1ARBA

The primary structure and structural characteristics of achromobacter lyticus protease i, a lysine-specific serine protease
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
263
structure length
263
Chain Sequence
GVSGSCNIDVVCPEGDGRRDIIRAVGAYSKSGTLACTGSLVNNTANDRKMYFLTAHHCGMGTASTAASIVVYWNYQNSTCRAPNTPASGANGDGSMSQTQSGSTVKATYATSDFTLLELNNAANPAFNLFWAGWDRRDQNYPGAIAIHHPNVAEKRISNSTSPTSFVAWGGGAGTTHLNVQWQPSGGVTEPGSSGSPIYSPEKRVLGQLHGGPSSCSATGTNRSDQYGRVFTSWTGGGAAASRLSDWLDPASTGAQFIDGLDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACHROMOBACTER PROTEASE I
publication title The primary structure and structural characteristics of Achromobacter lyticus protease I, a lysine-specific serine protease.
pubmed rcsb
source organism Achromobacter lyticus
molecule tags Hydrolase(serine protease)
total genus 81
structure length 263
sequence length 263
ec nomenclature ec 3.4.21.50: Lysyl endopeptidase.
pdb deposition date 1993-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1arbA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1arbA02
1Z1IA 5H4IB 2BD4A 4I33A 1BDAA 3K6ZA 1LVYA 2R9PA 3PMJA 1ZSLA 3SJIA 4OS1A 5FPYA 5IYTA 1QJ6B 1NTPA 2CJIA 3SO3A 2O8MA 1Y3UA 1IQGA 2AEIH 3M61U 1FY1A 1BUIA 3SGBE 3TU7H 3DT0H 4DIIH 1KLIH 1WAYB 3BTGE 1JMOH 2A5AA 4HGCA 4JZ1A 3H7TA 3UPEA 4TWWA 3OU0A 1K1PA 3E16B 1MQ6A 4WMDA 1Y59T 2OP9A 4RKOB 3A8DA 1HB0B 2AH4X 2ZNKH 1UTJA 3DA9B 1GJ5H 3MU1A 3QX5H 2ZFPH 3RXRA 1DXPA 3A85A 1B5GH 3KGPA 2FP7B 3A80A 1T7CA 1LCYA 4XE4A 4BTIB 3A83A 1K1JA 1NT1A 1GI1A 4DURA 1NU7B 1S0QA 2V3OH 1HYLA 2A5KA 1RTFB 2QXHA 4A1TA 2UWLA 1SLVB 1O38A 1BRCE 2AERH 4O3UA 1C2FA 4FXGH 1KLJH 5GCHF 3GICB 6ESTA 2M5TA 3BTDE 2HNTE 2G5VA 5F6MA 3MI4A 1XXDA 2IOTA 1SLWB 3NZIA 2BDIA 2A4OA 1L1NA 4KGAA 4TPIZ 3BEIB 2XC0A 3RXMA 4NWLA 3PO1C 5A0BA 1UK4A 3M5NA 3MO3A 1P3CA 1O3NA 1C2LA 4FUGA 1BBRK 3RMOH 1IHSH 4K1TA 1SHYA 4E7RG 5JYIA 2RDLA 3R0FA 2BDYA 1CA0C 2Z9GA 4Q7ZA 1TMBH 1ABIH 1YCPK 1EAXA 1TGBA 9ESTA 2BLVA 3EDXB 1OYTH 1HAYB 4NA8A 5HM2A 3UNSA 3BTTE 1NROH 4Z6AH 1TNIA 1GI9B 1F5LA 4X8SH 2SGPE 1O39A 1DM4B 1ESTA 1GCDA 3LJJA 3U1IB 2H6MA 1TPOA 2A45B 2A7JA 2NU2E 5JDUB 1VR1H 2TPIZ 4QT8C 3T5FH 4MPUA 1O2JA 4RN6A 1FLEE 5HGGA 2VIVA 4LXBH 4JMYA 3T2NA 3FVFB 1O3MA 3ZV8A 1VITF 4PROA 4WWYA 3RXDA 4Q7XA 4GCHF 2HWLB 7GCHG 2Y6TA 5C5OA 3PO1B 4B2AA 2VWLA 2XWAA 4Y6DA 1DLKB 1CHOF 1EZSC 1MUEB 2AMPA 8KME2 5F8XA 3ZZ3A 4NCYA 3AVZA 5EPNA 1O5BB 2P95A 3KQCA 1Z6EA 1CA0B 1QJ1B 1VJ9U 3O8DA 4YOIA 2ZCHP 2CF8H 2EI8A 1E37B 4OS6A 1O30A 2F91A 3SHCH 4WMFA 3AASA 1GHXH 3RC5A 2QXIA 3SNAA 3ZZDA 3K9XB 2FI3E 3DUXH 3BSQA 4ASHA 2JH6D 4CR5A 1ELFA 3P95A 1QB6A 1P2QA 3MH7A 4ZHAA 1P09A 1AY6H 3K6YA 2P3FH 1K1MA 1QRWA 1QBOA 1VITH 4X2YA 1A2CH 3SV6A 1FY5A 1P9SA 5A09A 1QTFA 1XUHA 2ZFQH 1EAIA 3SV8A 1BZXE 3UNRA 3Q3KA 1MKXK 2Y5GA 3DFJA 1CE5A 1V2NT 3TH3H 5EW1H 1DITH 3BTME 1C1QA 3QK1A 3VB7A 2BD2A 2C4FH 1O2ZA 1YPHE 1YCPM 4Q7YA 1TOCB 4Y8ZA 2PV9B 1EZXC 1FY3A 3MU5A 1O3EA 2ZTZA 1W10U 4K60A 5GIBA 2O8WA 2CHAB 1XKAC 1ZPBA 2GCHG 2BXTH 2C8XB 4ISLA 1A61H 1AD8H 3MU0A 1EKBB 3GISB 1QRXA 3LONA 2R0LA 1XUGA 4X1QU 4D9QA 2P3TB 1BMAA 3KQBA 2D26C 3OYPA 2ZC9H 4YTAA 2BD9A 3B9FH 3EA9A 1BMMH 1GI6A 1K22H 1O2PA 2OBQA 4JCNA 1ANBA 3BTEE 1HAIH 3SJOA 3UNQA 1QNJA 3MMGA 1NU9A 3ZVEA 1BITA 1SGFA 1GI2A 4O3TA 1XUKA 1DWEH 3PLPA 5A2MH 6GCHF 1OSSA 1O3IA 2FS9A 3BEFB 4YLUA 3SU3A 3ZZ7A 5EQRA 4FUJA 4UFGH 2A7HA 3GDUA 4IN1A 2ANWA 2FOAA 2Y81A 5DG6A 1CGIE 5ETXA 1UTQA 1GBIA 1WOFA 1KDQA 1TGSZ 1W8BH 3LGVA 1TNGA 3H5CB 3MNBA 4BTTB 5JBTA 3ATLA 1AQ7A 1QL8A 3PYHA 3S7HB 4MNWA 3QTOH 1AWFH 2BDGA 2PHBA 1INCA 3A89A 2DUCA 8GCHF 3A7YA 3BTQE 1S82A 4OS4A 1C1UH 1ZPZA 1XVOA 2TRMA 3L3TA 5J4SA 3GCOA 1GMDF 3NWUA 1Z8IB 1FY4A 1H8DH 1V2UT 1N6YA 2XCNA 3V13A 2J38A 1FDPA 1ZSKA 1GMHF 3DD2H 3SUGA 2F3CE 1PQ7A 3SV7A 1EJAA 5C1XA 3D49H 1O5DH 3K2UA 1VJAU 4TY6A 4K5ZA 1A46H 2AYWA 4RSPA 4WMEA 1C5NH 1IOEA 5E0HA 1IQJA 4CRBA 2G52A 3W95A 3P8GA 2W26A 2FX4A 1EAUA 4CRCA 3AAUA 4H42U 1O3GA 4MPVA 1P57B 1YGCH 1BTUA 1EAWA 1RXPA 1TRMA 1E34B 2BTCE 3RLYH 1NFWA 1MU8B 1JIRA 3QTVH 4KP0A 4YESB 1NRPH 1SGCA 2TGTA 2IN2A 4ABDA 1ANCA 3PMAB 1W13U 4IGDA 1HAZB 2ZGJA 1GHWH 2UUJB 1AB9C 4I31A 1G3EA 1OWKA 5FX6A 3TVJB 4DY7B 1RS0A 2YOLA 3ODDA 3RU4T 3UR9A 2HPPH 4AX9H 1C9PA 1GBDA 1KYNA 1SL3A 1SLUB 1ESAA 2V3HH 2P8OC 4B76A 3UWIA 8ESTE 3TJOA 1TPSA 4BANB 1SI5H 5T6DA 2B8OH 2ZU4A 3M7TA 1K9OE 4LOYH 4I7YH 4U32A 1NM6A 1XUFA 1TX7A 3GCHC 4ABBA 1EZQA 2OC7A 5FX5A 1TMTH 4CBOA 2J34A 3A8CA 1S81A 5JB9S 1GVLA 1UCYH 1TGNA 1WSSH 1UK2A 2Q6DA 1SFIA 1HIAA 5GXPA 4TY7A 3SV2H 3V3MA 1DY9A 1HAXB 1GI5A 4ABAA 3IG6B 3TNSA 2P93A 4Y0YE 1H4WA 3IWMA 5A0CA 1MCTA 4X1RU 3SBKA 1NS3A 3SUFA 1PFXC 4X6MA 4UD9H 1GHBF 1S83A 3STJA 2FOEA 2ZFFH 3M3SA 1BCUH 1QHRB 4D7GA 1AB9B 1GBEA 4FUFA 1LHGH 1LVBA 2BY6X 1DS2E 1EUFA 2VGCC 1O2MA 2PGQB 1GHYH 1O2LA 1ANDA 2AGEX 3P70B 3Q3XA 3EA7A 2ODPA 1W12U 2P8OB 2ODYB 3MNSA 1MZAA 1FQ3A 2SGFE 3TJVA 3T62A 4B2BA 1MMJN 4UDWH 2J95A 1UTMA 3LGYA 4BAKB 4UONA 3GCNA 1SGTA 1HRTH 2ZGXH 3GCHB 1CT2E 2B7DH 5K0HA 4ABIA 1AN1E 1DPOA 3QO6A 3A8AA 1MZDA 1SVPA 4MPWA 1S0RA 2A31A 3I77A 2PR3A 1A3EH 1TPPA 4KELA 5FCKA 4AG1A 1A5IA 1J14A 1NC6A 1Z1JA 4ABHA 5T6FA 4FVDA 3VXFH 3RXAA 1C2MA 1S6FA 4JZEH 1TRYA 2FI4E 1OWJA 1O35A 1TX6A 1LPGB 1O2UA 3RLWH 4ZROA 3SU6A 3RXGA 3STIA 1A0LA 1GMCG 1AIXH 4AB8A 3GY7A 4AN7A 1W2KH 2VGCB 1YM0A 2WPLS 1AI8H 1OWEA 2Z3EA 4DIHH 1CT0E 3GDSA 1W3CA 1TA2A 3RXEA 1TIOA 2AIQA 1D3PB 1BJUA 3LJOA 4YLQH 2AFQB 1MCVA 1J15A 5F8ZA 3RC6A 1HIAB 1FPHH 2KAIB 2GZ7A 2DE8A 1GJ6A 5C1UA 1YPKH 4Y10E 1GJ9B 3MH5A 4UFDH 1LHEH 3MWIU 3PWBA 4MQAA 1P2JA 1V2JT 2A4GA 3NCLA 1Y5BT 2FOBA 4DJZB 1F2SE 1ZHMA 1EOLA 2WYJA 2O8UA 3MH4A 1W0ZU 3BTHE 4INHA 1TAWA 2PGBB 5ESBA 1JBUH 4GLYA 1X7AC 3P17H 3GY5A 4YT7H 1Q2WA 3UOUA 1F0TA 3ODFA 4DCDA 1GHVH 4BAMB 1H9IE 4O9VA 1ZSJA 4X1PU 3RDZA 4MLFB 1CQQA 2CF9H 4I8KA 2XW9A 3B23B 3N7OA 6LPRA 1GDQA 1A4WH 1BTHH 1LPZB 1C1OA 2ZKSA 5LH8A 2F9UA 1IQNA 2ALVA 2FYRA 4K8BA 3VFEA 1HV7A 4ZHLU 1T4UH 5FCRA 1G2LA 2G4TA 1FN6A 1QQ4A 2J94A 4JYTA 7GCHF 1RFNA 1ZLRA 1C1PA 4CH2B 1OX1A 3T25A 3TJUA 1TB6H 5JB8S 1FIZA 2D1JA 1GVZA 2FDAA 1SG8B 1TGTA 3SORA 3PLKA 2ZCKP 2BLOA 1GBTA 2BDCA 1HJ8A 1GDNA 2CN0H 1C5OH 1DY8A 1P8VC 2FO9A 1V2LT 2YNBA 1ELCA 2AS9A 2Z7FE 1HAGE 3UY9A 5LGOA 3RU4E 3SV9A 1V3XA 1B0FA 1TONA 3VB4A 1BJVA 2HLCA 2VIPA 4H4FA 1NRNH 3RXHA 1T31A 3RXKA 4YOJA 1ID5H 1JRSA 2VU8E 4HFPB 5I46H 2F9BH 5BRRE 2P59A 3ZVBA 4YM9A 4X6OA 1O3DA 1FN8A 1TGCA 2Z9KA 1A0HB 3DHKH 2FLRH 2OC0A 3RXOA 1C5WB 1HJ9A 1Y3XA 2ZU2A 1QA0A 4AFSA 7KMEH 2ZHEH 2SGEE 3AW1A 1ZJDA 4WXIA 1A5GH 1Q3XA 2SGAA 2ZQ2A 1F5KU 3LIWA 4NIYA 1ETRH 4Y7BA 1AVWA 2P3UB 4D9RA 1JRTA 2A4QA 5CE1A 1MAYA 2BD3A 4GHQA 2ZECA 1LTOA 2HGTH 4ZH8A 1IAUA 1AVGH 4A1XA 3KHVA 1JIMA 3FP7E 2CXVA 1JWTA 1LHFH 4KTUA 3Q77A 4CRAA 1P02A 2WV4A 1G9IE 2GZ8A 3UTUH 4ZMAH 2XC4A 3RXPA 2G00A 3BTWE 4FU7A 3KEEA 1HAVB 4JYUH 4CR9A 4BAHB 4XOJA 1WUNH 1TNKA 2QCYA 1C5MD 3SU1A 4NSVA 1GI0A 2Z3DA 3RXIA 1AFEH 4ZKOU 5T3HA 3M36A 3S7KB 5A0AE 4AB9A 3ATKA 2HALA 4X1NU 1O32A 2O9QA 1HLTH 4XBBA 3HKJB 2BXUH 1K1OA 1Z7KA 3SU2A 1TRNA 4XBDA 1XMNB 2H5CA 1DX5M 1L2EA 2OD3B 5L6NH 2BLWA 5C67A 5SGAE 2BVSH 1TALA 3M5LA 1ETTH 3RMNH 3URCA 1GBHA 2XRCA 2QXJA 2NU3E 2VH6A 1GDUA 1A5HA 1DANH 3M5OA 4JZIA 3LU9B 1BMNH 3U8OH 1CA8B 3NXPA 3QN7A 4NFFA 4BNRA 1N8OC 4K1SA 1D4PB 4IW4E 3V7TA 1EP6A 1EOJA 1EATA 1EPTA 1O3PB 1TBRH 3E90B 1SGPE 2NU4E 4I8JA 1C5UA 3UR6A 4BAOB 5K7RA 2QF0A 1G3BA 5PTPA 3ZZ8A 4UFFH 2CMYA 1Z6JH 1PQ8A 3BN9A 2EEKA 1UTLM 4Y79A 3RXSA 1Y3YA 1MU6B 3QGNB 2DE9A 4DT7B 8LPRA 1AE5A 3RMMH 3Q3YA 1Z8JB 1PPFE 4ZAEA 4LZ4B 1YP9A 5G4BA 3SU0A 1O5CB 3OTJE 4NGAH 5EPYA 1C2IA 1C4V2 3RM0H 2FMJA 4BOHA 3LC5A 3QGJA 3MNXA 3GOVB 3A7VA 1BTZA 1A0JA 2Y5FA 3PB1E 1C2JA 2B5TB 3LH1A 5HXFA 3SJ8A 5DKMA 1NPMA 1PPCE 2ZDVH 1EPTC 2VIOA 1S6HA 2A2QH 2QXGA 1QRZA 5F8TA 4AGKA 1N8OB 3SU4A 4WVPE 1ANEA 1XVMA 1TNLA 3GDVA 1MKWK 2P16A 4MNYA 5AVDA 4E06H 3HPTB 1QBNA 5EW2H 3UOPA 5LPEA 1ZGVA 4Y0ZE 2QC2A 1LDTT 2Q6GA 3TPIZ 2GDDA 4ZXXH 2ZHDA 1D6RA 2R3YA 1SGRE 2G51A 2STAE 3RP2A 1ZR0A 2JH0D 1BBRH 3LT3A 1FI8A 4K8YA 1ACBE 1DWBH 1WQVH 3CS0A 1L1GA 1P01A 3SUEA 3UWJH 4X6NA 4INKA 1Y3WA 1C2HA 2PUXB 1K28D 5LPRA 1YCPH 4IBLH 2ULLA 4AORA 1DUAA 4CRDA 2XBYA 1TMUH 1BT7A 4Y7AA 1XX9A 2C8ZB 3JZ1B 3TK9A 3U98H 1J8AA 3GYLB 1TX8A 2VWOA 2HOBA 2TBSA 4SGBE 3G01A 1SQTA 4MTBA 3RXTA 1O5EH 1Y8TA 1AUJA 2XBXA 1E35B 4A6LA 2C3SA 1ZTJA 1EPTB 1UTNA 3SN8A 4X2XA 1D3DB 1NZQH 3GCTF 2AGGX 2Z94A 1BIOA 1OWDA 3SI4H 1OP2A 2V0BA 1PQAA 1SHHB 1SB1H 3F68H 2FZZA 4A7IB 2H2ZA 1GBAA 2BD5A 1OS8A 1C1VH 3BG8A 1P05A 3RUOA 3M3TA 3W94A 3MYWA 2ANKH 4OS7A 1GBKA 4B74A 1C1NA 1V2MT 1E36B 4AFZA 2FOFA 1O3HA 2BOHB 1RGQA 3HK6B 1GI3A 5FPTA 2GD4B 2UWOA 1LMWB 2WPJS 3LC3A 3SI3H 5C1YA 5LPFA 1MTWA 5TCAA 1P2IA 1A7SA 1O2RA 2JKHA 4I8HA 4Y71A 1IQLA 4OS5A 2OQUA 2FXRA 2C93B 5L30H 1VITG 3RU4D 1GHAF 1YPJH 2GTBA 1SGNE 3BEUA 5EOKA 3M3VA 4ISIH 1QL9A 1CHOG 3MNCA 1MKXH 1O3CA 6CHAC 2ZDKA 5A8YA 4WH8A 1V2OT 1O36A 4E05H 3HGPA 1P0SH 3HATH 1IQEA 5L2ZH 4DOQA 2XTTB 1KXBA 1DSUA 3LDXH 2RG3A 1DXWA 2FOCA 1BHXF 1OWIA 2QF3A 1O0DH 4O97A 1RJXB 3BG4C 1N6XA 2OLGA 2QAAA 1AWHB 3ATIA 1Z71A 3ZZ4A 3RXJA 4MDSA 2D2DA 2XC5A 1FAKH 5J4QA 1SGIB 1DSTA 1HJAC 1C1TA 2OBOA 3JZ2B 1G3DA 1QB9A 3LGIA 4UFEH 4D76A 4A5TS 2A4RA 1V2PT 1B7XB 2GP9B 3C1KA 3P8FA 4CREA 4UE7H 1M9UA 1SLXB 2HNTF 1GBLA 4X8VH 1QBVH 1ZGIA 1H8IH 1C5YB 3AW0A 2W3KA 4LK4A 2Z3CA 3TK5A 1KXEA 2VIWA 3ELAH 1T4VH 1B0EA 1CGJE 2BZ6H 2UWPA 3BIVH 3TJNA 2IPHA 5CHAC 5AF9H 3SJ9A 1OXGA 3ZYDA 1KLTA 1J17T 1KDQB 1YYY1 2XNIA 4R8TB 1HAOH 2XXLA 1F7ZA 1WTGH 1KXAA 1QCPA 4CHAC 2BY5X 1SOZA 3BG4B 5T6GA 3SNDA 3KCGH 3E0PB 1EJNA 4GHTA 3O8RA 3D62A 3MOCA 5E0GA 1HJAB 1P2NA 1FV9A 4GUXA 1GHZA 1O2HA 5ESTE 2GVFA 1SOTA 1KXDA 1OPHB 1C5TA 1NFXA 2WPMS 1LKBA 1SPJA 3UFAA 1ELDE 3P8OA 1MBMA 3ZZ9A 5B6OA 4K1EA 4FU9A 3FZDA 1UVTH 3KIDU 3Q76A 2BB4A 2BVRH 2BQ6B 1LHDH 2AMDA 2HNTC 1ELTA 4JYVH 1WV7H 1EXFA 2WPHS 5CHAB 1EX3A 4IS5A 4WY3A 1BTXA 1BA8B 2QV1A 1OOKB 3HK3B 4F49A 1CBWC 5ABWA 3I78A 1NY22 1ZMNA 2FTMA 5GJ4B 3E8LA 2W5EA 3ZZ6A 1LO6A 2R2WU 4B75A 1UMAH 5E2PA 3S0NA 4CHAB 3ZVAA 4B1TA 5HYOA 2OQ5A 2FS8A 1A1RA 1GBJA 4Z0KA 2ZGHA 1P3EA 8GCHG 1KTTB 1BHXB 1DFPA 1TQ7B 3SGAE 3A7ZA 1PYTD 2ZIQH 2I6QA 5GPIB 3E0NB 1H9LB 4WJG2 3ENSB 1UTOA 4ISNA 4ZXYH 1GMDG 1V2KT 1DLEA 1YC0A 1C5XB 1GJ4H 1VCPA 4K2YA 2Y7ZA 2ZGCA 2BQ7B 1O2VA 1BBRE 2BLQA 4AG2A 3WY8A 1G3CA 3MO9A 3S9CA 3ZVDA 5TJXA 1ETSH 4AGJA 3FZZA 2I6SA 2NU0E 1GL1A 4IC6A 1MTUA 1P10A 3T26A 1TYNA 2O8TA 1DICA 5FBEA 2VNTA 1AHTH 5AHGH 1CBWB 2ZF0H 2FEQH 1GCTC 3OSYA 1CSOE 1ZMJA 2QN5T 4AZ2B 3VB6A 4X2VA 2ZQ1A 3LGTA 1G36A 3A7WA 4ABFA 2ZDNA 4Y11E 4X8UH 3UQVA 5C3NA 4DGJA 4GSOA 2ZPRA 1TFXA 3EYDA 4NWKA 3SGQE 4ZKNU 2QA9E 4I8LA 2C8WB 1UTPA 1QJ7B 2BOKA 1GPZA 3LH3A 1TPAE 4FUEA 3TH2H 3ZZBA 3BTFE 3M7UA 2PWXA 3PTBA 3TLOA 5A8XA 1C1SA 1BTPA 1EZUC 3EGKH 1XKBC 1NFYA 4X6PA 1D9IA 3RXVA 1AE8H 4BXSA 1P12E 5I25A 2BMGB 2BY7X 3RC4A 2H9TH 4FUBA 3T29A 4DG4A 1LHCH 2TGPZ 2ZGBH 3LGUA 1O2WA 2PUQH 1ZZZA 2ZG0H 2ZU1A 4O03A 4A92A 4TYDA 3HKIB 1FIWA 1GCTB 3P6ZB 3SZNA 4H6TA 4UEHH 1YPHC 3A7XA 5L2YH 4IMQA 2A2XH 2ZFTA 4IN2A 3U9AH 5GWZA 1O2KA 1AGJA 2WYGA 1RD3B 2A5IA 5DJ7A 1HCGA 1MAXA 1HUTH 2VWNA 4DW2U 3ZVFA 3U8TH 2QGRA 5AFYH 4KTCA 2PLXA 1SGEE 2ZP0H 3F9HA 1LKAA 3ZZCA 3M5MA 1GHBG 2GMTC 1AZ8A 1T8MA 2BD8A 1LVOA 2OINA 1BTWA 5C20A 3KL6A 1GL0E 2ZDAH 4HTCH 1O2QA 1NO9H 3SNBA 2ZI2H 3MU4A 4SGAE 1GVKB 4Y8XA 1RRKA 1WCZA 3R3GB 3NPSA 1OP0A 2LNCA 1ELVA 2EA3A 2GT7A 1DUEA 1O2SA 3PM3A 5JPMH 4A1VA 2BX4A 4NZQA 3FP6E 1HGTH 2ODQA 3MHWU 5DP6A 1P03A 1HDTH 3GY3A 4CRFA 1O3JA 2QYIA 3A7TA 2F9NA 1RIWC 1FMGA 3S69A 3GYMA 1CT4E 4FVBA 3VEQB 2RA0A 2ANYA 2OTVA 1ARCA 3ZZAA 2VH0A 4WH6A 3SNCA 3URDA 4Q80A 2FOMB 3ESTA 5CMXH 5IDKA 1ELEE 3A81A 2BYAX 1THRH 1GJDB 2BD7A 2Z9JA 3MH6A 4ABGA 1ELGA 3P8NA 2UUKB 2A1DB 4OS2A 1D3QB 2ZU5A 2PFEA 2BZAA 2VVVA 2GMTB 2V35A 3RM2H 1WTHD 1YF4A 2GV7A 4TPYA 1IHTH 3LKWA 1H1BA 1ZHRA 3LOXA 3KN2A 4MPXA 2GCHF 1EB2A 3A8BA 3DFLA 4ZKRU 1G37A 2FX6A 3BIUH 1DDJA 3SUDA 2PKAA 1HAHH 4D7FA 1FNIA 2ZA5A 1PPHE 2RCEA 3SJKA 1C4U2 1SGYE 1VCQA 2F9PA 2SGQE 1C5QA 1UCYE 5DP3A 2A7CA 2BY9X 5DPAA 1TOMH 2VJ1A 4MG3A 4X1SU 1RIWB 7LPRA 1FAXA 1L4ZA 1J9CH 4H6SB 3TITA 2BX3A 4ABJA 1T8OA 1LPKB 2GV6A 3CP7A 4BXWA 5FAHA 2ESTE 1MTNC 3T28A 1U6QA 4KKDA 3BTKE 5EXMA 4AFQA 1AVXA 3NK8A 1GBMA 3U1JB 4YO9A 5C2ZA 4XDEA 4CRGA 2OXSA 2A32A 1O31A 1KXFA 1SGQE 2TGDA 1CHGA 1E0FD 1O3OA 2GT8A 3SW2B 5EODA 1BTYA 2VB0A 4NIXA 1QURH 2WV5A 3CS7A 3QWCH 1PPBH 4Q2KA 1WBGB 1DT2A 1O2OA 3PROA 5EGMA 1O2IA 2PSYA 3SHAH 4CH8B 1C2KA 1TNHA 4MVNA 3EA8A 2R3UA 1Y3VA 1QL7A 3E6PH 1T8NA 1BOQA 1P2KA 2G5NA 2H9HA 5FPSA 2TIOA 5DO4H 1SR5C 2EC9H 3S9BA 3FP8E 2SFAA 3B8JA 1HFDA 2RA3A 2AMQA 4ESTE 3PWCA 3NUMA 1PQ5A 2AIPA 1UO6A 3A82A 1THPB 3VB5A 3EAJA 5GDSH 1QY6A 1MTNB 3SQEE 5DK1A 3HGNA 1GJAB 1YBWA 1EASA 3L33A 1C1RA 1ZRKA 2XCFA 2J92A 1F0RA 3A87A 4CBNA 1SBWA 2BQWB 2W7UA 3SU5A 1L0ZA 1K21H 2PKAB 1MTSA 2CHAC 1CO7E 1CU1A 4NG9H 3RXUA 4DVAU 3PV4A 1FUJA 5DP7A 2FYQA 2OC8A 1LQEA 2ZTYA 1V2QT 1F5RA 2G4UA 1OKXA 1ZMLA 3GY2A 3LGWA 1TE0A 3UUZA 2A0QB 2ZPQA 5EG4A 4U01A 5E2OA 4OGYA 1K1NA 4BAQB 1K2I1 2C8YB 1P2OA 2H5DA 1QGFA 3GY8A 1TNJA 5A8ZA 2CGAA 1UTKA 3VGCC 1H9HE 1AO5A 4NA9H 3V12A 1GJ8B 1P06A 1DVAH 2WUCA 2BM2A 4GPGA 1K1LA 1QFKH 4ISOA 1BRUP 2G8TA 4NZLA 4VGCC 1EB1H 2SGDE 2ZDMA 1W14U 3VPKA 5DP4A 1S85A 1O5GH 1TABE 2ZFSA 3PMHB 1SSXA 3KQDA 3TH4H 1Q31A 1D6WA 4D8NA 2G55A 2CV3A 1UVUH 1NFUA 1DWDH 3D65E 3RXCA 2W3IA 4J1YA 1DWCH 1GBBA 1FJSA 1NN6A 5GCHG 1PJPA 1NRRH 5FHTA 4FUHA 1AUTC 3P92A 1QQUA 1SMFE 1C5ZB 3QUMP 3SQHE 1D3TB 1PPZA 1KXCA 1GGDC 2WUBA 2Z9IA 2ZFRH 3MU8A 3ATMA 5FBIA 3TGJE 2J9NA 2K1QA 1G30B 2OUAA 3KQEA 1C2GA 2VIDA 2ZHWH 2GCTC 3RXLA 4U30A 1T32A 4NA7A 2J4IA 4IC5A 5JBBS 2NU1E 4RKJB 3PLBA 3H7OA 2QY0B 1GG6C 1W7XH 1O34A 1VCWA 1YPEH 2ILNA 1HAPH 1ARBA 3TGKE 1MD8A 1SC8U 1YPGH 1ZPCA 5HM9A 1PPGE 3VGCB 1C4Y2 2C90B 4M7GA 2PSXA 1E38B 3GY4A 5C5NA 4HZHA 4VGCB 4B71A 1O2NA 3I29A 1ORFA 2G81E 3O8CA 4R0IA 3V0XA 1MBQA 3M35A 2FOGA 4JK6A 1FXYA 2GZ9A 2FOHA 3K65B 3UIRA 1UVSH 1C5LH 1O3LA 1V2VT 1C5PA 1XUJA 2J2UA 1OP8A 1MD7A 2H1UA 1WQSA 1UCYK 2BDBA 3F9FA 1JXPA 1S5SA 2SNVA 1GGDB 3A84A 5AFZH 3ZYEA 4GCHG 2V6NA 1XM1A 1YLDA 2PKSC 1GJBB 4XSKU 2GCTB 3IITA 1XXFA 4KTSA 4U2WA 1MKWH 1GG6B 1DE7H 2F9OA 3TNTA 4NIVA 5HMAA 2VVCA 1TBZH 1YPLH 1HXFH 1HPGA 2NWNA 1O37A 1NESE 3M7QA 1ZTLA 3TIUA 1HNEE 1FPCH 1C2DA 5E0JA 1P2MA 1VZQH 1C5RA 3U69H 1ZRBA 1GMCF 3A86A 3TGIE 4F4OC 2Q6FA 1RTLA 1QB1A 2SNWA 2Z9LA 4X0WU 5EXNA 2ASUB 1SQAA 1IQKA 1Y5AT 3VXEH 1AFQC 2STBE 4AYYB 2JH5D 4JZDH 1NRQH 4THNH 1F0UA 1F92A 2TGAA 1TQ0B 1SFQB 4JZFH 4WF8A 1GJCB 4Y76A 1UVOA 1V2RT 4NFEA 1TA6A 1AZZA 1DOJA 1GBFA 5EQQA 5EQSA 1P11E 1HBTH 1Y5UT 2GGVB 2ZPSA 2PKSB 2VWMA 4YT6H 3FANA 1O2TA 3F1SB 2O8LA 2FPZA 6CHAB 3CENA 3M37A 1UJ1A 1HXEH 1K1IA 1WU1A 1ZHPA 3MFJA 3NKKA 2ZHQH 4ZHMU 2ZDLA 3BF6H 2ZCLP 2VIQA 4NSYA 2BY8X 1O3FA 1Z8GA 1ESBA 5DP5A 1THSH 1MTVA 1QR3E 3QDZB 1BQYA 4Y8YA 3OY6U 3FAOA 4GAWA 4E7NA 1S84A 4HI3A 1SGFG 2YNAA 3EE0B 1Z8RA 3Q00A 3E1XB 3ZZ5A 1MH0A 2GX4A 1L4DA 2ZO3H 2FM2A 5JBCS 1BRAA 5TCCA 2FTLE 1AFQB 1UHBA 1ZJKA 2VVUA 3L6PA 3TK6A 3QZQA 1IQMA 2PTNA 4GVUA 3T27A 3QLPH 4JK5A 1LQDB 1ELBA 2ANMH 3GCTG 1RTKA 2W7SA 1VGCC 2R0KA 3FFGA 1GI8B 1FONA 2P94A 2KAIA 1YKTA 2ZTXA 1SGDE 3MTYA 3ZVCA 2Y82A 1ABJH 2XYAA 5FXLA 6GCHG 4YZUA 1V2ST 2XBWA 4AFUA 1O33A 1FY8E 4ZUHA 4ZKSU 3OY5U 4BTUB 4INLA 1V6DA 2GDEH 2OC1A 3C27B 4B2CA 1O2XA 1G32B 3EQ0H 1PPEE 3RXBA 5F03A 4LZ1H 2BDAA 1KY9A 1NRSH 4K69A 1XUIA 2Y7XA 5DP9A 3RMLH 3KNXA 1AU8A 1ELAA 2Y5HA 1BMLA 1KIGH 4X8TH 1LVMA 1GJ7B 2BHGA 1EP5A 4ABEA 1EQ9A 4X2WA 1N1LA 1YPMH 3F9GA 4AOQA 1ZYOA 1O5AB 3SNEA 1IQFA 1GMHG 3MO6A 3SOSA 1GHAG 1OWHA 2UUYA 1YLCA 1VGCB 2QIQA 3ATWA 5BPEA 2UUFB 3E3TA 4XFQA 5DP8A 4OGXA 5EXLA 1QA7A 3PTNA 4WXVA 1J16A 1C5VA 1KTSB 3ZV9A 1EJMA 9LPRA 2H9EH 1ZOMA 1G2MA 3PMBB 3O8BA 3VB3A 2Y80A 1AKSA 2R2MB 4FUDA 4I32A 2FESH 2HRVA 1GBCA 1ZTKA 2D8WA 2BDHA 2B9LA 2HVXA 2WPIS 2XBVA 2ZHFH 3D23A 2ZZUH 1T8LA 3A88A 2EI7A 4FUIA 2LPRA 4NIWA 3F9EA 2GKVE 2FIRH 1O3BA 1UHBB 3AAVA 1GI7B 4J2YB 1C5SA 3ZVGA 3ITIA 4AYVB 3U8RH 1TLDA 1A3BH 1C2EA 3UREA 1QIXB 1V2TT 1CGHA 2WPKS 1O2YA 1IQHA 1WYKA 2THFB 1O3AA 3RXQA 3BV9B 5JBAS 1OYQA 1W7GH 2JETC 3KF2A 1PYTC 2XWBI 2B0FA 1MQ5A 2EI6A 1BB0B 1KSNA 2FWWA 5DGJA 1SQOA 1AMHA 4MNVA 4YOGA 1W0YH 3UQOA 4MNXA 1O5FH 2AGIX 2PTCE 2VINA 2FODA 1JOUB 1O2GH 1IQIA 3F6UH 4B73A 4ISHH 4I8GA 2F83A 1V2WT 2ZEBA 1C9TA 3LPRA 1L1JA 2BVXH 3RXFA 2F9VA 1W11U 2ALPA 1O3KA 4FU8A 1P9UA 3E91A 4K3JA 3S9AA 7ESTE 5E8EH 1UK3A 1UVPA 1C1WH 2WINI 1GWAA 2IJOB 1HAVA 1P04A 1C1MA 2ZWLH 1F0SA 1TBQH 2Q1JA 2Z6BD 4IMZA 2HPQH 2OCVB 1GI4A 1CVWH 4TWYA 1FZZA 2FI5E 2JETB 1TWXB 1BRBE 2FLBH 2PW8H 5EU8A 2ZU3A 1AKSB 3OX7U 4XBCA 3QZRA 3GY6A 4FUCA
chains in the Genus database with same CATH superfamily
1Z1IA 5H4IB 2BD4A 4I33A 1BDAA 3K6ZA 1LVYA 2R9PA 3PMJA 1ZSLA 3SJIA 4OS1A 5FPYA 5IYTA 1QJ6B 1NTPA 2CJIA 3SO3A 2O8MA 1Y3UA 1IQGA 2AEIH 3OEHD 3M61U 4XD7D 1FY1A 1BUIA 3SGBE 3TU7H 3DT0H 4DIIH 1KLIH 1WAYB 3BTGE 1JMOH 2A5AA 4HGCA 4JZ1A 3H7TA 3UPEA 4TWWA 3OU0A 5T1VA 1K1PA 3E16B 1MQ6A 4WMDA 1Y59T 2OP9A 2QF4A 4RKOB 2WSSD 3A8DA 1HB0B 2AH4X 2ZNKH 1UTJA 3DA9B 1GJ5H 3MU1A 3QX5H 2ZFPH 3RXRA 1DXPA 3A85A 1B5GH 3KGPA 2FP7B 3A80A 1T7CA 1LCYA 4XE4A 4BTIB 3A83A 1YY3A 1K1JA 1NT1A 1GI1A 4DURA 1NU7B 1S0QA 2V3OH 1HYLA 2A5KA 1RTFB 2QXHA 4A1TA 2UWLA 1SLVB 1O38A 1BRCE 2AERH 4O3UA 1C2FA 4FXGH 1KLJH 5GCHF 3GICB 6ESTA 2M5TA 4M9FA 3BTDE 2HNTE 2JJ1D 2G5VA 5F6MA 2WPDD 3MI4A 1XXDA 2IOTA 1SLWB 1YLNA 3NZIA 2BDIA 2A4OA 1L1NA 4KGAA 4TPIZ 3BEIB 2XC0A 3RXMA 4NWLA 3PO1C 5A0BA 1UK4A 3M5NA 3MO3A 1P3CA 4TSFD 1O3NA 1C2LA 4FUGA 1BBRK 3RMOH 1IHSH 4K1TA 1SHYA 4E7RG 5JYIA 3W1EA 2RDLA 3R0FA 2BDYA 1CA0C 2Z9GA 4Q7ZA 1TMBH 1ABIH 1YCPK 1EAXA 1TGBA 9ESTA 2BLVA 3EDXB 1OYTH 1HAYB 4NA8A 5HM2A 3UNSA 3BTTE 1NROH 4Z6AH 1TNIA 1GI9B 1F5LA 4X8SH 2SGPE 1O39A 1DM4B 1ESTA 1GCDA 1VKYA 3LJJA 3U1IB 2H6MA 1TPOA 2A45B 2A7JA 2NU2E 5JDUB 1VR1H 2L74A 2TPIZ 4QT8C 3T5FH 4MPUA 1O2JA 4RN6A 1FLEE 5HGGA 2VIVA 4LXBH 4JMYA 3T2NA 3FVFB 5KGOA 1O3MA 3ZV8A 1VITF 4PROA 4WWYA 3RXDA 4Q7XA 2YMSD 4GCHF 2HWLB 7GCHG 2Y6TA 5C5OA 3PO1B 4B2AA 2VWLA 2XWAA 4Y6DA 1DLKB 1CHOF 1EZSC 1MUEB 2AMPA 5DN6D 8KME2 5F8XA 3ZZ3A 4NCYA 3AVZA 5EPNA 1O5BB 2P95A 3KQCA 1Z6EA 1E1QD 1CA0B 1QJ1B 1VJ9U 3O8DA 4YOIA 2ZCHP 2CF8H 2EI8A 1E37B 4OS6A 1O30A 2F91A 3SHCH 4WMFA 3AASA 1GHXH 3RC5A 2QXIA 3SNAA 3ZZDA 3F2GA 3K9XB 2FI3E 3DUXH 3BSQA 4ASHA 2JH6D 4CR5A 1ELFA 3P95A 2KCYA 1QB6A 1P2QA 3MH7A 4ZHAA 1P09A 1AY6H 3K6YA 2P3FH 1K1MA 1QRWA 1QBOA 1VITH 4X2YA 5KECA 1A2CH 3SV6A 1FY5A 1P9SA 5A09A 1QTFA 1XUHA 2ZFQH 1EAIA 3SV8A 1BZXE 3UNRA 3Q3KA 1MKXK 2Y5GA 3DFJA 1CE5A 1V2NT 3TH3H 5EW1H 1DITH 3BTME 1C1QA 3QK1A 3VB7A 2BD2A 2C4FH 1O2ZA 1YPHE 1YCPM 4Q7YA 1TOCB 4Y8ZA 2PV9B 1EZXC 1FY3A 3MU5A 1O3EA 2ZTZA 1W10U 4K60A 5GIBA 2O8WA 2CHAB 1XKAC 1ZPBA 2GCHG 2BXTH 2C8XB 4ISLA 1A61H 1AD8H 3MU0A 1EKBB 2XNDD 3GISB 1QRXA 3LONA 5HIYA 2R0LA 1XUGA 4X1QU 4D9QA 2P3TB 1BMAA 3KQBA 2D26C 3OYPA 2ZC9H 4YTAA 2BD9A 3B9FH 3EA9A 1BMMH 1GI6A 1K22H 1O2PA 2OBQA 4JCNA 3WW7A 1ANBA 3BTEE 1HAIH 3SJOA 3UNQA 1QNJA 3MMGA 1NU9A 3ZVEA 1BITA 1SGFA 1GI2A 4O3TA 1XUKA 1DWEH 2J97A 3PLPA 5A2MH 6GCHF 1OSSA 1O3IA 2FS9A 3BEFB 4YLUA 3SU3A 3ZZ7A 5EQRA 4FUJA 4UFGH 2A7HA 3GDUA 4IN1A 2ANWA 2FOAA 2Y81A 5DG6A 1CGIE 5ETXA 1UTQA 1GBIA 1WOFA 1KDQA 1TGSZ 1W8BH 3LGVA 1TNGA 3H5CB 3MNBA 4BTTB 5JBTA 3ATLA 1AQ7A 1QL8A 2KCAA 3PYHA 4MNWA 3S7HB 3QTOH 1AWFH 2BDGA 2PHBA 1INCA 3A89A 2DUCA 8GCHF 3A7YA 3BTQE 1S82A 4OS4A 1C1UH 1ZPZA 1XVOA 2TRMA 3L3TA 5J4SA 3GCOA 1GMDF 3NWUA 1Z8IB 1FY4A 1H8DH 1V2UT 1N6YA 2XCNA 3V13A 2J38A 1FDPA 3CNRA 1ZSKA 1GMHF 3DD2H 3SUGA 2QF5A 2F3CE 1PQ7A 3SV7A 1EJAA 5C1XA 3D49H 1O5DH 3K2UA 1VJAU 4TY6A 4K5ZA 1A46H 3PRDA 2AYWA 3KQ5A 4RSPA 4WMEA 1C5NH 1IOEA 5E0HA 1IQJA 4CRBA 2G52A 3W95A 3P8GA 1H8HD 2W26A 2FX4A 1EAUA 4Q63A 4CRCA 3AAUA 4H42U 1O3GA 4MPVA 1P57B 1YGCH 1BTUA 1EAWA 1RXPA 1TRMA 1E34B 2BTCE 3RLYH 1NFWA 1MU8B 1JIRA 4B6FA 3QTVH 4KP0A 4YESB 1NRPH 1SGCA 2TGTA 2IN2A 2CK3D 4XRNA 4ABDA 1ANCA 3PMAB 1W13U 4IGDA 1HAZB 2ZGJA 1GHWH 2UUJB 1AB9C 3F0PA 4I31A 1G3EA 1OWKA 5FX6A 3TVJB 4DY7B 1RS0A 2YOLA 3ODDA 3RU4T 3UR9A 1QZ8A 2HPPH 2K8IA 3VG8A 1C9PA 1GBDA 4AX9H 1KYNA 1SL3A 1SLUB 1ESAA 2V3HH 2P8OC 4B76A 3UWIA 8ESTE 3TJOA 1TPSA 4BANB 1SI5H 5T6DA 2B8OH 2ZU4A 2XOKD 1K9OE 3M7TA 4LOYH 4I7YH 4U32A 1NM6A 1XUFA 1TX7A 3GCHC 4ABBA 1EZQA 2OC7A 5FX5A 1TMTH 4CBOA 2J34A 3A8CA 1S81A 5JB9S 1GVLA 1UCYH 1TGNA 1WSSH 1UK2A 2Q6DA 1SFIA 5F53A 1HIAA 5GXPA 4TY7A 3SV2H 3V3MA 1DY9A 1HAXB 1GI5A 4ABAA 3IG6B 3TNSA 2P93A 4Y0YE 1H4WA 3IWMA 2KM0A 5A0CA 1MCTA 4X1RU 3SBKA 1NS3A 3SUFA 1PFXC 4X6MA 4UD9H 1GHBF 1S83A 3STJA 2F4LA 2FOEA 2ZFFH 3M3SA 1BCUH 1QHRB 4D7GA 1AB9B 1GBEA 4FUFA 1LHGH 1LVBA 2BY6X 1DS2E 1EUFA 2VGCC 1O2MA 2PGQB 1GHYH 1O2LA 5FL7D 1ANDA 2AGEX 3P70B 3Q3XA 3EA7A 4AC9A 2ODPA 1W12U 2P8OB 2ODYB 3MNSA 1MZAA 1FQ3A 2SGFE 3TJVA 3T62A 4B2BA 1MMJN 4UDWH 2J95A 1UTMA 3LGYA 4BAKB 4UONA 3GCNA 1SGTA 1HRTH 2ZGXH 3GCHB 1CT2E 2B7DH 5K0HA 4ABIA 1AN1E 1DPOA 3QO6A 3A8AA 1MZDA 3SYJA 1SVPA 4MPWA 1S0RA 2A31A 3FO8D 3I77A 2PR3A 1A3EH 1TPPA 4KELA 5FCKA 4AG1A 1A5IA 1J14A 1NC6A 1Z1JA 4ABHA 5T6FA 4FVDA 3VXFH 3RXAA 1C2MA 1S6FA 4JZEH 1TRYA 2FI4E 1OWJA 1O35A 1TX6A 1LPGB 1O2UA 3RLWH 4ZROA 3SU6A 3RXGA 3STIA 1A0LA 3F2HA 1GMCG 1AIXH 4AB8A 3GY7A 4AN7A 1W2KH 2VGCB 1YM0A 2WPLS 1AI8H 1OWEA 2Z3EA 4DIHH 1CT0E 3GDSA 1W3CA 1TA2A 3RXEA 1TIOA 2AIQA 1D3PB 1BJUA 3LJOA 4YLQH 2AFQB 1MCVA 1J15A 5F8ZA 3RC6A 1HIAB 1FPHH 2KAIB 2GZ7A 2DE8A 1GJ6A 5C1UA 1YPKH 4Y10E 1GJ9B 3MH5A 4UFDH 1LHEH 3MWIU 3PWBA 4MQAA 1P2JA 1V2JT 2A4GA 2EQNA 3NCLA 1Y5BT 2FOBA 4ACBA 4DJZB 1F2SE 4ASUD 3FOAA 1ZHMA 1EOLA 2WYJA 2O8UA 3MH4A 1W0ZU 3BTHE 2KX4A 4INHA 1TAWA 2PGBB 5ESBA 1JBUH 2RFKC 4GLYA 1X7AC 3P17H 3GY5A 4YT7H 1Q2WA 3UOUA 1F0TA 3ODFA 4DCDA 1GHVH 4BAMB 1H9IE 4O9VA 1ZSJA 4X1PU 3RDZA 4MLFB 1CQQA 2CF9H 1S6LA 4I8KA 2XW9A 3B23B 3N7OA 6LPRA 1GDQA 3PV2A 1A4WH 5GNDA 1BTHH 1LPZB 1C1OA 2ZKSA 5LH8A 2F9UA 1IQNA 2ALVA 2FYRA 4K8BA 3VFEA 1HV7A 4ZHLU 1T4UH 5FCRA 1G2LA 2G4TA 1FN6A 1QQ4A 2J94A 4JYTA 7GCHF 1RFNA 1ZLRA 1C1PA 4CH2B 1OX1A 3T25A 3TJUA 1TB6H 5JB8S 1FIZA 2D1JA 1GVZA 2FDAA 1SG8B 1TGTA 3SORA 2J98B 3PLKA 3AK5A 2ZCKP 2BLOA 1GBTA 2BDCA 1HJ8A 1GDNA 2CN0H 1C5OH 1DY8A 1P8VC 2FO9A 3WWBA 1V2LT 2YNBA 1ELCA 2AS9A 2Z7FE 1HAGE 3UY9A 5LGOA 3RU4E 3SV9A 1V3XA 1B0FA 2IPQX 1TONA 3VB4A 1BJVA 5EIYA 2HLCA 2VIPA 4H4FA 1NRNH 3RXHA 1T31A 3RXKA 4YOJA 1ID5H 1JRSA 2VU8E 4HFPB 5I46H 2F9BH 5BRRE 2P59A 3ZVBA 3F0OA 4YM9A 4X6OA 1O3DA 1FN8A 1TGCA 2Z9KA 1A0HB 3DHKH 2FLRH 2OC0A 3RXOA 1C5WB 1HJ9A 1Y3XA 2ZU2A 2VBCA 1QA0A 4AFSA 7KMEH 2ZHEH 2SGEE 3AW1A 1ZJDA 4WXIA 1A5GH 1Q3XA 2SGAA 2ZQ2A 1F5KU 3LIWA 4NIYA 1ETRH 4Y7BA 1AVWA 2P3UB 5C0TA 4D9RA 1JRTA 2A4QA 5CE1A 1MAYA 2BD3A 4GHQA 2ZECA 1LTOA 2HGTH 4ZH8A 1IAUA 1AVGH 4A1XA 3KHVA 4ACAA 1JIMA 3FP7E 2CXVA 1JWTA 1LHFH 4P00A 4KTUA 3Q77A 4CRAA 1P02A 2IJD1 1G9IE 2WV4A 2GZ8A 3UTUH 4ZMAH 2XC4A 3RXPA 2G00A 3BTWE 4FU7A 3KEEA 1HAVB 4JYUH 4CR9A 4BAHB 4XOJA 1WUNH 1TNKA 2QCYA 1C5MD 3SU1A 4NSVA 1GI0A 2Z3DA 3RXIA 1AFEH 4ZKOU 5T3HA 3M36A 3S7KB 5A0AE 4AB9A 3ATKA 2HALA 4X1NU 1NBME 1O32A 2O9QA 2QE7D 1HLTH 4XBBA 3HKJB 2BXUH 1K1OA 1Z7KA 3SU2A 1TRNA 2LP6A 4XBDA 1XMNB 2H5CA 1DX5M 1L2EA 2OD3B 3N99A 5L6NH 2BLWA 5C67A 5SGAE 2BVSH 1TALA 3M5LA 1ETTH 3RMNH 3URCA 1GBHA 1OHHD 2XRCA 2QXJA 2NU3E 2VH6A 1GDUA 1A5HA 1DANH 3M5OA 4JZIA 3LU9B 1BMNH 2W6JD 1CA8B 3U8OH 3NXPA 3QN7A 4YXWD 4NFFA 4BNRA 1N8OC 4K1SA 2EY4C 1D4PB 5EJLA 4IW4E 3V7TA 3MQKC 1EP6A 1EOJA 1EATA 1EPTA 1O3PB 1TBRH 3E90B 1SGPE 2NU4E 4I8JA 1C5UA 3UR6A 4BAOB 5K7RA 2QF0A 1G3BA 5PTPA 3ZZ8A 4UFFH 2CMYA 1Z6JH 1PQ8A 3BN9A 2EEKA 1UTLM 4Y79A 5HKKD 3RXSA 1Y3YA 1MU6B 3QGNB 2DE9A 4DT7B 8LPRA 1AE5A 3RMMH 3Q3YA 1Z8JB 1PPFE 4ZAEA 4LZ4B 1YP9A 5G4BA 3SU0A 1O5CB 3OTJE 4NGAH 5EPYA 1C2IA 1C4V2 3RM0H 2FMJA 4BOHA 3LC5A 3QGJA 3MNXA 3GOVB 3OTPA 3A7VA 1BTZA 1A0JA 2Y5FA 3PB1E 1C2JA 2B5TB 3LH1A 5HXFA 3SJ8A 5DKMA 1NPMA 1PPCE 2ZDVH 1EPTC 2JDID 1S6HA 2A2QH 2QXGA 1QRZA 2VIOA 5F8TA 4AGKA 1N8OB 3SU4A 4WVPE 1ANEA 1XVMA 1TNLA 3GDVA 1MKWK 2P16A 4MNYA 5AVDA 4E06H 3HPTB 1QBNA 5EW2H 3UOPA 5LPEA 1ZGVA 4Y0ZE 2QC2A 1LDTT 2Q6GA 3TPIZ 2GDDA 4ZXXH 2ZHDA 1D6RA 2R3YA 1SGRE 5IK2D 2G51A 2STAE 3RP2A 1ZR0A 2JH0D 1BBRH 3LT3A 1FI8A 4K8YA 1ACBE 1DWBH 1WQVH 3CS0A 1L1GA 1P01A 3SUEA 3UWJH 2YMSC 4X6NA 4INKA 1Y3WA 1C2HA 2PUXB 1K28D 5LPRA 1YCPH 4IBLH 2ULLA 4AORA 1DUAA 4CRDA 2XBYA 3U28C 1TMUH 1BT7A 4Y7AA 1XX9A 2C8ZB 3JZ1B 3TK9A 3U98H 1J8AA 3GYLB 1TX8A 2VWOA 2HOBA 2TBSA 4SGBE 3G01A 1SQTA 4MTBA 3RXTA 1O5EH 1Y8TA 1AUJA 2XBXA 1E35B 4A6LA 2HVYB 2C3SA 1ZTJA 1EPTB 1UTNA 3SN8A 4X2XA 1D3DB 1NZQH 3GCTF 5HIZA 2AGGX 2Z94A 1BIOA 1OWDA 3SI4H 1OP2A 2V0BA 1PQAA 2KR7A 1SHHB 1SB1H 3F68H 2FZZA 4A7IB 2H2ZA 1GBAA 2BD5A 1OS8A 1C1VH 3BG8A 1P05A 3RUOA 3M3TA 3W94A 3MYWA 2ANKH 4OS7A 1GBKA 4B74A 1C1NA 2YMSB 1V2MT 1E36B 4AFZA 2FOFA 1O3HA 2BOHB 1RGQA 3HK6B 1GI3A 5FPTA 2GD4B 2UWOA 1LMWB 2WPJS 3LC3A 3SI3H 5C1YA 5LPFA 1MTWA 5TCAA 1P2IA 1UW7A 1A7SA 1O2RA 4RT1A 2JKHA 4I8HA 4Y71A 1IQLA 4OS5A 2OQUA 2FXRA 2C93B 5L30H 1VITG 3RU4D 1GHAF 1YPJH 2GTBA 1SGNE 3BEUA 5EOKA 3M3VA 4ISIH 1QL9A 1CHOG 3MNCA 1MKXH 1O3CA 6CHAC 2ZDKA 5A8YA 4WH8A 1V2OT 1O36A 4E05H 3HGPA 1P0SH 3HATH 1IQEA 5L2ZH 4DOQA 2XTTB 1KXBA 1DSUA 2WHXA 2RG3A 3LDXH 2FOCA 1DXWA 1BHXF 1OWIA 2QF3A 1O0DH 4O97A 1RJXB 3BG4C 1N6XA 2OLGA 2QAAA 1AWHB 3ATIA 1Z71A 3ZZ4A 3RXJA 4MDSA 2D2DA 2XC5A 1FAKH 5J4QA 1SGIB 3OFND 1DSTA 1HJAC 4TT3D 1C1TA 2OBOA 3JZ2B 1G3DA 1QB9A 3LGIA 4UFEH 4D76A 4A5TS 2A4RA 2W6ID 1V2PT 1B7XB 2GP9B 3C1KA 1E1RD 3P8FA 4CREA 4UE7H 1M9UA 1SLXB 2HNTF 1GBLA 4X8VH 1QBVH 1ZGIA 1H8IH 1C5YB 3AW0A 2W3KA 4LK4A 2Z3CA 1EFRD 3TK5A 1KXEA 2K0QA 2VIWA 3ELAH 1T4VH 1B0EA 1CGJE 2BZ6H 2UWPA 3BIVH 3TJNA 2IPHA 3UAIC 5CHAC 5AF9H 3SJ9A 1OXGA 3ZYDA 5CHBA 1KLTA 1J17T 1KDQB 1YYY1 5EJ1A 1NBMD 2XNIA 4R8TB 1HAOH 2XXLA 3DSOA 1F7ZA 1WTGH 1KXAA 1QCPA 4CHAC 2BY5X 1SOZA 3BG4B 3DSPA 5T6GA 3SNDA 3KCGH 3E0PB 1EJNA 4GHTA 3O8RA 3D62A 3MOCA 5E0GA 1HJAB 1P2NA 1FV9A 4GUXA 1GHZA 1O2HA 5ESTE 2GVFA 1SOTA 1KXDA 1OPHB 1C5TA 1NFXA 2WPMS 1LKBA 1SPJA 3UFAA 1ELDE 3P8OA 1MBMA 3ZZ9A 5B6OA 4K1EA 4FU9A 3FZDA 1UVTH 3KIDU 3Q76A 2BB4A 2BVRH 2BQ6B 1LHDH 2AMDA 2HNTC 1ELTA 4JYVH 1WV7H 1EXFA 2WPHS 5CHAB 1EX3A 4IS5A 3SZEA 4WY3A 1BTXA 1BA8B 2QV1A 1OOKB 3HK3B 4F49A 1CBWC 3DCLA 3I78A 5ABWA 1NY22 1ZMNA 2FTMA 5GJ4B 3E8LA 2W5EA 3ZZ6A 1LO6A 2R2WU 4B75A 1UMAH 2J5UA 5E2PA 3S0NA 4CHAB 3ZVAA 4B1TA 5HYOA 2OQ5A 2FS8A 1A1RA 2V7QD 1GBJA 1YWUA 4Z0KA 2ZGHA 2KFWA 1P3EA 8GCHG 1KTTB 1BHXB 1DFPA 1TQ7B 3SGAE 3A7ZA 1PYTD 2ZIQH 4Z1MD 2I6QA 5GPIB 3E0NB 1H9LB 4WJG2 3ENSB 1UTOA 4ISNA 4ZXYH 2AHME 1GMDG 3NRLA 1V2KT 2WV9A 1DLEA 1YC0A 1C5XB 1GJ4H 1VCPA 4K2YA 2Y7ZA 2ZGCA 2BQ7B 1O2VA 1BBRE 2BLQA 4AG2A 3WY8A 1G3CA 3MO9A 3S9CA 3ZVDA 5TJXA 1ETSH 1SQRA 4AGJA 3FZZA 2I6SA 2NU0E 1GL1A 4IC6A 1MTUA 1P10A 3PRBA 3T26A 1TYNA 2O8TA 1DICA 5FBEA 2VNTA 1AHTH 5AHGH 1CBWB 2ZF0H 2FEQH 3ZIAD 1GCTC 3OSYA 1CSOE 1ZMJA 2QN5T 4AZ2B 3VB6A 4X2VA 2ZQ1A 3LGTA 1G36A 3A7WA 4ABFA 2ZDNA 4Y11E 4X8UH 3UQVA 5C3NA 4DGJA 4GSOA 2ZPRA 1TFXA 3EYDA 4NWKA 3SGQE 4ZKNU 2QA9E 4I8LA 2C8WB 1UTPA 1QJ7B 2BOKA 1GPZA 3LH3A 1TPAE 4FUEA 2V3MA 3TH2H 3ZZBA 3BTFE 3M7UA 2PWXA 3PTBA 3TLOA 1W0KD 5A8XA 1C1SA 1BTPA 1EZUC 3EGKH 1XKBC 1BMFD 1NFYA 4X6PA 1D9IA 3RXVA 1AE8H 4BXSA 1P12E 5I25A 2BMGB 2BY7X 3RC4A 2H9TH 4FUBA 3T29A 4DG4A 1LHCH 2TGPZ 2ZGBH 3LGUA 1O2WA 2PUQH 1ZZZA 2ZG0H 2ZU1A 4O03A 4A92A 4TYDA 2L6OA 3HKIB 1FIWA 1GCTB 3P6ZB 3SZNA 4H6TA 4UEHH 1YPHC 3A7XA 5L2YH 4IMQA 2A2XH 2ZFTA 4IN2A 3U9AH 5GWZA 1O2KA 1AGJA 2WYGA 1RD3B 2HLDD 2A5IA 5DJ7A 1HCGA 1MAXA 1HUTH 2VWNA 4DW2U 3ZVFA 3U8TH 2QGRA 5AFYH 4KTCA 2PLXA 4I86A 1SGEE 2ZP0H 3F9HA 1LKAA 4FOUC 3ZZCA 3M5MA 1GHBG 2GMTC 1AZ8A 1T8MA 2BD8A 1LVOA 2OINA 1BTWA 5C20A 3KL6A 1GL0E 2ZDAH 4HTCH 1O2QA 1NO9H 3SNBA 2ZI2H 3MU4A 4SGAE 1GVKB 4Y8XA 1RRKA 1WCZA 3R3GB 3NPSA 1OP0A 2LELA 2LNCA 1ELVA 2EA3A 2GT7A 1DUEA 1O2SA 3PM3A 5JPMH 4A1VA 2BX4A 4NZQA 3FP6E 1HGTH 2ODQA 3MHWU 5DP6A 1P03A 1HDTH 3GY3A 4CRFA 1O3JA 2QYIA 3A7TA 2F9NA 2M2AA 1RIWC 1FMGA 3S69A 3GYMA 1CT4E 4FVBA 3VEQB 2RA0A 2ANYA 2OTVA 1ARCA 3ZZAA 2VH0A 4WH6A 3SNCA 3URDA 4Q80A 2FOMB 3ESTA 5CMXH 5IDKA 1ELEE 3A81A 2BYAX 1THRH 1GJDB 2BD7A 3WWFA 2Z9JA 3MH6A 4ABGA 1ELGA 3KYFA 3P8NA 2UUKB 2A1DB 4OS2A 1D3QB 2ZU5A 1H8ED 2PFEA 2BZAA 2VVVA 2GMTB 2V35A 3RM2H 1WTHD 1YF4A 2GV7A 4TPYA 1IHTH 3LKWA 1H1BA 1ZHRA 3LOXA 3KN2A 4MPXA 2GCHF 1EB2A 3A8BA 3DFLA 4ZKRU 1G37A 2FX6A 3BIUH 1DDJA 3SUDA 2PKAA 1HAHH 4D7FA 1FNIA 2ZA5A 1PPHE 2RCEA 3SJKA 1C4U2 1SGYE 1VCQA 2F9PA 2SGQE 1C5QA 1UCYE 5DP3A 2A7CA 2BY9X 5DPAA 2WZQA 1TOMH 2VJ1A 4MG3A 4X1SU 1RIWB 7LPRA 1FAXA 1L4ZA 1J9CH 4H6SB 3TITA 2BX3A 4ABJA 1T8OA 1LPKB 2GV6A 4FETA 3CP7A 4BXWA 5FAHA 2ESTE 1MTNC 3T28A 1U6QA 4KKDA 3BTKE 5EXMA 4AFQA 1AVXA 3NK8A 1GBMA 3U1JB 4YO9A 2JJ2D 5C2ZA 4XDEA 4CRGA 2OXSA 2A32A 1O31A 1KXFA 1SGQE 2TGDA 1CHGA 1E0FD 1O3OA 2GT8A 3SW2B 5EODA 1BTYA 2VB0A 4NIXA 1QURH 2WV5A 3CS7A 3QWCH 1PPBH 4Q2KA 1WBGB 1DT2A 1O2OA 3PROA 5EGMA 1O2IA 2PSYA 3SHAH 4CH8B 1C2KA 1TNHA 4MVNA 3EA8A 2R3UA 1Y3VA 1QL7A 3E6PH 1T8NA 1BOQA 1P2KA 2G5NA 2H9HA 5FPSA 2TIOA 5DO4H 1SR5C 2EC9H 3S9BA 3FP8E 2SFAA 3B8JA 1HFDA 2RA3A 2AMQA 4ESTE 3PWCA 3NUMA 1PQ5A 2AIPA 1UO6A 3A82A 1THPB 3VB5A 3EAJA 5GDSH 1QY6A 1MTNB 3SQEE 5DK1A 3HGNA 1GJAB 1YBWA 2JIZD 1EASA 3L33A 1C1RA 1ZRKA 2XCFA 2J92A 1F0RA 3A87A 4CBNA 1SBWA 2BQWB 2W7UA 3SU5A 1L0ZA 1K21H 2PKAB 3FKSD 1MTSA 2CHAC 1CO7E 1CU1A 4NG9H 3RXUA 4DVAU 3PV4A 1FUJA 5DP7A 2FYQA 2OC8A 1LQEA 2ZTYA 1V2QT 3FN8A 1F5RA 2G4UA 1OKXA 1ZMLA 3GY2A 3LGWA 1TE0A 3UUZA 2A0QB 4OM9A 2ZPQA 5EG4A 4U01A 5E2OA 4OGYA 1K1NA 4BAQB 1K2I1 2C8YB 1P2OA 2H5DA 1QGFA 3GY8A 1TNJA 5A8ZA 3N7DA 2CGAA 1UTKA 3VGCC 1H9HE 1AO5A 4NA9H 3V12A 1GJ8B 1P06A 1DVAH 2WUCA 2BM2A 4GPGA 1K1LA 1QFKH 4ISOA 1BRUP 2G8TA 4NZLA 4VGCC 1EB1H 2SGDE 2ZDMA 1W14U 3VPKA 5DP4A 1S85A 1O5GH 1TABE 4P02A 2ZFSA 3PMHB 1SSXA 3KQDA 3TH4H 1Q31A 1D6WA 4D8NA 2G55A 2CV3A 1UVUH 1NFUA 1DWDH 3D65E 3RXCA 2W3IA 4J1YA 1DWCH 1GBBA 1FJSA 1NN6A 5GCHG 1PJPA 1NRRH 5FHTA 4FUHA 4F48B 1AUTC 3P92A 1QQUA 1SMFE 1C5ZB 3QUMP 3SQHE 1D3TB 1PPZA 1KXCA 1GGDC 2WUBA 2Z9IA 2ZFRH 3MU8A 3ATMA 5FBIA 5KEDA 3TGJE 2J9NA 2K1QA 1G30B 2OUAA 3KQEA 1C2GA 5EJZA 2VIDA 2ZHWH 2GCTC 3RXLA 4U30A 1T32A 4NA7A 2J4IA 4IC5A 5JBBS 2NU1E 4RKJB 3PLBA 3H7OA 2QY0B 1GG6C 1W7XH 1O34A 1VCWA 1YPEH 2ILNA 1HAPH 1ARBA 3TGKE 1MD8A 1SC8U 1YPGH 1ZPCA 5HM9A 1PPGE 3VGCB 1C4Y2 2C90B 4M7GA 2PSXA 1E38B 3GY4A 5C5NA 4HZHA 4VGCB 4B71A 1O2NA 3I29A 1ORFA 2G81E 3O8CA 4R0IA 3V0XA 1MBQA 3M35A 2FOGA 4JK6A 4B6EA 1FXYA 2GZ9A 2FOHA 3K65B 3UIRA 1UVSH 1C5LH 1O3LA 1V2VT 1C5PA 1XUJA 2J2UA 5B6LA 1OP8A 1MD7A 2H1UA 1WQSA 1UCYK 2BDBA 3F9FA 1JXPA 1S5SA 2SNVA 1GGDB 1WDIA 3A84A 5AFZH 3ZYEA 4GCHG 2V6NA 1XM1A 1YLDA 2PKSC 1GJBB 3KYGA 4XSKU 2GCTB 3IITA 1XXFA 4KTSA 4U2WA 1MKWH 1GG6B 1FX0B 1DE7H 5CDFE 2F9OA 3TNTA 4NIVA 5HMAA 2VVCA 1TBZH 1YPLH 1HXFH 1HPGA 2NWNA 5C94A 1O37A 1NESE 3M7QA 1ZTLA 3TIUA 1HNEE 1FPCH 1C2DA 5E0JA 1P2MA 1VZQH 1C5RA 3U69H 1ZRBA 1GMCF 3A86A 3TGIE 4F4OC 2Q6FA 1RTLA 1QB1A 2SNWA 2Z9LA 4X0WU 5EXNA 2ASUB 1SQAA 1IQKA 1Y5AT 3VXEH 1AFQC 2STBE 4AYYB 2JH5D 4JZDH 4RT0A 1NRQH 4THNH 1F0UA 1F92A 2TGAA 1TQ0B 1SFQB 4JZFH 4WF8A 1GJCB 4Y76A 1UVOA 1V2RT 4NFEA 1TA6A 1AZZA 1DOJA 1GBFA 5EQQA 5EQSA 1P11E 1HBTH 1COWD 1Y5UT 2GGVB 2ZPSA 4RI0A 2PKSB 2VWMA 4YT6H 3FANA 1O2TA 3F1SB 2O8LA 2FPZA 6CHAB 3CENA 3M37A 1UJ1A 1HXEH 1K1IA 1WU1A 1ZHPA 3MFJA 3NKKA 1WXRA 2ZHQH 4ZHMU 2ZDLA 3BF6H 2ZCLP 2VIQA 4NSYA 2BY8X 1O3FA 2KCPA 1Z8GA 1ESBA 5DP5A 1THSH 1MTVA 1QR3E 3QDZB 1BQYA 4Y8YA 3OY6U 3FAOA 4GAWA 4E7NA 1S84A 4HI3A 1SGFG 5DSFA 2YNAA 3EE0B 1Z8RA 3Q00A 3E1XB 3ZZ5A 1MH0A 2GX4A 1L4DA 2ZO3H 2FM2A 5JBCS 1BRAA 1E79D 1W0JD 5TCCA 2FTLE 1AFQB 1UHBA 1ZJKA 2VVUA 3L6PA 3TK6A 4ZCNA 3QZQA 1IQMA 2PTNA 4GVUA 1MABB 3T27A 4HG6A 3F2FA 3QLPH 4JK5A 1LQDB 1ELBA 2ANMH 3GCTG 1RTKA 2W7SA 1VGCC 2R0KA 3FFGA 1GI8B 1FONA 2P94A 2KAIA 1YKTA 2ZTXA 1SGDE 3MTYA 3ZVCA 2Y82A 1ABJH 2XYAA 5FXLA 6GCHG 4YZUA 1V2ST 2XBWA 4AFUA 1O33A 1FY8E 4ZUHA 4ZKSU 3OY5U 4BTUB 4INLA 1V6DA 2GDEH 2OC1A 3H09A 3C27B 4B2CA 3OE7D 1O2XA 1G32B 3EQ0H 1PPEE 3RXBA 5F03A 4LZ1H 1K0HA 2BDAA 1KY9A 1NRSH 4K69A 1XUIA 2Y7XA 5DP9A 3RMLH 3KNXA 1AU8A 1ELAA 2Y5HA 1SKYE 1BMLA 1KIGH 4X8TH 1LVMA 1GJ7B 2BHGA 3DSGA 1EP5A 4ABEA 1EQ9A 4X2WA 1N1LA 1YPMH 3F9GA 4AOQA 1ZYOA 1O5AB 3SNEA 1IQFA 1GMHG 3MO6A 3SOSA 1GHAG 1OWHA 2UUYA 1YLCA 3GS9A 1VGCB 2QIQA 3ATWA 5BPEA 4DT4A 2UUFB 3E3TA 4XFQA 5DP8A 4OGXA 1KMHB 1QA7A 5EXLA 3PTNA 4WXVA 1J16A 1C5VA 3OEED 1KTSB 3ZV9A 1EJMA 9LPRA 2H9EH 1ZOMA 1G2MA 3PMBB 3O8BA 3VB3A 2Y80A 1AKSA 2R2MB 2KZ4A 3EE7A 4FUDA 4I32A 2FESH 2HRVA 1GBCA 1ZTKA 2D8WA 2BDHA 2B9LA 2HVXA 2WPIS 2XBVA 2ZHFH 3D23A 2ZZUH 1T8LA 2J98A 3A88A 2PP6A 2EI7A 4FUIA 2LPRA 4NIWA 3F9EA 2F43B 2GKVE 2FIRH 1O3BA 1UHBB 3AAVA 3OAAD 1GI7B 4J2YB 1C5SA 3ZVGA 3ITIA 4AYVB 3U8RH 3UB0A 1TLDA 1A3BH 1C2EA 3UREA 1QIXB 5C0UA 2OK5A 1V2TT 1CGHA 2WPKS 1O2YA 1IQHA 1WYKA 2THFB 1O3AA 3RXQA 3BV9B 5JBAS 1OYQA 1W7GH 2JETC 3KF2A 1PYTC 2XWBI 2B0FA 1MQ5A 2KCOA 2EI6A 1BB0B 1KSNA 2FWWA 5DGJA 1SQOA 1AMHA 4MNVA 4YOGA 1W0YH 3UQOA 4MNXA 1O5FH 2AGIX 2PTCE 2VINA 2FODA 1JOUB 1O2GH 1IQIA 3F6UH 4B73A 3PV5A 4ISHH 4I8GA 2F83A 2GJGA 1V2WT 2ZEBA 1C9TA 3LPRA 1L1JA 2BVXH 3RXFA 2F9VA 1W11U 2ALPA 1O3KA 3F3BA 4FU8A 1P9UA 3E91A 4K3JA 3S9AA 7ESTE 3N7EA 5E8EH 1UK3A 1UVPA 1C1WH 5C17A 2WINI 1GWAA 2IJOB 1HAVA 4F55A 1P04A 1C1MA 2ZWLH 1F0SA 1TBQH 2Q1JA 2Z6BD 4IMZA 4Q4LA 2HPQH 2OCVB 1GI4A 1CVWH 4TWYA 1FZZA 2FI5E 2JETB 1TWXB 1BRBE 2RDEA 2FLBH 2PW8H 5EU8A 2ZU3A 1AKSB 3OX7U 4XBCA 3QZRA 3GY6A 4FUCA
chains in the Genus database with same CATH topology
1Z1IA 5H4IB 2BD4A 4I33A 1BDAA 3K6ZA 1LVYA 2R9PA 3PMJA 1ZSLA 3SJIA 4OS1A 5FPYA 5IYTA 1QJ6B 1NTPA 2CJIA 3SO3A 2O8MA 1Y3UA 1IQGA 2AEIH 3M61U 1FY1A 1BUIA 3SGBE 3TU7H 3DT0H 4DIIH 1KLIH 1WAYB 3BTGE 1JMOH 2A5AA 4HGCA 4JZ1A 3H7TA 3UPEA 4TWWA 3OU0A 1K1PA 3E16B 1MQ6A 4WMDA 1Y59T 2OP9A 4RKOB 3A8DA 1HB0B 2AH4X 2ZNKH 1UTJA 3DA9B 1GJ5H 3MU1A 3QX5H 2ZFPH 3RXRA 1DXPA 3A85A 1B5GH 3KGPA 2FP7B 3A80A 1T7CA 1LCYA 4XE4A 4BTIB 3A83A 1K1JA 1NT1A 1GI1A 4DURA 1NU7B 1S0QA 2V3OH 1HYLA 2A5KA 1RTFB 2QXHA 4A1TA 2UWLA 1SLVB 1O38A 1BRCE 2AERH 4O3UA 1C2FA 4FXGH 1KLJH 5GCHF 3GICB 6ESTA 2M5TA 3BTDE 2HNTE 2G5VA 5F6MA 3MI4A 1XXDA 2IOTA 1SLWB 3NZIA 2BDIA 2A4OA 1L1NA 4KGAA 4TPIZ 3BEIB 2XC0A 3RXMA 4NWLA 3PO1C 5A0BA 1UK4A 3M5NA 3MO3A 1P3CA 1O3NA 1C2LA 4FUGA 1BBRK 3RMOH 1IHSH 4K1TA 1SHYA 4E7RG 5JYIA 2RDLA 3R0FA 2BDYA 1CA0C 2Z9GA 4Q7ZA 1TMBH 1ABIH 1YCPK 1EAXA 1TGBA 9ESTA 2BLVA 3EDXB 1OYTH 1HAYB 4NA8A 5HM2A 3UNSA 3BTTE 1NROH 4Z6AH 1TNIA 1GI9B 1F5LA 4X8SH 2SGPE 1O39A 1DM4B 1ESTA 1GCDA 3LJJA 3U1IB 2H6MA 1TPOA 2A45B 2A7JA 2NU2E 5JDUB 1VR1H 2TPIZ 4QT8C 3T5FH 4MPUA 1O2JA 4RN6A 1FLEE 5HGGA 2VIVA 4LXBH 4JMYA 3T2NA 3FVFB 1O3MA 3ZV8A 1VITF 4PROA 4WWYA 3RXDA 4Q7XA 4GCHF 2HWLB 7GCHG 2Y6TA 5C5OA 3PO1B 4B2AA 2VWLA 2XWAA 4Y6DA 1DLKB 1CHOF 1EZSC 1MUEB 2AMPA 8KME2 5F8XA 3ZZ3A 4NCYA 3AVZA 5EPNA 1O5BB 2P95A 3KQCA 1Z6EA 1CA0B 1QJ1B 1VJ9U 3O8DA 4YOIA 2ZCHP 2CF8H 2EI8A 1E37B 4OS6A 1O30A 2F91A 3SHCH 4WMFA 3AASA 1GHXH 3RC5A 2QXIA 3SNAA 3ZZDA 3K9XB 2FI3E 3DUXH 3BSQA 4ASHA 2JH6D 4CR5A 1ELFA 3P95A 1QB6A 1P2QA 3MH7A 4ZHAA 1P09A 1AY6H 3K6YA 2P3FH 1K1MA 1QRWA 1QBOA 1VITH 4X2YA 1A2CH 3SV6A 1FY5A 1P9SA 5A09A 1QTFA 1XUHA 2ZFQH 1EAIA 3SV8A 1BZXE 3UNRA 3Q3KA 1MKXK 2Y5GA 3DFJA 1CE5A 1V2NT 3TH3H 5EW1H 1DITH 3BTME 1C1QA 3QK1A 3VB7A 2BD2A 2C4FH 1O2ZA 1YPHE 1YCPM 4Q7YA 1TOCB 4Y8ZA 2PV9B 1EZXC 1FY3A 3MU5A 1O3EA 2ZTZA 1W10U 4K60A 5GIBA 2O8WA 2CHAB 1XKAC 1ZPBA 2GCHG 2BXTH 2C8XB 4ISLA 1A61H 1AD8H 3MU0A 1EKBB 3GISB 1QRXA 3LONA 2R0LA 1XUGA 4X1QU 4D9QA 2P3TB 1BMAA 3KQBA 2D26C 3OYPA 2ZC9H 4YTAA 2BD9A 3B9FH 3EA9A 1BMMH 1GI6A 1K22H 1O2PA 2OBQA 4JCNA 1ANBA 3BTEE 1HAIH 3SJOA 3UNQA 1QNJA 3MMGA 1NU9A 3ZVEA 1BITA 1SGFA 1GI2A 4O3TA 1XUKA 1DWEH 3PLPA 5A2MH 6GCHF 1OSSA 1O3IA 2FS9A 3BEFB 4YLUA 3SU3A 3ZZ7A 5EQRA 4FUJA 4UFGH 2A7HA 3GDUA 4IN1A 2ANWA 2FOAA 2Y81A 5DG6A 1CGIE 5ETXA 1UTQA 1GBIA 1WOFA 1KDQA 1TGSZ 1W8BH 3LGVA 1TNGA 3H5CB 3MNBA 4BTTB 5JBTA 3ATLA 1AQ7A 1QL8A 3PYHA 3S7HB 4MNWA 3QTOH 1AWFH 2BDGA 2PHBA 1INCA 3A89A 2DUCA 8GCHF 3A7YA 3BTQE 1S82A 4OS4A 1C1UH 1ZPZA 1XVOA 2TRMA 3L3TA 5J4SA 3GCOA 1GMDF 3NWUA 1Z8IB 1FY4A 1H8DH 1V2UT 1N6YA 2XCNA 3V13A 2J38A 1FDPA 1ZSKA 1GMHF 3DD2H 3SUGA 2F3CE 1PQ7A 3SV7A 1EJAA 5C1XA 3D49H 1O5DH 3K2UA 1VJAU 4TY6A 4K5ZA 1A46H 2AYWA 4RSPA 4WMEA 1C5NH 1IOEA 5E0HA 1IQJA 4CRBA 2G52A 3W95A 3P8GA 2W26A 2FX4A 1EAUA 4CRCA 3AAUA 4H42U 1O3GA 4MPVA 1P57B 1YGCH 1BTUA 1EAWA 1RXPA 1TRMA 1E34B 2BTCE 3RLYH 1NFWA 1MU8B 1JIRA 3QTVH 4KP0A 4YESB 1NRPH 1SGCA 2TGTA 2IN2A 4ABDA 1ANCA 3PMAB 1W13U 4IGDA 1HAZB 2ZGJA 1GHWH 2UUJB 1AB9C 4I31A 1G3EA 1OWKA 5FX6A 3TVJB 4DY7B 1RS0A 2YOLA 3ODDA 3RU4T 3UR9A 2HPPH 4AX9H 1C9PA 1GBDA 1KYNA 1SL3A 1SLUB 1ESAA 2V3HH 2P8OC 4B76A 3UWIA 8ESTE 3TJOA 1TPSA 4BANB 1SI5H 5T6DA 2B8OH 2ZU4A 3M7TA 1K9OE 4LOYH 4I7YH 4U32A 1NM6A 1XUFA 1TX7A 3GCHC 4ABBA 1EZQA 2OC7A 5FX5A 1TMTH 4CBOA 2J34A 3A8CA 1S81A 5JB9S 1GVLA 1UCYH 1TGNA 1WSSH 1UK2A 2Q6DA 1SFIA 1HIAA 5GXPA 4TY7A 3SV2H 3V3MA 1DY9A 1HAXB 1GI5A 4ABAA 3IG6B 3TNSA 2P93A 4Y0YE 1H4WA 3IWMA 5A0CA 1MCTA 4X1RU 3SBKA 1NS3A 3SUFA 1PFXC 4X6MA 4UD9H 1GHBF 1S83A 3STJA 2FOEA 2ZFFH 3M3SA 1BCUH 1QHRB 4D7GA 1AB9B 1GBEA 4FUFA 1LHGH 1LVBA 2BY6X 1DS2E 1EUFA 2VGCC 1O2MA 2PGQB 1GHYH 1O2LA 1ANDA 2AGEX 3P70B 3Q3XA 3EA7A 2ODPA 1W12U 2P8OB 2ODYB 3MNSA 1MZAA 1FQ3A 2SGFE 3TJVA 3T62A 4B2BA 1MMJN 4UDWH 2J95A 1UTMA 3LGYA 4BAKB 4UONA 3GCNA 1SGTA 1HRTH 2ZGXH 3GCHB 1CT2E 2B7DH 5K0HA 4ABIA 1AN1E 1DPOA 3QO6A 3A8AA 1MZDA 1SVPA 4MPWA 1S0RA 2A31A 3I77A 2PR3A 1A3EH 1TPPA 4KELA 5FCKA 4AG1A 1A5IA 1J14A 1NC6A 1Z1JA 4ABHA 5T6FA 4FVDA 3VXFH 3RXAA 1C2MA 1S6FA 4JZEH 1TRYA 2FI4E 1OWJA 1O35A 1TX6A 1LPGB 1O2UA 3RLWH 4ZROA 3SU6A 3RXGA 3STIA 1A0LA 1GMCG 1AIXH 4AB8A 3GY7A 4AN7A 1W2KH 2VGCB 1YM0A 2WPLS 1AI8H 1OWEA 2Z3EA 4DIHH 1CT0E 3GDSA 1W3CA 1TA2A 3RXEA 1TIOA 2AIQA 1D3PB 1BJUA 3LJOA 4YLQH 2AFQB 1MCVA 1J15A 5F8ZA 3RC6A 1HIAB 1FPHH 2KAIB 2GZ7A 2DE8A 1GJ6A 5C1UA 1YPKH 4Y10E 1GJ9B 3MH5A 4UFDH 1LHEH 3MWIU 3PWBA 4MQAA 1P2JA 1V2JT 2A4GA 3NCLA 1Y5BT 2FOBA 4DJZB 1F2SE 1ZHMA 1EOLA 2WYJA 2O8UA 3MH4A 1W0ZU 3BTHE 4INHA 1TAWA 2PGBB 5ESBA 1JBUH 4GLYA 1X7AC 3P17H 3GY5A 4YT7H 1Q2WA 3UOUA 1F0TA 3ODFA 4DCDA 1GHVH 4BAMB 1H9IE 4O9VA 1ZSJA 4X1PU 3RDZA 4MLFB 1CQQA 2CF9H 4I8KA 2XW9A 3B23B 3N7OA 6LPRA 1GDQA 1A4WH 1BTHH 1LPZB 1C1OA 2ZKSA 5LH8A 2F9UA 1IQNA 2ALVA 2FYRA 4K8BA 3VFEA 1HV7A 4ZHLU 1T4UH 5FCRA 1G2LA 2G4TA 1FN6A 1QQ4A 2J94A 4JYTA 7GCHF 1RFNA 1ZLRA 1C1PA 4CH2B 1OX1A 3T25A 3TJUA 1TB6H 5JB8S 1FIZA 2D1JA 1GVZA 2FDAA 1SG8B 1TGTA 3SORA 3PLKA 2ZCKP 2BLOA 1GBTA 2BDCA 1HJ8A 1GDNA 2CN0H 1C5OH 1DY8A 1P8VC 2FO9A 1V2LT 2YNBA 1ELCA 2AS9A 2Z7FE 1HAGE 3UY9A 5LGOA 3RU4E 3SV9A 1V3XA 1B0FA 1TONA 3VB4A 1BJVA 2HLCA 2VIPA 4H4FA 1NRNH 3RXHA 1T31A 3RXKA 4YOJA 1ID5H 1JRSA 2VU8E 4HFPB 5I46H 2F9BH 5BRRE 2P59A 3ZVBA 4YM9A 4X6OA 1O3DA 1FN8A 1TGCA 2Z9KA 1A0HB 3DHKH 2FLRH 2OC0A 3RXOA 1C5WB 1HJ9A 1Y3XA 2ZU2A 1QA0A 4AFSA 7KMEH 2ZHEH 2SGEE 3AW1A 1ZJDA 4WXIA 1A5GH 1Q3XA 2SGAA 2ZQ2A 1F5KU 3LIWA 4NIYA 1ETRH 4Y7BA 1AVWA 2P3UB 4D9RA 1JRTA 2A4QA 5CE1A 1MAYA 2BD3A 4GHQA 2ZECA 1LTOA 2HGTH 4ZH8A 1IAUA 1AVGH 4A1XA 3KHVA 1JIMA 3FP7E 2CXVA 1JWTA 1LHFH 4KTUA 3Q77A 4CRAA 1P02A 2WV4A 1G9IE 2GZ8A 3UTUH 4ZMAH 2XC4A 3RXPA 2G00A 3BTWE 4FU7A 3KEEA 1HAVB 4JYUH 4CR9A 4BAHB 4XOJA 1WUNH 1TNKA 2QCYA 1C5MD 3SU1A 4NSVA 1GI0A 2Z3DA 3RXIA 1AFEH 4ZKOU 5T3HA 3M36A 3S7KB 5A0AE 4AB9A 3ATKA 2HALA 4X1NU 1O32A 2O9QA 1HLTH 4XBBA 3HKJB 2BXUH 1K1OA 1Z7KA 3SU2A 1TRNA 4XBDA 1XMNB 2H5CA 1DX5M 1L2EA 2OD3B 5L6NH 2BLWA 5C67A 5SGAE 2BVSH 1TALA 3M5LA 1ETTH 3RMNH 3URCA 1GBHA 2XRCA 2QXJA 2NU3E 2VH6A 1GDUA 1A5HA 1DANH 3M5OA 4JZIA 3LU9B 1BMNH 3U8OH 1CA8B 3NXPA 3QN7A 4NFFA 4BNRA 1N8OC 4K1SA 1D4PB 4IW4E 3V7TA 1EP6A 1EOJA 1EATA 1EPTA 1O3PB 1TBRH 3E90B 1SGPE 2NU4E 4I8JA 1C5UA 3UR6A 4BAOB 5K7RA 2QF0A 1G3BA 5PTPA 3ZZ8A 4UFFH 2CMYA 1Z6JH 1PQ8A 3BN9A 2EEKA 1UTLM 4Y79A 3RXSA 1Y3YA 1MU6B 3QGNB 2DE9A 4DT7B 8LPRA 1AE5A 3RMMH 3Q3YA 1Z8JB 1PPFE 4ZAEA 4LZ4B 1YP9A 5G4BA 3SU0A 1O5CB 3OTJE 4NGAH 5EPYA 1C2IA 1C4V2 3RM0H 2FMJA 4BOHA 3LC5A 3QGJA 3MNXA 3GOVB 3A7VA 1BTZA 1A0JA 2Y5FA 3PB1E 1C2JA 2B5TB 3LH1A 5HXFA 3SJ8A 5DKMA 1NPMA 1PPCE 2ZDVH 1EPTC 2VIOA 1S6HA 2A2QH 2QXGA 1QRZA 5F8TA 4AGKA 1N8OB 3SU4A 4WVPE 1ANEA 1XVMA 1TNLA 3GDVA 1MKWK 2P16A 4MNYA 5AVDA 4E06H 3HPTB 1QBNA 5EW2H 3UOPA 5LPEA 1ZGVA 4Y0ZE 2QC2A 1LDTT 2Q6GA 3TPIZ 2GDDA 4ZXXH 2ZHDA 1D6RA 2R3YA 1SGRE 2G51A 2STAE 3RP2A 1ZR0A 2JH0D 1BBRH 3LT3A 1FI8A 4K8YA 1ACBE 1DWBH 1WQVH 3CS0A 1L1GA 1P01A 3SUEA 3UWJH 4X6NA 4INKA 1Y3WA 1C2HA 2PUXB 1K28D 5LPRA 1YCPH 4IBLH 2ULLA 4AORA 1DUAA 4CRDA 2XBYA 1TMUH 1BT7A 4Y7AA 1XX9A 2C8ZB 3JZ1B 3TK9A 3U98H 1J8AA 3GYLB 1TX8A 2VWOA 2HOBA 2TBSA 4SGBE 3G01A 1SQTA 4MTBA 3RXTA 1O5EH 1Y8TA 1AUJA 2XBXA 1E35B 4A6LA 2C3SA 1ZTJA 1EPTB 1UTNA 3SN8A 4X2XA 1D3DB 1NZQH 3GCTF 2AGGX 2Z94A 1BIOA 1OWDA 3SI4H 1OP2A 2V0BA 1PQAA 1SHHB 1SB1H 3F68H 2FZZA 4A7IB 2H2ZA 1GBAA 2BD5A 1OS8A 1C1VH 3BG8A 1P05A 3RUOA 3M3TA 3W94A 3MYWA 2ANKH 4OS7A 1GBKA 4B74A 1C1NA 1V2MT 1E36B 4AFZA 2FOFA 1O3HA 2BOHB 1RGQA 3HK6B 1GI3A 5FPTA 2GD4B 2UWOA 1LMWB 2WPJS 3LC3A 3SI3H 5C1YA 5LPFA 1MTWA 5TCAA 1P2IA 1A7SA 1O2RA 2JKHA 4I8HA 4Y71A 1IQLA 4OS5A 2OQUA 2FXRA 2C93B 5L30H 1VITG 3RU4D 1GHAF 1YPJH 2GTBA 1SGNE 3BEUA 5EOKA 3M3VA 4ISIH 1QL9A 1CHOG 3MNCA 1MKXH 1O3CA 6CHAC 2ZDKA 5A8YA 4WH8A 1V2OT 1O36A 4E05H 3HGPA 1P0SH 3HATH 1IQEA 5L2ZH 4DOQA 2XTTB 1KXBA 1DSUA 3LDXH 2RG3A 1DXWA 2FOCA 1BHXF 1OWIA 2QF3A 1O0DH 4O97A 1RJXB 3BG4C 1N6XA 2OLGA 2QAAA 1AWHB 3ATIA 1Z71A