2CXVA

Dual modes of modification of hepatitis a virus 3c protease by a serine-derived betalactone: selective crystallization and high-resolution structure of the his-102 adduct
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
212
structure length
212
Chain Sequence
STLEIAGLVRKNLVQFGVGEKNGSVRWVMNALGVKDDWLLVPSHAYKFEKDYEMMEFYFNRGGTYYSISAGNVVIQSLDVGFQDVVLMKVPTIPKFRDITQHFIKKGDVPRALNRLATLVTTVNGTPMLISEGPLKMEEKATYVHKKNDGTTVDLTVDQAWRGKGEGLPGMCGGALVSSNQSIQNAILGIHVAGGNSILVAKLVTQEMFQNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable protein P3C
publication title Dual Modes of Modification of Hepatitis A Virus 3C Protease by a Serine-derived beta-Lactone: Selective Crystallization and Formation of a Functional Catalytic Triad in the Active Site
pubmed doi rcsb
source organism Human hepatitis a virus hu/northern africa/mbb/1978
molecule tags Hydrolase
total genus 53
structure length 212
sequence length 212
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00548 Peptidase_C3 3C cysteine protease (picornain 3C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2cxvA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2cxvA02
1NU7B 1O5BB 2C8YB 2Z9JA 2GX4A 2HLCA 1BTZA 1YCPK 2YNBA 1B5GH 1A0HB 5J4SA 1ZSJA 1TMUH 3MU1A 1GMHF 1O3DA 3K6YA 3C1KA 2AMPA 1ZTJA 2Q6DA 1PPBH 4ZXYH 3UNRA 1XUIA 1AHTH 2SGDE 1P9SA 3FP8E 2XBWA 1H9HE 3F68H 4R0IA 4TY7A 1P57B 3A7ZA 1Z71A 1G3EA 2WUBA 1HUTH 3RMNH 1Z6EA 4H42U 4UFFH 2LPRA 4AFUA 3P92A 1TFXA 2BD5A 2W7UA 4B2CA 1S0RA 4B75A 1MTSA 1BMMH 1SLVB 3SORA 1O2UA 4NIYA 5LH8A 2A4QA 4FU7A 2ZHWH 1OWHA 3T28A 1BA8B 4OS5A 1RJXB 1MD7A 4ZH8A 5T3HA 2XBVA 1V2TT 4JCNA 3SZNA 2PWXA 4O97A 2NU2E 3A8CA 1NRSH 1NZQH 3ZV9A 1UTPA 3QWCH 1NTPA 4E05H 2Y82A 1PPFE 3ITIA 3SUFA 1CBWB 4KTCA 2PKSB 3QTOH 4Y79A 1TNJA 4BAHB 1FZZA 4OS7A 4D7FA 3P8GA 2GCHF 4MNVA 5AF9H 3ZZCA 1BMAA 3OX7U 1C2IA 2HOBA 1SGPE 5C67A 4X6OA 4CHAC 3LJOA 5LPEA 1C1TA 3RXVA 4GCHG 1P2KA 3ZV8A 1DPOA 1V6DA 3QN7A 4RKOB 2OC8A 2V0BA 2OCVB 1NFXA 1O5FH 4Q7YA 4H6TA 3RLWH 3MO6A 5F6MA 2Z9LA 1A0JA 2ZGXH 1H9LB 4WVPE 2ZCHP 1W3CA 5EPYA 4ABBA 3RXKA 3L33A 3SNDA 3UNQA 3ZYDA 2STBE 2W5EA 1J8AA 5CHAC 1TOCB 1DSTA 1LVOA 1IQEA 1GI2A 3FZDA 4CR9A 2GDEH 2FOMB 3GICB 1G3BA 1W10U 2HGTH 1QL9A 1TYNA 1VCWA 2SNVA 3MYWA 4A5TS 3BEUA 1C1OA 1FI8A 4YOGA 1QR3E 1GPZA 3B9FH 3FANA 1MKXH 3BTDE 1MTNB 4XBCA 2ODPA 4JK5A 4Q7XA 1LKBA 1CA0B 4F49A 5DGJA 1OP0A 2FLRH 5K0HA 1AVXA 2UUJB 2ZDLA 2J9NA 2PUQH 1PFXC 4I7YH 3RC4A 2JKHA 3TK5A 1EP5A 1MKWK 2H9EH 4YZUA 3TPIZ 2FLBH 2SGFE 4MTBA 1TQ0B 1ZMNA 4QT8C 3KQDA 1AQ7A 1DY8A 1KY9A 3TVJB 1AI8H 4BXSA 5FCRA 1DM4B 2A1DB 3S7KB 2WPMS 4K5ZA 1O3GA 2HPPH 2R9PA 4X6MA 2GV7A 3BTHE 3I29A 4JZDH 2ZQ1A 3ZVCA 1HCGA 4K8BA 5J4QA 1QURH 1TA6A 5EOKA 2ZFTA 1ORFA 4CRBA 4NCYA 4JZIA 1SGYE 1P2NA 2OQUA 1HGTH 1CT0E 1ZHPA 2VIVA 1OXGA 2Z94A 2P93A 5A8XA 2XRCA 1P02A 3G01A 1AUTC 3PTBA 3UQVA 2RG3A 4XBDA 1EKBB 3C27B 4E7RG 1QL8A 2BD2A 1WV7H 1IQIA 1GBTA 1SQTA 5E0GA 5I25A 3MH6A 3SNAA 4FUHA 1LVMA 3F6UH 5FXLA 4ABGA 2G81E 1EAXA 3RXRA 2BD8A 2ZPRA 2OP9A 3QGNB 3RXJA 6GCHG 4AGKA 4X1RU 2XXLA 3S9CA 1THRH 3GCNA 3R3GB 3LOXA 1DSUA 4HI3A 1TBQH 2UUFB 2BQWB 1O32A 6CHAB 3BEFB 4XSKU 1E37B 2ZFFH 3LPRA 2ZU1A 1SBWA 1WQSA 1TGNA 1QHRB 5T6GA 2HNTC 3ZVGA 3M3VA 1BRAA 2ZDNA 1CBWC 2FYRA 1C5WB 3K9XB 2V35A 4K60A 1VITF 1SQAA 1UTJA 1FONA 1J14A 1BMNH 4UFEH 1EJNA 4NWKA 1QA0A 1BTWA 1S84A 3A7VA 1GI5A 1VJAU 2J4IA 4I32A 4UFDH 1DUAA 4MPUA 5PTPA 2QAAA 1FIZA 3PLPA 3SGQE 2QXIA 3DA9B 3NKKA 8GCHG 1GL0E 2CF8H 1Z8RA 4Y0ZE 1AVWA 4X1QU 1P09A 2BOKA 4J1YA 2AGIX 4DW2U 1TB6H 2F3CE 2GT8A 2C3SA 1BTXA 2BQ6B 2VGCB 3RXMA 4B2AA 5JB9S 1DVAH 5LPFA 3SO3A 3MNSA 2KAIB 1UO6A 3MU4A 1KXAA 5A8YA 3V13A 1ELDE 3RXAA 4AB8A 1MTNC 3P8FA 3ZZ5A 4CRDA 1C2FA 1UTKA 1CA0C 3OTJE 1G2LA 2UWLA 1BTUA 1P2JA 1MH0A 1G36A 3PLBA 3RXDA 1FDPA 2ZFRH 4JZFH 1S6HA 1MU6B 1IQLA 5EQRA 1IQGA 3UUZA 1P0SH 4CR5A 3FAOA 3LGUA 5HGGA 4O9VA 3SJKA 1O3IA 1H4WA 1HJ9A 3QZQA 7ESTE 2QN5T 4YOIA 1LHDH 2PHBA 4GAWA 4RN6A 1GHWH 2TBSA 4D76A 4YLQH 2F83A 3ODDA 5T6DA 2BHGA 1HNEE 2PLXA 3DHKH 1GDUA 4Y6DA 2W3KA 1NT1A 1O3OA 5GXPA 5DK1A 1AIXH 1O2PA 2FWWA 1EB1H 2PTCE 3RMMH 1RFNA 3SU4A 4ASHA 1PPCE 3RXGA 3HKIB 1C1NA 1OYTH 2ANMH 1GHYH 1GJ6A 1ESTA 1NS3A 3MU0A 4U32A 2AS9A 5FX6A 1DX5M 2GGVB 1MQ5A 3RXFA 2ANYA 2M5TA 5IDKA 3D49H 3UR6A 3AASA 5F8XA 4IN2A 1NM6A 3HATH 4GPGA 1GWAA 2BY9X 2A32A 2B0FA 3A84A 4ABAA 1GG6B 3W94A 3M7TA 3RLYH 4MNYA 1O3EA 1L1GA 1RGQA 1Z1JA 1C4Y2 1D9IA 1CA8B 4ZHMU 4HFPB 1V2WT 1T8OA 3BIUH 1O5GH 1P3CA 3RXCA 2F9NA 3K2UA 1LHCH 4Q80A 1E34B 3SN8A 1TA2A 2Z9GA 4U30A 2DUCA 1C5UA 2XCNA 1HAXB 2A7CA 1WQVH 2AERH 3EQ0H 1HJAC 2ZGBH 2Y80A 3BTFE 3E90B 3GY3A 4FUGA 4ZXXH 4MNWA 4A7IB 1C5PA 3LGWA 1ELVA 1V2VT 1ABJH 2NU4E 4E06H 2ZF0H 1QY6A 3RU4E 1S6FA 1Y59T 3GY4A 3ZZDA 1D3DB 1QJ1B 2B5TB 2VIWA 2AH4X 6CHAC 3E91A 1Q2WA 2ZFSA 1D6WA 4CREA 1WUNH 4OGXA 2BLOA 2H5DA 1O2YA 3SI4H 2C93B 3T2NA 3M5MA 3ZZAA 4XE4A 1TOMH 1NC6A 3HK3B 2BTCE 5G4BA 3UWIA 4VGCB 1QFKH 2A0QB 1EAUA 4YO9A 1CO7E 3IWMA 4TWYA 3SUEA 4IBLH 3GCHB 1FPCH 4ISIH 1QRZA 1TMBH 3RU4T 2FOHA 2V3OH 1AD8H 1YC0A 3MTYA 3GCTG 2Y5HA 1ANEA 1P2QA 3AW0A 4X8TH 1J15A 4CH2B 5C2ZA 4AGJA 1N8OC 2FI3E 4AYYB 3TH2H 1AWHB 1AZZA 2ZO3H 3BF6H 2FIRH 1FY8E 2BD4A 2VIDA 1K1OA 1O2LA 5F8ZA 1A0LA 1YPLH 1RD3B 2BY7X 1TPPA 2RA0A 1QRWA 5F03A 4BANB 1GHXH 2CMYA 5L2YH 4X1SU 1XUJA 1BOQA 1YM0A 3STIA 1HIAB 3VXEH 1XXDA 3TNTA 2AIQA 3E8LA 2ZKSA 5TCCA 3SOSA 4J2YB 1GI8B 1QNJA 1CE5A 2BDHA 3U8OH 3MNBA 2RCEA 1LHGH 1KLTA 4B76A 1T8MA 1DDJA 1N1LA 2GV6A 3L3TA 1CQQA 1O2NA 2VWMA 1ETTH 1MMJN 4ZAEA 1MZDA 5DP9A 1TIOA 5JDUB 4Z0KA 2B9LA 1KTSB 4CBNA 1P03A 8LPRA 1ZTLA 2V6NA 2P95A 4ISOA 1ELTA 1GGDB 3SJ8A 1J9CH 4AOQA 1S85A 1SGCA 3RC6A 2BM2A 2GVFA 3KN2A 4X2XA 4YESB 5JBCS 1V2MT 1BB0B 2FI5E 2GZ8A 3U98H 4ZKRU 3QLPH 1BIOA 3ATWA 3S7HB 1QRXA 1GBBA 1W2KH 1Q3XA 4R8TB 3LJJA 2P8OC 3A7WA 4TPYA 4ZKOU 1HAHH 2H5CA 1ELBA 1IHTH 3NPSA 1HIAA 5AFYH 3VEQB 2GKVE 1C5XB 1SFQB 1TPAE 1UK2A 5E8EH 1C1MA 3RXBA 3RXLA 2P3UB 4D9RA 5FHTA 3VB6A 1JWTA 1GI3A 1NU9A 1ABIH 3ZZ7A 1O2GH 1C4U2 1ZMLA 2ZHQH 4UFGH 2AGEX 1QBNA 3NXPA 5E0HA 3RMLH 3ATIA 2A4OA 3DFLA 1TRMA 1CHOG 5FBEA 3P17H 1GG6C 1B0EA 1TRNA 1ELGA 1ETRH 2EC9H 4X8UH 5EXLA 3T29A 4ISHH 2TGDA 4MVNA 3EAJA 3SGBE 1W12U 1GJ5H 4Y8XA 3BTGE 4X8SH 1GCTB 2PGBB 3RM2H 1HXFH 1GI9B 2JH6D 1LHEH 3BTQE 3LC3A 1P3EA 1B0FA 1LMWB 2QXGA 2V3HH 3CS0A 2BDAA 1INCA 4ISNA 1DOJA 1ACBE 3ZVBA 2BVSH 1UHBA 4FUBA 4ZKNU 3GYLB 1Y3UA 3PV4A 1JIMA 1MCVA 3MH7A 1EJMA 3TJOA 2ZHFH 1TLDA 2CV3A 1GBMA 5FAHA 1HFDA 3A83A 2ZEBA 4FXGH 1O2QA 1FQ3A 2VU8E 4A6LA 1TX8A 1AB9C 4I8HA 1LKAA 2ZFQH 5FBIA 2ZP0H 2A5AA 4I8LA 3SBKA 4Y0YE 1GHBF 2HRVA 1C1RA 2XYAA 2OD3B 2OINA 5EW1H 1K1MA 1Y3WA 4JYVH 2JH5D 3SV6A 1GJ9B 3LU9B 1J17T 2HNTE 1EOJA 2Y81A 7GCHF 1E35B 4Y71A 5EODA 4X2YA 3HGNA 1TE0A 1CGHA 4TWWA 2QY0B 2Z9IA 3PMHB 1MTVA 4CBOA 1FUJA 3SNBA 1LCYA 1THSH 1MKWH 1C5OH 1KDQB 1DWBH 1QJ6B 3M37A 1GMCF 1WAYB 2G55A 3UPEA 1EP6A 2ZPQA 2D2DA 4KTSA 1O3HA 1NO9H 1KLJH 1C5TA 2OTVA 4DIHH 4WXIA 2XWAA 1HAOH 4GLYA 1AO5A 1GMDG 1C5RA 3U9AH 1GHZA 2QXHA 4Y8ZA 1ZZZA 1DWCH 1O2ZA 5DP5A 4K69A 2B7DH 3MNCA 6LPRA 2BY6X 3M35A 4A92A 2STAE 2BDCA 1BZXE 2SNWA 4INLA 4NWLA 3TIUA 1P8VC 4IC5A 3RUOA 3UTUH 2ZNKH 3P95A 1EAWA 3L6PA 3MU8A 2PTNA 1O3LA 1HAVB 4K1TA 5BRRE 4BAKB 1C2MA 1ARCA 1C5ZB 4WXVA 1GGDC 1EB2A 1Y3VA 2OLGA 2C8XB 3UQOA 4F4OC 2FOBA 3NUMA 4BAQB 2TRMA 4Q7ZA 1C1SA 2ANWA 1ZGIA 3M7UA 1UVUH 2PSXA 4UDWH 2W3IA 5EGMA 1TPSA 4GVUA 3S9BA 4YT7H 1K9OE 1O3JA 4DY7B 1C4V2 1CGIE 1JOUB 5TCAA 1W11U 1AKSB 1L4ZA 1YPMH 3SI3H 3CP7A 4NIWA 4LOYH 2AGGX 3DD2H 4HGCA 3A80A 2WYGA 1OOKB 3SGAE 1YPEH 3KQBA 4NA9H 3U1JB 2CGAA 1H1BA 2ASUB 3DUXH 1C2EA 4KP0A 1TNLA 4ABFA 2FS8A 5IYTA 1X7AC 2R0LA 4ESTE 1F5KU 1FJSA 1T4UH 3E16B 3RXUA 1CVWH 1WSSH 1DANH 1Z8JB 1A2CH 2VB0A 1HAVA 2BDYA 1OYQA 3A8DA 4LK4A 1Y5AT 1KXFA 2ZCKP 1GCTC 1M9UA 4IW4E 3LH1A 4INKA 2Z3CA 4MLFB 1KXEA 3A82A 1G3CA 1S82A 1SHYA 4I8KA 5C5NA 1LTOA 1UK3A 4X8VH 1O2HA 1OKXA 1FY5A 1FMGA 4MDSA 4DCDA 2NU3E 1Y5BT 1V2JT 1SGTA 4K3JA 3TITA 4X0WU 2BLWA 1K1LA 1SGEE 1ZSLA 3PMAB 5DKMA 4GHQA 1YCPM 3NK8A 2BB4A 1DITH 5C1UA 2SGEE 4ZUHA 2IPHA 5E2OA 2HPQH 4GSOA 2D1JA 3HK6B 2WPIS 1C2GA 3OSYA 1C1QA 4MPVA 4GCHF 1HAIH 5T6FA 3TGIE 2P3TB 1EZUC 1NRRH 2OBOA 1OSSA 4WH6A 1G30B 1SGIB 4AG1A 1F5RA 1BUIA 2F9OA 3EA9A 2C90B 4FVBA 4NA8A 2H2ZA 5EQSA 3I78A 2JH0D 5FCKA 3EGKH 3TJUA 3PWCA 3LGTA 2P94A 1UCYH 1P12E 2ZHDA 1GBAA 5H4IB 5DPAA 2Z3DA 3D62A 1BQYA 3MNXA 4AB9A 1C2LA 3E6PH 1F0RA 1G3DA 1AVGH 1ZHRA 3U8TH 1PQ7A 1UCYE 3FP7E 3BG8A 3QUMP 1T32A 5A2MH 1UVSH 1VR1H 5JBBS 3M3SA 4LZ4B 1UK4A 2PKSC 4KELA 1FNIA 1EZSC 3V12A 1ANDA 1KYNA 3H5CB 1TPOA 2HVXA 3TLOA 1ZPBA 2QXJA 3MO3A 1AFQB 4XOJA 1HBTH 1O39A 1LPZB 5CMXH 2FOFA 1SMFE 3GY6A 1GHVH 3QK1A 3LKWA 1LPGB 5HM9A 4DJZB 2GCTB 1V2NT 1YF4A 3BTTE 5FPTA 4YTAA 3I77A 4D9QA 3PM3A 5HYOA 5GWZA 2QC2A 3M5LA 1EPTB 1D3PB 1JMOH 1ARBA 1XUFA 1GI7B 3VB5A 1SVPA 4AORA 5GCHG 3M3TA 1EXFA 1D3TB 1B7XB 1MUEB 3U8RH 1L1JA 1C5MD 3SU2A 4B2BA 4NZQA 1O2TA 2PV9B 3OU0A 2XBYA 1CGJE 2VH0A 1HXEH 4DURA 4OS6A 2VIQA 2D26C 3HGPA 4CRAA 1GI0A 2TGPZ 3VGCB 2W26A 4H4FA 3SV2H 3D65E 1XUKA 3M5NA 2XWBI 4ZROA 3SQEE 3SU6A 3Q3YA 1S81A 1T8LA 3T25A 1UMAH 1K1PA 1C5NH 2Z7FE 3B8JA 4K2YA 3Q3XA 1UCYK 1Z1IA 4IN1A 1TX6A 1O5DH 2C8WB 2D8WA 1SLWB 2WPJS 4RKJB 1O2MA 4BNRA 3TNSA 1ZLRA 2ZTXA 3IITA 3N7OA 4NSVA 1XM1A 2PUXB 3TH4H 1C2JA 3VXFH 1EPTA 2XBXA 1SOZA 4TPIZ 1H8IH 3PB1E 3Q3KA 5JB8S 4ABEA 2THFB 1EJAA 3ZZ8A 3QO6A 6GCHF 1SG8B 3RDZA 3O8DA 3ZVFA 2GMTB 1EASA 3TJVA 1HPGA 4DGJA 1K1JA 4OS2A 5C1XA 2ESTE 1VGCB 1F2SE 3GY8A 4O3UA 2SGQE 1GBHA 2ZGCA 4BTIB 2ZPSA 1O0DH 2KAIA 2OQ5A 2O8WA 3ENSB 4NGAH 2CHAB 1AFEH 1V2UT 1A5IA 3BV9B 1DS2E 3TU7H 1O2IA 1C9PA 1W8BH 4H6SB 4UEHH 2XCFA 1V2OT 2BD9A 3A86A 2ODYB 3TK6A 1GJ8B 1GCDA 1LQEA 3SQHE 2FDAA 3F9EA 5ESBA 3UOUA 1ETSH 1PPGE 1C1PA 2ILNA 1P2MA 8ESTE 1YBWA 1Q31A 1EATA 1O5CB 1C1UH 1TGTA 3IG6B 1O3MA 3RXHA 1TMTH 3PO1B 2Y6TA 2GT7A 4FUCA 5JBTA 2ZGJA 1SQOA 2NU1E 4JMYA 1HRTH 3P8NA 1OWJA 2J95A 2FYQA 4THNH 2BZAA 8GCHF 3TJNA 1GJBB 4RSPA 3SJ9A 1FXYA 1LVBA 1ZPCA 1F7ZA 4TYDA 2AEIH 1O5AB 2Y7ZA 1T4VH 1YPKH 4LXBH 1K1NA 1TALA 3VPKA 3O8RA 1MQ6A 2K1QA 2VWOA 2ZG0H 3A88A 1O2WA 1PYTD 3S0NA 1TQ7B 4WMFA 1DE7H 1GHAG 2G51A 4DG4A 2FESH 5GJ4B 5E0JA 3A8AA 1NROH 1GJ4H 4BAMB 1TGCA 1GJAB 1DWDH 1HV7A 1K2I1 1BT7A 1TGBA 3K65B 4IC6A 2NU0E 3A89A 4NFFA 3SUGA 1DWEH 1EUFA 1IQFA 1Z7KA 2BZ6H 4Y76A 3F9FA 4LZ1H 4K1SA 3F1SB 1P01A 4WMEA 2GCTC 1EOLA 2Q6FA 1ZOMA 2R3YA 3QDZB 3BSQA 3SU5A 4BTTB 4I8GA 1EPTC 2FX4A 1KXDA 1EZQA 1OWDA 2ZTYA 3NCLA 2AIPA 3PMBB 1BMLA 1HAGE 1QB6A 1DUEA 3R0FA 3BEIB 1SC8U 2EI7A 1K22H 3GY5A 1QIXB 1P2IA 1GMHG 4I33A 2A31A 3SJOA 6ESTA 2VGCC 1QGFA 4Y10E 4A1XA 2FOEA 1FPHH 4FUJA 4AZ2B 4ISLA 1VJ9U 2IJOB 2HWLB 1JBUH 1SB1H 1WU1A 3MO9A 1A7SA 1IQJA 1MAXA 1ZGVA 2EI8A 3BG4B 3BTEE 3UWJH 4SGAE 4OS1A 2CN0H 1BBRK 5AVDA 1GL1A 4Y7BA 2W7SA 1NN6A 4ABHA 4UD9H 3O8BA 1WTGH 3KEEA 1ZHMA 3ELAH 2WINI 1ZRBA 1XKBC 1CSOE 1O5EH 1GVLA 3FVFB 5ABWA 2OC1A 2ZCLP 1IQMA 3MU5A 3H7TA 1F92A 3RXSA 4JYTA 3GDUA 5K7RA 2YOLA 3BN9A 1ZPZA 3ZVAA 1P11E 1A4WH 4YM9A 2FS9A 4K8YA 5AHGH 1O30A 1ID5H 2BLQA 1UTNA 2Q6GA 1SI5H 1HAPH 2ZU3A 1UTLM 2AMQA 1N6XA 2FI4E 1LDTT 3GOVB 5C20A 2OXSA 1A3EH 1C5SA 1PPEE 1VGCC 4HZHA 5JPMH 2VWLA 1ESAA 3P70B 3SHAH 1K1IA 4WH8A 1C2HA 2G5VA 1SLXB 1RTLA 3DT0H 5A8ZA 2ZU4A 4X2WA 5EQQA 3STJA 2WV5A 2GCHG 2ALPA 3T5FH 1GBIA 5EU8A 5DP7A 1MZAA 5TJXA 2QCYA 3JZ1B 5EXMA 1D3QB 1NY22 4AX9H 3QX5H 2YNAA 4A1VA 4WMDA 1MD8A 1UVTH 3FZZA 1FY3A 2DE8A 3BIVH 1TONA 5DP6A 1NESE 1O37A 1YLDA 1U6QA 3MH4A 2ODQA 1OPHB 2BD3A 4XDEA 2O8UA 3A87A 2C8ZB 4KGAA 4NIVA 4CH8B 1HLTH 3GCTF 4AN7A 3ZZ4A 1D4PB 1RS0A 1PYTC 1O2OA 3PMJA 1TNIA 3KHVA 5DP4A 4YOJA 1SR5C 2ZDMA 1O3PB 1JRTA 1DICA 5L30H 2GZ9A 1T31A 5ESTE 3DFJA 1SOTA 3AW1A 4Y8YA 2TPIZ 2RA3A 4IGDA 3Q76A 3LGVA 1O35A 1W7XH 1A3BH 2FOAA 4NZLA 4NG9H 1FIWA 2WPLS 1Z8IB 1V2KT 2P3FH 2G00A 1O2VA 1SGFA 5L2ZH 1NFWA 1TAWA 9ESTA 1UVOA 1P2OA 2VWNA 2ZFPH 4VGCC 5B6OA 1XUGA 2O8TA 2BLVA 4CRGA 1O3FA 2FMJA 2BD7A 3A7TA 3GCHC 2H9TH 3S69A 1L0ZA 1ANBA 1A5HA 3KL6A 1YPHC 2GTBA 1TABE 2A5IA 3E3TA 5GIBA 2UWPA 3WY8A 3UY9A 3VB4A 2ZA5A 1C1WH 1YYY1 3SV7A 4D7GA 1AY6H 1BITA 2HNTF 4D8NA 3LDXH 3UFAA 1CT4E 3TH3H 1C9TA 2RDLA 3ATKA 2G52A 2J34A 3AAVA 1BRBE 2ZQ2A 2BOHB 1OS8A 3SHCH 2SGPE 3JZ2B 3ATMA 1UTMA 2QYIA 3KGPA 1S83A 1O2JA 1SPJA 2WV4A 2DE9A 1W14U 1G37A 2ZWLH 1QTFA 2ZHEH 1A61H 2FX6A 1LHFH 1CHOF 4AG2A 1ZJKA 4MPWA 3PTNA 2ULLA 3BG4C 2CJIA 2FO9A 1LO6A 1AU8A 5F8TA 1V3XA 5LGOA 5FX5A 1G9IE 2G4TA 1KXBA 1NRQH 2VVUA 4WY3A 1ZR0A 2GDDA 2BXUH 3MI4A 2WPHS 1ANCA 1KDQA 1WYKA 4HTCH 4YLUA 1BCUH 1Z8GA 1GVKB 2GZ7A 1Z6JH 1RIWB 4X6NA 1ESBA 1GI6A 4JYUH 2Q1JA 1O2XA 3NZIA 2WUCA 4KTUA 2FODA 5A0CA 4WF8A 5DP8A 3S9AA 1T7CA 1FN6A 2A45B 2F9VA 3MWIU 3SNEA 3UOPA 1C5QA 1A1RA 3CENA 2FXRA 2ZU2A 1C2KA 2BDIA 1EX3A 3LIWA 1O2SA 2A2XH 1P9UA 1LQDB 4NIXA 3BTWE 1ELCA 1QL7A 3URDA 2FEQH 1IOEA 1VITG 1YGCH 5HXFA 2F9BH 3ZZBA 1DT2A 1OWIA 1CT2E 3MMGA 5FPSA 4CRCA 1S5SA 4XBBA 1RXPA 2OC7A 4ABJA 5EXNA 1J16A 1YKTA 1MBQA 3ZYEA 1KLIH 3OY5U 3P8OA 1TNKA 4CRFA 2H1UA 5C5OA 3TK9A 3PYHA 4FU9A 1IQHA 3V0XA 2FOGA 1QB1A 1MBMA 3H7OA 3SU1A 1CU1A 2SFAA 3K6ZA 2FP7B 2BQ7B 1QB9A 1T8NA 5AFZH 1QQUA 4A1TA 4TY6A 1C5YB 1AKSA 1JIRA 1GJCB 3VB7A 1XUHA 1SSXA 4NFEA 5A0BA 3RP2A 1YP9A 1TX7A 2BVRH 5C1YA 2VIPA 4Y11E 5CE1A 3KF2A 1GMDF 1OX1A 1DY9A 1TBZH 1KIGH 2QF0A 4DVAU 2ZI2H 5DG6A 2R2WU 5ETXA 1CHGA 4O3TA 4X6PA 1XX9A 4SGBE 1YPGH 3QTVH 1ZTKA 5EW2H 1L2EA 1PQ8A 1NFUA 2F91A 4MNXA 1MKXK 2F9UA 1D6RA 1HJAB 1SGRE 3GYMA 2FZZA 1VITH 3UNSA 4MQAA 2EEKA 1VZQH 2QGRA 3SU0A 1TNGA 3BTME 1PJPA 3RXOA 3SV9A 2PFEA 2A5KA 4MG3A 3HKJB 3GY2A 2Z3EA 1GVZA 1E38B 2XC0A 5FPYA 3RXPA 3VFEA 1UJ1A 1XVOA 2ANKH 2NWNA 4X2VA 1V2RT 3KIDU 1LPKB 2BDGA 4M7GA 3A7XA 4NA7A 2LNCA 1AUJA 1NRNH 2J2UA 2J94A 2XTTB 2IOTA 1FV9A 1C2DA 1E0FD 2ZZUH 3GDVA 1BJVA 2VNTA 1FY1A 4BAOB 1F0UA 1P04A 3EYDA 1GBJA 2G4UA 4ZKSU 1XKAC 1GI4A 2ZDAH 4ZMAH 2Y7XA 3F9HA 2XC5A 2BYAX 1L1NA 3GDSA 1O2RA 1ELAA 1DXWA 1BRCE 1THPB 1XXFA 4FVDA 2ZIQH 2UUKB 2UUYA 3ZZ9A 2Y5GA 3KQCA 1N8OB 2HALA 1N6YA 3KQEA 1AWFH 3F9GA 1HYLA 2QV1A 4B73A 1MAYA 3LC5A 4DT7B 1HB0B 1MCTA 5A09A 1ZJDA 5HMAA 2J92A 2WPKS 1H8DH 1C5VA 1FAXA 5GPIB 4BXWA 3RXTA 4WWYA 1RIWC 3URCA 5GDSH 3O8CA 3A7YA 1FY4A 3A81A 5A0AE 1VCQA 2CF9H 4DIIH 2VJ1A 4BOHA 1TGSZ 2FTLE 1Y3XA 3EA7A 5BPEA 1O2KA 3ZVEA 2G8TA 1QBOA 1YLCA 2I6QA 3GISB 4AYVB 4FUFA 1RTKA 3QGJA 3LT3A 1F5LA 5SGAE 5DP3A 1BHXF 4KKDA 1OWEA 1TBRH 2IN2A 3T62A 1GBEA 1UVPA 1AZ8A 2FOCA 3ATLA 3FP6E 3RMOH 1KTTB 2FTMA 4OS4A 3CS7A 2O8LA 3B23B 1SL3A 1Y3YA 2PR3A 3TGKE 1TRYA 2VH6A 4PROA 5JYIA 1BHXB 5EPNA 4ZHLU 2P8OB 1BTYA 1BJUA 1MTWA 1UTQA 4AFQA 3OYPA 2VINA 3AAUA 1DLEA 1WTHD 4U2WA 1O33A 2JETB 1C1VH 1HDTH 2AFQB 4B74A 3ZVDA 1OWKA 5EG4A 1K21H 2XW9A 3UIRA 3KCGH 5E2PA 3HPTB 3M61U 2PSYA 1AGJA 1AE8H 1XVMA 1QJ7B 3RXIA 4NSYA 3V7TA 4AFSA 4FUIA 1H9IE 5I46H 1IQKA 2PGQB 2J38A 3SU3A 2P59A 1IAUA 4O03A 2F9PA 3PROA 1YPJH 4XFQA 4MPXA 1HAZB 4JK6A 3SUDA 1FAKH 2XC4A 2QF3A 2AYWA 3OY6U 2A2QH 1EAIA 1Y5UT 3GCOA 4Q2KA 3MOCA 2H9HA 1DFPA 1F0SA 1P05A 4IMZA 4UE7H 3ZZ3A 5L6NH 5LPRA 4B1TA 2B8OH 9LPRA 3M7QA 5C3NA 3LGIA 1BBRH 4AFZA 5GCHF 3NWUA 3RC5A 3KNXA 3EDXB 2ALVA 4FU8A 2ZDKA 1EQ9A 1PPHE 3BTKE 2BDBA 4INHA 2OUAA 4X1PU 1SGDE 1O31A 1YPHE 4OGYA 4X1NU 1BBRE 2BY8X 3VB3A 4ZHAA 3E0PB 1SGNE 3E1XB 1ZRKA 1SGFG 4FUEA 1F0TA 1NPMA 4BTUB 5JBAS 3U1IB 1JRSA 1AB9B 3LGYA 1QA7A 1ZSKA 1UTOA 1WBGB 1DXPA 1GBCA 2O9QA 1O38A 1V2PT 3D23A 1AFQC 2P16A 8KME2 1RRKA 2R3UA 1G32B 1MTUA 1W0ZU 1GDNA 2BX4A 1AN1E 1KSNA 1V2ST 1QCPA 1GBDA 1O3NA 1VCPA 1PPZA 1BRUP 1AMHA 2WYJA 1O3BA 1OP8A 2GP9B 2QIQA 3PLKA 3U69H 1L4DA 3M36A 2BX3A 2G5NA 2ZTZA 2EA3A 3SJIA 3MFJA 1ELEE 3SNCA 2A4RA 2BVXH 1G2MA 4GUXA 3UR9A 4JZ1A 1BTHH 1PQAA 4I31A 2BY5X 1ZYOA 2PW8H 3SW2B 3AVZA 2FPZA 3RU4D 1V2QT 2VVVA 2I6SA 3FFGA 3VGCC 2ZGHA 4U01A 3TGJE 4E7NA 3ZZ6A 2OBQA 1NFYA 4CHAB 4B71A 4IMQA 1SGQE 1SFIA 3T27A 1EZXC 3SV8A 1GI1A 1GHBG 4ABIA 1OP2A 4FUDA 1SLUB 2EI6A 3V3MA 2BXTH 1O36A 1YCPH 2H6MA 2Z9KA 3UREA 5DJ7A 1AE5A 2R0KA 4WJG2 1GDQA 2VIOA 2AMDA 2TGTA 3PWBA 4JZEH 4ABDA 4DOQA 7GCHG 1WOFA 1NRPH 1C5LH 1HAYB 1S0QA 2ZDVH 5CHAB 1XMNB 2PKAB 2SGAA 2ZECA 1E36B 3ESTA 4I8JA 1GBKA 2XNIA 1O3KA 2GMTC 2BMGB 2QA9E 1BTPA 2R2MB 4Z6AH 3A85A 1FN8A 3LONA 4Y7AA 1W7GH 4GHTA 3M5OA 7KMEH 1GBFA 3Q00A 3LH3A 3E0NB 3ODFA 1HJ8A 1PQ5A 1GMCG 3EE0B 1W0YH 1A46H 2TGAA 2ZC9H 4YT6H 5DO4H 1UHBB 2CHAC 3QZRA 1DLKB 2Y5FA 4UONA 1O3CA 1P10A 3RXEA 1GBLA 2JETC 3T26A 2A7JA 4K1EA 1TWXB 1IHSH 1V2LT 1GHAF 1P06A 3RXQA 3EA8A 2A4GA 5HM2A 3A8BA 3MH5A 3P6ZB 4IS5A 1MU8B 1QQ4A 2GD4B 2VVCA 2C4FH 1JXPA 1QBVH 1LVYA 2TIOA 1A5GH 2ZU5A 1Y8TA 3MHWU 1W13U 3W95A 1IQNA 1FLEE 1WCZA 2FM2A 2CXVA 3Q77A 2PKAA 1RTFB 7LPRA 1BDAA 1KXCA 3GY7A 3PO1C 3RM0H 1O3AA 1SHHB 2OC0A 1ZMJA 1K28D 1GJDB 1GJ7B 2Z6BD 1ELFA 1O34A 2O8MA 1TNHA 2A7HA 2UWOA
chains in the Genus database with same CATH superfamily
1NU7B 1H8ED 1O5BB 2C8YB 2Z9JA 2GX4A 2HLCA 1BTZA 1YCPK 2YNBA 1B5GH 1A0HB 5J4SA 1ZSJA 1TMUH 3MU1A 1GMHF 1O3DA 3K6YA 3C1KA 2AMPA 1ZTJA 2Q6DA 1PPBH 4ZXYH 3UNRA 1XUIA 1AHTH 2SGDE 1P9SA 3FP8E 2XBWA 1H9HE 3F68H 4R0IA 4TY7A 1P57B 3A7ZA 1Z71A 1G3EA 2WUBA 1HUTH 3RMNH 1Z6EA 2IPQX 4H42U 2WV9A 4UFFH 2LPRA 4AFUA 3P92A 1TFXA 2BD5A 2W7UA 4B2CA 1S0RA 4B75A 1MTSA 1BMMH 1SLVB 3SORA 5KEDA 1O2UA 4NIYA 5LH8A 2A4QA 4FU7A 3FN8A 2ZHWH 1OWHA 3T28A 1BA8B 4OS5A 1RJXB 1MD7A 4ZH8A 5T3HA 2XBVA 1V2TT 4JCNA 3SZNA 2PWXA 4O97A 2NU2E 3A8CA 1NRSH 1NZQH 3N7DA 2LELA 1UTPA 3QWCH 3GS9A 3ZV9A 1NTPA 4E05H 2Y82A 1PPFE 3ITIA 3SUFA 1CBWB 4FOUC 4KTCA 2PKSB 3QTOH 4Y79A 1TNJA 4BAHB 1FZZA 4OS7A 4D7FA 3P8GA 2GCHF 4MNVA 5AF9H 3ZZCA 1BMAA 3OX7U 2HVYB 1C2IA 2HOBA 1SGPE 5C67A 4X6OA 4CHAC 3LJOA 5LPEA 1C1TA 3RXVA 4GCHG 1P2KA 3ZV8A 1DPOA 1V6DA 3QN7A 4RKOB 2OC8A 2V0BA 2OCVB 1NFXA 1O5FH 4Q7YA 4H6TA 3RLWH 3MO6A 5F6MA 2Z9LA 1COWD 1A0JA 2ZGXH 1H9LB 4WVPE 2ZCHP 1W3CA 5EPYA 4ABBA 3RXKA 3L33A 3SNDA 4Q63A 3UNQA 3ZYDA 2EQNA 2STBE 2W5EA 1J8AA 5CHAC 1TOCB 1DSTA 1LVOA 1IQEA 1GI2A 3FZDA 4CR9A 2GDEH 2FOMB 3GICB 1G3BA 1W10U 2HGTH 1QL9A 1TYNA 1VCWA 2SNVA 3MYWA 4A5TS 3BEUA 1C1OA 1FI8A 4YOGA 1QR3E 2RFKC 1GPZA 3B9FH 3FANA 1MKXH 4B6FA 3BTDE 1MTNB 4XBCA 2ODPA 4JK5A 4Q7XA 1QZ8A 1LKBA 1CA0B 4F49A 5DGJA 1OP0A 2FLRH 5K0HA 1AVXA 2UUJB 2ZDLA 2J9NA 2PUQH 1PFXC 4I7YH 3RC4A 2JKHA 3DSOA 3TK5A 1EP5A 1MKWK 2H9EH 4YZUA 3TPIZ 2FLBH 2SGFE 4MTBA 1TQ0B 1ZMNA 4QT8C 3KQDA 1AQ7A 4B6EA 1DY8A 1KY9A 3TVJB 1AI8H 2WHXA 4BXSA 5FCRA 1DM4B 2A1DB 3S7KB 2WPMS 4K5ZA 1O3GA 2HPPH 2R9PA 3DCLA 4X6MA 2GV7A 3BTHE 3I29A 4JZDH 2ZQ1A 3ZVCA 1HCGA 4K8BA 5J4QA 1QURH 1TA6A 5EOKA 2ZFTA 1ORFA 4CRBA 2VBCA 1MABB 4F55A 4NCYA 4JZIA 1SGYE 1P2NA 2OQUA 1HGTH 1CT0E 1ZHPA 2KCPA 2VIVA 1OXGA 2Z94A 2P93A 5A8XA 2XRCA 1P02A 3G01A 1AUTC 3PTBA 3UQVA 2RG3A 4XBDA 1EKBB 3C27B 4E7RG 1QL8A 2BD2A 1WV7H 2KCAA 3OFND 1IQIA 1GBTA 1SQTA 5E0GA 5I25A 3MH6A 3SNAA 4FUHA 1LVMA 3F6UH 5FXLA 4ABGA 2G81E 1EAXA 3RXRA 2BD8A 2ZPRA 2OP9A 3QGNB 3RXJA 6GCHG 4AGKA 5T1VA 4X1RU 2XXLA 3S9CA 1THRH 3GCNA 5C0UA 3R3GB 3LOXA 1DSUA 5KGOA 4ZCNA 4HI3A 1TBQH 2UUFB 2BQWB 1O32A 6CHAB 3BEFB 4XSKU 1E37B 2ZFFH 3LPRA 2ZU1A 1SBWA 1WQSA 5B6LA 1TGNA 1QHRB 5T6GA 2HNTC 3ZVGA 3M3VA 1BRAA 2ZDNA 1CBWC 2FYRA 4TSFD 1C5WB 3K9XB 2V35A 4K60A 1VITF 1SQAA 1UTJA 1FONA 1J14A 1BMNH 2KX4A 4UFEH 1EJNA 4NWKA 1QA0A 4I86A 1BTWA 1S84A 3A7VA 1GI5A 1VJAU 2J4IA 4I32A 4UFDH 1DUAA 3FKSD 4MPUA 5PTPA 2QAAA 1FIZA 3PLPA 3SGQE 2QXIA 3DA9B 3NKKA 8GCHG 1GL0E 2CF8H 1Z8RA 4Y0ZE 1AVWA 4X1QU 1P09A 2BOKA 2JJ2D 4J1YA 2AGIX 4DW2U 1TB6H 2F3CE 2GT8A 2XNDD 2C3SA 1BTXA 2BQ6B 2VGCB 3RXMA 4B2AA 5JB9S 1DVAH 5LPFA 3WWFA 4OM9A 3SO3A 3MNSA 2KAIB 1UO6A 3MU4A 1KXAA 5A8YA 3V13A 1ELDE 3RXAA 4AB8A 1MTNC 3P8FA 3ZZ5A 4CRDA 1C2FA 1UTKA 1CA0C 3OTJE 1G2LA 3H09A 2K0QA 1BTUA 2UWLA 1P2JA 3F0PA 1MH0A 1G36A 2L74A 3PLBA 3RXDA 1FDPA 2ZFRH 2GJGA 4JZFH 1S6HA 1MU6B 2YMSD 1IQLA 5EQRA 1IQGA 3UUZA 1P0SH 4CR5A 3FAOA 3LGUA 5HGGA 4O9VA 3SJKA 1O3IA 1H4WA 1HJ9A 3QZQA 7ESTE 2QN5T 4YOIA 1LHDH 2PHBA 4GAWA 4RN6A 1GHWH 2TBSA 4D76A 4YLQH 2F83A 3ODDA 5T6DA 5EJ1A 1W0JD 2BHGA 1HNEE 2PLXA 3DHKH 1GDUA 4Y6DA 2W3KA 1NT1A 1O3OA 5GXPA 5DK1A 4ASUD 1AIXH 1O2PA 2FWWA 1EB1H 2PTCE 3RMMH 1RFNA 3SU4A 4ASHA 1PPCE 1YWUA 3RXGA 3HKIB 1C1NA 1OYTH 2ANMH 1GHYH 1GJ6A 1ESTA 1NS3A 3MU0A 4U32A 2AS9A 5FX6A 1DX5M 2GGVB 1MQ5A 3RXFA 2ANYA 2M5TA 5IDKA 3D49H 3UR6A 3AASA 5F8XA 4IN2A 4FETA 1NM6A 3HATH 4GPGA 1GWAA 2BY9X 2A32A 2B0FA 3A84A 4ABAA 1GG6B 3W94A 3M7TA 3RLYH 2KFWA 4MNYA 1O3EA 1L1GA 1RGQA 1Z1JA 2K8IA 1C4Y2 1D9IA 1CA8B 4ZHMU 4HFPB 1V2WT 1T8OA 3BIUH 1O5GH 1P3CA 2LP6A 5C94A 3RXCA 2F9NA 3K2UA 1LHCH 4Q80A 1E34B 3SN8A 5EJLA 1TA2A 2Z9GA 4U30A 2DUCA 1C5UA 2XCNA 1HAXB 2A7CA 1WQVH 2AERH 3EQ0H 1HJAC 2ZGBH 2Y80A 3BTFE 3E90B 3GY3A 4FUGA 4ZXXH 4MNWA 4A7IB 1C5PA 3LGWA 1ELVA 1V2VT 1ABJH 2NU4E 4E06H 2ZF0H 1QY6A 3RU4E 1S6FA 1Y59T 3GY4A 3ZZDA 1D3DB 1QJ1B 2B5TB 2VIWA 2AH4X 6CHAC 3E91A 1Q2WA 2ZFSA 1D6WA 4CREA 1WUNH 4OGXA 2BLOA 2H5DA 1O2YA 3SI4H 2C93B 3T2NA 3M5MA 3ZZAA 4XE4A 5DN6D 1TOMH 1NC6A 3HK3B 2BTCE 5G4BA 3UWIA 4VGCB 1QFKH 2A0QB 1EAUA 4YO9A 1CO7E 3IWMA 4TWYA 3SUEA 4IBLH 3GCHB 4ACAA 1FPCH 4ISIH 1QRZA 1TMBH 3RU4T 3DSGA 2FOHA 2V3OH 1AD8H 1YC0A 3MTYA 3GCTG 2Y5HA 1ANEA 1P2QA 3AW0A 4X8TH 1J15A 4CH2B 5C2ZA 4AGJA 1N8OC 2FI3E 4AYYB 3TH2H 1AWHB 1AZZA 2ZO3H 3BF6H 2FIRH 1FY8E 2BD4A 2VIDA 1K1OA 1O2LA 2F4LA 5F8ZA 3FOAA 1A0LA 1YPLH 1RD3B 2BY7X 1TPPA 2RA0A 1QRWA 5F03A 4BANB 1GHXH 2CMYA 5L2YH 4X1SU 1XUJA 1BOQA 1YM0A 3STIA 1HIAB 3VXEH 1XXDA 3TNTA 2AIQA 2YMSC 3E8LA 2ZKSA 5TCCA 3SOSA 4J2YB 1GI8B 1QNJA 1CE5A 2BDHA 3U8OH 3MNBA 3KYGA 2RCEA 1LHGH 1KLTA 4B76A 1T8MA 1DDJA 1N1LA 2GV6A 3L3TA 1CQQA 1O2NA 2VWMA 1ETTH 1MMJN 4ZAEA 1MZDA 5DP9A 3PV2A 1TIOA 5JDUB 4Z0KA 2B9LA 1KTSB 4CBNA 1P03A 8LPRA 1ZTLA 2V6NA 2P95A 4ISOA 1ELTA 1GGDB 3SJ8A 1J9CH 1NBME 4AOQA 4YXWD 1S85A 1SGCA 3RC6A 2BM2A 2GVFA 3KN2A 4X2XA 4YESB 5HIYA 5JBCS 1V2MT 1BB0B 2FI5E 2GZ8A 4XD7D 3U98H 3F2HA 4ZKRU 3QLPH 1BIOA 3ATWA 3S7HB 1QRXA 1GBBA 1W2KH 1Q3XA 4R8TB 3LJJA 2P8OC 3A7WA 4TPYA 4ZKOU 1HAHH 2H5CA 1ELBA 1IHTH 3NPSA 1HIAA 5AFYH 3VEQB 2GKVE 1C5XB 1SFQB 1TPAE 1UK2A 5E8EH 1C1MA 3RXBA 3RXLA 2P3UB 4D9RA 2JIZD 5FHTA 3VB6A 1JWTA 1GI3A 1K0HA 1NU9A 1ABIH 3ZZ7A 1O2GH 1C4U2 1ZMLA 2ZHQH 4UFGH 5GNDA 2AGEX 1QBNA 3NXPA 5E0HA 3RMLH 3ATIA 2A4OA 3DFLA 3OE7D 1TRMA 1CHOG 5FBEA 3P17H 1GG6C 1B0EA 1TRNA 2F43B 1ELGA 4Z1MD 1ETRH 2EC9H 4X8UH 4AC9A 5EXLA 3T29A 4ISHH 2TGDA 4HG6A 4MVNA 3EAJA 2M2AA 3SGBE 1W12U 1GJ5H 4Y8XA 3BTGE 4X8SH 1GCTB 2PGBB 3OEED 3RM2H 1HXFH 1GI9B 2JH6D 1LHEH 3BTQE 3LC3A 1P3EA 1B0FA 1LMWB 2QXGA 2V3HH 3CS0A 2BDAA 1INCA 4ISNA 1DOJA 1ACBE 3WWBA 3ZVBA 2BVSH 1UHBA 4FUBA 4ZKNU 3GYLB 1Y3UA 3PV4A 1JIMA 1MCVA 3MH7A 1EJMA 3TJOA 2ZHFH 1TLDA 2CV3A 1GBMA 5FAHA 1HFDA 3A83A 2ZEBA 2W6JD 4FXGH 1O2QA 1FQ3A 2VU8E 2WPDD 4A6LA 1TX8A 1AB9C 4I8HA 1LKAA 2ZFQH 5FBIA 2ZP0H 2A5AA 4I8LA 3SBKA 4Y0YE 5F53A 1GHBF 2HRVA 1C1RA 2XYAA 2OD3B 2OINA 5EW1H 1K1MA 1Y3WA 1W0KD 4JYVH 2JH5D 3SV6A 1GJ9B 3LU9B 1J17T 2HNTE 1EOJA 2Y81A 7GCHF 1E35B 4Y71A 3CNRA 5EODA 4X2YA 3HGNA 1TE0A 1CGHA 4TWWA 2QY0B 2Z9IA 3PMHB 1MTVA 4CBOA 1FUJA 5EIYA 3SNBA 1LCYA 1THSH 1MKWH 1C5OH 1KDQB 1DWBH 1SQRA 1QJ6B 3M37A 1GMCF 2G55A 1WAYB 3UPEA 1EP6A 2ZPQA 2D2DA 4KTSA 1O3HA 1NO9H 1KLJH 1C5TA 2OTVA 4DIHH 4WXIA 2XWAA 1HAOH 4GLYA 1AO5A 1GMDG 1C5RA 3U9AH 1GHZA 2QXHA 4Y8ZA 1ZZZA 1DWCH 1O2ZA 5DP5A 4K69A 2B7DH 3MNCA 6LPRA 2BY6X 3M35A 4A92A 2STAE 2BDCA 4RI0A 1BZXE 2SNWA 4INLA 4NWLA 3TIUA 1P8VC 4IC5A 3RUOA 3SZEA 3UTUH 2ZNKH 3P95A 1EAWA 3L6PA 3MU8A 2PTNA 1O3LA 1HAVB 4K1TA 5BRRE 4BAKB 1C2MA 1ARCA 1C5ZB 4WXVA 1GGDC 1EB2A 1Y3VA 2OLGA 2C8XB 3UQOA 4F4OC 2FOBA 2WSSD 3NUMA 2OK5A 4BAQB 2TRMA 4Q7ZA 1C1SA 2ANWA 3SYJA 1ZGIA 3M7UA 1UVUH 2PSXA 1BMFD 4UDWH 2W3IA 5EGMA 1TPSA 4GVUA 3S9BA 4YT7H 1K9OE 1O3JA 4DY7B 1OHHD 1YY3A 1C4V2 3NRLA 1CGIE 1JOUB 5TCAA 1W11U 1AKSB 1L4ZA 1YPMH 3SI3H 3CP7A 4NIWA 4LOYH 2AGGX 3DD2H 4HGCA 3A80A 2WYGA 1OOKB 3SGAE 1YPEH 3KQBA 4NA9H 3U1JB 2CGAA 1H1BA 2ASUB 3DUXH 1C2EA 4KP0A 1TNLA 1SKYE 4ABFA 2FS8A 5IYTA 1X7AC 2R0LA 5IK2D 4ESTE 1F5KU 3UAIC 1FJSA 1T4UH 3E16B 3RXUA 1CVWH 1WSSH 2QE7D 1DANH 1Z8JB 1A2CH 2VB0A 1HAVA 2BDYA 1OYQA 3A8DA 4LK4A 1Y5AT 1KXFA 2ZCKP 1GCTC 1M9UA 4IW4E 3LH1A 4INKA 2Z3CA 4MLFB 2V3MA 1KXEA 3A82A 1G3CA 1S82A 1SHYA 4I8KA 5C5NA 1LTOA 1UK3A 4X8VH 4RT0A 1O2HA 1OKXA 1FY5A 1FMGA 4MDSA 4DCDA 2NU3E 1Y5BT 1V2JT 1SGTA 4K3JA 3TITA 5EJZA 4X0WU 2BLWA 1K1LA 1SGEE 1ZSLA 3PMAB 5DKMA 4GHQA 1YCPM 3NK8A 2BB4A 1DITH 1H8HD 5C1UA 2SGEE 4ZUHA 2IPHA 5E2OA 2HPQH 4GSOA 2D1JA 3HK6B 2WPIS 1C2GA 3OSYA 1C1QA 4MPVA 4GCHF 1HAIH 5T6FA 3TGIE 2P3TB 1EZUC 1NRRH 1OSSA 2OBOA 4WH6A 1G30B 1SGIB 4AG1A 1F5RA 1BUIA 2F9OA 3EA9A 2C90B 4FVBA 4NA8A 2H2ZA 5EQSA 3I78A 3AK5A 2JH0D 5FCKA 3EGKH 3TJUA 3PWCA 4F48B 3LGTA 2P94A 1UCYH 1P12E 2ZHDA 5FL7D 1GBAA 4DT4A 5H4IB 5DPAA 2Z3DA 3D62A 1BQYA 3MNXA 4AB9A 1C2LA 3E6PH 1F0RA 1G3DA 1AVGH 2RDEA 1ZHRA 3U8TH 1PQ7A 1UCYE 3FP7E 3BG8A 3QUMP 4XRNA 1T32A 5A2MH 1UVSH 1VR1H 5JBBS 3M3SA 4LZ4B 1UK4A 2PKSC 4KELA 1FNIA 1EZSC 3V12A 1ANDA 1KYNA 3H5CB 1TPOA 2HVXA 3TLOA 1ZPBA 2QXJA 3MO3A 1AFQB 4XOJA 1HBTH 1O39A 1LPZB 5CMXH 2FOFA 1SMFE 3FO8D 3GY6A 1GHVH 3QK1A 3LKWA 1LPGB 5HM9A 4RT1A 2L6OA 4DJZB 2GCTB 1V2NT 1YF4A 3BTTE 5FPTA 4YTAA 3I77A 4D9QA 3PM3A 5HYOA 5GWZA 2QC2A 3M5LA 1EPTB 1D3PB 1JMOH 1ARBA 1XUFA 1GI7B 3VB5A 1SVPA 4AORA 5GCHG 3M3TA 1EXFA 1D3TB 1B7XB 1MUEB 3U8RH 1L1JA 1C5MD 3SU2A 4B2BA 4NZQA 1O2TA 2PV9B 3OU0A 2XBYA 1CGJE 2VH0A 1HXEH 5HKKD 4DURA 4OS6A 2VIQA 2D26C 3HGPA 4CRAA 1GI0A 2XOKD 2TGPZ 3VGCB 2W26A 3KQ5A 4H4FA 3SV2H 3D65E 1XUKA 3M5NA 2XWBI 4ZROA 3SQEE 3SU6A 3Q3YA 1S81A 1T8LA 3T25A 1UMAH 1K1PA 1WXRA 1C5NH 2Z7FE 3B8JA 4K2YA 3Q3XA 1UCYK 1Z1IA 4IN1A 1TX6A 1O5DH 2C8WB 2D8WA 1SLWB 2WPJS 4RKJB 1O2MA 4BNRA 3TNSA 1ZLRA 2ZTXA 3IITA 3N7OA 4NSVA 1XM1A 2PUXB 3TH4H 1C2JA 3VXFH 1EPTA 2XBXA 1SOZA 4TPIZ 1H8IH 3PB1E 3Q3KA 5JB8S 4ABEA 2THFB 1EJAA 3ZZ8A 3QO6A 6GCHF 1SG8B 3RDZA 3O8DA 2IJD1 3ZVFA 2GMTB 1EASA 3TJVA 1HPGA 4DGJA 1K1JA 4OS2A 5C1XA 2ESTE 1VGCB 1F2SE 3GY8A 4O3UA 2SGQE 1GBHA 2ZGCA 4BTIB 2ZPSA 1O0DH 2KAIA 2OQ5A 2O8WA 3ENSB 4NGAH 2CHAB 1AFEH 1V2UT 1A5IA 3BV9B 1DS2E 3TU7H 1O2IA 1C9PA 1W8BH 4H6SB 4UEHH 2XCFA 1V2OT 2BD9A 3A86A 2ODYB 3TK6A 1GJ8B 1GCDA 1LQEA 3SQHE 2FDAA 3F9EA 5ESBA 3UOUA 1ETSH 1PPGE 1C1PA 2ILNA 3N7EA 1P2MA 8ESTE 1YBWA 1Q31A 1EATA 1O5CB 1C1UH 1TGTA 3IG6B 1O3MA 3RXHA 1TMTH 3PO1B 2Y6TA 2GT7A 4FUCA 5JBTA 2ZGJA 1SQOA 2NU1E 4JMYA 1HRTH 3P8NA 1OWJA 3PV5A 2J95A 2FYQA 4THNH 2BZAA 8GCHF 2KM0A 3TJNA 1GJBB 2J98B 4RSPA 3SJ9A 1FXYA 1LVBA 1ZPCA 1F7ZA 4TYDA 5HIZA 2AEIH 1O5AB 2Y7ZA 1T4VH 3N99A 1YPKH 4LXBH 1K1NA 1TALA 3VPKA 3O8RA 1MQ6A 2K1QA 2VWOA 3MQKC 2ZG0H 3A88A 1O2WA 1PYTD 3S0NA 5C17A 1TQ7B 4WMFA 1DE7H 1GHAG 2G51A 4DG4A 2FESH 5GJ4B 5E0JA 1S6LA 3A8AA 1NROH 1GJ4H 4BAMB 1TGCA 1GJAB 1DWDH 1HV7A 1K2I1 1BT7A 1TGBA 3K65B 4IC6A 2NU0E 3A89A 4NFFA 3SUGA 1DWEH 1EUFA 1IQFA 1Z7KA 2BZ6H 4Y76A 3F9FA 4LZ1H 4K1SA 3F1SB 1P01A 4WMEA 2GCTC 1EOLA 2Q6FA 1ZOMA 2R3YA 3QDZB 3BSQA 3SU5A 4BTTB 4I8GA 1VKYA 1EPTC 2FX4A 1KXDA 1EZQA 1OWDA 2W6ID 2ZTYA 3NCLA 2AIPA 3PMBB 1BMLA 1HAGE 1QB6A 1DUEA 3PRBA 3R0FA 3BEIB 1SC8U 2EI7A 1K22H 3GY5A 1QIXB 1P2IA 1GMHG 4I33A 2A31A 3SJOA 6ESTA 2VGCC 1QGFA 4Y10E 4A1XA 2FOEA 1FPHH 2JJ1D 4FUJA 4AZ2B 4ISLA 1VJ9U 2IJOB 2HWLB 1JBUH 1SB1H 1WU1A 3MO9A 1A7SA 1IQJA 1MAXA 1ZGVA 2EI8A 3BG4B 3BTEE 3UWJH 4SGAE 4OS1A 2CN0H 1BBRK 5AVDA 1GL1A 4Y7BA 2KR7A 2W7SA 1NN6A 4ABHA 4UD9H 3O8BA 1WTGH 3KEEA 1ZHMA 3ELAH 2WINI 1ZRBA 1XKBC 1CSOE 1O5EH 1GVLA 3FVFB 5ABWA 2OC1A 2ZCLP 1IQMA 3MU5A 3H7TA 1F92A 3RXSA 4JYTA 3GDUA 4P00A 5K7RA 2YOLA 3BN9A 1ZPZA 3ZVAA 1P11E 1A4WH 4YM9A 2FS9A 4K8YA 5AHGH 1O30A 1ID5H 2BLQA 1UTNA 2Q6GA 1SI5H 1HAPH 2ZU3A 1UTLM 2AMQA 1N6XA 2FI4E 1LDTT 3GOVB 5C20A 2OXSA 1A3EH 1C5SA 1PPEE 1VGCC 4HZHA 5JPMH 2VWLA 1ESAA 3P70B 3SHAH 1K1IA 4WH8A 1C2HA 2G5VA 1SLXB 1RTLA 3DT0H 5A8ZA 2ZU4A 4X2WA 5EQQA 3STJA 2WV5A 2GCHG 2ALPA 3T5FH 1GBIA 5EU8A 5DP7A 1MZAA 5TJXA 2QCYA 3JZ1B 5EXMA 1D3QB 1NY22 4AX9H 3QX5H 2YNAA 4A1VA 4WMDA 1MD8A 1UVTH 3FZZA 1FY3A 2DE8A 3BIVH 1TONA 5DP6A 1NESE 1O37A 1YLDA 1U6QA 3MH4A 2ODQA 1OPHB 2BD3A 4XDEA 2O8UA 3A87A 2C8ZB 4KGAA 4NIVA 4CH8B 1HLTH 3GCTF 4AN7A 3ZZ4A 1D4PB 1RS0A 1PYTC 1O2OA 3PMJA 1TNIA 3KHVA 5DP4A 4YOJA 1SR5C 3F0OA 2ZDMA 1O3PB 1JRTA 1DICA 5L30H 2GZ9A 1T31A 5ESTE 3DFJA 1SOTA 3AW1A 4Y8YA 2TPIZ 2RA3A 4IGDA 3Q76A 3LGVA 1O35A 1W7XH 1A3BH 3F2FA 2FOAA 4NZLA 4NG9H 1FIWA 2WPLS 1Z8IB 1V2KT 2P3FH 2G00A 1O2VA 1SGFA 5L2ZH 1NFWA 1TAWA 9ESTA 1UVOA 3OAAD 1P2OA 2VWNA 2ZFPH 4VGCC 5B6OA 2KZ4A 1XUGA 2O8TA 2BLVA 4CRGA 1O3FA 2FMJA 2BD7A 3A7TA 3GCHC 2H9TH 3S69A 1L0ZA 1ANBA 1A5HA 4Q4LA 3KL6A 1YPHC 2GTBA 1TABE 2A5IA 3E3TA 5GIBA 2UWPA 5DSFA 3UY9A 3VB4A 2ZA5A 3WY8A 1C1WH 1YYY1 3SV7A 4D7GA 1AY6H 1E1RD 1BITA 2HNTF 4D8NA 3LDXH 3UFAA 1CT4E 3TH3H 1C9TA 2RDLA 3ATKA 3ZIAD 2G52A 2J34A 3AAVA 1BRBE 2ZQ2A 2BOHB 1OS8A 3SHCH 2SGPE 3JZ2B 4TT3D 3ATMA 1UTMA 2QYIA 3KGPA 1S83A 1O2JA 1SPJA 2WV4A 2DE9A 1W14U 1G37A 2ZWLH 1QTFA 2ZHEH 1A61H 2FX6A 1LHFH 1CHOF 4AG2A 1ZJKA 4MPWA 3PTNA 2ULLA 3BG4C 2CJIA 2FO9A 1LO6A 1AU8A 3EE7A 5F8TA 1V3XA 5LGOA 5FX5A 1G9IE 2G4TA 1KXBA 1NRQH 2VVUA 4WY3A 1ZR0A 2GDDA 2KCYA 2BXUH 3MI4A 2WPHS 1ANCA 1YLNA 1KDQA 1WYKA 4HTCH 3PRDA 4YLUA 1BCUH 1Z8GA 5KECA 1GVKB 2GZ7A 1Z6JH 1RIWB 2WZQA 4X6NA 1ESBA 3U28C 1GI6A 4JYUH 2Q1JA 1O2XA 3NZIA 2WUCA 4KTUA 2FODA 5A0CA 4WF8A 5DP8A 3S9AA 1T7CA 3OTPA 1FN6A 2A45B 3W1EA 2F9VA 3MWIU 3SNEA 3UOPA 1C5QA 1A1RA 3CENA 2FXRA 4ACBA 2ZU2A 1C2KA 2BDIA 1EX3A 3LIWA 1O2SA 2A2XH 1P9UA 1LQDB 4NIXA 3BTWE 1ELCA 1QL7A 3URDA 2FEQH 1IOEA 1VITG 1YGCH 5HXFA 2F9BH 3ZZBA 1DT2A 1OWIA 1CT2E 3MMGA 5FPSA 4CRCA 1S5SA 4XBBA 1RXPA 2OC7A 4ABJA 5EXNA 1J16A 1YKTA 1MBQA 3ZYEA 1KLIH 3OY5U 3P8OA 1TNKA 3DSPA 1WDIA 4CRFA 2H1UA 5C5OA 3TK9A 3PYHA 4FU9A 1IQHA 3V0XA 2FOGA 1QB1A 1MBMA 3H7OA 3SU1A 1CU1A 2SFAA 3K6ZA 2FP7B 2BQ7B 1QB9A 1T8NA 5AFZH 1QQUA 4A1TA 4TY6A 1C5YB 1AKSA 1JIRA 1GJCB 3VB7A 1XUHA 1SSXA 4NFEA 5A0BA 3RP2A 1YP9A 1TX7A 2BVRH 5C1YA 2VIPA 4Y11E 5CE1A 3KF2A 1GMDF 1OX1A 1DY9A 1TBZH 1KIGH 2QF0A 4DVAU 2ZI2H 5DG6A 2R2WU 5ETXA 1CHGA 4O3TA 4X6PA 1XX9A 4SGBE 1YPGH 3QTVH 1ZTKA 5EW2H 1L2EA 1PQ8A 1NFUA 2F91A 4MNXA 1MKXK 2F9UA 1D6RA 1HJAB 1SGRE 3GYMA 2FZZA 1VITH 3UNSA 4MQAA 2EEKA 1VZQH 2KCOA 2QGRA 3SU0A 1TNGA 3BTME 1PJPA 3RXOA 3SV9A 2PFEA 2A5KA 4MG3A 3HKJB 3GY2A 2QF4A 2Z3EA 1GVZA 1E38B 2HLDD 2XC0A 5FPYA 3RXPA 3VFEA 1UJ1A 1XVOA 2ANKH 2NWNA 4X2VA 1V2RT 3KIDU 1LPKB 2BDGA 4M7GA 3A7XA 4NA7A 2LNCA 1AUJA 1NRNH 2J2UA 2J94A 2XTTB 2IOTA 1FV9A 1C2DA 1E0FD 2ZZUH 3GDVA 1BJVA 2VNTA 1FY1A 4BAOB 2CK3D 1F0UA 1P04A 3EYDA 1GBJA 2G4UA 3OEHD 4ZKSU 1XKAC 1GI4A 1KMHB 2ZDAH 4ZMAH 2Y7XA 3F9HA 2XC5A 2BYAX 1L1NA 3GDSA 1O2RA 1ELAA 1DXWA 1BRCE 1THPB 1XXFA 4FVDA 2ZIQH 2UUKB 2UUYA 3ZZ9A 2Y5GA 3KQCA 1N8OB 2HALA 1N6YA 3KQEA 1AWFH 3F9GA 1HYLA 2AHME 2QV1A 4B73A 1MAYA 3LC5A 4DT7B 1HB0B 1MCTA 5A09A 1ZJDA 5HMAA 2J92A 2WPKS 1H8DH 1C5VA 1FAXA 5GPIB 4BXWA 3RXTA 4WWYA 1RIWC 3URCA 5GDSH 3F2GA 3O8CA 3A7YA 1FY4A 3A81A 2YMSB 5A0AE 1VCQA 2CF9H 4DIIH 2VJ1A 4BOHA 1TGSZ 2FTLE 1Y3XA 3EA7A 5BPEA 1EFRD 1O2KA 2G8TA 3ZVEA 1QBOA 1YLCA 2I6QA 3GISB 4P02A 4AYVB 4FUFA 1RTKA 3QGJA 3LT3A 1F5LA 5SGAE 5DP3A 1BHXF 4KKDA 1OWEA 3UB0A 1TBRH 2IN2A 3T62A 1GBEA 1UVPA 1AZ8A 2FOCA 3ATLA 3FP6E 3RMOH 1KTTB 2FTMA 4OS4A 3CS7A 2O8LA 3B23B 1SL3A 1Y3YA 2PR3A 3TGKE 1TRYA 2VH6A 4PROA 3WW7A 5JYIA 1BHXB 5EPNA 4ZHLU 2P8OB 1E1QD 1BTYA 1BJUA 1MTWA 1UTQA 4AFQA 3OYPA 2VINA 3AAUA 1DLEA 1WTHD 4U2WA 1O33A 2JETB 1C1VH 1HDTH 2AFQB 4B74A 3ZVDA 1OWKA 5EG4A 1K21H 2XW9A 3UIRA 3KCGH 5E2PA 3HPTB 3M61U 2PSYA 5C0TA 1AGJA 1AE8H 1XVMA 1QJ7B 3RXIA 4NSYA 3V7TA 4AFSA 4FUIA 2QF5A 1H9IE 5I46H 1IQKA 2PGQB 2J38A 3SU3A 2P59A 1IAUA 4O03A 2F9PA 3PROA 1YPJH 4XFQA 4MPXA 1HAZB 4JK6A 3SUDA 1FAKH 2XC4A 2EY4C 5CDFE 2JDID 2QF3A 2AYWA 3OY6U 2A2QH 1EAIA 1Y5UT 3GCOA 4Q2KA 3MOCA 1FX0B 1DFPA 1F0SA 2H9HA 1P05A 4IMZA 4UE7H 3ZZ3A 5L6NH 5LPRA 4B1TA 2B8OH 9LPRA 3M7QA 5C3NA 3LGIA 1BBRH 3VG8A 4AFZA 5GCHF 3NWUA 3RC5A 3KNXA 2J97A 3EDXB 2ALVA 4FU8A 2ZDKA 1EQ9A 1PPHE 3BTKE 2BDBA 4INHA 2OUAA 4X1PU 1SGDE 1O31A 1YPHE 5CHBA 4OGYA 4X1NU 2V7QD 1BBRE 2BY8X 3VB3A 4ZHAA 3E0PB 1SGNE 3E1XB 1ZRKA 1SGFG 4FUEA 1F0TA 1NPMA 4BTUB 5JBAS 3U1IB 1JRSA 3KYFA 1AB9B 3LGYA 1QA7A 1ZSKA 1UTOA 1WBGB 1DXPA 1GBCA 2O9QA 1O38A 1V2PT 3D23A 1AFQC 2P16A 8KME2 1RRKA 2R3UA 1G32B 1MTUA 1W0ZU 2J5UA 1GDNA 2BX4A 1AN1E 1KSNA 1V2ST 1QCPA 1GBDA 1O3NA 1E79D 1VCPA 1PPZA 1BRUP 1AMHA 2WYJA 1O3BA 1OP8A 2GP9B 2QIQA 3PLKA 2J98A 3U69H 1L4DA 1UW7A 3M36A 2BX3A 2G5NA 2ZTZA 2EA3A 3SJIA 3MFJA 1ELEE 3SNCA 2A4RA 2BVXH 1G2MA 4GUXA 3UR9A 4JZ1A 1BTHH 1PQAA 4I31A 2BY5X 1ZYOA 2PW8H 3SW2B 3AVZA 2FPZA 3RU4D 1V2QT 2VVVA 2I6SA 3FFGA 3VGCC 2ZGHA 4U01A 3TGJE 4E7NA 3ZZ6A 2OBQA 1NFYA 4CHAB 4B71A 4IMQA 1SGQE 1SFIA 3T27A 1EZXC 3SV8A 1GI1A 1GHBG 4ABIA 1OP2A 4FUDA 1SLUB 2EI6A 3V3MA 2BXTH 1O36A 1YCPH 2H6MA 2Z9KA 3UREA 5DJ7A 1AE5A 2R0KA 4WJG2 1GDQA 2VIOA 2AMDA 2TGTA 3PWBA 4JZEH 4ABDA 4DOQA 7GCHG 1WOFA 1NRPH 1C5LH 1HAYB 1S0QA 2ZDVH 5CHAB 1XMNB 2PKAB 2SGAA 2ZECA 1E36B 3ESTA 4I8JA 1GBKA 2XNIA 1O3KA 2GMTC 2BMGB 2QA9E 1BTPA 2R2MB 4Z6AH 3A85A 1FN8A 3F3BA 3LONA 4Y7AA 1W7GH 4GHTA 3M5OA 7KMEH 1GBFA 3Q00A 3LH3A 3E0NB 3ODFA 1HJ8A 1PQ5A 1GMCG 3EE0B 1W0YH 1A46H 2TGAA 2ZC9H 4YT6H 5DO4H 1UHBB 2CHAC 3QZRA 1DLKB 2Y5FA 4M9FA 4UONA 1O3CA 1P10A 3RXEA 1GBLA 2JETC 3T26A 2A7JA 4K1EA 2PP6A 1TWXB 1IHSH 1V2LT 1GHAF 1P06A 3RXQA 3EA8A 2A4GA 5HM2A 3A8BA 3MH5A 3P6ZB 4IS5A 1MU8B 1QQ4A 2GD4B 2VVCA 2C4FH 1JXPA 1QBVH 1LVYA 2TIOA 1A5GH 2ZU5A 1Y8TA 3MHWU 1W13U 3W95A 1IQNA 1FLEE 1WCZA 2FM2A 2CXVA 3Q77A 2PKAA 1RTFB 7LPRA 1BDAA 1KXCA 3GY7A 3PO1C 3RM0H 1O3AA 1SHHB 1ZMJA 1K28D 1NBMD 2OC0A 1GJDB 1GJ7B 2Z6BD 1ELFA 1O34A 2O8MA 1TNHA 2A7HA 2UWOA
chains in the Genus database with same CATH topology
1NU7B 1O5BB 2C8YB 2Z9JA 2GX4A 2HLCA 1BTZA 1YCPK 2YNBA 1B5GH 1A0HB 5J4SA 1ZSJA 1TMUH 3MU1A 1GMHF 1O3DA 3K6YA 3C1KA 2AMPA 1ZTJA 2Q6DA 1PPBH 4ZXYH 3UNRA 1XUIA 1AHTH 2SGDE 1P9SA 3FP8E 2XBWA 1H9HE 3F68H 4R0IA 4TY7A 1P57B 3A7ZA 1Z71A 1G3EA 2WUBA 1HUTH 3RMNH 1Z6EA 4H42U 4UFFH 2LPRA 4AFUA 3P92A 1TFXA 2BD5A 2W7UA 4B2CA 1S0RA 4B75A 1MTSA 1BMMH 1SLVB 3SORA 1O2UA 4NIYA 5LH8A 2A4QA 4FU7A 2ZHWH 1OWHA 3T28A 1BA8B 4OS5A 1RJXB 1MD7A 4ZH8A 5T3HA 2XBVA 1V2TT 4JCNA 3SZNA 2PWXA 4O97A 2NU2E 3A8CA 1NRSH 1NZQH 3ZV9A 1UTPA 3QWCH 1NTPA 4E05H 2Y82A 1PPFE 3ITIA 3SUFA 1CBWB 4KTCA 2PKSB 3QTOH 4Y79A 1TNJA 4BAHB 1FZZA 4OS7A 4D7FA 3P8GA 2GCHF 4MNVA 5AF9H 3ZZCA 1BMAA 3OX7U 1C2IA 2HOBA 1SGPE 5C67A 4X6OA 4CHAC 3LJOA 5LPEA 1C1TA 3RXVA 4GCHG 1P2KA 3ZV8A 1DPOA 1V6DA 3QN7A 4RKOB 2OC8A 2V0BA 2OCVB 1NFXA 1O5FH 4Q7YA 4H6TA 3RLWH 3MO6A 5F6MA 2Z9LA 1A0JA 2ZGXH 1H9LB 4WVPE 2ZCHP 1W3CA 5EPYA 4ABBA 3RXKA 3L33A 3SNDA 3UNQA 3ZYDA 2STBE 2W5EA 1J8AA 5CHAC 1TOCB 1DSTA 1LVOA 1IQEA 1GI2A 3FZDA 4CR9A 2GDEH 2FOMB 3GICB 1G3BA 1W10U 2HGTH 1QL9A 1TYNA 1VCWA 2SNVA 3MYWA 4A5TS 3BEUA 1C1OA 1FI8A 4YOGA 1QR3E 1GPZA 3B9FH 3FANA 1MKXH 3BTDE 1MTNB 4XBCA 2ODPA 4JK5A 4Q7XA 1LKBA 1CA0B 4F49A 5DGJA 1OP0A 2FLRH 5K0HA 1AVXA 2UUJB 2ZDLA 2J9NA 2PUQH 1PFXC 4I7YH 3RC4A 2JKHA 3TK5A 1EP5A 1MKWK 2H9EH 4YZUA 3TPIZ 2FLBH 2SGFE 4MTBA 1TQ0B 1ZMNA 4QT8C 3KQDA 1AQ7A 1DY8A 1KY9A 3TVJB 1AI8H 4BXSA 5FCRA 1DM4B 2A1DB 3S7KB 2WPMS 4K5ZA 1O3GA 2HPPH 2R9PA 4X6MA 2GV7A 3BTHE 3I29A 4JZDH 2ZQ1A 3ZVCA 1HCGA 4K8BA 5J4QA 1QURH 1TA6A 5EOKA 2ZFTA 1ORFA 4CRBA 4NCYA 4JZIA 1SGYE 1P2NA 2OQUA 1HGTH 1CT0E 1ZHPA 2VIVA 1OXGA 2Z94A 2P93A 5A8XA 2XRCA 1P02A 3G01A 1AUTC 3PTBA 3UQVA 2RG3A 4XBDA 1EKBB 3C27B 4E7RG 1QL8A 2BD2A 1WV7H 1IQIA 1GBTA 1SQTA 5E0GA 5I25A 3MH6A 3SNAA 4FUHA 1LVMA 3F6UH 5FXLA 4ABGA 2G81E 1EAXA 3RXRA 2BD8A 2ZPRA 2OP9A 3QGNB 3RXJA 6GCHG 4AGKA 4X1RU 2XXLA 3S9CA 1THRH 3GCNA 3R3GB 3LOXA 1DSUA 4HI3A 1TBQH 2UUFB 2BQWB 1O32A 6CHAB 3BEFB 4XSKU 1E37B 2ZFFH 3LPRA 2ZU1A 1SBWA 1WQSA 1TGNA 1QHRB 5T6GA 2HNTC 3ZVGA 3M3VA 1BRAA 2ZDNA 1CBWC 2FYRA 1C5WB 3K9XB 2V35A 4K60A 1VITF 1SQAA 1UTJA 1FONA 1J14A 1BMNH 4UFEH 1EJNA 4NWKA 1QA0A 1BTWA 1S84A 3A7VA 1GI5A 1VJAU 2J4IA 4I32A 4UFDH 1DUAA 4MPUA 5PTPA 2QAAA 1FIZA 3PLPA 3SGQE 2QXIA 3DA9B 3NKKA 8GCHG 1GL0E 2CF8H 1Z8RA 4Y0ZE 1AVWA 4X1QU 1P09A 2BOKA 4J1YA 2AGIX 4DW2U 1TB6H 2F3CE 2GT8A 2C3SA 1BTXA 2BQ6B 2VGCB 3RXMA 4B2AA 5JB9S 1DVAH 5LPFA 3SO3A 3MNSA 2KAIB 1UO6A 3MU4A 1KXAA 5A8YA 3V13A 1ELDE 3RXAA 4AB8A 1MTNC 3P8FA 3ZZ5A 4CRDA 1C2FA 1UTKA 1CA0C 3OTJE 1G2LA 2UWLA 1BTUA 1P2JA 1MH0A 1G36A 3PLBA 3RXDA 1FDPA 2ZFRH 4JZFH 1S6HA 1MU6B 1IQLA 5EQRA 1IQGA 3UUZA 1P0SH 4CR5A 3FAOA 3LGUA 5HGGA 4O9VA 3SJKA 1O3IA 1H4WA 1HJ9A 3QZQA 7ESTE 2QN5T 4YOIA 1LHDH 2PHBA 4GAWA 4RN6A 1GHWH 2TBSA 4D76A 4YLQH 2F83A 3ODDA 5T6DA 2BHGA 1HNEE 2PLXA 3DHKH 1GDUA 4Y6DA 2W3KA 1NT1A 1O3OA 5GXPA 5DK1A 1AIXH 1O2PA 2FWWA 1EB1H 2PTCE 3RMMH 1RFNA 3SU4A 4ASHA 1PPCE 3RXGA 3HKIB 1C1NA 1OYTH 2ANMH 1GHYH 1GJ6A 1ESTA 1NS3A 3MU0A 4U32A 2AS9A 5FX6A 1DX5M 2GGVB 1MQ5A 3RXFA 2ANYA 2M5TA 5IDKA 3D49H 3UR6A 3AASA 5F8XA 4IN2A 1NM6A 3HATH 4GPGA 1GWAA 2BY9X 2A32A 2B0FA 3A84A 4ABAA 1GG6B 3W94A 3M7TA 3RLYH 4MNYA 1O3EA 1L1GA 1RGQA 1Z1JA 1C4Y2 1D9IA 1CA8B 4ZHMU 4HFPB 1V2WT 1T8OA 3BIUH 1O5GH 1P3CA 3RXCA 2F9NA 3K2UA 1LHCH 4Q80A 1E34B 3SN8A 1TA2A 2Z9GA 4U30A 2DUCA 1C5UA 2XCNA 1HAXB 2A7CA 1WQVH 2AERH 3EQ0H 1HJAC 2ZGBH 2Y80A 3BTFE 3E90B 3GY3A 4FUGA 4ZXXH 4MNWA 4A7IB 1C5PA 3LGWA 1ELVA 1V2VT 1ABJH 2NU4E 4E06H 2ZF0H 1QY6A 3RU4E 1S6FA 1Y59T 3GY4A 3ZZDA 1D3DB 1QJ1B 2B5TB 2VIWA 2AH4X 6CHAC 3E91A 1Q2WA 2ZFSA 1D6WA 4CREA 1WUNH 4OGXA 2BLOA 2H5DA 1O2YA 3SI4H 2C93B 3T2NA 3M5MA 3ZZAA 4XE4A 1TOMH 1NC6A 3HK3B 2BTCE 5G4BA 3UWIA 4VGCB 1QFKH 2A0QB 1EAUA 4YO9A 1CO7E 3IWMA 4TWYA 3SUEA 4IBLH 3GCHB 1FPCH 4ISIH 1QRZA 1TMBH 3RU4T 2FOHA 2V3OH 1AD8H 1YC0A 3MTYA 3GCTG 2Y5HA 1ANEA 1P2QA 3AW0A 4X8TH 1J15A 4CH2B 5C2ZA 4AGJA 1N8OC 2FI3E 4AYYB 3TH2H 1AWHB 1AZZA 2ZO3H 3BF6H 2FIRH 1FY8E 2BD4A 2VIDA 1K1OA 1O2LA 5F8ZA 1A0LA 1YPLH 1RD3B 2BY7X 1TPPA 2RA0A 1QRWA 5F03A 4BANB 1GHXH 2CMYA 5L2YH 4X1SU 1XUJA 1BOQA 1YM0A 3STIA 1HIAB 3VXEH 1XXDA 3TNTA 2AIQA 3E8LA 2ZKSA 5TCCA 3SOSA 4J2YB 1GI8B 1QNJA 1CE5A 2BDHA 3U8OH 3MNBA 2RCEA 1LHGH 1KLTA 4B76A 1T8MA 1DDJA 1N1LA 2GV6A 3L3TA 1CQQA 1O2NA 2VWMA 1ETTH 1MMJN 4ZAEA 1MZDA 5DP9A 1TIOA 5JDUB 4Z0KA 2B9LA 1KTSB 4CBNA 1P03A 8LPRA 1ZTLA 2V6NA 2P95A 4ISOA 1ELTA 1GGDB 3SJ8A 1J9CH 4AOQA 1S85A 1SGCA 3RC6A 2BM2A 2GVFA 3KN2A 4X2XA 4YESB 5JBCS 1V2MT 1BB0B 2FI5E 2GZ8A 3U98H 4ZKRU 3QLPH 1BIOA 3ATWA 3S7HB 1QRXA 1GBBA 1W2KH 1Q3XA 4R8TB 3LJJA 2P8OC 3A7WA 4TPYA 4ZKOU 1HAHH 2H5CA 1ELBA 1IHTH 3NPSA 1HIAA 5AFYH 3VEQB 2GKVE 1C5XB 1SFQB 1TPAE 1UK2A 5E8EH 1C1MA 3RXBA 3RXLA 2P3UB 4D9RA 5FHTA 3VB6A 1JWTA 1GI3A 1NU9A 1ABIH 3ZZ7A 1O2GH 1C4U2 1ZMLA 2ZHQH 4UFGH 2AGEX 1QBNA 3NXPA 5E0HA 3RMLH 3ATIA 2A4OA 3DFLA 1TRMA 1CHOG 5FBEA 3P17H 1GG6C 1B0EA 1TRNA 1ELGA 1ETRH 2EC9H 4X8UH 5EXLA 3T29A 4ISHH 2TGDA 4MVNA 3EAJA 3SGBE 1W12U 1GJ5H 4Y8XA 3BTGE 4X8SH 1GCTB 2PGBB 3RM2H 1HXFH 1GI9B 2JH6D 1LHEH 3BTQE 3LC3A 1P3EA 1B0FA 1LMWB 2QXGA 2V3HH 3CS0A 2BDAA 1INCA 4ISNA 1DOJA 1ACBE 3ZVBA 2BVSH 1UHBA 4FUBA 4ZKNU 3GYLB 1Y3UA 3PV4A 1JIMA 1MCVA 3MH7A 1EJMA 3TJOA 2ZHFH 1TLDA 2CV3A 1GBMA 5FAHA 1HFDA 3A83A 2ZEBA 4FXGH 1O2QA 1FQ3A 2VU8E 4A6LA 1TX8A 1AB9C 4I8HA 1LKAA 2ZFQH 5FBIA 2ZP0H 2A5AA 4I8LA 3SBKA 4Y0YE 1GHBF 2HRVA 1C1RA 2XYAA 2OD3B 2OINA 5EW1H 1K1MA 1Y3WA 4JYVH 2JH5D 3SV6A 1GJ9B 3LU9B 1J17T 2HNTE 1EOJA 2Y81A 7GCHF 1E35B 4Y71A 5EODA 4X2YA 3HGNA 1TE0A 1CGHA 4TWWA 2QY0B 2Z9IA 3PMHB 1MTVA 4CBOA 1FUJA 3SNBA 1LCYA 1THSH 1MKWH 1C5OH 1KDQB 1DWBH 1QJ6B 3M37A 1GMCF 1WAYB 2G55A 3UPEA 1EP6A 2ZPQA 2D2DA 4KTSA 1O3HA 1NO9H 1KLJH 1C5TA 2OTVA 4DIHH 4WXIA 2XWAA 1HAOH 4GLYA 1AO5A 1GMDG 1C5RA 3U9AH 1GHZA 2QXHA 4Y8ZA 1ZZZA 1DWCH 1O2ZA 5DP5A 4K69A 2B7DH 3MNCA 6LPRA 2BY6X 3M35A 4A92A 2STAE 2BDCA 1BZXE 2SNWA 4INLA 4NWLA 3TIUA 1P8VC 4IC5A 3RUOA 3UTUH 2ZNKH 3P95A 1EAWA 3L6PA 3MU8A 2PTNA 1O3LA 1HAVB 4K1TA 5BRRE 4BAKB 1C2MA 1ARCA 1C5ZB 4WXVA 1GGDC 1EB2A 1Y3VA 2OLGA 2C8XB 3UQOA 4F4OC 2FOBA 3NUMA 4BAQB 2TRMA 4Q7ZA 1C1SA 2ANWA 1ZGIA 3M7UA 1UVUH 2PSXA 4UDWH 2W3IA 5EGMA 1TPSA 4GVUA 3S9BA 4YT7H 1K9OE 1O3JA 4DY7B 1C4V2 1CGIE 1JOUB 5TCAA 1W11U 1AKSB 1L4ZA 1YPMH 3SI3H 3CP7A 4NIWA 4LOYH 2AGGX 3DD2H 4HGCA 3A80A 2WYGA 1OOKB 3SGAE 1YPEH 3KQBA 4NA9H 3U1JB 2CGAA 1H1BA 2ASUB 3DUXH 1C2EA 4KP0A 1TNLA 4ABFA 2FS8A 5IYTA 1X7AC 2R0LA 4ESTE 1F5KU 1FJSA 1T4UH 3E16B 3RXUA 1CVWH 1WSSH 1DANH 1Z8JB 1A2CH 2VB0A 1HAVA 2BDYA 1OYQA 3A8DA 4LK4A 1Y5AT 1KXFA 2ZCKP 1GCTC 1M9UA 4IW4E 3LH1A 4INKA 2Z3CA 4MLFB 1KXEA 3A82A 1G3CA 1S82A 1SHYA 4I8KA 5C5NA 1LTOA 1UK3A 4X8VH 1O2HA 1OKXA 1FY5A 1FMGA 4MDSA 4DCDA 2NU3E 1Y5BT 1V2JT 1SGTA 4K3JA 3TITA 4X0WU 2BLWA 1K1LA 1SGEE 1ZSLA 3PMAB 5DKMA 4GHQA 1YCPM 3NK8A 2BB4A 1DITH 5C1UA 2SGEE 4ZUHA 2IPHA 5E2OA 2HPQH 4GSOA 2D1JA 3HK6B 2WPIS 1C2GA 3OSYA 1C1QA 4MPVA 4GCHF 1HAIH 5T6FA 3TGIE 2P3TB 1EZUC 1NRRH 2OBOA 1OSSA 4WH6A 1G30B 1SGIB 4AG1A 1F5RA 1BUIA 2F9OA 3EA9A 2C90B 4FVBA 4NA8A 2H2ZA 5EQSA 3I78A 2JH0D 5FCKA 3EGKH 3TJUA 3PWCA 3LGTA 2P94A 1UCYH 1P12E 2ZHDA 1GBAA 5H4IB 5DPAA 2Z3DA 3D62A 1BQYA 3MNXA 4AB9A 1C2LA 3E6PH 1F0RA 1G3DA 1AVGH 1ZHRA 3U8TH 1PQ7A 1UCYE 3FP7E 3BG8A 3QUMP 1T32A 5A2MH 1UVSH 1VR1H 5JBBS 3M3SA 4LZ4B 1UK4A 2PKSC 4KELA 1FNIA 1EZSC 3V12A 1ANDA 1KYNA 3H5CB 1TPOA 2HVXA 3TLOA 1ZPBA 2QXJA 3MO3A 1AFQB 4XOJA 1HBTH 1O39A 1LPZB 5CMXH 2FOFA 1SMFE 3GY6A 1GHVH 3QK1A 3LKWA 1LPGB 5HM9A 4DJZB 2GCTB 1V2NT 1YF4A 3BTTE 5FPTA 4YTAA 3I77A 4D9QA 3PM3A 5HYOA 5GWZA 2QC2A 3M5LA 1EPTB 1D3PB 1JMOH 1ARBA 1XUFA 1GI7B 3VB5A 1SVPA 4AORA 5GCHG 3M3TA 1EXFA 1D3TB 1B7XB 1MUEB 3U8RH 1L1JA 1C5MD 3SU2A 4B2BA 4NZQA 1O2TA 2PV9B 3OU0A 2XBYA 1CGJE 2VH0A 1HXEH 4DURA 4OS6A 2VIQA 2D26C 3HGPA 4CRAA 1GI0A 2TGPZ 3VGCB 2W26A 4H4FA 3SV2H 3D65E 1XUKA 3M5NA 2XWBI 4ZROA 3SQEE 3SU6A 3Q3YA 1S81A 1T8LA 3T25A 1UMAH