YA 5E2PA 1ABJH 5FBIA 4GAWA 4LXBH 9ESTA 1A3BH 2ZA5A 3RXMA 1JRTA 3U28C 2M5TA 1TRYA 2BY9X 3VB3A 1N8OC 1T8OA 5DP9A 4NIVA 4ZMAH 5L30H 3R3GB 1C5NH 2LELA 4DIIH 2J5UA 3MI4A 1NFXA 4JZFH 4HZHA 3ZZDA 3A7XA 4Y11E 2WYGA 2VINA 4YLQH 2F9NA 3OY5U 1T4UH 1YWUA 3OYPA 4BAKB 1Z8GA 3PLBA 1TA2A 3OEHD 2HNTF 5A2MH 2CF9H 3SV6A 3V13A 4F49A 3EE0B 4TYDA 1TABE 2ZIQH 4FU7A 1YY3A 2GVFA 2PUQH 2FWWA 4ISHH 2GTBA 1WAYB 3K2UA 4HG6A 1OHHD 2EA3A 2P3TB 1PYTC 1GWAA 2I6QA 3E1XB 1NU7B 1OPHB 5T1VA 3L3TA 1UTLM 1OYQA 3BIVH 3EA8A 1DANH 1XUKA 2JETC 1UTKA 1ZHPA 3SUDA 3HPTB 4GHTA 2NWNA 2BM2A 1MD8A 4JCNA 3QLPH 5AFZH 3T26A 4Y8XA 4I7YH 2ANKH 2B8OH 3LC5A 4IGDA 1NC6A 3RMMH 1AMHA 1O5AB 3TJUA 2F9VA 4X1RU 4KTSA 1O2XA 2BDCA 1XUHA 4X1QU 2Z9IA 1P8VC 4BNRA 3GDSA 1SR5C 4WJG2 1WXRA 2RG3A 2PKAB 2BQ6B 1YLNA 2IPQX 1DE7H 2ZG0H 9LPRA 2C8WB 1GMDF 2BDIA 1C5UA 1Y5UT 3V3MA 1AWHB 2HPQH 1QCPA 4UFDH 4K1TA 1FY4A 1IQNA 1WV7H 5DP5A 2ZF0H 1GBCA 3RXEA 4I8GA 3ZV8A 3SI3H 2TPIZ 1UHBA 1BMNH 2TGPZ 1EAWA 3SGQE 1EZXC 3SU0A 3MH4A 1KDQA 1NY22 1FX0B 5C0TA 3BG4C 1KSNA 1QL7A 4X8UH 4B74A 2AGEX 1QRWA 1TGSZ 2SGQE 2XYAA 1LPGB 3RXQA 1IAUA 4FUGA 1LHEH 3OAAD 1Z7KA 2PGQB 1J9CH 3P17H 5FCRA 4NIWA 2AMPA 1ANBA 7ESTE 1V2PT 3PTBA 1PFXC 4YTAA 1BTHH 4X2XA 3A7ZA 1PPBH 2FIRH 4BOHA 4AN7A 1GBFA 2H6MA 2D8WA 1GVLA 1TRNA 2QF4A 1OKXA 4J1YA 1DITH 2A5IA 1YLDA 1C1PA 1GHWH 4UFFH 4CHAC 4AGJA 1LQDB 1NS3A 2GJGA 4X8VH 1W14U 4ZXYH 2D2DA 1MKXH 5ABWA 3S0NA 4ZHMU 3C1KA 3QUMP 3SN8A 1SFQB 1SLVB 1LHFH 3RUOA 1FIZA 1MU8B 5C5OA 1P2OA 2FOFA 5EQRA 3TH4H 2C93B 2ZHDA 1G32B 1O5CB 2FOGA 5HYOA 2J34A 3ITIA 1AE8H 3ZZ7A 2BVXH 1FY5A 1VZQH 2VIVA 5HMAA 3TU7H 2Z6BD 3LKWA 4KTUA 3P95A 2PSYA 1IQEA 3URCA 4ZH8A 2K1QA 4B2BA 3VB4A 1MQ6A 2EY4C 4JYTA 3WW7A 1EAXA 1N1LA 3RXIA 4RN6A 1IOEA 1MZAA 2ZI2H 1V2KT 1T32A 2VIQA 3T28A 1O2KA 1F2SE 2F3CE 2L6OA 1DY8A 1P12E 4ISIH 3S9BA 1SL3A 4FXGH 4CR5A 1A4WH 1JOUB 1FV9A 1GL0E 1P57B 5FPSA 1EUFA 2JJ2D 1S0RA 1O2MA 2VVCA 1HAVA 1Q2WA 3K6ZA 2Q6FA 3EGKH 2FX6A 3RXOA 1KMHB 4Z1MD 2A31A 1ETRH 2KM0A 2ZFRH 2QN5T 4ZAEA 5GWZA 2F9PA 2ZU5A 2H2ZA 4CHAB 1KXEA 1ARCA 1LPZB 2J95A 4WMFA 1GJ9B 2J4IA 2KAIA 1ZPCA 4TY7A 1A46H 2J9NA 1PPFE 3UTUH 1AGJA 1CHGA 1TLDA 2WZQA 4F48B 1TBZH 8LPRA 4YT7H 4XD7D 4IBLH 1BTXA 1GJ7B 4K8YA 4IMZA 3GY3A 1TMTH 2CMYA 4WMDA 2OCVB 1EJMA 2VIDA 4YESB 1FNIA 3AASA 1QURH 3A7TA 3EA7A 4ZHLU 1BTUA 2W26A 2ZKSA 1IQGA 1DSUA 3F9EA 1CGJE 2XBWA 1O5DH 1PPHE 2NU3E 5CMXH 2JJ1D 1DWEH 5A0BA 2HRVA 1TA6A 1RXPA 4MNWA 3MNSA 2SGAA 3HK3B 4AFUA 2BDAA 2PFEA 1C1RA 2ZFSA 4RKJB 1ELCA 3H5CB 5EIYA 2ZTXA 1C5TA 4TPIZ 1GJ6A 1WTGH 4AFZA 3FZDA 1O5EH 2FXRA 1F0TA 4CRDA 1C1TA 1O32A 1HJ8A 3KQCA 1FPHH 2Z94A 1C2KA 1O2QA 1GG6B 1DVAH 3ZYDA 1C1UH 3SUEA 1AWFH 2ANYA 1EAUA 2J97A 1GBMA 1C5YB 2VIWA 1V2NT 1GBAA 2J2UA 3BG4B 5GDSH 5GPIB 1GHBF 3TJVA 1DDJA 2ZU2A 5AF9H 4INLA 5DKMA 3MYWA 4JYUH 5CDFE 2Z3DA 1GI3A 4Y0YE 4WVPE 2WPHS 1GL1A 3JZ2B 4O3UA 1BBRH 2P8OB 2UUJB 4ZXXH 1X7AC 4AGKA 3QTVH 1D3PB 3M7TA 5HXFA 4U2WA 4HGCA 1AKSA 2BD2A 1TNJA 2WV4A 2Z9KA 3BTEE 1K2I1 3MH5A 1GMDG 1KXCA 4Y10E 5TJXA 3JZ1B 3ODFA 2XCFA 2QYIA 1CGHA 1H1BA 2YMSC 4AFQA 1C5MD 1EZQA 3DFLA 1B5GH 1ABIH 1ELGA 1GJAB 1KXFA 4CRCA 1F5KU 1EAIA 1GHAF 4I32A 4KELA 2GCHF 1QL9A 1QZ8A 1FDPA 1W7XH 2HLCA 1UK3A 1HAZB 1BUIA 1G3BA 3ZZ5A 3NRLA 1OWIA 1VKYA 1HB0B 2BY5X 2RFKC 1O2ZA 2CF8H 2BLQA 2AGGX 1GDNA 2A7HA 1XKAC 1AN1E 1BRUP 4NWLA 2IJD1 2DUCA 1O3IA 1KTTB 3SJOA 1ACBE 1GJDB 4ZKOU 1THSH 2JIZD 3HGPA 4FUFA 1UMAH 5HM2A 1JWTA 3MTYA 4ABGA 2A4QA 2VVUA 2LP6A 1SGEE 1CHOG 4DGJA 2JH6D 2XNDD 2FOMB 1FZZA 1TBQH 2Y6TA 5LPEA 2GMTB 1SGFG 1QQ4A 4AB8A 2C3SA 3SV7A 3M5OA 2V3MA 2BOHB 2QF3A 3OE7D 3FFGA 3VB7A 1H8IH 4X6MA 4UONA 5CE1A 1UVOA 4MG3A 1VR1H 2HALA 1RRKA 3ODDA 1MCTA 1HRTH 1HAIH 3A8CA 2HNTC 5ESBA 2VGCB 2WHXA 1SMFE 1NPMA 1BCUH 2FEQH 1ANCA 1CBWC 4MDSA 3HATH 3VG8A 4X6NA 8GCHG 4JZ1A 1FY1A 1Z71A 2XW9A 4ISOA 5EJ1A 2FS9A 1TGBA 1Z8JB 4B6EA 1DX5M 4LZ4B 1T31A 3FOAA 1NU9A 2PGBB 1P0SH 2TRMA 2P94A 5J4QA 4MNVA 4ACBA 1IQFA 3SO3A 4VGCC 4MVNA 1ZPBA 3IITA 2P3FH 4IMQA 4AG2A 5HM9A 2GGVB 1F5RA 2QA9E 1C2IA 2IOTA 1RTKA 3FP6E 4GSOA 3TNTA 3ZZ6A 5A0CA 5IK2D 3EA9A 4D76A 3KIDU 2TGTA 3RXAA 1FMGA 1S85A 4XOJA 2OTVA 1ESBA 3DSGA 4YT6H 5JBAS 2ANMH 3UQVA 4AYVB 1TNIA 1RFNA 3K6YA 2AIPA 4NCYA 2FO9A 5BPEA 3RM0H 1E37B 5C1YA 3RXDA 1BA8B 1O33A 1O2GH 2BLWA 1O2LA 1P06A 1DFPA 5FX6A 3ZZ8A 1AUJA 2VH6A 3GY8A 3RMOH 1QL8A 3C27B 2A32A 2HWLB 2V7QD 2D1JA 1XUJA 2ZU1A 1MU6B 4Q7YA 2ZTZA 1A61H 5HGGA 1W0YH 1AE5A 1O37A 3QK1A 3GS9A 1C5WB 3LC3A 3MU1A 3SJKA 1AB9C 2ESTE 1O2UA 3GY2A 2A2QH 1YGCH 3QZRA 2OBOA 1OWJA 2FI4E 3SJ9A 1YPHE 5FHTA 1SKYE 2EI7A 3PO1C 3A7VA 3SV9A 1Y3UA 2TBSA 3T5FH 3LJOA 2P3UB 4JK6A 5F8TA 1FLEE 1GHYH 1BHXB 1CBWB 3KNXA 5HIYA 2BD4A 2QV1A 3TGJE 5LGOA 2G52A 1TPOA 3AVZA 3A86A 1UW7A 1OXGA 1DXPA 1O3GA 3LJJA 1SG8B 1N6XA 4WH6A 4UEHH 3P70B 1P2IA 1HFDA 3F6UH 1GI0A 1UTMA 1V2OT 4VGCB 3NXPA 2IPHA 5JBTA 2V3OH 5DP8A 2WPDD 3T27A 2W3IA 3A89A 3RXRA 3BTFE 1ZHMA 1ELVA 1P11E 1BMMH 1F5LA 1TPSA 2I6SA 2VIPA 2P93A 5JB9S 2GT7A 1T4VH 4KP0A 1S83A 1PPEE 2FZZA 2ULLA 3UNQA 1V6DA 3U1IB 3GYLB 3MQKC 4TPYA 3GY6A 1A2CH 3L33A 1RTFB 1Y3WA 3P6ZB 1KXDA 4DG4A 2ODPA 2STAE 5EPNA 1WU1A 3KQ5A 2PKSC 2ZHWH 1EZUC 3FAOA 2FS8A 3M37A 4D7GA 1TNLA 4NG9H 2R0LA 2OINA 4CBNA 1MD7A 3BEUA 4J2YB 3GY4A 3T25A 1NT1A 4U32A 3RXUA 1O2IA 3SGBE 3ATMA 4FUIA 3SU3A 1FIWA 1A0JA 1O3BA 2Z7FE 3BEIB 1IQIA 1EATA 1UO6A 2ZQ1A 4AOQA 1ELEE 1DLKB 4MTBA 1J17T 1H8DH 1YKTA 2WPIS 3RC6A 2PTCE 3M3TA 3O8CA 3P8FA 1K1JA 2C90B 2OQUA 3FP7E 5JBCS 4ISLA 2QXIA 4YO9A 1LTOA 2XXLA 3NWUA 1MAXA 1P9UA 3DCLA 5G4BA 5AHGH 1C4U2 1SGPE 3TITA 3TK5A 2WUCA 1DPOA 4ZROA 4DIHH 5FL7D 2WV9A 3DT0H 3EYDA 4F4OC 1P2NA 3E8LA 3TK6A 3UREA 1YPEH 1SGYE 4FETA 1HIAB 3S69A 4CREA 1GI5A 3SNDA 1XVOA 4BTTB 6CHAB 1VCWA 1H4WA 3LONA 1F0UA 1EOLA 2FI3E 3A81A 3BIUH 1SLXB 1TQ0B 4MPXA 1G3CA 2AS9A 1AD8H 1LCYA 5HIZA 3SJ8A 1BBRK 4AFSA 1A5HA 2AEIH 2OUAA 1YLCA 1DUAA 3BEFB 5AFYH 4TSFD 1JXPA 3LGVA 3I29A 3R0FA 1CA0B 2A1DB 2C8ZB 2PHBA 1O2PA 2K8IA 1UTJA 1LMWB 1G3DA 3PLKA 1EJNA 1F7ZA 1ELFA 3LH1A 1GGDB 4XBDA 3RXPA 3N7EA 1V2ST 4O9VA 2G81E 1MTWA 1Z8RA 1HDTH 3OEED 5B6OA 1E34B 3KQDA 2QE7D 1MQ5A 2B0FA 1KTSB 1W0JD 1RS0A 5LPRA 3MH6A 1YPGH 5K0HA 4NSVA 3ATLA 5I25A 1Z1JA 1KLIH 3LGWA 4OS6A 2QXJA 3ZVAA 4BAOB 1GMHG 3PMAB 3E90B 2V3HH 3O8BA 2AFQB 3SU6A 7GCHG 1YF4A 1ZTKA 1XM1A 3DA9B 2BDGA 1ELBA 1O2HA 2EC9H 3D65E 2UUFB 2Q6DA 1WOFA 4D9RA 5BRRE 1EKBB 2ZCKP 3T29A 4ACAA 1BMFD 1D3TB 1SLWB 2CHAC 1BTWA 2J98B 3Q76A 4U30A 3PTNA 1O3DA 1V2QT 1W11U 3MO9A 1ZPZA 4ABHA 1P2QA 3PLPA 2SFAA 1GBKA 2G51A 2TGDA 5PTPA 3MO6A 2OC8A 2XWAA 5F8ZA 1LKBA 1W2KH 3CENA 1VJAU 4ABEA 2M2AA 3A8AA 2ZEBA 1EB2A 4O03A 1V3XA 1BMAA 4U01A 1C5QA 3AW1A 1SSXA 4X6OA 3D62A 3RC5A 3KQBA 2FTLE 3QDZB 1SPJA 1J8AA 1IHSH 1QIXB 3OU0A 4NGAH 1GI9B 1OWHA 1L1NA 2ALVA 1GJ4H 2OC1A 2HLDD 1G36A 1NRRH 3PWCA 4HFPB 2GX4A 2GZ7A 2KX4A 2H9EH 4NSYA 1AY6H 1GHVH 1K1IA 3LH3A 1AFEH 1S84A 1OWEA 2RDEA 4M9FA 4X1PU 5EPYA 3ATIA 1TOCB 2XTTB 1A0LA 3A8DA 2XRCA 3Q3YA 3HK6B 1SBWA 1VGCB 1EPTB 4B2CA 2FP7B 1D3QB 3ZZ4A 1EZSC 1QBOA 2VNTA 1BQYA 1QB9A 3E0PB 3GICB 1GHAG 2ZFFH 2O8WA 3PB1E 1BTYA 4ZCNA 5EQSA 2AHME 2XOKD 3VB5A 4DT7B 2ZQ2A 1YC0A 1F0RA 3IG6B 5A8XA 4ABFA 2VU8E 1GHXH 2A4GA 3ZYEA 1LKAA 2WPJS 4B71A 3BSQA 2F4LA 3TPIZ 4E05H 1C9TA 1O3CA 1XUGA 3UR9A 3SI4H 2BDBA 2BVRH 4AYYB 5C5NA 1XKBC 1YCPK 3F9HA 1DY9A 3TGKE 4XFQA 1V2RT 2BLOA 1UVSH 4UE7H 3NZIA 2R2MB 1ZHRA 3QN7A 2W7UA 2GD4B 1K22H 3KEEA 1AVGH 1C1OA 1THPB 2B5TB 1C5OH 3LT3A 3U8TH 5JPMH 1TX8A 4I31A 4D7FA 2XWBI 1Q3XA 4Y76A 3A87A 2YMSB 4FU8A 1O31A 3KGPA 2H1UA 2QXGA 2AIQA 1SVPA 2BDHA 3BTTE 4O3TA 1UK4A 5FCKA 1HXFH 1GCTB 1FPCH 4WF8A 1K1NA 2QCYA 3T62A 1FN8A 1HV7A 4TWYA 1H8HD 3UWJH 3O8DA 1NTPA 4CBOA 2R3YA 1TGNA 1CO7E 2ZZUH 3TIUA 1FONA 1P01A 1WQSA 1SI5H 2O9QA 1ZRKA 2CGAA 1K1MA 2QF0A 5DO4H 2GV6A 5EODA 4YOJA 3U1JB 1DLEA 4BAHB 1NRNH 2VWNA 2QC2A 1GBLA 4P00A 3NPSA 3ATWA 3QO6A 2GCHG 4DT4A 1HAXB 3A82A 3Q3KA 4KTCA 1GI2A 1W12U 1Y59T 1O30A 1PQ5A 3A7WA 3QZQA 1D3DB 1LHGH 3OFND 1W10U 1G30B 2ZGJA 1ZGIA 4INKA 2P59A 2VH0A 4X2YA 1TOMH 2WYJA 2F9UA 7LPRA 3SUFA 2BZ6H 3BV9B 6GCHF 3L6PA 1BRCE 1C5VA 2CK3D 2Y81A 3SGAE 1S0QA 1SC8U 2OD3B 2ZFPH 1JIMA 3AAUA 4K60A 4YXWD 2BVSH 4IN1A 1P3EA 2A4OA 3RU4E 1ZRBA 1AVWA 1MBMA 4LK4A 4GHQA 3LIWA 1WDIA 2BTCE 4B76A 5FBEA 4HI3A 3B9FH 1O2YA 1J14A 3MNCA 1QJ7B 5DGJA 1E36B 5TCAA 1SFIA 1EPTC 2ZCLP 1DWDH 1QBVH 1P2JA 1C1WH 3SW2B 4ABAA 1LVYA 2FOHA 3PO1B 1O5GH 1XXDA 3VB6A 1O34A 1CVWH 4DVAU 3ZVEA 5A8ZA 2YNBA 2ZPQA 4WXIA 3V7TA 1VJ9U 5FX5A 1DWBH 1P04A 1XXFA 2F91A 1S6FA 4DOQA 2D26C 3KF2A 4OS4A 1P2MA 4BANB 1TWXB 2GZ9A 4Q2KA 2FX4A 2R2WU 1KIGH 1C2EA 4SGBE 4X1SU 3M35A 4B73A 3PMBB 3H09A 2AH4X 2EI6A 4AG1A 1W13U 4PROA 2G5NA 1EOJA 4ASUD 3PM3A 1D4PB 1A1RA 1K0HA 2HOBA 3ZV9A 4BAMB 2BD9A 3FANA 1GDQA 5EXMA 3K9XB 1QB6A 2G4TA 3GCOA 1D9IA 1TYNA 3KYFA 2KAIB 1NROH 1QGFA 1TE0A 3W95A 2Z3CA 3UFAA 2P16A 1S6LA 1AIXH 2AMQA 4DY7B 1L0ZA 1JBUH 3TJNA 1M9UA 4Y8YA 1AO5A 4ABJA 1L2EA 1HCGA 2UUKB 3P92A 1OWKA 3F1SB 2BD5A 2OBQA 1SQOA 3E3TA 3LGUA 2UUYA 1N8OB 5I46H 1CU1A 1CT0E 2PR3A 2AGIX 3DHKH 1SGNE 5A0AE 1EPTA 4JYVH 5A09A 4B1TA 3RXCA 3RMLH 4DCDA 2H5DA 3A80A 1S82A 1C1VH 4MQAA 1KY9A 1SQTA 3ZZBA 3TGIE 3KCGH 4D8NA 2LNCA 3MHWU 8ESTE 7KMEH 3FZZA 4B2AA 5C0UA 3P8GA 4AX9H 2XC4A 1QJ1B 2Z3EA 2Y5HA 1NRPH 1TRMA 2W6JD 5F8XA 3MFJA 3RM2H 2UWPA 3F9FA 4WY3A 2R0KA 3A83A 1P03A 3NUMA 2YMSD 1GBIA 1BMLA 2WSSD 2VJ1A 1P02A 1E35B 1A0HB 1UTQA 3BN9A 5DJ7A 2BYAX 1QB1A 2RCEA 3FKSD 3ZVFA 3FO8D 4CRBA 3UR6A 2Y5GA 2A7JA 2ZGHA 1P10A 3KN2A 3RXSA 3MWIU 4BXWA 1Z6JH 1EP5A 1ELDE 2HNTE 2FOCA 1LQEA 1L4DA 1GBDA 5GJ4B 1O3AA 2Y80A 2ZHEH 4GCHG 3SJIA 3S9CA 1TONA 1RTLA 2BMGB 2SGDE 1Z1IA 4CR9A 2GDDA 4KGAA 2ZDLA 1HAPH 2YNAA 1J16A 4TT3D 1TMBH 3DSOA 1UVTH 2WPMS 2ZGBH 3ESTA 1EASA 1GBEA 1D6WA 1KLJH 4FUBA 1HAOH 1ZOMA 4ABDA 1K1PA 1NRSH 1GPZA 2WINI 1FI8A 1UVUH 3WWBA 4E7NA 1BDAA 2ZDVH 4MNXA 4Y8ZA 4F55A 4THNH 1GGDC 1SGIB 1V2MT 5DP7A 1ZMLA 3A88A 5CHBA 5EG4A 1IQLA 1ZR0A 2O8MA 4XDEA 1VCPA 5E2OA 1YM0A 2ODYB 1PJPA 4INHA 2J92A 3T2NA 4M7GA 3U8RH 4MPWA 3BTGE 3SHCH 1GI8B 1AKSB 4I8HA 1W3CA 1AI8H 2J38A 2C8YB 3B23B 1TGCA 1KXBA 4H4FA 1YPHC 2PKAA 1RJXB 5CHAB 3UY9A 3M5NA 2STBE 3SV2H 3UWIA 4FVBA 1GG6C 3TK9A 1VITG 3BTHE 1S6HA 1MBQA 1E38B 1TMUH 1HXEH 4HTCH 1GMCF 2ZTYA 1C5XB 2CHAB 4MPUA 3UUZA 3MH7A 3LGTA 1H8ED 4FUDA 1TALA 5C67A 3F3BA 2VVVA 1Y5BT 2JKHA 1U6QA 1UCYH 1SGRE 3V12A 4AB9A 4H42U 2P8OC 3AAVA 3ZVGA 3I78A 1UTPA 3AW0A 4H6SB 1AQ7A 1OWDA 1Z6EA 4SGAE 2BZAA 5AVDA 2OQ5A 3GDVA 1BITA 1O3PB 3UPEA 1MKWK 2NU2E 4YLUA 1W8BH 1O3OA 4A1XA 2Y82A 4RT0A 1TQ7B 1AFQC 1SGTA 4R0IA 1ZTLA 4P02A 1E1QD 3SQEE 3GDUA 3DD2H 4B75A 1MH0A 3V0XA 1O3KA 1H9HE 2HVXA 2Z9LA 4NA8A 1RD3B 1C1QA 1O35A 1O5BB 1WSSH 5FXLA 3IWMA 2KR7A 1HPGA 1P2KA 4ABIA 1GI7B 4RSPA 1AZZA 1NN6A 2GP9B 4K8BA 3VFEA 1CQQA 3RP2A 3W94A 2VGCC 2XBXA 3E6PH 3MO3A 1MKXK 2WV5A 3F2GA 4I8KA 2FMJA 4MPVA 1FQ3A 1OP0A 4UD9H 1A7SA 1CT2E 1SGQE 2EEKA 1NM6A 5E0HA 1G2LA 3HGNA 3M5MA 5EW1H 5F6MA 1SOZA 1TNKA 1AU8A 2G55A 2ZP0H 2VWMA 1ZTJA 4TY6A 4X8SH 1QFKH 1UK2A 2ZWLH 1GJBB 2LPRA 1C1NA 3STJA 5A8YA 3CS0A 1HAGE 1QTFA 3RXGA 4AZ2B 1MTUA 2WUBA 3D49H 1RIWC 4YOIA 1BIOA 1GVKB 3PV4A 4X2VA 1BRBE 1K21H 5JBBS 4ZUHA 2ALPA 5DP4A 2BY7X 1W0KD 3OY6U 1IQHA 4CRAA 1CGIE 5FPYA 1GJCB 1C5RA 5T6GA 3VEQB 3RLYH 1SQRA 5B6LA 2J94A 1C5ZB 1UHBB 3SNEA 3ZZCA 4FOUC 4XRNA 2ZO3H 3RLWH 1EB1H 3SYJA 4X2WA 1SGFA 3RDZA 2F43B 1VITF 1SGDE 3U9AH 2F9OA 1C5PA 4JZIA 1O3FA 7GCHF 1DICA 1W0ZU 2Z9JA 5J4SA 1VGCC 1LO6A 2KCOA 4OS5A 2H9HA 4O97A 4E7RG 1ORFA 1Y5AT 4R8TB 1JMOH 1WQVH 4NA9H 3SZEA 1D6RA 3MU4A 2Y7ZA 1LHDH 4ABBA 2G8TA 1ZJDA 1YP9A 1SB1H 2FM2A 1L4ZA 1LDTT 3ZVBA 3BTKE 3ZVCA 2GV7A 1SQAA 3SV8A 2R9PA 3SNBA 3TH3H 3TH2H 1S5SA 4ESTE 1EFRD 1O2RA 3TNSA 4RKOB 2ZDMA 5EOKA 3CS7A 3RXFA 1IQJA 5TCCA 2FODA 4IN2A 2B7DH 3Q00A 2XC0A 1UTNA 3PRBA 1C2GA 4OS1A 1WTHD 2SGPE 5DP6A 2A7CA 5K7RA 6GCHG 3KL6A 1DWCH 5DG6A 1IQMA 1CA8B 4I8LA 4Z0KA 3GCHB 1P05A 4NWKA 1ESTA 1OP2A 3UNRA 1SLUB 2XC5A 3ZZ3A 4GPGA 3LOXA 3S7KB 1SOTA 1O0DH 1AHTH 1QA0A 2BQ7B 4ZKRU 1AUTC 3M3VA 2Y5FA 5DSFA 5FPTA 2RA0A 1HJ9A 2QY0B 1PQAA 2GDEH 1GCTC 1XVMA 3F68H 2ZDAH 3N7OA 4X6PA 1BTPA 1PYTD 1O2WA 4JZDH 1C2JA 1YPJH 1NZQH 1O38A 2A5KA 4JMYA 8KME2 5H4IB 1UVPA 1TAWA 1T8MA 3LGYA 4WWYA 3UNSA 2ZPRA 3BTQE 3AK5A 1GI4A 1YPLH 2W6ID 2ZHFH 3M61U 4MNYA 2OP9A 3F0OA 1BT7A 2ZECA 3DUXH 1Y3VA 2UWLA 1HAVB 3FVFB 3TVJB 1B7XB 2BY8X 2UWOA 2VB0A 4YOGA 1ZSLA 1KXAA 1GI6A 2BHGA 5EXNA 1O2VA 4Y7BA 2ZFTA 1HJAB 2FPZA 4ZKSU 1YBWA 4OGXA 3RXVA 3MU5A 3LGIA 4IW4E 1LHCH 3OTPA 1HAYB 2FOAA 4B6FA 3STIA 3M7QA 2BXTH 4FVDA 1DUEA 5ESTE 1XX9A 2G4UA 1O2SA 2EI8A 1KDQB 3EAJA 4K3JA 2ZPSA 2XBYA 3UB0A 4A1VA 5HKKD 5E0GA 5T6FA 1NBME 1COWD 3GCTF 3H7TA 2GCTB 3GCHC 4GUXA 1ZMNA 3SZNA 1B0FA 2SNVA 3W1EA 5EJZA 1LVOA 1G37A 3BTME 1E79D 2CXVA 4K1EA 1QQUA 3PMHB 1MMJN 2G5VA 1JRSA 2NU4E 2W5EA 1TPPA 2SGEE 4UFGH 4TWWA 3SNCA 2NU0E 3PWBA 2HGTH 3LU9B 1HIAA 2ZU4A 3RMNH 2BY6X 5DK1A 3EDXB 3SHAH 5GCHF 4A92A 2JDID 2DE9A 5IDKA 2RA3A 1O5FH 1QNJA 3GY7A 3MMGA 3M36A 1OP8A 5L6NH 1XMNB 4LZ1H 1UTOA 4RI0A 2K0QA 3BTWE 4XBBA 1GHZA 4LOYH 2WPLS 4YZUA 5JYIA 3HKJB 1A5GH 5GXPA 5C20A 4FUEA 1WYKA 1GJ5H 1ANEA 2V35A 4CH2B 3D23A 5JDUB 4ZHAA 1QA7A 5JB8S 3RXKA 4X1NU 4UDWH 2VIOA 3U8OH 2WPKS 2KCPA 2KCYA 2BX3A 1OYTH 2JETB 3VPKA 2GMTC 1IQKA 1HYLA 2ZGXH 2ZDNA 1MTVA 4E06H 3P8NA 2BQWB 4RT1A 5C94A 2KZ4A 3SU1A 3P8OA 5T3HA 2A0QB 2GZ8A 2BOKA 4IC5A 3URDA 3KYGA 4QT8C 1YYY1 2GT8A 1A5IA 3RXBA 1O2JA 5DN6D 1C2DA 3RU4D 5DP3A 1BJUA 2AMDA 1TPAE 1C2MA 1Y3XA 3VXFH 3QGNB 1FY3A 4WXVA 1UCYK 4Y79A 1A3EH 2TGAA 1ELAA 1AZ8A 3S9AA 1HBTH 2PWXA 5LH8A 1H9LB 1HUTH 2BD8A 3KHVA 4Q63A 3EE7A 1FN6A 1Y8TA 1MKWH 1AB9B 3CP7A 4XBCA 1YPKH 1Z8IB 1ZLRA 4Y7AA 4ZKNU 3WY8A 1DT2A 4BTIB 3ZVDA 5C3NA 2F9BH 1V2TT 5EQQA 1OOKB 2F83A 3SOSA 4CH8B 5EW2H 3VGCC 2H9TH 2IN2A 5FAHA 1O3EA 3MOCA 1IHTH 1PPCE 4NFFA 1TX6A 1BB0B 1CSOE 1FAXA 2PLXA 2ZDKA 4DJZB 3GCTG 4I8JA 1V2UT 4Q4LA 1B0EA 1OX1A 1ZSKA 3I77A 2OXSA 1DS2E 2O8UA 3KQEA 4BXSA 4A5TS 4AC9A 4K2YA 1C2HA 2Y7XA 1MABB 2ASUB 4WH8A 2O8TA 3UQOA 2BD7A 1K9OE 1F0SA 3ELAH 2QXHA 4A7IB 2FOEA 2FYRA 2GCTC 2ZGCA 1MZDA 1K1OA 3E91A 5E8EH 1PQ8A 4Q80A 1PPGE 1C1SA 3N99A 4JK5A 3ZZ9A 1MTSA 2Z9GA 1QRZA 3O8RA 3QX5H 1NFWA 1V2JT 1WCZA 1T7CA 3B8JA 3BF6H 3N7DA 3A7YA 1CHOF 4NIXA 4CRFA 2JH5D 5T6DA 2TIOA 3DSPA 3BG8A 1O36A 3F9GA 1ETSH 1C2LA 2XBVA 1O3LA 1NFUA 5CHAC 3ZIAD 1FJSA 2OK5A 2SNWA 3FP8E 2ZNKH 4GVUA 4OS7A 3RXHA 4IS5A 1O3JA 1MTNC 1TBRH 1OSSA 3M3SA 1CT4E 4XSKU 3NCLA 5EXLA 1EP6A 1CE5A 2THFB 4KKDA 2HPPH 3EQ0H 1BTZA 1DM4B 3RC4A 4BAQB 1EJAA 4H6TA 2R3UA 2VWLA 3Q3XA 2ILNA 2GKVE 2YOLA 1YCPM 1Q31A 4UFEH 2C8XB 1WUNH 3WWFA 1EQ9A 1BRAA 1KYNA 1NO9H 1GBTA 1TGTA 1PQ7A 2H5CA 1TNGA 3NKKA 4X8TH 1GBHA 1QR3E 4NZQA 6ESTA 1O39A 1O2NA 1RGQA 1AFQB 1DXWA 2V6NA 4OS2A 3FN8A 3ATKA 2C4FH 1YCPH 2PTNA 3ZZAA 1P09A 1P9SA 3SQHE 3QGJA 4D9QA 3F2HA 2PW8H 2FESH 5EU8A 2ZHQH 4CRGA 1TIOA 3SUGA 1VCQA 2FDAA 1UJ1A 3SORA 1BJVA 2CJIA 5DPAA 2BXUH 3SU4A 3U69H 1GJ8B 1E0FD 3RXJA 1ZSJA 4Q7ZA 2QF5A 4FUHA 2ZCHP 2FYQA 2O8LA 2OLGA 2ZFQH 1ID5H 1T8LA 1SGCA 1EX3A 2ZC9H 1DOJA 1C5LH 4I86A 4DW2U 1C1MA 1ZGVA 3TJOA 2A4RA 5L2YH 1ZYOA 1KLTA 1RIWB 2A2XH 5C2ZA 1GBBA 1ZJKA 1C4V2 2QAAA 1INCA 2XNIA 3OSYA 5EGMA 2ZU3A 3TLOA 5KEDA 1QBNA 1TNHA 2G00A 5L2ZH 1UCYE 1C2FA 1MUEB 1AVXA 1ZMJA 1NESE 3GOVB 1YPMH 5E0JA 4Y71A 1NRQH 5C1XA 4Y0ZE 1G3EA 2NU1E 8GCHF 5C1UA 1HAHH 3ENSB 1GDUA 2A5AA 2KCAA 1QRXA 3K65B 4K69A 1ETTH 1F92A 1GMCG 2KFWA 1BOQA 4OM9A 4Z6AH 5KECA 2CV3A 1GVZA 4A1TA 1C4Y2 3E16B 3LPRA 2PKSB 4FU9A 3UOUA 1ELTA 3CNRA 5GIBA 1ANDA 2SGFE 1LVMA 3A85A 1SHYA 2ODQA 3Q77A 2EQNA 2Q6GA 4GLYA 1J15A 3A8BA 1GBJA 6LPRA 1GMHF 4OGYA 5F53A 5F03A 3SU2A 4A6LA 3RXTA 2VWOA 3VGCB 1FAKH 1O2TA 1TB6H 3HKIB 2BX4A 1GHBG 2BLVA 2BB4A 1T8NA 1H9IE 1BBRE 4NZLA 1HLTH 2FOBA 2RDLA 3OX7U 4K5ZA 4MLFB 3LDXH 2QIQA 3M7UA 3MNBA 4JZEH 1MAYA 3NK8A 5C17A 4GCHF 3U98H 3GYMA 1C9PA 4I33A 2AERH 3MU8A 4XE4A 3GISB 1LPKB 1EXFA 4NA7A 4DURA 3RU4T 3QTOH 1C5SA 5LPFA 1NBMD 1WBGB 3E0NB 3OTJE 3GY5A 2BD3A 1NFYA 3RXLA 5GNDA 2FLBH 1BHXF 1L1GA 1TFXA 3UIRA 4FUCA 3S7HB 1ESAA 2PP6A 1DSTA 1QJ6B 5ETXA 4IC6A 6CHAC 3G01A 3UOPA 3PV2A 2IJOB 5SGAE 1W7GH 1K28D 3PV5A 1XUFA 3UAIC 3DFJA 1MTNB 4FUJA 2BDYA 2AYWA 4YM9A 2VBCA 3PROA 3BTDE 4ISNA 3SU5A 1G9IE 1O2OA 1JIRA 2J98A 2HVYB 2L74A 1SHHB 3H7OA 3PMJA 4Q7XA 1ARBA 2ANWA 1N6YA 3PYHA 2OC0A 2B9LA 4AORA 1HNEE 1MCVA 1P3CA 1HGTH
chains in the Genus database with same CATH topology
1FY8E 2JH0D 1E1RD 1V2VT 4NFEA 1CA0C 4Y6DA 3M5LA 4WMEA 2PUXB 3GCNA 2QGRA 1QY6A 2A45B 1S81A 4BTUB 1O3NA 1QHRB 1V2LT 1GI1A 2W3KA 1O3MA 2DE8A 4ASHA 2PSXA 1TX7A 3SNAA 1K1LA 1ZZZA 3F0PA 2CN0H 1THRH 3MU0A 3SBKA 3QWCH 2PV9B 2V0BA 1G2MA 2FI5E 3VXEH 2W7SA 1VITH 2FLRH 1HJAC 1L1JA 4K1SA 1OS8A 1FXYA 1GCDA 2P95A 1PPZA 3PRDA 1V2WT 4NIYA 2Q1JA 1O3HA 2XCNA 1XUIA 2FTMA 1LVBA 3A84A 3MNXA 1BZXE 3F2FA 2OC7A 5IYTA 4X0WU 1FUJA 5GCHG 1Y3YA 5E2PA 1ABJH 5FBIA 4GAWA 4LXBH 9ESTA 1A3BH 2ZA5A 3RXMA 1JRTA 2M5TA 1TRYA 2BY9X 3VB3A 1N8OC 1T8OA 5DP9A 4NIVA 4ZMAH 5L30H 3R3GB 1C5NH 2LELA 4DIIH 2J5UA 3MI4A 1NFXA 4JZFH 4HZHA 3ZZDA 3A7XA 4Y11E 2WYGA 2VINA 4YLQH 2F9NA 3OY5U 1T4UH 3OYPA 4BAKB 1Z8GA 3PLBA 1TA2A 3OEHD 2HNTF 5A2MH 2CF9H 3SV6A 3V13A 4F49A 3EE0B 4TYDA 1TABE 2ZIQH 4FU7A 2GVFA 2PUQH 2FWWA 4ISHH 2GTBA 1WAYB 3K2UA 1OHHD 2EA3A 2P3TB 1PYTC 1GWAA 2I6QA 3E1XB 1NU7B 1OPHB 5T1VA 3L3TA 1UTLM 1OYQA 3BIVH 3EA8A 1DANH 1XUKA 2JETC 1UTKA 1ZHPA 3SUDA 3HPTB 4GHTA 2NWNA 2BM2A 1MD8A 4JCNA 3QLPH 5AFZH 3T26A 4Y8XA 4I7YH 2ANKH 2B8OH 3LC5A 4IGDA 1NC6A 3RMMH 1AMHA 1O5AB 3TJUA 2F9VA 4X1RU 4KTSA 1O2XA 2BDCA 1XUHA 4X1QU 2Z9IA 1P8VC 4BNRA 3GDSA 1SR5C 4WJG2 1WXRA 2RG3A 2PKAB 2BQ6B 1DE7H 2ZG0H 9LPRA 2C8WB 1GMDF 2BDIA 1C5UA 1Y5UT 3V3MA 1AWHB 2HPQH 1QCPA 4UFDH 4K1TA 1FY4A 1IQNA 1WV7H 5DP5A 2ZF0H 1GBCA 3RXEA 4I8GA 3ZV8A 3SI3H 2TPIZ 1UHBA 1BMNH 2TGPZ 1EAWA 3SGQE 1EZXC 3SU0A 3MH4A 1KDQA 1NY22 1FX0B 5C0TA 3BG4C 1KSNA 1QL7A 4X8UH 4B74A 2AGEX 1QRWA 1TGSZ 2SGQE 2XYAA 1LPGB 3RXQA 1IAUA 4FUGA 1LHEH 3OAAD 1Z7KA 2PGQB 1J9CH 3P17H 5FCRA 4NIWA 2AMPA 1ANBA 7ESTE 1V2PT 3PTBA 1PFXC 4YTAA 1BTHH 4X2XA 3A7ZA 1PPBH 2FIRH 4BOHA 4AN7A 1GBFA 2H6MA 2D8WA 1GVLA 1TRNA 2QF4A 1OKXA 4J1YA 1DITH 2A5IA 1YLDA 1C1PA 1GHWH 4UFFH 4CHAC 4AGJA 1LQDB 1NS3A 4X8VH 1W14U 4ZXYH 2D2DA 1MKXH 5ABWA 3S0NA 4ZHMU 3C1KA 3QUMP 3SN8A 1SFQB 1SLVB 1LHFH 3RUOA 1FIZA 1MU8B 5C5OA 1P2OA 2FOFA 5EQRA 3TH4H 2C93B 2ZHDA 1G32B 1O5CB 2FOGA 5HYOA 2J34A 3ITIA 1AE8H 3ZZ7A 2BVXH 1FY5A 1VZQH 2VIVA 5HMAA 3TU7H 2Z6BD 3LKWA 4KTUA 3P95A 2PSYA 1IQEA 3URCA 4ZH8A 2K1QA 4B2BA 3VB4A 1MQ6A 4JYTA 3WW7A 1EAXA 1N1LA 3RXIA 4RN6A 1IOEA 1MZAA 2ZI2H 1V2KT 1T32A 2VIQA 3T28A 1O2KA 1F2SE 2F3CE 2L6OA 1DY8A 1P12E 4ISIH 3S9BA 1SL3A 4FXGH 4CR5A 1A4WH 1JOUB 1FV9A 1GL0E 1P57B 5FPSA 1EUFA 2JJ2D 1S0RA 1O2MA 2VVCA 1HAVA 1Q2WA 3K6ZA 2Q6FA 3EGKH 2FX6A 3RXOA 1KMHB 4Z1MD 2A31A 1ETRH 2ZFRH 4ZAEA 2QN5T 5GWZA 2KM0A 2F9PA 2ZU5A 2H2ZA 4CHAB 1KXEA 1ARCA 1LPZB 2J95A 4WMFA 1GJ9B 2J4IA 2KAIA 1ZPCA 4TY7A 1A46H 2J9NA 1PPFE 3UTUH 1AGJA 1CHGA 1TLDA 2WZQA 1TBZH 8LPRA 4YT7H 4XD7D 4IBLH 1BTXA 1GJ7B 4K8YA 4IMZA 3GY3A 1TMTH 2CMYA 4WMDA 2OCVB 1EJMA 2VIDA 4YESB 1FNIA 3AASA 1QURH 3A7TA 3EA7A 4ZHLU 1BTUA 2W26A 2ZKSA 1IQGA 1DSUA 3F9EA 1CGJE 2XBWA 1O5DH 1PPHE 2NU3E 5CMXH 2JJ1D 1DWEH 5A0BA 2HRVA 1TA6A 1RXPA 4MNWA 3MNSA 2SGAA 3HK3B 4AFUA 2BDAA 2PFEA 1C1RA 2ZFSA 4RKJB 1ELCA 3H5CB 2ZTXA 1C5TA 4TPIZ 1GJ6A 1WTGH 4AFZA 3FZDA 1O5EH 2FXRA 1F0TA 4CRDA 1C1TA 1O32A 1HJ8A 3KQCA 1FPHH 2Z94A 1C2KA 1O2QA 1GG6B 1DVAH 3ZYDA 1C1UH 3SUEA 1AWFH 2ANYA 1EAUA 1GBMA 1C5YB 2VIWA 1V2NT 1GBAA 2J2UA 3BG4B 5GDSH 5GPIB 1GHBF 3TJVA 1DDJA 2ZU2A 5AF9H 4INLA 5DKMA 3MYWA 4JYUH 5CDFE 2Z3DA 1GI3A 4Y0YE 4WVPE 2WPHS 1GL1A 3JZ2B 4O3UA 1BBRH 2P8OB 2UUJB 4ZXXH 1X7AC 4AGKA 3QTVH 1D3PB 3M7TA 5HXFA 4U2WA 4HGCA 1AKSA 2BD2A 1TNJA 2WV4A 2Z9KA 3BTEE 1K2I1 3MH5A 1GMDG 1KXCA 4Y10E 5TJXA 3JZ1B 3ODFA 2XCFA 2QYIA 1CGHA 1H1BA 2YMSC 4AFQA 1C5MD 1EZQA 3DFLA 1B5GH 1ABIH 1ELGA 1GJAB 1KXFA 4CRCA 1F5KU 1EAIA 1GHAF 4I32A 4KELA 2GCHF 1QL9A 1FDPA 1W7XH 2HLCA 1UK3A 1HAZB 1BUIA 1G3BA 3ZZ5A 3NRLA 1OWIA 1HB0B 2BY5X 1O2ZA 2CF8H 2BLQA 2AGGX 1GDNA 2A7HA 1XKAC 1AN1E 1BRUP 4NWLA 2IJD1 2DUCA 1O3IA 1KTTB 3SJOA 1ACBE 1GJDB 4ZKOU 1THSH 2JIZD 3HGPA 4FUFA 1UMAH 5HM2A 1JWTA 3MTYA 4ABGA 2A4QA 2VVUA 1SGEE 1CHOG 4DGJA 2JH6D 2XNDD 2FOMB 1FZZA 1TBQH 2Y6TA 5LPEA 2GMTB 1SGFG 1QQ4A 4AB8A 2C3SA 3SV7A 3M5OA 2BOHB 2QF3A 3OE7D 3FFGA 3VB7A 1H8IH 4X6MA 4UONA 5CE1A 1UVOA 4MG3A 1VR1H 2HALA 1RRKA 3ODDA 1MCTA 1HRTH 1HAIH 3A8CA 2HNTC 5ESBA 2VGCB 2WHXA 1SMFE 1NPMA 1BCUH 2FEQH 1ANCA 1CBWC 4MDSA 3HATH 3VG8A 4X6NA 8GCHG 4JZ1A 1FY1A 1Z71A 2XW9A 4ISOA 2FS9A 1TGBA 1Z8JB 4B6EA 1DX5M 4LZ4B 1T31A 3FOAA 1NU9A 2PGBB 1P0SH 2TRMA 2P94A 5J4QA 4MNVA 1IQFA 3SO3A 4VGCC 4MVNA 1ZPBA 3IITA 2P3FH 4IMQA 4AG2A 5HM9A 2GGVB 1F5RA 2QA9E 1C2IA 2IOTA 1RTKA 3FP6E 4GSOA 3TNTA 3ZZ6A 5A0CA 5IK2D 3EA9A 4D76A 3KIDU 2TGTA 3RXAA 1FMGA 1S85A 4XOJA 2OTVA 1ESBA 4YT6H 5JBAS 2ANMH 3UQVA 4AYVB 1TNIA 1RFNA 3K6YA 2AIPA 4NCYA 2FO9A 5BPEA 3RM0H 1E37B 5C1YA 3RXDA 1BA8B 1O33A 1O2GH 2BLWA 1O2LA 1P06A 1DFPA 5FX6A 3ZZ8A 1AUJA 2VH6A 3GY8A 3RMOH 1QL8A 3C27B 2A32A 2HWLB 2V7QD 2D1JA 1XUJA 2ZU1A 1MU6B 4Q7YA 2ZTZA 1A61H 5HGGA 1W0YH 1AE5A 1O37A 3QK1A 3GS9A 1C5WB 3LC3A 3MU1A 3SJKA 1AB9C 2ESTE 1O2UA 3GY2A 2A2QH 1YGCH 3QZRA 2OBOA 1OWJA 2FI4E 3SJ9A 1YPHE 5FHTA 2EI7A 1SKYE 3PO1C 3A7VA 3SV9A 1Y3UA 2TBSA 3T5FH 3LJOA 2P3UB 4JK6A 5F8TA 1FLEE 1GHYH 1BHXB 1CBWB 3KNXA 2BD4A 2QV1A 3TGJE 5LGOA 2G52A 1TPOA 3AVZA 3A86A 1OXGA 1DXPA 1O3GA 3LJJA 1SG8B 1N6XA 4WH6A 4UEHH 3P70B 1P2IA 1HFDA 3F6UH 1GI0A 1UTMA 1V2OT 4VGCB 3NXPA 2IPHA 5JBTA 2V3OH 5DP8A 2WPDD 3T27A 2W3IA 3A89A 3RXRA 3BTFE 1ZHMA 1ELVA 1P11E 1BMMH 1F5LA 1TPSA 2I6SA 2VIPA 2P93A 5JB9S 2GT7A 1T4VH 4KP0A 1S83A 1PPEE 2FZZA 2ULLA 3UNQA 1V6DA 3U1IB 3GYLB 4TPYA 3GY6A 1A2CH 3L33A 1RTFB 1Y3WA 3P6ZB 1KXDA 4DG4A 2ODPA 2STAE 5EPNA 1WU1A 2PKSC 2ZHWH 1EZUC 3FAOA 2FS8A 3M37A 4D7GA 1TNLA 4NG9H 2R0LA 2OINA 4CBNA 1MD7A 3BEUA 4J2YB 3GY4A 3T25A 1NT1A 4U32A 3RXUA 1O2IA 3SGBE 3ATMA 4FUIA 3SU3A 1FIWA 1A0JA 1O3BA 2Z7FE 3BEIB 1IQIA 1EATA 1UO6A 2ZQ1A 4AOQA 1ELEE 1DLKB 4MTBA 1J17T 1H8DH 1YKTA 2WPIS 3RC6A 2PTCE 3M3TA 3O8CA 3P8FA 1K1JA 2C90B 2OQUA 3FP7E 5JBCS 4ISLA 2QXIA 4YO9A 1LTOA 2XXLA 3NWUA 1MAXA 1P9UA 3DCLA 5G4BA 5AHGH 1C4U2 1SGPE 3TITA 3TK5A 2WUCA 1DPOA 4ZROA 4DIHH 5FL7D 2WV9A 3DT0H 3EYDA 4F4OC 1P2NA 3E8LA 3TK6A 3UREA 1YPEH 1SGYE 4FETA 1HIAB 3S69A 4CREA 1GI5A 3SNDA 1XVOA 4BTTB 6CHAB 1VCWA 1H4WA 3LONA 1F0UA 1EOLA 2FI3E 3A81A 3BIUH 1SLXB 1TQ0B 4MPXA 1G3CA 2AS9A 1AD8H 1LCYA 3SJ8A 1BBRK 4AFSA 1A5HA 2AEIH 2OUAA 1YLCA 1DUAA 3BEFB 5AFYH 4TSFD 1JXPA 3LGVA 3I29A 3R0FA 1CA0B 2A1DB 2C8ZB 2PHBA 1O2PA 2K8IA 1UTJA 1LMWB 1G3DA 3PLKA 1EJNA 1F7ZA 1ELFA 3LH1A 1GGDB 4XBDA 3RXPA 3N7EA 1V2ST 4O9VA 2G81E 1MTWA 1Z8RA 1HDTH 3OEED 5B6OA 1E34B 3KQDA 2QE7D 1MQ5A 2B0FA 1KTSB 1W0JD 1RS0A 5LPRA 3MH6A 1YPGH 5K0HA 4NSVA 3ATLA 5I25A 1Z1JA 1KLIH 3LGWA 4OS6A 2QXJA 3ZVAA 4BAOB 1GMHG 3PMAB 3E90B 2V3HH 3O8BA 2AFQB 3SU6A 7GCHG 1YF4A 1ZTKA 1XM1A 3DA9B 2BDGA 1ELBA 1O2HA 2EC9H 3D65E 2UUFB 2Q6DA 1WOFA 4D9RA 5BRRE 1EKBB 2ZCKP 3T29A 1D3TB 1BMFD 1SLWB 2CHAC 1BTWA 3Q76A 4U30A 3PTNA 1O3DA 1V2QT 1W11U 3MO9A 1ZPZA 4ABHA 1P2QA 3PLPA 2SFAA 1GBKA 2G51A 2TGDA 5PTPA 3MO6A 2OC8A 2XWAA 5F8ZA 1LKBA 1W2KH 3CENA 1VJAU 4ABEA 2M2AA 3A8AA 2ZEBA 1EB2A 4O03A 1V3XA 1BMAA 4U01A 1C5QA 3AW1A 1SSXA 4X6OA 3D62A 3RC5A 3KQBA 2FTLE 3QDZB 1SPJA 1J8AA 1IHSH 1QIXB 3OU0A 4NGAH 1GI9B 1OWHA 1L1NA 2ALVA 1GJ4H 2OC1A 2HLDD 1G36A 1NRRH 3PWCA 4HFPB 2GX4A 2GZ7A 4NSYA 2H9EH 1AY6H 1GHVH 1K1IA 3LH3A 1AFEH 1S84A 1OWEA 4M9FA 4X1PU 5EPYA 3ATIA 1TOCB 2XTTB 1A0LA 3A8DA 2XRCA 3Q3YA 3HK6B 1SBWA 1VGCB 1EPTB 4B2CA 2FP7B 1D3QB 3ZZ4A 1EZSC 1QBOA 2VNTA 1BQYA 1QB9A 3E0PB 3GICB 1GHAG 2ZFFH 2O8WA 3PB1E 1BTYA 4ZCNA 5EQSA 2AHME 2XOKD 3VB5A 4DT7B 2ZQ2A 1YC0A 1F0RA 3IG6B 5A8XA 4ABFA 2VU8E 1GHXH 2A4GA 3ZYEA 1LKAA 2WPJS 4B71A 3BSQA 2F4LA 3TPIZ 4E05H 1C9TA 1O3CA 1XUGA 3UR9A 3SI4H 2BDBA 2BVRH 4AYYB 5C5NA 1XKBC 1YCPK 3F9HA 1DY9A 3TGKE 4XFQA 1V2RT 2BLOA 1UVSH 4UE7H 3NZIA 2R2MB 1ZHRA 3QN7A 2W7UA 2GD4B 1K22H 3KEEA 1AVGH 1C1OA 1THPB 2B5TB 1C5OH 3LT3A 3U8TH 5JPMH 1TX8A 4I31A 4D7FA 2XWBI 1Q3XA 4Y76A 3A87A 2YMSB 4FU8A 1O31A 3KGPA 2H1UA 2QXGA 2AIQA 1SVPA 2BDHA 3BTTE 4O3TA