1ARBA

The primary structure and structural characteristics of achromobacter lyticus protease i, a lysine-specific serine protease
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
263
structure length
263
Chain Sequence
GVSGSCNIDVVCPEGDGRRDIIRAVGAYSKSGTLACTGSLVNNTANDRKMYFLTAHHCGMGTASTAASIVVYWNYQNSTCRAPNTPASGANGDGSMSQTQSGSTVKATYATSDFTLLELNNAANPAFNLFWAGWDRRDQNYPGAIAIHHPNVAEKRISNSTSPTSFVAWGGGAGTTHLNVQWQPSGGVTEPGSSGSPIYSPEKRVLGQLHGGPSSCSATGTNRSDQYGRVFTSWTGGGAAASRLSDWLDPASTGAQFIDGLDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(serine protease)
molecule keywords ACHROMOBACTER PROTEASE I
publication title The primary structure and structural characteristics of Achromobacter lyticus protease I, a lysine-specific serine protease.
pubmed rcsb
source organism Achromobacter lyticus
total genus 81
structure length 263
sequence length 263
ec nomenclature ec 3.4.21.50: Lysyl endopeptidase.
pdb deposition date 1993-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1arbA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1arbA02
4ZAEA 1TQ0B 1OWKA 1ZMLA 2ZHDA 1S0QA 1P2NA 1HJAC 4IMQA 2VVCA 2ZGBH 4DG4A 2AMPA 3RXQA 1FY4A 4MTBA 1P3EA 5GPIB 4B76A 1BQYA 1VGCC 1DDJA 4MNXA 1C5YB 5FX6A 1EQ9A 3SU0A 1GJ8B 1TAWA 1NPMA 3R0FA 1GJ7B 3S9CA 2F3CE 2P8OC 1V2QT 3BTHE 1C1SA 1MKWH 3HK6B 1V6DA 3VFEA 1HIAA 1F0TA 1LHGH 1RRKA 2OTVA 2OLGA 3BTTE 2R2MB 2FOFA 4NIWA 2WPIS 3A8DA 1O38A 1P57B 3LU9B 4Y79A 4K8BA 2GMTC 1ARBA 2A45B 4UFGH 1SSXA 2FOCA 3KNXA 3SW2B 1O2KA 4X8UH 3FANA 3V0XA 3IG6B 1H9LB 2AGGX 3I77A 1A3EH 1FN6A 3A8BA 1KXFA 4AORA 1IAUA 2WPHS 5FBIA 2F9UA 3RM2H 3STJA 2ZDNA 1WAYB 1AVXA 1AWFH 3K9XB 3V13A 3AW1A 3PMHB 1SFQB 3K65B 2ZU3A 4Y10E 1VITH 3HATH 1ZZZA 2VIDA 1C4V2 1GHBG 1NU7B 1YBWA 1RFNA 2SGAA 1MUEB 1WOFA 2ZQ1A 3UIRA 1O3KA 4AX9H 4CRFA 2OC1A 1INCA 1AI8H 2QXIA 2ZPSA 1LO6A 1T8NA 1C1PA 1V2PT 5FXLA 1HXFH 1SGPE 1SHHB 2ZFPH 1GHYH 3UY9A 3W94A 1CT2E 5AHGH 1GHAF 1MKXK 2UUFB 5J4SA 3BTGE 1YPJH 4ZKRU 5T6GA 1K1NA 1QJ6B 1YGCH 1DXPA 2C3SA 1CO7E 1ZSKA 1EOLA 1IQLA 4ZUHA 4LXBH 2BOKA 3M7TA 2PKSB 3TJUA 2F9NA 1TGNA 1IQMA 1QRWA 4XBCA 4ZHAA 2VVVA 3BEIB 2BVRH 5C3NA 2Z94A 2ZPRA 1DXWA 1AWHB 2J95A 3T62A 1H4WA 1QGFA 1YM0A 1QB6A 3O8BA 3V12A 1TGSZ 1V2UT 2Z3DA 3SU5A 1Z71A 2QF0A 2GDDA 3RM0H 1TNIA 4KKDA 2O8WA 3RU4T 1M9UA 2FOEA 1F0RA 2BD3A 3MI4A 4WMFA 3BSQA 2IN2A 3U8OH 4B1TA 1GBCA 2Z9IA 1WU1A 1V2NT 3E6PH 2ILNA 1L0ZA 3GCNA 3KHVA 1NRRH 1G2LA 1MU8B 2Y82A 2FYRA 3D23A 1O2UA 3RXBA 1GI0A 3ZVGA 1W13U 2V35A 2FIRH 1ELCA 1UMAH 4AYVB 5DGJA 3PYHA 3T26A 2G5NA 1TNKA 2BVSH 1NFYA 4ASHA 1K1MA 2ODPA 2Y5GA 1L4DA 1G3BA 1NRPH 2XBVA 2M5TA 1QY6A 3A84A 3ZVCA 1F2SE 1PYTC 1QFKH 3LGYA 3BG8A 1GHBF 3EAJA 1W0ZU 2ZO3H 1GMHG 4D76A 4HGCA 2BDBA 1FY5A 4IW4E 1T4UH 1ZR0A 1ETRH 5ESTE 2BDCA 2J94A 3GCOA 2QXHA 2ZHFH 2Z3EA 3MHWU 2STAE 3OY6U 1XUKA 1GWAA 3A89A 1VITG 2TRMA 1VJAU 2ALPA 1GL1A 1A46H 4A1TA 1SLXB 1FPCH 1O2PA 3GDUA 2A4GA 2ZFTA 3UNQA 1WV7H 3AVZA 1SGFA 2OINA 4INHA 2B9LA 3SV8A 4FUJA 4X6MA 2VWLA 3SV6A 1UCYE 1A3BH 1FXYA 3ZVBA 4E7RG 3UR6A 1A0LA 1C5TA 4H6SB 1OS8A 1G32B 4X1PU 3P70B 3M61U 1PYTD 1O2XA 3AASA 2Y5FA 4YOIA 1H8IH 1MQ6A 4Z6AH 2W5EA 1U6QA 4D7GA 1PPBH 4ZXXH 2GZ7A 1ABJH 3CS0A 1HAYB 2PR3A 1NROH 1VCWA 1BA8B 4CH8B 2BTCE 1EP5A 2FOGA 1ZTKA 3RXOA 1XXFA 4NWLA 1NFXA 3FFGA 1GI1A 1EZQA 1H9HE 1TYNA 5EQRA 1O3BA 5K7RA 1TBQH 2FEQH 1HAHH 4IN1A 1DLEA 3GISB 2F83A 1BUIA 4WXVA 4YLQH 3RXIA 2OUAA 2TGAA 1KSNA 1EKBB 1ELTA 3E16B 3PLPA 3SNBA 1W11U 1MTNB 5EU8A 1O3CA 4AYYB 2H6MA 1YF4A 1GBJA 2BD4A 4IC6A 1TOMH 5ABWA 1W7XH 5L2ZH 1SLVB 5HXFA 4JYVH 4I8HA 4FU9A 2SGPE 2PTNA 1C2DA 5EG4A 7ESTE 1SC8U 4A6LA 2CF8H 2YNAA 4IBLH 1SOZA 3KQBA 3T5FH 1AB9B 3S7KB 2W26A 3EQ0H 1D9IA 2RG3A 2QXGA 2TGPZ 2GV7A 3RXGA 1BCUH 3VB5A 1SGNE 3RXHA 2RDLA 3B8JA 4Y8ZA 1UVOA 1TLDA 1VITF 2AMDA 5FPSA 5DJ7A 3TIUA 4YOGA 4SGAE 1GBLA 1GJDB 5LH8A 3VB6A 1GI5A 1SFIA 1P9SA 4HFPB 4NZLA 1HFDA 5C1YA 1C2EA 4D9RA 1GPZA 4NSYA 2R0KA 1MCVA 2FOBA 3PB1E 4X6OA 1EPTA 2A7CA 1P2MA 3OU0A 5C1XA 1MD8A 1YPMH 3S69A 3STIA 5LPEA 2HGTH 1QRXA 3FZDA 1ESTA 3BTFE 1HGTH 3E8LA 4AG1A 1D3PB 4B2BA 2ZDMA 3MO6A 2V3HH 2J34A 1MZAA 1FPHH 4XOJA 7LPRA 1TPSA 1P05A 4TWYA 3MU1A 1E34B 1O3LA 3GY7A 1KXEA 1VZQH 4ABAA 5HM2A 1G3CA 4GAWA 1LQEA 1ZRBA 1NT1A 2FOAA 4BAKB 1Y8TA 3OYPA 4CRCA 2Z9LA 3UR9A 3V3MA 1A1RA 2ZIQH 2LNCA 3SORA 5AVDA 3EA7A 2W3KA 1KLTA 2QIQA 3GY5A 2HALA 5GXPA 1T8OA 1AGJA 4BTUB 2P95A 1KTSB 4LZ1H 1GJAB 1PFXC 4Y76A 2C8YB 1O3FA 2NU1E 5G4BA 2ZPQA 1IOEA 2WV4A 3F9HA 1BIOA 1C5QA 1QHRB 1Z8JB 3E90B 3SV9A 1UVUH 1AIXH 1QA7A 2BDGA 3H7TA 5ETXA 3W95A 3A7XA 3RMOH 1FN8A 2VGCC 4ABGA 1T7CA 1O3PB 1C2IA 2BD9A 3BIVH 1HXEH 4YT6H 1GMDF 2BY7X 3M37A 4MPUA 1W7GH 2FWWA 3PO1C 3OY5U 3P8GA 1ZRKA 4JK6A 4X2YA 4U2WA 3L33A 1TB6H 2W7UA 1ELAA 3DUXH 2ESTE 2XYAA 1EASA 1FIZA 4X0WU 4HTCH 3MMGA 4KELA 1NS3A 3EA8A 3M36A 1MAXA 1GDUA 2HNTE 1WUNH 1C2MA 4RKOB 2ZHEH 1ELBA 2PSYA 4FUDA 4VGCB 2BQ7B 1F0UA 2GZ8A 1HBTH 1CGJE 1SG8B 1PPZA 1CHOG 1EAIA 1EZUC 3KQDA 5JB8S 1VCPA 2XBYA 3SI4H 2ZU2A 4AFQA 1O5GH 2ZU5A 4LOYH 2GVFA 2PW8H 1AZZA 5EPNA 3BG4B 1HAOH 1V2JT 3GY6A 1O3HA 1O2VA 4YESB 1WQSA 1UK2A 1QQ4A 1KXAA 3U8TH 4MVNA 3H5CB 4AB9A 3C1KA 1AHTH 1NO9H 1ELDE 2VIPA 1KXBA 2EEKA 2PTCE 3BF6H 2NWNA 1WCZA 1KLJH 3ATIA 2FODA 2G81E 3QDZB 1DUAA 1GI2A 2ZGHA 1YCPK 1HAGE 3BTWE 3A7WA 2QCYA 2C8XB 1GJ4H 1A0HB 5E0GA 3HGPA 2JH0D 1YKTA 1FJSA 3SV7A 4O3TA 2BM2A 2F91A 4UFFH 1SQOA 5A2MH 1EPTB 1MMJN 3DD2H 3C27B 4NA7A 4DURA 1BBRH 1PQ8A 1ESBA 2JETC 3EGKH 3RLWH 1G9IE 5FCKA 2CMYA 1HB0B 1C2HA 1AFQB 2QY0B 4MNVA 2Y6TA 4B2CA 4Z0KA 1K21H 1C5XB 3FP7E 1AMHA 4BOHA 1CBWB 2I6SA 2H1UA 3RXUA 2HNTC 2H9HA 1EZSC 1KLIH 1P2OA 1C1RA 1GL0E 1OSSA 3GCHC 1DVAH 2WPKS 3M5OA 3TPIZ 2PGQB 2XRCA 1THPB 1GI9B 3UUZA 3O8RA 4A7IB 1ZMNA 3S9AA 3VGCB 4FU7A 4XFQA 2BY8X 2ZDKA 1N8OC 1N8OB 1XVOA 1OXGA 4UEHH 2ANMH 3PMAB 4IN2A 1FY8E 2ODYB 1FUJA 1YLCA 1GI3A 1N6YA 1EB2A 1CHOF 1CT4E 5CE1A 2NU4E 2BLQA 4UE7H 1BMLA 1LPKB 2ZFFH 1GI7B 3V7TA 2GCHF 1A5IA 1J15A 1Y3XA 4MPVA 4ABFA 3KL6A 3TH2H 1DUEA 1QJ7B 4AFUA 2BZ6H 2VWMA 5EPYA 3ZZ8A 3LGWA 1O5AB 4TPIZ 4FUFA 3TGIE 1V2KT 3SJOA 1NFUA 2EA3A 3OX7U 1MU6B 4FUBA 1FY1A 4I8GA 1OKXA 4JZEH 3GYMA 5SGAE 1LPGB 1DM4B 1GVZA 1QQUA 5EODA 5DG6A 1C5UA 5FBEA 2F9VA 1TNGA 2ZGCA 3SU1A 2A5KA 2ULLA 2C4FH 2P93A 1BTYA 1GBBA 3PMBB 3U9AH 3ZVDA 4K1SA 6ESTA 1HLTH 1H1BA 1TWXB 5JBCS 1GBIA 3RXCA 2BVXH 4B71A 8GCHG 2P59A 2Q1JA 9LPRA 3SBKA 5A0CA 2AIPA 3T28A 4M7GA 4Y0ZE 4TYDA 2H5CA 1XUHA 2SGFE 2J9NA 2AMQA 2VINA 3ZZ9A 1C9TA 3GOVB 3TJVA 1O2SA 1QB1A 1C1OA 5DP4A 2A0QB 2ZTXA 8KME2 1TOCB 5CHAB 4AG2A 1GMCG 1KY9A 1WSSH 5JBAS 5EW2H 2FLRH 4X8TH 4H6TA 4DOQA 1FIWA 1K1PA 1MD7A 4K69A 3T29A 2BD7A 3UNSA 1YPEH 2EI7A 3MU4A 5EXMA 1ACBE 1F7ZA 1LCYA 2FI4E 5TCAA 1O32A 1G36A 2OCVB 4A1VA 1CGHA 1GVLA 3QX5H 2BDHA 4ZMAH 9ESTA 2FS8A 2UUKB 3IITA 1RIWB 4U30A 1YPLH 3O8DA 1F5RA 1AQ7A 1BRBE 1O3MA 4AFSA 4TWWA 4I31A 1VCQA 3TJOA 1UTQA 1MKXH 4JZ1A 5GCHG 2V3OH 1SR5C 4DW2U 2OBQA 1FQ3A 3LGUA 2PKSC 3SNEA 5GJ4B 1EP6A 1S6FA 4ISHH 5T6FA 1HNEE 4BANB 5F6MA 1PQ7A 1W0YH 2PKAA 1OYTH 4WY3A 1O3OA 1ZYOA 1TX8A 1P10A 1UCYK 1W14U 4YT7H 1BB0B 2A32A 3K6ZA 3BTME 1O3DA 2SGEE 1O5BB 2Q6FA 1C2JA 4AGKA 2ZC9H 4ISNA 2OQ5A 3HK3B 3RXLA 3RP2A 3SU6A 1O5FH 4NA8A 2BDAA 8GCHF 4X1NU 4XDEA 1BRCE 4ZKNU 3PLKA 1ANEA 2BD2A 2O8LA 2ALVA 4NZQA 1KXCA 1C1NA 2BQ6B 3ODDA 2IJOB 1QB9A 1UTNA 1LVBA 3U1IB 5E8EH 2H5DA 1EB1H 3N7OA 2VNTA 2CJIA 1PPGE 3QO6A 1CA0B 1BZXE 5FPTA 1XUJA 3SOSA 2THFB 1C4Y2 4WJG2 5AFYH 1ORFA 2OC0A 2R3YA 2Q6DA 2WPJS 4KTCA 2ZDAH 2TGTA 3BTDE 3A81A 1W12U 1QRZA 4JK5A 2SNVA 2QAAA 1VR1H 2FX6A 2XC0A 1Z6JH 4B73A 4GUXA 1S0RA 2Z3CA 3RXSA 3TGKE 1Y3YA 2GV6A 2A7HA 2FDAA 4ZHMU 1QL9A 1TABE 3FZZA 3ZYDA 1RGQA 3HKJB 3SN8A 2HVXA 3ITIA 4X8VH 4ZROA 2VB0A 4K1EA 1CU1A 5GCHF 1O35A 4K2YA 4GHTA 3RXRA 3ZZ5A 2A31A 4AZ2B 2BXUH 3MH6A 2PFEA 3MH5A 3P6ZB 2ZZUH 3TLOA 2A2XH 5LPRA 3ATWA 1BMNH 1BOQA 5PTPA 4IGDA 4F49A 2P3UB 1SGCA 1PJPA 3MO3A 1NRNH 1O2NA 1BTXA 4JYTA 3F68H 1O2OA 1XUIA 5A8YA 3FVFB 2IOTA 3LPRA 1PPFE 1DPOA 1Q31A 1C5VA 2CXVA 4ISIH 4DJZB 1TPOA 3MFJA 3UOPA 1K1IA 4OS4A 1LHEH 1RTFB 1P04A 1D6WA 2G4TA 1RTKA 2G52A 1PPEE 1MCTA 1JRSA 4I8JA 3QZRA 4CRGA 4JCNA 1FNIA 1P11E 3RUOA 1LHDH 1OOKB 2J92A 4DIIH 1QCPA 1VJ9U 2KAIB 4FVBA 4AB8A 2PKAB 4MPXA 2ANYA 2OC7A 2JH5D 1MTNC 4YTAA 4UFEH 1W3CA 2UWOA 1T4VH 3LT3A 1DE7H 2Z7FE 1BJVA 2CGAA 3RXMA 1GCTB 1L1JA 3GY4A 2G00A 3NXPA 3URDA 3GYLB 3UTUH 1QJ1B 1C2KA 1D3QB 1O5CB 1A61H 1BDAA 1GMHF 1L4ZA 3EDXB 1GG6B 1DX5M 5FX5A 1AB9C 4TPYA 1TMBH 1BRAA 2SFAA 3RXTA 3UOUA 2WPMS 2XBXA 1MQ5A 2ZA5A 1ABIH 1ZSJA 1DLKB 2O8TA 1DWBH 3GY2A 3ZYEA 2ZHQH 2QV1A 1O31A 4ZH8A 1C5PA 4BAQB 3BV9B 3F9GA 1FONA 3K6YA 3PWCA 1EX3A 1P9UA 2BY9X 4QT8C 4NWKA 1YPHC 1XUGA 3M5LA 1G2MA 3BN9A 3LIWA 5EXLA 3TITA 3TH4H 3MO9A 1O2YA 2ZFSA 3EE0B 4AGJA 5DP8A 3UQVA 1Z1IA 2G5VA 3ZZBA 4OS5A 3NZIA 1C5OH 1K9OE 3GCTG 1OWHA 5T6DA 1D4PB 4FUHA 3JZ1B 4FUCA 3BEFB 1Y3UA 3A80A 2Z9JA 2XXLA 4LK4A 1SL3A 4PROA 1XKAC 1Y5AT 1AFEH 4ABBA 4OS6A 2VIWA 5TCCA 1O2IA 3RXDA 5C1UA 2XBWA 1CT0E 3KQCA 4Y0YE 2STBE 4MG3A 1O30A 5GWZA 3CENA 1J9CH 2FOMB 1D6RA 3OTJE 4D9QA 2XNIA 4FUGA 4ESTE 1C5LH 5T3HA 3TU7H 5E0JA 1SGIB 2YOLA 5HMAA 2HPPH 4CHAB 2Y7ZA 3M7UA 2FM2A 2PWXA 2ZWLH 5JBTA 3ZVAA 2BLWA 5DP5A 1G3EA 2FOHA 4Q7YA 5EXNA 3A8CA 1ZGIA 2Z9GA 4GCHG 2W7SA 1TALA 2VWNA 1TA6A 3HKIB 3TK6A 2WINI 3A7TA 5DK1A 5F8TA 3RMLH 1Q2WA 2B8OH 1UHBA 2SGDE 2BX3A 1UK4A 5FHTA 1BHXB 2BB4A 1IQKA 3ZVFA 2B7DH 1G37A 1D3TB 3MU5A 3M5MA 3A7YA 1TGTA 2I6QA 2ZNKH 2A2QH 2ZGXH 2J2UA 4NA9H 3SUDA 4K3JA 1AKSB 1SOTA 3UWIA 2GZ9A 3QLPH 2GT8A 1P06A 1TX7A 2R9PA 2O8UA 3QWCH 4A5TS 1LQDB 2QF3A 4VGCC 3RXVA 1O2HA 1L1NA 1FI8A 3L3TA 3QN7A 4GLYA 1MAYA 4E05H 1Z6EA 1O3JA 2ZCHP 1HPGA 1GDQA 1LKAA 3BEUA 1V2LT 4NFFA 3BG4C 3P8FA 1N6XA 3UFAA 3GCTF 2OP9A 2A4QA 1GDNA 1GHZA 1P2QA 1O2TA 1GBEA 1GVKB 1SLUB 2UUYA 1MBMA 1AD8H 3T2NA 2ZI2H 2HWLB 4Y8YA 3SZNA 3RXPA 3QK1A 4K5ZA 1WTGH 4IS5A 5DPAA 4OS1A 2OBOA 1NTPA 1BHXF 2H9TH 1K28D 1EAUA 1ZJDA 1EAWA 1F5KU 1BMAA 1TGCA 2ZCLP 1YPGH 1SGTA 1OWDA 4Y71A 1ANCA 2FTMA 2DE8A 1C1UH 2WYGA 4DY7B 1C5WB 3QZQA 2G51A 1UTJA 1OWEA 3I78A 1Y5UT 2XCFA 1BTUA 1YCPH 1EPTC 2CF9H 5F8ZA 5FAHA 1TIOA 2BYAX 3B23B 3PMJA 4FVDA 3ZZCA 3SJIA 2PGBB 4INLA 3SJKA 1ETTH 1GJ5H 3OSYA 3QGJA 1AFQC 2AGIX 2R3UA 2G4UA 3F6UH 3DA9B 1PPCE 2Z6BD 1FAKH 4X6NA 5LGOA 1E37B 2CHAB 5HGGA 1HV7A 5AFZH 2SNWA 1S82A 1O2RA 1CBWC 1UVPA 4MNYA 2JH6D 4CRBA 4YOJA 2BLOA 2QA9E 3NUMA 4J2YB 6CHAB 3PV4A 1OP2A 3ESTA 3E91A 1Z7KA 2ZU4A 1CA8B 3MNCA 1Y59T 2OC8A 1SQAA 1SQTA 3MNXA 1L1GA 3TGJE 2H2ZA 1KYNA 4ZHLU 2PLXA 3KGPA 5F03A 3VGCC 2A5IA 1IQEA 1FMGA 1P09A 1CSOE 1TRMA 2O9QA 1P01A 2BZAA 7KMEH 1HAPH 2D2DA 1GI4A 4ABEA 1ELVA 1KIGH 1C1QA 3UWJH 1A2CH 1O2QA 2XTTB 3DFLA 3LC3A 3AW0A 2AIQA 2FP7B 2R2WU 4ZKSU 1YLDA 5E2OA 2ZDLA 1UHBB 4O03A 2J38A 5DKMA 5A0BA 1XKBC 3VPKA 4NSVA 3D49H 4R0IA 2C8WB 1F5LA 4ABDA 1P03A 4CR5A 2BY6X 1NY22 1ARCA 2B5TB 4GVUA 1GGDB 1ETSH 1O39A 2VH6A 1H8DH 2GCTB 3NPSA 1AN1E 2J4IA 1L2EA 1OYQA 3PTBA 5IDKA 1GHAG 3D65E 3Q00A 4CBNA 2BMGB 4DCDA 1IHTH 4BTIB 2VJ1A 1BJUA 4X6PA 2WPLS 4OS7A 3MWIU 1NU9A 5C2ZA 1FLEE 5A0AE 2F9OA 4AN7A 1V2ST 5DP9A 1GBMA 3A7VA 3KEEA 2WUBA 1BBRE 3A8AA 4Y6DA 5CMXH 5C5NA 3VB3A 1SGQE 1TRNA 1HJAB 2ZCKP 1IQHA 2BD5A 2GGVB 2O8MA 3QTOH 1ANBA 4DVAU 2P16A 1MKWK 1LDTT 4KTUA 1TONA 1ELGA 3ATMA 1EATA 3QUMP 1ID5H 3SJ9A 1GJBB 3SQHE 1VGCB 3SNCA 1J17T 1MTSA 2D8WA 2FZZA 1LPZB 2P8OB 2P94A 4HZHA 5E2PA 3SU2A 1ZTJA 4XBDA 3SV2H 4X2VA 4GSOA 1CVWH 5GDSH 2BLVA 3A83A 2XC5A 1ESAA 1E0FD 1QTFA 2FO9A 4RN6A 3SGQE 4UFDH 1Z1JA 1PQ5A 2F9PA 4CRAA 4B75A 1BTWA 2GMTB 5CHAC 1EJAA 1WQVH 1FDPA 4INKA 4X1RU 1SVPA 1YCPM 1D3DB 1O33A 2QYIA 5E0HA 2Y81A 2ZECA 2TPIZ 5IYTA 3PM3A 2PUQH 2AGEX 3GDSA 3GY3A 1DSTA 3CS7A 1SGYE 3NKKA 1QIXB 3I29A 3HGNA 3GICB 5EOKA 4BAHB 1CQQA 3MU0A 1SBWA 4X1SU 3M3TA 3H7OA 4RSPA 5DP6A 3LOXA 4A92A 1P2JA 1LMWB 1RIWC 2G8TA 4YO9A 3K2UA 3SUEA 3M3VA 3U8RH 2B0FA 1BTPA 1MH0A 1XUFA 4SGBE 4X2WA 3RXJA 1MTUA 1ZHMA 3SQEE 4I8LA 1AUJA 2Q6GA 1AE8H 1C1TA 4U32A 5I46H 1THRH 2ZQ2A 5J4QA 4WWYA 1O2JA 1TNJA 1T31A 1V2TT 1AUTC 1AVGH 4YLUA 1T32A 1LKBA 5A09A 1K2I1 4F4OC 1DANH 2C93B 2KAIA 1DY8A 5AF9H 2GKVE 1UTMA 2NU3E 4Q7XA 2FI3E 2EI6A 3NK8A 1C1VH 1O5EH 1GCDA 4X1QU 4GPGA 4Y11E 3E3TA 4TY6A 3ATLA 2C90B 2V6NA 1EZXC 3SJ8A 1IQNA 1XM1A 1UCYH 4K8YA 3LONA 4WF8A 4UONA 1Q3XA 4H42U 1B0EA 2NU2E 5JB9S 4O9VA 3LGIA 2ZGJA 1DWCH 1X7AC 4ABJA 4ISLA 1UK3A 1EUFA 1HRTH 1FY3A 4MNWA 4KTSA 2EI8A 3ENSB 4IC5A 5HYOA 3SGBE 2FESH 8ESTE 1HJ9A 1B5GH 2PSXA 3LKWA 1DWDH 4DIHH 1CA0C 2BDYA 1GHWH 5EGMA 1TMUH 7GCHG 5K0HA 1QBVH 4BTTB 1XMNB 1GMCF 4O97A 1HCGA 3SNAA 1ZPBA 1NRQH 1O36A 1C2LA 2ASUB 1ZSLA 2VIQA 1A0JA 1UJ1A 4WXIA 3M35A 5DO4H 1JWTA 1IQJA 3E0PB 3P95A 2GD4B 2A1DB 2C8ZB 3LGVA 2ZDVH 2ZFRH 2PHBA 2EC9H 2VH0A 4JZDH 2BQWB 3KN2A 3RC6A 1G3DA 3G01A 1JMOH 3ZVEA 2FX4A 5FCRA 4WMDA 1O2LA 1HIAB 1ELFA 2VIOA 2IPHA 3SUFA 2JKHA 5JDUB 1JBUH 1HUTH 1N1LA 2ZHWH 1T8LA 1C9PA 1QNJA 1OP0A 2PUXB 2A5AA 5C67A 3A85A 3TK5A 3URCA 4XE4A 4ABHA 2H9EH 5BRRE 2Y7XA 3MTYA 3LJOA 1GI6A 2ZP0H 1IQFA 1HYLA 1O3EA 3F9FA 2OXSA 2DE9A 2VVUA 2TIOA 2QXJA 3A88A 1F92A 2OQUA 4CH2B 1SLWB 3EYDA 3DFJA 3O8CA 3SI3H 1DT2A 4BNRA 1B0FA 1LVOA 4MDSA 2ZFQH 5HM9A 2WV5A 1YPHE 1UVSH 1K1JA 1O3GA 4BAOB 4OS2A 1V2RT 1ZHPA 2XCNA 1C1WH 3RMMH 2D26C 1P2IA 4NFEA 1B7XB 4ZXYH 1EOJA 2ANWA 1ANDA 1C5NH 3LDXH 5H4IB 2RA0A 5DP7A 4KP0A 5EW1H 2ODQA 3LJJA 3AAVA 1ZOMA 3MU8A 3A7ZA 3KIDU 3Q3KA 1BTZA 1QR3E 5L6NH 4K1TA 1SB1H 1J8AA 3U69H 1FV9A 2F9BH 3EA9A 2AS9A 3E0NB 1BT7A 3TNSA 1NC6A 4WVPE 1UTKA 1T8MA 2AEIH 4FUIA 5JPMH 1TNLA 3NWUA 3P92A 3GDVA 3RMNH 1P02A 1AKSA 4DT7B 1V2WT 1J16A 1JRTA 2LPRA 1SGRE 7GCHF 2ZF0H 1QBNA 3ELAH 1AVWA 2PV9B 4MQAA 3DT0H 3VEQB 1O2MA 1GCTC 4I8KA 4B2AA 1ZJKA 1TFXA 3Q3YA 3SGAE 2ZTYA 1CGIE 5L2YH 2FS9A 4THNH 4JMYA 3TNTA 1O2GH 3D62A 3UNRA 3QGNB 3RU4E 3TK9A 1S83A 1TPAE 1GG6C 1JOUB 4RKJB 5ESBA 1TMTH 1UO6A 1IQGA 4XSKU 3RLYH 3UQOA 3ZZAA 1XVMA 2UUJB 1O3AA 3MNBA 4Y8XA 1YYY1 3FAOA 5LPFA 4D7FA 1DFPA 3P17H 2BX4A 3VXEH 1AE5A 3LH3A 4ISOA 2FYQA 3MNSA 1DICA 2P3FH 3M5NA 3T27A 2VU8E 1GMDG 1ZPZA 5TJXA 3Q76A 1NFWA 2Z9KA 1C5MD 1V3XA 2YNBA 4MPWA 2A4OA 1SHYA 1P0SH 2QGRA 4ABIA 4XBBA 1A5GH 1C5RA 1QL8A 2A7JA 3BTEE 1C1MA 3KQEA 2VIVA 5DP3A 3M3SA 2UWLA 1SGFG 3MH4A 3DHKH 1JIRA 5JBBS 1KTTB 5C5OA 2UWPA 1GJ9B 3MH7A 1GBTA 5C20A 1QL7A 4NIYA 1CE5A 1RTLA 3WY8A 1Y5BT 1O0DH 1P12E 5B6OA 4X2XA 2BXTH 3LGTA 1EJNA 2A4RA 4UD9H 1EAXA 5FPYA 1O37A 2HPQH 3ZV9A 4CRDA 3L6PA 1O3NA 1P3CA 1YP9A 1ZLRA 3A87A 4E7NA 3A86A 1BMMH 1S81A 4Q80A 1S84A 1DOJA 3VB7A 3VB4A 1GHXH 1SGEE 2BD8A 4D8NA 4NIXA 1GBFA 1TGBA 3ODFA 1UTPA 1NRSH 2TGDA 2K1QA 1HAIH 3PLBA 1GHVH 1Z8RA 3RXEA 2TBSA 1ZPCA 1DITH 3KCGH 1OP8A 1RJXB 2RA3A 4U01A 2XWAA 4FUEA 1HAZB 3LH1A 4GHQA 4LZ4B 3KF2A 3ZZ7A 2GTBA 2CV3A 2ZU1A 4B74A 5EQQA 3RXAA 1IQIA 3RXFA 1NM6A 1C2FA 2FTLE 1SPJA 1TNHA 2XW9A 4CHAC 3A82A 4CREA 1V2VT 1K1OA 2BOHB 1RD3B 6LPRA 3ZZ4A 1FAXA 1XXDA 2NU0E 3B9FH 3SHCH 3SUGA 4CR9A 1AY6H 1OX1A 1S85A 2AYWA 4Y7AA 4UDWH 4NGAH 4JZFH 3SU4A 8LPRA 1A4WH 1NZQH 5A8XA 1C4U2 3NCLA 1Z8IB 2FLBH 1UTLM 1HAVA 1TBRH 1IHSH 1ZTLA 2AFQB 4Q7ZA 1TPPA 1V2MT 4WH6A 1KXDA 2QC2A 1GBAA 1UTOA 1ZGVA 2VGCB 1E35B 2ZKSA 1W10U 1DSUA 1XX9A 3ZV8A 1Y3WA 4DGJA 1NN6A 1KDQA 2HOBA 1F0SA 1GBHA 3RU4D 3FP8E 3PO1B 2DUCA 4JZIA 1O34A 2FI5E 3BIUH 1K1LA 4MLFB 6GCHG 2HRVA 4O3UA 4ZKOU 5JYIA 2OD3B 3AAUA 4E06H 4FU8A 5GIBA 4K60A 2QN5T 1W8BH 1MBQA 1O2ZA 1THSH 2BDIA 3QTVH 1LVYA 1C5ZB 1OWIA 1UVTH 3ATKA 1Z8GA 2ZEBA 1S6HA 1CHGA 1W2KH 4AFZA 3TH3H 2CN0H 4TY7A 3P8NA 2GCHG 2P3TB 2G55A 3FP6E 2WUCA 2GP9B 1GJ6A 5F8XA 3ZZ3A 1PPHE 1J14A 2ZTZA 4I32A 1E38B 3BTQE 5EQSA 4BAMB 3U1JB 3RC5A 1C2GA 1TA2A 1NESE 3VXFH 2HLCA 3Q3XA 5A8ZA 4Q2KA 3IWMA 5L30H 3T25A 1QBOA 2AERH 1HAXB 4J1YA 1MZDA 2W3IA 1S5SA 1JXPA 1QA0A 4FXGH 3RXKA 1C5SA 3F1SB 3Q77A 3E1XB 1AO5A 2BHGA 4IMZA 4KGAA 1O2WA 1BBRK 3PROA 3TVJB 1QURH 1ZMJA 3PTNA 3RC4A 1WYKA 2CHAC 4YZUA 2Y80A 1WBGB 4WMEA 1LHFH 4GCHF 1BITA 1P2KA 1GBDA 1BRUP 1ELEE 2RCEA 4NCYA 1EJMA 6CHAC 1GJCB 2SGQE 1G30B 1MTVA 2JETB 2WYJA 1O3IA 4A1XA 3GY8A 4OGXA 1K22H 4JYUH 2GX4A 1SI5H 3SU3A 2BY5X 1ZHRA 3RDZA 3ZZDA 2XWBI 1PQAA 3TJNA 3SHAH 3S9BA 2VWOA 1A7SA 1P8VC 1JIMA 3MYWA 2XC4A 3S7HB 3R3GB 1RXPA 3M7QA 3CP7A 2FMJA 3GCHB 2Y5HA 1BTHH 1H9IE 1RS0A 2D1JA 3P8OA 1AZ8A 1TQ7B 1GI8B 3SO3A 3UREA 1TBZH 1LVMA 1TX6A 1SMFE 1LTOA 4WH8A 6GCHF 2FXRA 1Y3VA 1MTWA 1O5DH 4HI3A 3HPTB 4R8TB 1HAVB 1SGDE 1YPKH 3UPEA 3ZZ6A 1WTHD 1LHCH 1DS2E 2FPZA 2GT7A 4YM9A 3F9EA 2ZG0H 3U98H 1FZZA 1GBKA 1DY9A 1OWJA 4NIVA 1EXFA 1GGDC 1DWEH 2GCTC 3SNDA 4H4FA 3S0NA 4I33A 1HJ8A 2GDEH 1TE0A 2ANKH 4Y7BA 1AU8A 4BXWA 1HDTH 1KDQB 4CBOA 1A5HA 5I25A 3MOCA 3BTKE 4I7YH 2V0BA 1E36B 1OPHB 3LC5A 4BXSA 4AOQA 2R0LA 4NG9H 1TRYA 1V2OT 2HNTF 3PWBA 2AH4X 4OGYA 3JZ2B 4X8SH 5BPEA 1YC0A
chains in the Genus database with same CATH superfamily
4ZAEA 1TQ0B 1OWKA 1ZMLA 2ZHDA 1S0QA 1P2NA 1HJAC 4IMQA 2L6OA 2VVCA 2ZGBH 2VBCA 4DG4A 2AMPA 3RXQA 1FY4A 4MTBA 1P3EA 5GPIB 4B76A 1BQYA 1VGCC 1DDJA 4MNXA 1C5YB 5FX6A 1EQ9A 3SU0A 1GJ8B 1TAWA 1NPMA 3R0FA 1GJ7B 3S9CA 2F3CE 2P8OC 1V2QT 3BTHE 1C1SA 1MKWH 3HK6B 1V6DA 3VFEA 1HIAA 1F0TA 1LHGH 1RRKA 2OTVA 2OLGA 3BTTE 2R2MB 2FOFA 4NIWA 2WPIS 3A8DA 1O38A 1P57B 3LU9B 4Y79A 4K8BA 2GMTC 1ARBA 2A45B 4RI0A 4UFGH 1SSXA 2FOCA 3KNXA 3SW2B 1O2KA 4X8UH 3FANA 3V0XA 3IG6B 1H9LB 2AGGX 4TSFD 3I77A 1A3EH 1FN6A 3A8BA 1KXFA 4AORA 1K0HA 1IAUA 2WPHS 5FBIA 2F9UA 3RM2H 3STJA 2ZDNA 1H8HD 1WAYB 1AVXA 1AWFH 3K9XB 3V13A 3AW1A 3PMHB 1SFQB 3K65B 2ZU3A 4Y10E 3GS9A 3W1EA 1VITH 3OEHD 3HATH 1ZZZA 2VIDA 1C4V2 1GHBG 1NU7B 1YBWA 1RFNA 2SGAA 1MUEB 1WOFA 2ZQ1A 3UIRA 1O3KA 4AX9H 4CRFA 2OC1A 1INCA 1AI8H 2QXIA 2ZPSA 1LO6A 1T8NA 1C1PA 1V2PT 5FXLA 1HXFH 1SGPE 1SHHB 2ZFPH 1GHYH 3UY9A 3W94A 1CT2E 5AHGH 1GHAF 1MKXK 2UUFB 5J4SA 3VG8A 3BTGE 1YPJH 4ZKRU 5T6GA 1K1NA 1QJ6B 2F43B 5B6LA 1YGCH 1DXPA 2K0QA 2C3SA 1CO7E 1W0JD 1ZSKA 1EOLA 1IQLA 4ZUHA 3F2GA 4LXBH 2BOKA 3M7TA 2PKSB 3TJUA 2F9NA 1TGNA 1IQMA 1QRWA 4XBCA 4ZHAA 2VVVA 3F0PA 3BEIB 2BVRH 5C3NA 2Z94A 2ZPRA 1DXWA 1AWHB 2J95A 3T62A 4Q63A 1H4WA 1QGFA 1YM0A 1QB6A 3O8BA 3V12A 2WV9A 1TGSZ 1V2UT 2Z3DA 2WPDD 3SU5A 1Z71A 2QF0A 2GDDA 3RM0H 1TNIA 4KKDA 2O8WA 3RU4T 1M9UA 2FOEA 1F0RA 2BD3A 3MI4A 4WMFA 3BSQA 2IN2A 3U8OH 4B1TA 1GBCA 1W0KD 2Z9IA 1WU1A 1V2NT 3E6PH 2ILNA 1L0ZA 3GCNA 3KHVA 1NRRH 2JDID 1G2LA 1MU8B 2Y82A 2FYRA 3D23A 1O2UA 3RXBA 1GI0A 3ZVGA 1W13U 2V35A 2FIRH 2EQNA 1ELCA 1UMAH 4AYVB 5DGJA 3PYHA 3T26A 2G5NA 1TNKA 2BVSH 1NFYA 4ASHA 1K1MA 2ODPA 2Y5GA 1L4DA 1G3BA 1NRPH 2XBVA 2M5TA 1QY6A 3A84A 3ZVCA 1F2SE 1PYTC 1QFKH 3LGYA 3BG8A 1GHBF 3EAJA 1W0ZU 2ZO3H 1GMHG 4D76A 4HGCA 2BDBA 1FY5A 4IW4E 1T4UH 1ZR0A 4F48B 1ETRH 5ESTE 2BDCA 2J94A 3GCOA 2QXHA 2M2AA 2ZHFH 2Z3EA 3MHWU 2STAE 2HVYB 3OY6U 1XUKA 1GWAA 3A89A 1VITG 2TRMA 1VJAU 2ALPA 1GL1A 1A46H 4A1TA 1SLXB 1FPCH 1O2PA 3GDUA 2A4GA 2ZFTA 3UNQA 1WV7H 3AVZA 1SGFA 2OINA 4INHA 2B9LA 3SV8A 4FUJA 4X6MA 2VWLA 3SV6A 1UCYE 1A3BH 3SYJA 1FXYA 3ZVBA 4E7RG 3UR6A 1A0LA 1C5TA 2XOKD 4H6SB 1OS8A 1G32B 4X1PU 3P70B 3M61U 1PYTD 1O2XA 3AASA 2Y5FA 4YOIA 1H8IH 1MQ6A 4Z6AH 2W5EA 1U6QA 4D7GA 1PPBH 4TT3D 4ZXXH 2GZ7A 2CK3D 1ABJH 3CS0A 1HAYB 5HIZA 2PR3A 1NROH 1VCWA 1BA8B 4CH8B 2BTCE 1EP5A 2FOGA 1ZTKA 3RXOA 1XXFA 4NWLA 1NFXA 3FFGA 1GI1A 1EZQA 1H9HE 1TYNA 5EQRA 1O3BA 5K7RA 1MABB 1TBQH 2FEQH 1HAHH 4IN1A 1DLEA 3GISB 2F83A 1BUIA 4WXVA 4YLQH 3RXIA 2OUAA 2TGAA 1KSNA 1EKBB 1ELTA 3E16B 3PLPA 3SNBA 1W11U 1MTNB 5EU8A 1O3CA 4AYYB 2H6MA 1YF4A 1GBJA 2BD4A 4IC6A 1TOMH 5ABWA 1W7XH 5L2ZH 1SLVB 5HXFA 4JYVH 4I8HA 4FU9A 2SGPE 2PTNA 1C2DA 5EG4A 7ESTE 1SC8U 4A6LA 2CF8H 2YNAA 4IBLH 1SOZA 3KQBA 3T5FH 1AB9B 3S7KB 2W26A 3EQ0H 1D9IA 2RG3A 2QXGA 2TGPZ 2GV7A 3RXGA 1BCUH 3VB5A 1SGNE 3RXHA 2RDLA 3B8JA 4Y8ZA 1UVOA 1TLDA 1VITF 2AMDA 2JJ1D 5FPSA 5DJ7A 3TIUA 4YOGA 4SGAE 1GBLA 1GJDB 2HLDD 2QF4A 5LH8A 3VB6A 1GI5A 1SFIA 1P9SA 4HFPB 4NZLA 1HFDA 5C1YA 1C2EA 4D9RA 1GPZA 4NSYA 2R0KA 1MCVA 2FOBA 3PB1E 4X6OA 3OEED 1EPTA 2A7CA 1P2MA 2JIZD 3OU0A 5C1XA 1MD8A 1YPMH 3S69A 3STIA 5LPEA 2HGTH 1FX0B 1QRXA 3FZDA 1ESTA 3BTFE 1HGTH 3E8LA 4AG1A 3FO8D 1D3PB 4B2BA 2ZDMA 3MO6A 2V3HH 2J34A 1MZAA 1FPHH 4XOJA 7LPRA 1TPSA 1P05A 4TWYA 3MU1A 1E34B 1O3LA 3GY7A 1KXEA 1VZQH 5KECA 4ABAA 5HM2A 1G3CA 4GAWA 1LQEA 3KYFA 1ZRBA 1NT1A 2FOAA 4BAKB 1Y8TA 3OYPA 5DSFA 2Z9LA 4CRCA 3UR9A 3V3MA 1A1RA 2ZIQH 2LNCA 3SORA 5AVDA 3EA7A 2W3KA 1KLTA 2QIQA 3GY5A 2HALA 5GXPA 1T8OA 1AGJA 4BTUB 2P95A 1KTSB 4LZ1H 1GJAB 1PFXC 4Y76A 2C8YB 1O3FA 2NU1E 5G4BA 2ZPQA 1IOEA 2WV4A 3F9HA 1BIOA 3N7DA 1C5QA 1QHRB 1Z8JB 3E90B 3SV9A 1UVUH 1AIXH 1QA7A 2BDGA 3H7TA 5ETXA 3W95A 3A7XA 3RMOH 1FN8A 2VGCC 4ABGA 1T7CA 1O3PB 2WZQA 1C2IA 2BD9A 3BIVH 1HXEH 4YT6H 1GMDF 2BY7X 3M37A 4MPUA 1W7GH 2FWWA 3PO1C 3OY5U 3P8GA 1ZRKA 4JK6A 4X2YA 4U2WA 3L33A 1TB6H 2W7UA 1ELAA 3DUXH 2ESTE 2XYAA 1EASA 1FIZA 4X0WU 4HTCH 3MMGA 3CNRA 4KELA 1NS3A 3EA8A 3M36A 1MAXA 1GDUA 2HNTE 1WUNH 1C2MA 4RKOB 2ZHEH 1ELBA 2PSYA 4FUDA 4VGCB 2BQ7B 1F0UA 2GZ8A 1HBTH 1CGJE 1SG8B 1PPZA 1CHOG 1EAIA 1EZUC 3KQDA 5JB8S 1VCPA 2XBYA 3SI4H 2ZU2A 4AFQA 3DCLA 1O5GH 2ZU5A 4LOYH 2GVFA 2PW8H 1AZZA 5EPNA 3BG4B 1HAOH 1V2JT 3GY6A 5C0UA 1O3HA 1O2VA 4YESB 1WQSA 1UK2A 1QQ4A 1KXAA 4P00A 3U8TH 4MVNA 3H5CB 4AB9A 3C1KA 1AHTH 1NO9H 4FETA 1ELDE 2VIPA 1KXBA 2EEKA 2PTCE 3BF6H 2NWNA 1WCZA 1KLJH 3ATIA 2FODA 2G81E 3QDZB 1DUAA 1GI2A 2ZGHA 1YCPK 1HAGE 3BTWE 3A7WA 2QCYA 2C8XB 1GJ4H 1A0HB 5E0GA 3HGPA 2JH0D 1YKTA 1FJSA 3SV7A 4O3TA 2BM2A 2F91A 4UFFH 1SQOA 5A2MH 1EPTB 1MMJN 3DD2H 3C27B 4NA7A 4DURA 1BBRH 1PQ8A 1QZ8A 1ESBA 2JETC 2L74A 3EGKH 3RLWH 1G9IE 5FCKA 5CHBA 2CMYA 1HB0B 1C2HA 4ACAA 1AFQB 2QY0B 4MNVA 2Y6TA 4B2CA 4Z0KA 1K21H 1C5XB 3FP7E 1AMHA 4BOHA 1CBWB 2I6SA 2H1UA 3RXUA 2HNTC 2H9HA 1EZSC 1KLIH 1P2OA 1C1RA 1GL0E 1OSSA 3GCHC 1DVAH 2WPKS 3M5OA 3TPIZ 2PGQB 2XRCA 1THPB 1GI9B 3UUZA 3F2FA 3O8RA 4A7IB 1ZMNA 3S9AA 3VGCB 4FU7A 4XFQA 2BY8X 2ZDKA 1N8OC 1N8OB 1XVOA 1OXGA 4UEHH 2ANMH 3PMAB 4IN2A 1FY8E 2ODYB 1FUJA 1YLCA 1GI3A 1N6YA 1EB2A 1CHOF 1CT4E 5CE1A 2NU4E 2BLQA 4UE7H 1BMLA 1LPKB 2ZFFH 5KGOA 1GI7B 3V7TA 2GCHF 1A5IA 1J15A 1Y3XA 1VKYA 4MPVA 3PV2A 4ABFA 3KL6A 3TH2H 1DUEA 1QJ7B 4AFUA 2BZ6H 2LELA 2VWMA 1COWD 5EPYA 3ZZ8A 3LGWA 1O5AB 4TPIZ 4FUFA 3TGIE 1V2KT 3SJOA 1NFUA 2EA3A 3OX7U 1MU6B 2KCYA 4FUBA 1FY1A 4I8GA 1OKXA 4JZEH 3GYMA 5SGAE 1LPGB 1DM4B 1GVZA 1QQUA 1SQRA 5EODA 5DG6A 1C5UA 3DSPA 3F0OA 2F9VA 5FBEA 1TNGA 2ZGCA 3SU1A 2A5KA 2ULLA 2C4FH 2P93A 1BTYA 1GBBA 3PMBB 3U9AH 3ZVDA 4K1SA 6ESTA 2KZ4A 1HLTH 1H1BA 1TWXB 5JBCS 1GBIA 3RXCA 2BVXH 4B71A 8GCHG 2P59A 2Q1JA 9LPRA 3SBKA 5A0CA 2AIPA 3T28A 1S6LA 4M7GA 2XNDD 4Y0ZE 4TYDA 2H5CA 1XUHA 2SGFE 2J9NA 2AMQA 2VINA 3ZZ9A 1C9TA 3GOVB 3TJVA 1O2SA 1QB1A 1C1OA 5DP4A 2A0QB 2ZTXA 8KME2 1TOCB 5CHAB 4AG2A 1GMCG 1KY9A 1WSSH 5JBAS 5EW2H 2FLRH 4X8TH 4H6TA 4DOQA 1FIWA 1K1PA 1MD7A 4K69A 3T29A 2BD7A 3UNSA 3WWFA 1YPEH 2EI7A 3MU4A 5EXMA 1ACBE 1F7ZA 1LCYA 2FI4E 5TCAA 1O32A 1G36A 5CDFE 2OCVB 4A1VA 1CGHA 2J97A 3KQ5A 1GVLA 3QX5H 2BDHA 4ZMAH 9ESTA 2FS8A 2UUKB 3IITA 1RIWB 4U30A 1YPLH 3O8DA 1F5RA 1AQ7A 1BRBE 1O3MA 4AFSA 1YLNA 4TWWA 4I31A 1VCQA 3TJOA 1UTQA 1MKXH 4JZ1A 5GCHG 2V3OH 1SR5C 4DW2U 2OBQA 1FQ3A 3LGUA 2PKSC 3SNEA 5GJ4B 1EP6A 1S6FA 4ISHH 5T6FA 1HNEE 5F53A 4BANB 3F3BA 5F6MA 1PQ7A 1W0YH 2PKAA 1OYTH 4WY3A 1O3OA 1ZYOA 1TX8A 1P10A 1UCYK 1W14U 4YT7H 1BB0B 2A32A 3K6ZA 3BTME 1O3DA 2SGEE 1O5BB 2Q6FA 1C2JA 4AGKA 2ZC9H 4ISNA 2OQ5A 4XRNA 3HK3B 3RXLA 3RP2A 3SU6A 1O5FH 4NA8A 2BDAA 8GCHF 4X1NU 4XDEA 1BRCE 4ZKNU 3PLKA 2RFKC 1ANEA 2BD2A 2O8LA 3DSGA 2ALVA 4NZQA 1KXCA 1C1NA 2BQ6B 3ODDA 2IJOB 1QB9A 1UTNA 1LVBA 3U1IB 5E8EH 2H5DA 1EB1H 3N7OA 2VNTA 2CJIA 5EIYA 1PPGE 3QO6A 1CA0B 1BZXE 5FPTA 1XUJA 3SOSA 2THFB 1EFRD 1C4Y2 1E1RD 4WJG2 5AFYH 1ORFA 2OC0A 2R3YA 3H09A 2Q6DA 2WPJS 4KTCA 2ZDAH 2TGTA 3BTDE 3A81A 1W12U 1QRZA 4JK5A 2SNVA 2QAAA 1VR1H 2FX6A 2XC0A 1Z6JH 4B73A 4GUXA 2OK5A 1S0RA 2Z3CA 3RXSA 3FKSD 3TGKE 1Y3YA 2GV6A 2A7HA 2FDAA 4ZHMU 1QL9A 1TABE 3FZZA 3ZYDA 1RGQA 3HKJB 3SN8A 2HVXA 3ITIA 4X8VH 4ZROA 2VB0A 4K1EA 1CU1A 5GCHF 1O35A 4K2YA 4GHTA 3RXRA 3ZZ5A 2A31A 4AZ2B 2BXUH 3MH6A 2PFEA 3MH5A 3P6ZB 2ZZUH 3TLOA 2A2XH 5LPRA 3ATWA 1BMNH 1BOQA 5PTPA 4IGDA 4F49A 2P3UB 1SGCA 1PJPA 3MO3A 1NRNH 1O2NA 2AHME 1BTXA 4JYTA 3F68H 1O2OA 1XUIA 5A8YA 3FVFB 2IOTA 3LPRA 1PPFE 1DPOA 1Q31A 1C5VA 2CXVA 4ISIH 4DJZB 1TPOA 3MFJA 3UOPA 1K1IA 4OS4A 1LHEH 1RTFB 1P04A 1D6WA 2G4TA 1RTKA 2G52A 1PPEE 1MCTA 1JRSA 4I8JA 3QZRA 4CRGA 4JCNA 1FNIA 1P11E 3RUOA 1LHDH 1OOKB 4RT0A 2J92A 4DIIH 1QCPA 1VJ9U 2KAIB 4FVBA 4AB8A 2W6JD 2PKAB 4MPXA 1OHHD 2ANYA 2JH5D 2OC7A 1MTNC 4YTAA 4UFEH 1W3CA 2UWOA 1T4VH 3LT3A 1DE7H 2Z7FE 1UW7A 1BJVA 2CGAA 3RXMA 1GCTB 1L1JA 3GY4A 2G00A 3NXPA 2KCOA 3URDA 3GYLB 3UTUH 1QJ1B 1C2KA 1D3QB 2KX4A 1O5CB 1A61H 1BDAA 5C94A 1GMHF 1L4ZA 3EDXB 1GG6B 1DX5M 5FX5A 1AB9C 4TPYA 1TMBH 1BRAA 2SFAA 3RXTA 3UOUA 2WPMS 2XBXA 1MQ5A 2ZA5A 2YMSB 1ABIH 1ZSJA 1DLKB 2O8TA 1DWBH 3GY2A 3ZYEA 2ZHQH 2QV1A 3ZIAD 1O31A 4ZH8A 1C5PA 4BAQB 3BV9B 3F9GA 1FONA 3K6YA 3PWCA 1EX3A 1P9UA 2BY9X 4QT8C 4NWKA 1YPHC 1XUGA 3M5LA 1G2MA 3BN9A 3LIWA 5EXLA 3TITA 3TH4H 2GJGA 3MO9A 1O2YA 2ZFSA 3EE0B 4AGJA 5DP8A 3UQVA 1Z1IA 2G5VA 3ZZBA 4OS5A 3NZIA 1C5OH 1K9OE 3GCTG 1OWHA 5T6DA 1D4PB 4FUHA 2KCAA 3JZ1B 4FUCA 3BEFB 1Y3UA 3A80A 2Z9JA 2XXLA 4LK4A 1SL3A 4PROA 1SKYE 1XKAC 1Y5AT 1AFEH 4ABBA 4OS6A 2VIWA 5TCCA 1O2IA 2J98A 3RXDA 5C1UA 2XBWA 1CT0E 3KQCA 4Y0YE 2STBE 4MG3A 1O30A 5GWZA 3CENA 1J9CH 2FOMB 1D6RA 3OTJE 4D9QA 2XNIA 4FUGA 3SZEA 4ESTE 1C5LH 5T3HA 3TU7H 5E0JA 1SGIB 2LP6A 2YOLA 5HMAA 2HPPH 4CHAB 4M9FA 2Y7ZA 2F4LA 3M7UA 2FM2A 2PWXA 2ZWLH 5JBTA 3ZVAA 2BLWA 5DP5A 1G3EA 2FOHA 4Q7YA 5EXNA 3A8CA 1ZGIA 2Z9GA 4GCHG 2W7SA 1TALA 2VWNA 1TA6A 3HKIB 3TK6A 2WINI 3A7TA 5DK1A 5F8TA 3RMLH 1Q2WA 2B8OH 1UHBA 2SGDE 2BX3A 1UK4A 5FHTA 1BHXB 2BB4A 1IQKA 3ZVFA 2B7DH 1G37A 1D3TB 3MU5A 3M5MA 3A7YA 1TGTA 2I6QA 2ZNKH 2A2QH 2ZGXH 2J2UA 4NA9H 3SUDA 4XD7D 4K3JA 1AKSB 1SOTA 3UWIA 2GZ9A 3QLPH 2GT8A 1P06A 1TX7A 2R9PA 2O8UA 3QWCH 4A5TS 1E1QD 1LQDB 2QF3A 4VGCC 3RXVA 1O2HA 1L1NA 1FI8A 3L3TA 3QN7A 4GLYA 1MAYA 4E05H 1Z6EA 1O3JA 2ZCHP 1HPGA 1GDQA 1LKAA 3BEUA 1V2LT 4NFFA 3MQKC 3BG4C 3P8FA 1N6XA 3UFAA 3GCTF 5C0TA 2OP9A 2A4QA 1GDNA 1GHZA 1P2QA 1O2TA 1GBEA 1GVKB 1SLUB 2UUYA 1MBMA 1AD8H 3T2NA 2ZI2H 5EJ1A 2HWLB 4Y8YA 3SZNA 3RXPA 3QK1A 4K5ZA 1WTGH 4IS5A 5DN6D 5DPAA 4OS1A 2OBOA 1NTPA 1BHXF 2H9TH 1K28D 1EAUA 1ZJDA 1EAWA 1F5KU 1BMAA 1TGCA 4P02A 2ZCLP 1YPGH 1SGTA 1OWDA 4Y71A 1ANCA 2FTMA 2DE8A 2QF5A 1C1UH 2WYGA 4DY7B 1C5WB 3QZQA 2G51A 1UTJA 1OWEA 3I78A 1Y5UT 2XCFA 3OE7D 1BTUA 1YCPH 1EPTC 2CF9H 4OM9A 5F8ZA 5FAHA 1TIOA 2BYAX 3B23B 3PMJA 3N99A 4FVDA 3ZZCA 3SJIA 2PGBB 5FL7D 4INLA 3SJKA 1ETTH 1GJ5H 3OSYA 3QGJA 1AFQC 2AGIX 2R3UA 2G4UA 3F6UH 3DA9B 1PPCE 2Z6BD 4YXWD 1FAKH 4X6NA 5LGOA 1E37B 2CHAB 2J98B 5HGGA 1HV7A 2KFWA 5AFZH 2SNWA 1S82A 1O2RA 1CBWC 1UVPA 4MNYA 2JH6D 4CRBA 4YOJA 2BLOA 2QA9E 3NUMA 4J2YB 6CHAB 3PV4A 1OP2A 3WWBA 4ASUD 3ESTA 3E91A 1Z7KA 2ZU4A 1CA8B 3MNCA 1Y59T 2OC8A 1SQAA 1SQTA 3MNXA 1L1GA 3TGJE 2H2ZA 1KYNA 4ZHLU 2PLXA 3KGPA 5F03A 3VGCC 2A5IA 1IQEA 1FMGA 1P09A 1CSOE 1TRMA 2O9QA 1P01A 2BZAA 7KMEH 1HAPH 2D2DA 2KR7A 1GI4A 4ABEA 3U28C 1ELVA 1KIGH 1C1QA 3UWJH 1A2CH 1O2QA 2XTTB 3DFLA 3LC3A 2K8IA 3AW0A 2AIQA 2FP7B 2R2WU 4ZKSU 1YLDA 5E2OA 2ZDLA 1UHBB 4O03A 2J38A 5DKMA 5A0BA 1XKBC 3VPKA 4NSVA 3D49H 4R0IA 2C8WB 1F5LA 4ABDA 1P03A 4CR5A 2BY6X 1NY22 1ARCA 2B5TB 3PRDA 4GVUA 1GGDB 1ETSH 1O39A 2VH6A 1H8DH 2GCTB 3NPSA 1AN1E 2J4IA 1L2EA 1OYQA 3PTBA 5IDKA 3UB0A 1GHAG 3D65E 3Q00A 4CBNA 2BMGB 4DCDA 1IHTH 4BTIB 2VJ1A 1BJUA 4X6PA 2WPLS 4OS7A 3MWIU 1NU9A 5C2ZA 1FLEE 5A0AE 2F9OA 4AN7A 1V2ST 2EY4C 1GBMA 3A7VA 5DP9A 3KEEA 2WUBA 1BBRE 3A8AA 4Y6DA 5CMXH 5C5NA 3VB3A 1SGQE 1TRNA 3OAAD 1HJAB 2ZCKP 1IQHA 3PRBA 2BD5A 2GGVB 2O8MA 3QTOH 1ANBA 4DVAU 2P16A 1MKWK 1LDTT 4KTUA 1TONA 1ELGA 3ATMA 1EATA 3QUMP 1ID5H 3SJ9A 1GJBB 3SQHE 1VGCB 3SNCA 1J17T 1MTSA 2D8WA 2FZZA 1LPZB 2P8OB 2P94A 4HZHA 5E2PA 3SU2A 1ZTJA 4XBDA 3SV2H 4X2VA 4GSOA 1CVWH 5GDSH 2BLVA 3A83A 2XC5A 1ESAA 1E0FD 1QTFA 2FO9A 4RN6A 3SGQE 4UFDH 1Z1JA 1PQ5A 2F9PA 1E79D 4CRAA 4B75A 1BTWA 2GMTB 5CHAC 1EJAA 1WQVH 1FDPA 4INKA 4X1RU 1SVPA 1YCPM 1D3DB 1O33A 2IPQX 2QYIA 3N7EA 5E0HA 2Y81A 2ZECA 2TPIZ 5IYTA 3PM3A 2PUQH 2AGEX 3GDSA 2J5UA 3GY3A 1DSTA 3CS7A 1SGYE 3NKKA 1QIXB 3I29A 3HGNA 3GICB 5EOKA 4BAHB 1CQQA 3MU0A 1SBWA 4X1SU 3M3TA 3H7OA 4RSPA 5DP6A 3LOXA 4A92A 1P2JA 1LMWB 1RIWC 4ZCNA 2G8TA 4YO9A 3K2UA 3SUEA 3M3VA 3U8RH 2B0FA 1BTPA 1MH0A 1XUFA 4SGBE 4X2WA 3RXJA 1MTUA 1ZHMA 3SQEE 4I8LA 1AUJA 2Q6GA 1AE8H 1C1TA 4U32A 5I46H 1THRH 2ZQ2A 5J4QA 4WWYA 1O2JA 5HKKD 1TNJA 1T31A 1V2TT 1AUTC 1AVGH 4YLUA 1T32A 1LKBA 5A09A 1K2I1 4F4OC 1DANH 2C93B 2KAIA 1DY8A 5AF9H 2GKVE 1UTMA 2NU3E 1YWUA 4Q7XA 2FI3E 2EI6A 4ACBA 3NK8A 1C1VH 1O5EH 1GCDA 4X1QU 4GPGA 3AK5A 4Y11E 3E3TA 4TY6A 3ATLA 2C90B 2V6NA 1EZXC 3SJ8A 1IQNA 1XM1A 1UCYH 4K8YA 3UAIC 3LONA 4WF8A 4UONA 1Q3XA 4H42U 1B0EA 2NU2E 2V3MA 4O9VA 3LGIA 5JB9S 2ZGJA 1DWCH 1X7AC 4ABJA 4ISLA 1UK3A 1EUFA 1HRTH 1FY3A 4MNWA 4KTSA 2EI8A 3ENSB 4IC5A 5EJLA 3SGBE 5HYOA 2FESH 8ESTE 1HJ9A 1B5GH 2PSXA 3LKWA 1DWDH 4DIHH 1CA0C 2BDYA 1GHWH 5EGMA 1TMUH 7GCHG 5K0HA 1QBVH 4BTTB 1XMNB 1BMFD 1GMCF 4O97A 1HCGA 3SNAA 2QE7D 1ZPBA 1NRQH 1O36A 1C2LA 2ASUB 1ZSLA 2VIQA 1A0JA 1UJ1A 4WXIA 3M35A 4AC9A 5DO4H 1JWTA 1IQJA 3E0PB 3P95A 2GD4B 2A1DB 2C8ZB 3LGVA 2ZDVH 2ZFRH 2PHBA 2EC9H 2VH0A 4JZDH 2BQWB 3KN2A 3RC6A 1G3DA 3G01A 1JMOH 3ZVEA 2FX4A 5FCRA 4WMDA 1O2LA 1HIAB 1ELFA 2VIOA 2IPHA 3SUFA 2JKHA 5JDUB 1JBUH 1HUTH 1N1LA 2ZHWH 1T8LA 1C9PA 1QNJA 1OP0A 2PUXB 2A5AA 2PP6A 5C67A 3A85A 3TK5A 3URCA 4XE4A 4ABHA 2H9EH 5BRRE 2Y7XA 3MTYA 4F55A 3LJOA 1GI6A 2ZP0H 1IQFA 1HYLA 1O3EA 3F9FA 3EE7A 2OXSA 2DE9A 2VVUA 2TIOA 2QXJA 4I86A 3A88A 1F92A 2OQUA 4CH2B 1SLWB 3EYDA 3DFJA 3O8CA 3SI3H 1DT2A 4BNRA 1B0FA 1LVOA 4MDSA 5GNDA 2ZFQH 5HM9A 2WV5A 1YPHE 1UVSH 1K1JA 1O3GA 4BAOB 2W6ID 4OS2A 1V2RT 1ZHPA 2XCNA 1C1WH 3RMMH 2D26C 1P2IA 4NFEA 1B7XB 4ZXYH 1EOJA 2ANWA 5HIYA 1ANDA 1C5NH 3LDXH 5H4IB 2RA0A 5DP7A 4KP0A 5EW1H 2ODQA 3LJJA 3AAVA 1ZOMA 3MU8A 3A7ZA 3WW7A 3KIDU 3Q3KA 1BTZA 1QR3E 5L6NH 4K1TA 1SB1H 1J8AA 3U69H 1FV9A 2F9BH 3EA9A 3F2HA 2AS9A 3E0NB 1BT7A 3TNSA 1NC6A 4WVPE 1UTKA 1T8MA 2AEIH 4FUIA 5JPMH 1TNLA 3NWUA 3P92A 3GDVA 3RMNH 1P02A 1AKSA 4DT7B 1V2WT 1J16A 1JRTA 2LPRA 1SGRE 7GCHF 2ZF0H 1QBNA 3ELAH 1AVWA 2PV9B 4MQAA 3DT0H 3VEQB 1O2MA 1GCTC 4I8KA 4B2AA 1ZJKA 1TFXA 3Q3YA 3SGAE 2ZTYA 1CGIE 5L2YH 2FS9A 4THNH 4JMYA 3TNTA 1O2GH 3D62A 3UNRA 3QGNB 3RU4E 3TK9A 1S83A 1TPAE 1KMHB 1GG6C 1JOUB 4RKJB 5ESBA 1TMTH 1UO6A 1IQGA 4XSKU 3RLYH 2YMSC 3UQOA 1XVMA 3ZZAA 2UUJB 1O3AA 3MNBA 4Y8XA 1YYY1 3FAOA 5LPFA 4D7FA 1DFPA 3P17H 2BX4A 3VXEH 1AE5A 5T1VA 3LH3A 5IK2D 1WDIA 4ISOA 2FYQA 3MNSA 1DICA 2P3FH 3M5NA 3OTPA 3T27A 2VU8E 1GMDG 1ZPZA 5TJXA 3Q76A 1NFWA 2Z9KA 1C5MD 1V3XA 3FOAA 2YNBA 4MPWA 2A4OA 1SHYA 1P0SH 2QGRA 4ABIA 4XBBA 3OFND 1A5GH 1C5RA 1QL8A 2A7JA 3BTEE 1C1MA 3KQEA 2VIVA 5DP3A 3M3SA 2UWLA 1SGFG 3MH4A 3DHKH 1JIRA 5JBBS 1KTTB 5C5OA 3PV5A 2UWPA 1GJ9B 3MH7A 1GBTA 5C20A 1QL7A 4NIYA 1CE5A 1RTLA 3WY8A 1Y5BT 1O0DH 1P12E 5B6OA 4X2XA 2BXTH 3LGTA 1EJNA 2A4RA 4UD9H 1EAXA 3FN8A 5FPYA 1O37A 2HPQH 3ZV9A 4CRDA 3L6PA 1O3NA 4Z1MD 1P3CA 1YP9A 1ZLRA 3A87A 4E7NA 3A86A 1BMMH 1S81A 4Q80A 4FOUC 1S84A 1DOJA 2YMSD 3VB7A 3VB4A 1GHXH 1SGEE 2BD8A 4D8NA 4NIXA 1GBFA 1TGBA 3ODFA 1UTPA 1NRSH 2TGDA 2K1QA 4DT4A 1HAIH 3PLBA 1GHVH 1Z8RA 3RXEA 2TBSA 1ZPCA 1DITH 3KCGH 1OP8A 1RJXB 2RA3A 4RT1A 2XWAA 4FUEA 4U01A 1HAZB 3NRLA 3LH1A 4GHQA 4LZ4B 2KCPA 3KF2A 3ZZ7A 2GTBA 2CV3A 2ZU1A 4B74A 5EQQA 3RXAA 1IQIA 3RXFA 1NM6A 1C2FA 2FTLE 1SPJA 1TNHA 2XW9A 4CHAC 3A82A 4CREA 1V2VT 3DSOA 1K1OA 2BOHB 1RD3B 6LPRA 3ZZ4A 1FAXA 1XXDA 2NU0E 3B9FH 3SHCH 3SUGA 4CR9A 1AY6H 1OX1A 1S85A 1NBME 2AYWA 4UDWH 4Y7AA 4NGAH 4JZFH 3SU4A 8LPRA 1A4WH 1NZQH 5A8XA 1C4U2 3NCLA 1Z8IB 4Q4LA 2FLBH 1UTLM 1HAVA 1TBRH 1IHSH 1ZTLA 2AFQB 4Q7ZA 1TPPA 1V2MT 4WH6A 1KXDA 2QC2A 1GBAA 1UTOA 1ZGVA 2VGCB 1E35B 2ZKSA 1W10U 1DSUA 1XX9A 3ZV8A 1Y3WA 4DGJA 1NN6A 1KDQA 2HOBA 1F0SA 1GBHA 3RU4D 3FP8E 3PO1B 2DUCA 4JZIA 1O34A 2FI5E 3BIUH 1K1LA 4MLFB 6GCHG 2HRVA 4O3UA 4ZKOU 5JYIA 2OD3B 3AAUA 4E06H 4FU8A 5GIBA 2JJ2D 4K60A 2QN5T 1W8BH 1MBQA 1O2ZA 1THSH 2BDIA 3QTVH 1LVYA 1C5ZB 1OWIA 1UVTH 3ATKA 1Z8GA 2ZEBA 1S6HA 1CHGA 1W2KH 4AFZA 3TH3H 2CN0H 4TY7A 3P8NA 2GCHG 2P3TB 2G55A 3FP6E 2WUCA 2GP9B 1GJ6A 4HG6A 5F8XA 3ZZ3A 1PPHE 1J14A 2ZTZA 4I32A 1E38B 3BTQE 5EQSA 4BAMB 3U1JB 3RC5A 1C2GA 1TA2A 1NESE 3VXFH 2WHXA 2HLCA 3Q3XA 5A8ZA 4Q2KA 3IWMA 5L30H 3T25A 1QBOA 2AERH 1HAXB 4J1YA 1MZDA 2W3IA 1S5SA 1JXPA 1QA0A 4FXGH 3RXKA 1C5SA 3F1SB 3Q77A 3E1XB 1AO5A 2BHGA 4B6EA 4IMZA 4KGAA 1O2WA 1BBRK 3PROA 3TVJB 1QURH 1ZMJA 3PTNA 3RC4A 1WYKA 2CHAC 4YZUA 2Y80A 1WBGB 4WMEA 1LHFH 2RDEA 4GCHF 1BITA 1P2KA 1GBDA 1BRUP 1ELEE 2RCEA 4NCYA 1EJMA 6CHAC 1GJCB 2SGQE 1G30B 1MTVA 2JETB 2WYJA 1O3IA 4A1XA 3GY8A 4OGXA 5C17A 1K22H 4JYUH 2GX4A 1SI5H 3SU3A 2BY5X 1ZHRA 3RDZA 1WXRA 3ZZDA 2XWBI 1PQAA 3TJNA 3SHAH 3S9BA 1YY3A 2VWOA 1A7SA 1P8VC 1JIMA 3MYWA 2XC4A 3S7HB 3R3GB 1RXPA 3M7QA 3CP7A 2FMJA 3GCHB 1NBMD 1BTHH 2Y5HA 1H9IE 1RS0A 2D1JA 3P8OA 1AZ8A 1TQ7B 1GI8B 3SO3A 3UREA 1TBZH 5EJZA 1LVMA 1TX6A 1SMFE 1LTOA 4WH8A 6GCHF 2FXRA 1Y3VA 5KEDA 1MTWA 1O5DH 4HI3A 3HPTB 4R8TB 1HAVB 1SGDE 1YPKH 3UPEA 3ZZ6A 1WTHD 1LHCH 1DS2E 2FPZA 2GT7A 4YM9A 3F9EA 2KM0A 2ZG0H 3U98H 4B6FA 1FZZA 1GBKA 1DY9A 1OWJA 4NIVA 1EXFA 1GGDC 1DWEH 2GCTC 3SNDA 4H4FA 3KYGA 3S0NA 4I33A 1HJ8A 2GDEH 1TE0A 2IJD1 2ANKH 4Y7BA 1AU8A 4BXWA 1HDTH 1KDQB 4CBOA 1A5HA 5I25A 3MOCA 3BTKE 4I7YH 2WSSD 2V0BA 1E36B 1OPHB 3LC5A 2V7QD 4BXSA 4AOQA 2R0LA 4NG9H 1TRYA 1H8ED 1V2OT 2HNTF 3PWBA 2AH4X 4OGYA 3JZ2B 4X8SH 5BPEA 1YC0A
chains in the Genus database with same CATH topology
4ZAEA 1TQ0B 1OWKA 1ZMLA 2ZHDA 1S0QA 1P2NA 1HJAC 4IMQA 2VVCA 2ZGBH 4DG4A 2AMPA 3RXQA 1FY4A 4MTBA 1P3EA 5GPIB 4B76A 1BQYA 1VGCC 1DDJA 4MNXA 1C5YB 5FX6A 1EQ9A 3SU0A 1GJ8B 1TAWA 1NPMA 3R0FA 1GJ7B 3S9CA 2F3CE 2P8OC 1V2QT 3BTHE 1C1SA 1MKWH 3HK6B 1V6DA 3VFEA 1HIAA 1F0TA 1LHGH 1RRKA 2OTVA 2OLGA 3BTTE 2R2MB 2FOFA 4NIWA 2WPIS 3A8DA 1O38A 1P57B 3LU9B 4Y79A 4K8BA 2GMTC 1ARBA 2A45B 4UFGH 1SSXA 2FOCA 3KNXA 3SW2B 1O2KA 4X8UH 3FANA 3V0XA 3IG6B 1H9LB 2AGGX 3I77A 1A3EH 1FN6A 3A8BA 1KXFA 4AORA 1IAUA 2WPHS 5FBIA 2F9UA 3RM2H 3STJA 2ZDNA 1WAYB 1AVXA 1AWFH 3K9XB 3V13A 3AW1A 3PMHB 1SFQB 3K65B 2ZU3A 4Y10E 1VITH 3HATH 1ZZZA 2VIDA 1C4V2 1GHBG 1NU7B 1YBWA 1RFNA 2SGAA 1MUEB 1WOFA 2ZQ1A 3UIRA 1O3KA 4AX9H 4CRFA 2OC1A 1INCA 1AI8H 2QXIA 2ZPSA 1LO6A 1T8NA 1C1PA 1V2PT 5FXLA 1HXFH 1SGPE 1SHHB 2ZFPH 1GHYH 3UY9A 3W94A 1CT2E 5AHGH 1GHAF 1MKXK 2UUFB 5J4SA 3BTGE 1YPJH 4ZKRU 5T6GA 1K1NA 1QJ6B 1YGCH 1DXPA 2C3SA 1CO7E 1ZSKA 1EOLA 1IQLA 4ZUHA 4LXBH 2BOKA 3M7TA 2PKSB 3TJUA 2F9NA 1TGNA 1IQMA 1QRWA 4XBCA 4ZHAA 2VVVA 3BEIB 2BVRH 5C3NA 2Z94A 2ZPRA 1DXWA 1AWHB 2J95A 3T62A 1H4WA 1QGFA 1YM0A 1QB6A 3O8BA 3V12A 1TGSZ 1V2UT 2Z3DA 3SU5A 1Z71A 2QF0A 2GDDA 3RM0H 1TNIA 4KKDA 2O8WA 3RU4T 1M9UA 2FOEA 1F0RA 2BD3A 3MI4A 4WMFA 3BSQA 2IN2A 3U8OH 4B1TA 1GBCA 2Z9IA 1WU1A 1V2NT 3E6PH 2ILNA 1L0ZA 3GCNA 3KHVA 1NRRH 1G2LA 1MU8B 2Y82A 2FYRA 3D23A 1O2UA 3RXBA 1GI0A 3ZVGA 1W13U 2V35A 2FIRH 1ELCA 1UMAH 4AYVB 5DGJA 3PYHA 3T26A 2G5NA 1TNKA 2BVSH 1NFYA 4ASHA 1K1MA 2ODPA 2Y5GA 1L4DA 1G3BA 1NRPH 2XBVA 2M5TA 1QY6A 3A84A 3ZVCA 1F2SE 1PYTC 1QFKH 3LGYA 3BG8A 1GHBF 3EAJA 1W0ZU 2ZO3H 1GMHG 4D76A 4HGCA 2BDBA 1FY5A 4IW4E 1T4UH 1ZR0A 1ETRH 5ESTE 2BDCA 2J94A 3GCOA 2QXHA 2ZHFH 2Z3EA 3MHWU 2STAE 3OY6U 1XUKA 1GWAA 3A89A 1VITG 2TRMA 1VJAU 2ALPA 1GL1A 1A46H 4A1TA 1SLXB 1FPCH 1O2PA 3GDUA 2A4GA 2ZFTA 3UNQA 1WV7H 3AVZA 1SGFA 2OINA 4INHA 2B9LA 3SV8A 4FUJA 4X6MA 2VWLA 3SV6A 1UCYE 1A3BH 1FXYA 3ZVBA 4E7RG 3UR6A 1A0LA 1C5TA 4H6SB 1OS8A 1G32B 4X1PU 3P70B 3M61U 1PYTD 1O2XA 3AASA 2Y5FA 4YOIA 1H8IH 1MQ6A 4Z6AH 2W5EA 1U6QA 4D7GA 1PPBH 4ZXXH 2GZ7A 1ABJH 3CS0A 1HAYB 2PR3A 1NROH 1VCWA 1BA8B 4CH8B 2BTCE 1EP5A 2FOGA 1ZTKA 3RXOA 1XXFA 4NWLA 1NFXA 3FFGA 1GI1A 1EZQA 1H9HE 1TYNA 5EQRA 1O3BA 5K7RA 1TBQH 2FEQH 1HAHH 4IN1A 1DLEA 3GISB 2F83A 1BUIA 4WXVA 4YLQH 3RXIA 2OUAA 2TGAA 1KSNA 1EKBB 1ELTA 3E16B 3PLPA 3SNBA 1W11U 1MTNB 5EU8A 1O3CA 4AYYB 2H6MA 1YF4A 1GBJA 2BD4A 4IC6A 1TOMH 5ABWA 1W7XH 5L2ZH 1SLVB 5HXFA 4JYVH 4I8HA 4FU9A 2SGPE 2PTNA 1C2DA 5EG4A 7ESTE 1SC8U 4A6LA 2CF8H 2YNAA 4IBLH 1SOZA 3KQBA 3T5FH 1AB9B 3S7KB 2W26A 3EQ0H 1D9IA 2RG3A 2QXGA 2TGPZ 2GV7A 3RXGA 1BCUH 3VB5A 1SGNE 3RXHA 2RDLA 3B8JA 4Y8ZA 1UVOA 1TLDA 1VITF 2AMDA 5FPSA 5DJ7A 3TIUA 4YOGA 4SGAE 1GBLA 1GJDB 5LH8A 3VB6A 1GI5A 1SFIA 1P9SA 4HFPB 4NZLA 1HFDA 5C1YA 1C2EA 4D9RA 1GPZA 4NSYA 2R0KA 1MCVA 2FOBA 3PB1E 4X6OA 1EPTA 2A7CA 1P2MA 3OU0A 5C1XA 1MD8A 1YPMH 3S69A 3STIA 5LPEA 2HGTH 1QRXA 3FZDA 1ESTA 3BTFE 1HGTH 3E8LA 4AG1A 1D3PB 4B2BA 2ZDMA 3MO6A 2V3HH 2J34A 1MZAA 1FPHH 4XOJA 7LPRA 1TPSA 1P05A 4TWYA 3MU1A 1E34B 1O3LA 3GY7A 1KXEA 1VZQH 4ABAA 5HM2A 1G3CA 4GAWA 1LQEA 1ZRBA 1NT1A 2FOAA 4BAKB 1Y8TA 3OYPA 4CRCA 2Z9LA 3UR9A 3V3MA 1A1RA 2ZIQH 2LNCA 3SORA 5AVDA 3EA7A 2W3KA 1KLTA 2QIQA 3GY5A 2HALA 5GXPA 1T8OA 1AGJA 4BTUB 2P95A 1KTSB 4LZ1H 1GJAB 1PFXC 4Y76A 2C8YB 1O3FA 2NU1E 5G4BA 2ZPQA 1IOEA 2WV4A 3F9HA 1BIOA 1C5QA 1QHRB 1Z8JB 3E90B 3SV9A 1UVUH 1AIXH 1QA7A 2BDGA 3H7TA 5ETXA 3W95A 3A7XA 3RMOH 1FN8A 2VGCC 4ABGA 1T7CA 1O3PB 1C2IA 2BD9A 3BIVH 1HXEH 4YT6H 1GMDF 2BY7X 3M37A 4MPUA 1W7GH 2FWWA 3PO1C 3OY5U 3P8GA 1ZRKA 4JK6A 4X2YA 4U2WA 3L33A 1TB6H 2W7UA 1ELAA 3DUXH 2ESTE 2XYAA 1EASA 1FIZA 4X0WU 4HTCH 3MMGA 4KELA 1NS3A 3EA8A 3M36A 1MAXA 1GDUA 2HNTE 1WUNH 1C2MA 4RKOB 2ZHEH 1ELBA 2PSYA 4FUDA 4VGCB 2BQ7B 1F0UA 2GZ8A 1HBTH 1CGJE 1SG8B 1PPZA 1CHOG 1EAIA 1EZUC 3KQDA 5JB8S 1VCPA 2XBYA 3SI4H 2ZU2A 4AFQA 1O5GH 2ZU5A 4LOYH 2GVFA 2PW8H 1AZZA 5EPNA 3BG4B 1HAOH 1V2JT 3GY6A 1O3HA 1O2VA 4YESB 1WQSA 1UK2A 1QQ4A 1KXAA 3U8TH 4MVNA 3H5CB 4AB9A 3C1KA 1AHTH 1NO9H 1ELDE 2VIPA 1KXBA 2EEKA 2PTCE 3BF6H 2NWNA 1WCZA 1KLJH 3ATIA 2FODA 2G81E 3QDZB 1DUAA 1GI2A 2ZGHA 1YCPK 1HAGE 3BTWE 3A7WA 2QCYA 2C8XB 1GJ4H 1A0HB 5E0GA 3HGPA 2JH0D 1YKTA 1FJSA 3SV7A 4O3TA 2BM2A 2F91A 4UFFH 1SQOA 5A2MH 1EPTB 1MMJN 3DD2H 3C27B 4NA7A 4DURA 1BBRH 1PQ8A 1ESBA 2JETC 3EGKH 3RLWH 1G9IE 5FCKA 2CMYA 1HB0B 1C2HA 1AFQB 2QY0B 4MNVA 2Y6TA 4B2CA 4Z0KA 1K21H 1C5XB 3FP7E 1AMHA 4BOHA 1CBWB 2I6SA 2H1UA 3RXUA 2HNTC 2H9HA 1EZSC 1KLIH 1P2OA 1C1RA 1GL0E 1OSSA 3GCHC 1DVAH 2WPKS 3M5OA 3TPIZ 2PGQB 2XRCA 1THPB 1GI9B 3UUZA 3O8RA 4A7IB 1ZMNA 3S9AA 3VGCB 4FU7A 4XFQA 2BY8X 2ZDKA 1N8OC 1N8OB 1XVOA 1OXGA 4UEHH 2ANMH 3PMAB 4IN2A 1FY8E 2ODYB 1FUJA 1YLCA 1GI3A 1N6YA 1EB2A 1CHOF 1CT4E 5CE1A 2NU4E 2BLQA 4UE7H 1BMLA 1LPKB 2ZFFH 1GI7B 3V7TA 2GCHF 1A5IA 1J15A 1Y3XA 4MPVA 4ABFA 3KL6A 3TH2H 1DUEA 1QJ7B 4AFUA 2BZ6H 2VWMA 5EPYA 3ZZ8A 3LGWA 1O5AB 4TPIZ 4FUFA 3TGIE 1V2KT 3SJOA 1NFUA 2EA3A 3OX7U 1MU6B 4FUBA 1FY1A 4I8GA 1OKXA 4JZEH 3GYMA 5SGAE 1LPGB 1DM4B 1GVZA 1QQUA 5EODA 5DG6A 1C5UA 5FBEA 2F9VA 1TNGA 2ZGCA 3SU1A 2A5KA 2ULLA 2C4FH 2P93A 1BTYA 1GBBA 3PMBB 3U9AH 3ZVDA 4K1SA 6ESTA 1HLTH 1H1BA 1TWXB 5JBCS 1GBIA 3RXCA 2BVXH 4B71A 8GCHG 2P59A 2Q1JA 9LPRA 3SBKA 5A0CA 2AIPA 3T28A 4M7GA 4Y0ZE 4TYDA 2H5CA 1XUHA 2SGFE 2J9NA 2AMQA 2VINA 3ZZ9A 1C9TA 3GOVB 3TJVA 1O2SA 1QB1A 1C1OA 5DP4A 2A0QB 2ZTXA 8KME2 1TOCB 5CHAB 4AG2A 1GMCG 1KY9A 1WSSH 5JBAS 5EW2H 2FLRH 4X8TH 4H6TA 4DOQA 1FIWA 1K1PA 1MD7A 4K69A 3T29A 2BD7A 3UNSA 1YPEH 2EI7A 3MU4A 5EXMA 1ACBE 1F7ZA 1LCYA 2FI4E 5TCAA 1O32A 1G36A 2OCVB 4A1VA 1CGHA 1GVLA 3QX5H 2BDHA 4ZMAH 9ESTA 2FS8A 2UUKB 3IITA 1RIWB 4U30A 1YPLH 3O8DA 1F5RA 1AQ7A 1BRBE 1O3MA 4AFSA 4TWWA 4I31A 1VCQA 3TJOA 1UTQA 1MKXH 4JZ1A 5GCHG 2V3OH 1SR5C 4DW2U 2OBQA 1FQ3A 3LGUA 2PKSC 3SNEA 5GJ4B 1EP6A 1S6FA 4ISHH 5T6FA 1HNEE 4BANB 5F6MA 1PQ7A 1W0YH 2PKAA 1OYTH 4WY3A 1O3OA 1ZYOA 1TX8A 1P10A 1UCYK 1W14U 4YT7H 1BB0B 2A32A 3K6ZA 3BTME 1O3DA 2SGEE 1O5BB 2Q6FA 1C2JA 4AGKA 2ZC9H 4ISNA 2OQ5A 3HK3B 3RXLA 3RP2A 3SU6A 1O5FH 4NA8A 2BDAA 8GCHF 4X1NU 4XDEA 1BRCE 4ZKNU 3PLKA 1ANEA 2BD2A 2O8LA 2ALVA 4NZQA 1KXCA 1C1NA 2BQ6B 3ODDA 2IJOB 1QB9A 1UTNA 1LVBA 3U1IB 5E8EH 2H5DA 1EB1H 3N7OA 2VNTA 2CJIA 1PPGE 3QO6A 1CA0B 1BZXE 5FPTA 1XUJA 3SOSA 2THFB 1C4Y2 4WJG2 5AFYH 1ORFA 2OC0A 2R3YA 2Q6DA 2WPJS 4KTCA 2ZDAH 2TGTA 3BTDE 3A81A 1W12U 1QRZA 4JK5A 2SNVA 2QAAA 1VR1H 2FX6A 2XC0A 1Z6JH 4B73A 4GUXA 1S0RA 2Z3CA 3RXSA 3TGKE 1Y3YA 2GV6A 2A7HA 2FDAA 4ZHMU 1QL9A 1TABE 3FZZA 3ZYDA 1RGQA 3HKJB 3SN8A 2HVXA 3ITIA 4X8VH 4ZROA 2VB0A 4K1EA 1CU1A 5GCHF 1O35A 4K2YA 4GHTA 3RXRA 3ZZ5A 2A31A 4AZ2B 2BXUH 3MH6A 2PFEA 3MH5A 3P6ZB 2ZZUH 3TLOA 2A2XH 5LPRA 3ATWA 1BMNH 1BOQA 5PTPA 4IGDA 4F49A 2P3UB 1SGCA 1PJPA 3MO3A 1NRNH 1O2NA 1BTXA 4JYTA 3F68H 1O2OA 1XUIA 5A8YA 3FVFB 2IOTA 3LPRA 1PPFE 1DPOA 1Q31A 1C5VA 2CXVA 4ISIH 4DJZB 1TPOA 3MFJA 3UOPA 1K1IA 4OS4A 1LHEH 1RTFB 1P04A 1D6WA 2G4TA 1RTKA 2G52A 1PPEE 1MCTA 1JRSA 4I8JA 3QZRA 4CRGA 4JCNA 1FNIA 1P11E 3RUOA 1LHDH 1OOKB 2J92A 4DIIH 1QCPA 1VJ9U 2KAIB 4FVBA 4AB8A 2PKAB 4MPXA 2ANYA 2OC7A 2JH5D 1MTNC 4YTAA 4UFEH 1W3CA 2UWOA 1T4VH 3LT3A 1DE7H 2Z7FE 1BJVA 2CGAA 3RXMA 1GCTB 1L1JA 3GY4A 2G00A 3NXPA 3URDA 3GYLB 3UTUH 1QJ1B 1C2KA 1D3QB 1O5CB 1A61H 1BDAA 1GMHF 1L4ZA 3EDXB 1GG6B 1DX5M 5FX5A 1AB9C 4TPYA 1TMBH 1BRAA 2SFAA 3RXTA 3UOUA 2WPMS 2XBXA 1MQ5A 2ZA5A 1ABIH 1ZSJA 1DLKB 2O8TA 1DWBH 3GY2A 3ZYEA 2ZHQH 2QV1A 1O31A 4ZH8A 1C5PA 4BAQB 3BV9B 3F9GA 1FONA 3K6YA 3PWCA 1EX3A 1P9UA 2BY9X 4QT8C 4NWKA 1YPHC 1XUGA 3M5LA 1G2MA 3BN9A 3LIWA 5EXLA 3TITA 3TH4H 3MO9A 1O2YA 2ZFSA 3EE0B 4AGJA 5DP8A 3UQVA 1Z1IA 2G5VA 3ZZBA 4OS5A 3NZIA 1C5OH 1K9OE 3GCTG 1OWHA 5T6DA 1D4PB 4FUHA 3JZ1B 4FUCA 3BEFB 1Y3UA 3A80A 2Z9JA 2XXLA 4LK4A 1SL3A 4PROA 1XKAC 1Y5AT 1AFEH 4ABBA 4OS6A 2VIWA 5TCCA 1O2IA 3RXDA 5C1UA 2XBWA 1CT0E 3KQCA 4Y0YE 2STBE 4MG3A 1O30A 5GWZA 3CENA 1J9CH 2FOMB 1D6RA 3OTJE 4D9QA 2XNIA 4FUGA 4ESTE 1C5LH 5T3HA 3TU7H 5E0J