1ARBA

The primary structure and structural characteristics of achromobacter lyticus protease i, a lysine-specific serine protease
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
263
structure length
263
Chain Sequence
b'GVSGSCNIDVVCPEGDGRRDIIRAVGAYSKSGTLACTGSLVNNTANDRKMYFLTAHHCGMGTASTAASIVVYWNYQNSTCRAPNTPASGANGDGSMSQTQSGSTVKATYATSDFTLLELNNAANPAFNLFWAGWDRRDQNYPGAIAIHHPNVAEKRISNSTSPTSFVAWGGGAGTTHLNVQWQPSGGVTEPGSSGSPIYSPEKRVLGQLHGGPSSCSATGTNRSDQYGRVFTSWTGGGAAASRLSDWLDPASTGAQFIDGLDS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACHROMOBACTER PROTEASE I
publication title The primary structure and structural characteristics of Achromobacter lyticus protease I, a lysine-specific serine protease.
pubmed rcsb
source organism Achromobacter lyticus
molecule tags Hydrolase(serine protease)
total genus 81
structure length 263
sequence length 263
ec nomenclature ec 3.4.21.50: Lysyl endopeptidase.
pdb deposition date 1993-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1arbA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1arbA02
4WJG2 2JKHA 1H8DH 4BXWA 4U32A 1V2MT 2XWBI 4AYVB 2G8TA 1O3MA 3S69A 2ZCLP 2GD4B 4DIHH 1K28D 4F49A 1TPPA 2W3IA 1MU8B 3UUZA 4NA7A 3S7HB 2XCFA 1QNJA 3A89A 1PQAA 1NN6A 1PQ8A 3DA9B 1O36A 5E2OA 1O2RA 4FXGH 1O2PA 3SNEA 3RXCA 1BRBE 4GCHG 3TK9A 1K1NA 4X2YA 1MKWK 2HGTH 2P59A 1XM1A 1A5HA 2AGEX 4M7GA 3QN7A 4VGCB 4QT8C 3STJA 1EAXA 4X1RU 4CBNA 1MAXA 3MH6A 3F9FA 2B0FA 1Z7KA 4OS5A 4OGYA 1O0DH 5ESTE 4Q7XA 2GP9B 3A88A 3M7UA 5EQQA 2FO9A 4A7IB 3KQBA 3V13A 5K7RA 3L6PA 1VJ9U 2BZ6H 2ZPRA 1A4WH 2FOMB 1AWHB 2A4GA 2SGFE 4CHAB 2C8YB 1ELVA 3P8OA 1QB1A 1GHWH 2W26A 1EAUA 1GI8B 1MH0A 1W13U 5A0BA 3ESTA 1P09A 2HLCA 2XWAA 4Y8XA 4X1NU 1IQNA 4B75A 2FOCA 4DOQA 1L1JA 4ABIA 4MPVA 2BY9X 2QA9E 1C2DA 1XMNB 3SGAE 3C27B 4HFPB 5DP5A 1CGJE 2SFAA 2UUFB 1E38B 1EPTC 1LVMA 3ZV9A 2Z3DA 4Q7YA 5L2ZH 3RC5A 1UTJA 1C2KA 3FAOA 1ZTJA 2WPMS 1NFUA 1TQ7B 4ZH8A 4DVAU 7ESTE 2BOHB 8ESTE 2P3FH 1YYY1 8GCHF 5C5OA 2NWNA 3T29A 1W0YH 3RC6A 1GVLA 5GWZA 4ABAA 2STAE 1FZZA 1VITH 5F8ZA 1C5SA 2PWXA 2A1DB 1F7ZA 2VIDA 3M3TA 2OC0A 1SQAA 1SGQE 1C2HA 1MTWA 2R2WU 3Q3KA 2OP9A 1BMNH 4NSVA 1Y3UA 1UO6A 3AW1A 1BRAA 3VB5A 1AB9B 4LOYH 3SO3A 1GBTA 1Z1IA 4DG4A 1CU1A 1UVSH 3UQVA 3A83A 2FOHA 3V0XA 1EASA 6LPRA 4RKJB 4YOIA 1S6FA 2Z3EA 3UIRA 2ODPA 1C5ZB 2GZ7A 2Y7ZA 2CGAA 5GCHF 1OKXA 1N1LA 1DXPA 3MU8A 2ZFQH 3QWCH 1TGNA 1C2EA 1GBAA 1TA2A 4IC5A 4CRGA 4AZ2B 3O8RA 3TGIE 4U01A 4DY7B 1P2JA 4AG2A 3FFGA 3ZYEA 2TBSA 1HUTH 2FX6A 1C5QA 3S9BA 3SUGA 4XDEA 3T28A 3MTYA 4WH6A 1PFXC 1KXAA 4GSOA 1FY1A 1AN1E 1Z1JA 3RXUA 1J8AA 1L1GA 2GDDA 3V7TA 1EZSC 1KIGH 1C1UH 4TY7A 4FUFA 1DOJA 2W7UA 2VNTA 4ZUHA 1GJ7B 3PLKA 2VH0A 1SGFA 3RMOH 4BTUB 2FIRH 1C5XB 2OC1A 4UFFH 3QDZB 2ZCHP 1G3CA 2V35A 1CT2E 1VGCC 1VR1H 3OY6U 3RXMA 3ZVBA 1GI1A 1NO9H 2CV3A 3BTEE 2R0LA 3D23A 1MZAA 1NTPA 2V3OH 1QL8A 2OBOA 3QGJA 4H6SB 1ZZZA 3A87A 2VVCA 3LJOA 1IQFA 3M36A 2AMQA 3W95A 4Z6AH 1MKWH 1GWAA 2O8WA 3MO9A 3RXVA 2BDHA 1ESAA 3UQOA 4ZKOU 1GJDB 1EJMA 2Z9JA 1AVGH 3MU4A 1GI5A 1FAKH 3RXBA 4WXIA 1HAYB 4DIIH 1TOMH 4X1PU 1BHXB 2P8OC 2GCTC 1NM6A 1NZQH 1C5VA 5GIBA 1X7AC 2GV6A 3AAVA 1HAOH 2ZFPH 2WPIS 1N6YA 4TPYA 2QCYA 4X2VA 3SV6A 1WUNH 1WQSA 1QL9A 1MTUA 3D62A 1HJ9A 2EI6A 1D3DB 1RRKA 2QN5T 2A7HA 3TLOA 2OINA 2THFB 1LHCH 5A8ZA 2A4QA 3MMGA 4FU8A 1QIXB 3R0FA 4YLQH 4ISHH 3FVFB 1M9UA 4NWLA 1V2OT 2JETB 4O03A 1QY6A 3ZYDA 1P2MA 4BTIB 4WXVA 5A2MH 1KXDA 3K65B 5JBAS 1GDUA 1AFEH 1UHBA 5E0GA 5EG4A 2J92A 3OYPA 3TJOA 1D3QB 1OWHA 3I78A 3SU6A 3GOVB 1HAPH 1ZHMA 1HIAB 3NXPA 2W3KA 2A5AA 5EW1H 4KTCA 3TK5A 3BTME 4X1QU 3SHCH 2FLBH 3VEQB 1GHAF 2PTNA 1QB6A 1ELTA 2VWNA 2FESH 6ESTA 3AVZA 2W7SA 1HJAB 1NFXA 1TBQH 3LGUA 4MNWA 2F9BH 1OWEA 1PPBH 3BEIB 3LPRA 1FPCH 1A0LA 1A1RA 2D2DA 1Y3WA 2BD4A 2BLVA 1C5YB 1UVTH 3TH4H 1B0FA 3GCNA 2BVXH 1G3BA 1PQ7A 2RA3A 1S5SA 1EP5A 1RTKA 3HK3B 3WY8A 4LK4A 2ZGJA 1IAUA 3PB1E 1PQ5A 3A85A 1XXFA 3NUMA 5HYOA 2O8LA 1J14A 1O5GH 2ZU4A 1SL3A 1T8NA 3ZZ8A 3LC5A 1C1QA 1EAWA 1C5PA 1TMTH 1ZPBA 3SNCA 2VJ1A 4E06H 1GMCG 1FDPA 1GI7B 5A0CA 4YOGA 2ZG0H 3TH2H 1D6RA 1L2EA 2CHAB 4GUXA 1BQYA 4X0WU 2Z9IA 2QV1A 2ZTYA 2HOBA 2ZDKA 4R0IA 3PMJA 4TWYA 1GVZA 5FHTA 3CS7A 1DFPA 1AE5A 1EPTA 4LZ4B 5L30H 6GCHG 4ISOA 1QCPA 2H1UA 1HAVB 1UTQA 1DICA 1HB0B 1JBUH 4JCNA 1MTNC 3E16B 2A0QB 3RXQA 1YKTA 1IOEA 3ELAH 4MLFB 3VB3A 1KLTA 3SU1A 1WQVH 1P8VC 1MBQA 1P06A 2WYJA 4PROA 1S81A 2KAIA 3ODFA 1Z6JH 5DO4H 1O35A 2OBQA 2VIWA 2TPIZ 4BAKB 1K9OE 2BD8A 2BOKA 1P11E 1XXDA 4X6OA 5LPEA 1YCPK 1E35B 1LPZB 3CENA 4YLUA 1VCQA 4ABGA 1GG6C 4ASHA 5TJXA 1HNEE 1C2MA 4HGCA 1TMUH 1Y8TA 2PW8H 4NGAH 1JIMA 2Z94A 1TLDA 3OTJE 2ANWA 2Y82A 3BG8A 4JMYA 3MU0A 2UWLA 3T2NA 3MWIU 1XUHA 3EQ0H 2ZTXA 3BEUA 1XKBC 2Z3CA 2BD5A 4B74A 2HPPH 2FEQH 3BIUH 3EAJA 3RDZA 3SU0A 1GMHG 4JYUH 3I29A 4K1EA 2BLWA 1HGTH 3KNXA 2BY7X 1W7GH 1FUJA 1JRSA 1O2ZA 3DD2H 3RXFA 3GCOA 1QURH 1K1OA 1TAWA 1TPSA 1EQ9A 2C8ZB 1FONA 1FY5A 4H4FA 1P2QA 1L1NA 3EA7A 4Y0ZE 4YO9A 4ABBA 1YC0A 3A8DA 3PTNA 1ZJDA 1O31A 1ACBE 2BB4A 2EC9H 3M5MA 1GHXH 2BMGB 4VGCC 1ELFA 5H4IB 4ZMAH 7LPRA 1JXPA 1DLEA 2QY0B 1C1VH 2CMYA 3MNXA 1BJUA 4UD9H 1OXGA 5T3HA 2QGRA 3U69H 4OS4A 1UTOA 3QTOH 1EAIA 1GHYH 2Q6GA 1O2OA 1YBWA 1AKSB 1MBMA 2GMTC 3BG4C 1T7CA 3UR6A 3BN9A 2J9NA 3VB6A 2GVFA 1TRMA 2Y5FA 4JK6A 2ZU1A 1VCPA 2PKAA 1GBHA 3MO3A 1EB1H 1GMDG 3SQHE 1YF4A 1LPKB 5EW2H 1F2SE 1LMWB 3RXIA 2G52A 3MI4A 2FXRA 2FS8A 4D7FA 1C4V2 1ARBA 4CHAC 1SPJA 2BTCE 4MTBA 5EGMA 2ZEBA 4A6LA 1LDTT 1JIRA 3STIA 1LKAA 1DE7H 4D8NA 1E36B 2P3TB 4X8UH 1F5LA 1DPOA 3DFJA 4YT6H 1SLWB 4JZEH 3RXSA 1CHOF 2F9PA 3LGVA 1TE0A 1TABE 1QL7A 2FZZA 4CRAA 3A81A 3T26A 3BTKE 3GY4A 1U6QA 1AO5A 5CE1A 3PO1C 4MPUA 1H8IH 1OP2A 2OQ5A 4ZXXH 1AVWA 1IQGA 1XX9A 3A8BA 1SQOA 1ORFA 4Y7AA 1V3XA 3UOUA 3DHKH 3R3GB 1A5IA 3C1KA 4KELA 1YPGH 1C1RA 4I8JA 4UEHH 4AFSA 1C1OA 1F0SA 1BTYA 1LHDH 3SJKA 2P95A 1AE8H 1ZPZA 1SOZA 1S83A 1THPB 2F9OA 3FP6E 1UK4A 4Y8ZA 3DUXH 3TH3H 1GBEA 1FNIA 1ZMLA 3RMMH 2HNTF 1P2NA 3PWBA 3KQDA 1TGBA 4RN6A 1T8OA 1J17T 1YCPM 3A84A 4I8GA 5A8YA 3SUFA 2EEKA 4B73A 1QA0A 4E05H 1UTKA 1C1NA 1LVBA 4CRFA 2OTVA 3BTHE 1EOLA 1A0JA 3SV8A 1XUIA 4KKDA 1UMAH 2H5DA 3P92A 2W5EA 2QXHA 1YCPH 2UWPA 4FVBA 3OU0A 2GCHF 1W12U 4E7NA 1LKBA 1BTPA 3W94A 3A7WA 4NFEA 1P05A 5LGOA 1BBRK 4DGJA 5TCAA 4AFZA 3RXDA 1S0QA 3A82A 4NA9H 1BTWA 4Y7BA 3HKJB 1A0HB 1CT0E 4YOJA 1C5MD 3SNBA 1QQUA 2C8WB 5FBEA 2HWLB 4FVDA 4YTAA 3JZ2B 1KSNA 1O2IA 4JZDH 3LOXA 1QJ6B 3OX7U 1FLEE 4FUCA 2GMTB 3BG4B 4WWYA 1TQ0B 3SU2A 1EJNA 1MQ6A 3GCTG 2F9NA 3LH3A 1NRPH 2BYAX 5L2YH 1HAXB 1SSXA 1RTLA 2VGCB 2NU3E 1KDQA 1QGFA 4UE7H 5A0AE 3KHVA 3KF2A 2ZFSA 4Y11E 2BHGA 4LXBH 1DY8A 4BAQB 4CR9A 1P02A 9ESTA 2WPKS 1XKAC 3SI4H 1JWTA 1O3NA 1V2RT 2FOFA 4NSYA 3SU5A 1Y5AT 2GKVE 1FY3A 1GBCA 3F9EA 2FTMA 1C1PA 1O2UA 1G2MA 3AAUA 3HKIB 3LGYA 1FV9A 1NU7B 4NG9H 4LZ1H 2SGPE 1HPGA 1W0ZU 1BMAA 5EQRA 3TK6A 1ANEA 1O34A 4ABDA 2WV5A 2OQUA 3ZZDA 1ELGA 1DM4B 3PO1B 3SNAA 5HM9A 1LPGB 1C1MA 5FPYA 5F8TA 4MDSA 2AMPA 4CH8B 3RM2H 2UUJB 5IYTA 1GCDA 1HV7A 4D7GA 3E0NB 3M61U 1YPLH 3LJJA 1O3FA 3SBKA 1TBZH 1ESTA 1O2MA 4NA8A 4IN1A 3RXLA 2OUAA 1XVMA 1TYNA 3AASA 4MNYA 2R9PA 1G9IE 4FUIA 5E8EH 3QK1A 4WMEA 1GI4A 1YPHC 1O5EH 1RFNA 3MYWA 4SGAE 1AUTC 2R2MB 3SJIA 4INKA 3U1JB 2XBWA 4ZROA 3TGKE 5C1XA 4FUHA 1SFIA 4I32A 3M35A 5AVDA 3ZV8A 2JETC 2ANMH 1OWDA 2BM2A 1FJSA 2FOBA 4X1SU 1G30B 1O2JA 2ZC9H 1O2WA 2H2ZA 1SLXB 5E0JA 2EI8A 3RUOA 5FX6A 1O2XA 1O3LA 3E6PH 2F9VA 4WH8A 1O2QA 1YPHE 1O38A 2QYIA 1FAXA 2NU1E 4K2YA 1UTPA 1V2KT 2BVRH 4ZHAA 1D6WA 2BY8X 1KYNA 4FUDA 5FCRA 1DX5M 1GHBG 1SI5H 5JPMH 1DUAA 2Z9LA 1WOFA 1GL0E 5PTPA 1HJAC 2H9TH 2ZDMA 4Y76A 3SV9A 1N8OB 3UFAA 2XC5A 4IMQA 4Q80A 3S7KB 3ATWA 3DFLA 1OSSA 1D9IA 3BV9B 3GDSA 1CBWC 2VIVA 2ZGBH 1E34B 1HLTH 5HXFA 3PROA 3EE0B 1GJ4H 4BOHA 4J2YB 5C2ZA 1TGCA 1CA8B 1HDTH 3PMBB 3QGNB 1DY9A 1GI3A 2BD3A 3QZQA 4WMFA 2B9LA 2SGEE 3QZRA 1W8BH 2XRCA 2VWLA 1LHGH 5JBCS 1TRNA 2O8MA 1GBIA 3ZZ6A 4NZQA 4Y71A 2QF3A 1BBRH 1GBDA 2YNBA 5EXLA 4FUBA 3TU7H 2ZQ1A 3PLPA 4JYTA 1DVAH 4K1SA 6CHAC 1TOCB 3NK8A 2CHAC 3PYHA 3GY6A 2A2XH 3SHAH 3FZZA 1T8LA 3E90B 5ETXA 2C90B 1LCYA 1TA6A 3PV4A 5DJ7A 1H1BA 1J15A 3ITIA 4INLA 2QIQA 3S9CA 5C20A 2F91A 2LPRA 1ETTH 1J9CH 1EP6A 3HATH 2JH6D 2Y5GA 2B8OH 4UONA 1ELEE 1ID5H 1F5RA 2D1JA 1JRTA 2DE8A 2G51A 4K5ZA 4ZKRU 3SN8A 1O3EA 3ZZ5A 1MZDA 1ZMNA 1KXCA 4NCYA 4CRBA 2VVVA 1Z8RA 1SGDE 3ATLA 1Y3YA 1EKBB 4AG1A 4MG3A 4I8KA 2AERH 4DT7B 1K1PA 3KCGH 1V2JT 1O2YA 1QJ7B 3EA9A 1BA8B 3RXRA 3UTUH 1V2TT 2BY6X 2Z6BD 2K1QA 3JZ1B 1Y3VA 2PV9B 4X6NA 1XVOA 2BDGA 4GCHF 1ELBA 2H6MA 3I77A 2XW9A 1HXEH 1TX6A 2YNAA 2BDAA 2IJOB 1TNLA 2A7CA 1HFDA 1O3OA 1RD3B 4IW4E 1UCYE 4H6TA 3V12A 2BY5X 1HAHH 1OWJA 2GV7A 1OP8A 2ODQA 4JYVH 1ELCA 3Q76A 1FIZA 4I7YH 1ZTKA 1EZUC 1A61H 3TJUA 1V2WT 1OOKB 1LVYA 1JOUB 1DITH 4ZHLU 5F8XA 2A5IA 1BOQA 2SGQE 5T6GA 3RXKA 3URDA 1ZSKA 1K2I1 1TIOA 1J16A 1GJAB 4MPXA 2AH4X 5FXLA 2HALA 1GCTB 3GY8A 1HCGA 2I6QA 4OS1A 2VVUA 4Q7ZA 3PMHB 3ZZBA 2CN0H 3UNRA 2HVXA 3BTGE 1C5OH 2H9EH 1V2ST 2ZDNA 1G2LA 5EU8A 1GBJA 2D26C 4Y0YE 1CBWB 1O33A 3MNCA 5ABWA 3QX5H 1CO7E 2NU4E 1IQJA 4ZHMU 5LPFA 3BTTE 3MU5A 3KGPA 2Y6TA 1IHSH 2ZGCA 2Y81A 3VFEA 4I8LA 2EA3A 3D65E 3U8TH 4TPIZ 3L33A 3CP7A 1SMFE 2ZWLH 2XBVA 2VU8E 2BDIA 3E1XB 3M3VA 2BZAA 7GCHG 3ATKA 3PMAB 2BVSH 1G32B 1GJ8B 1CT4E 1GJBB 3KEEA 1YPMH 2BX4A 3ZZCA 1HXFH 3ATIA 2DE9A 4CR5A 6CHAB 2ZFTA 1LVOA 3HK6B 5C67A 1GJ9B 1QRWA 3IWMA 2P16A 1QJ1B 2VB0A 5HM2A 3B9FH 4J1YA 2M5TA 1CSOE 2H9HA 1CQQA 1L0ZA 2A4RA 1A3BH 2WYGA 1O2GH 3TJNA 5J4QA 2ZU3A 1GI6A 2ZZUH 4XE4A 3TITA 2J94A 1DWEH 3FANA 3GYMA 4A1TA 1K1MA 3E8LA 5EXMA 3K6ZA 2XBXA 2RG3A 1ZLRA 4B2BA 2XTTB 2WINI 1EZXC 3SV7A 2QXIA 1C5LH 3EYDA 3VGCC 4D9QA 1GHBF 4I33A 1TONA 1MCTA 3PLBA 5C1UA 1GBLA 1RTFB 4ISLA 1GJ6A 4Z0KA 3SW2B 2GZ8A 2BQWB 2HPQH 4O9VA 4B76A 1UK3A 2ASUB 2J34A 5HMAA 3CS0A 2PSXA 5DK1A 4WMDA 1QQ4A 1QA7A 3MH5A 5DP8A 3RXJA 4DCDA 2ZHDA 1CGHA 3IG6B 2ODYB 1QTFA 1BTUA 1RGQA 1ZMJA 1GL1A 5GPIB 1DANH 3QUMP 1O5CB 3O8DA 2FS9A 1CHGA 1TB6H 3T5FH 3Q00A 3SJ8A 3TVJB 4NIVA 5AF9H 2FYQA 1YM0A 4IGDA 2FPZA 3O8CA 4FU7A 1O39A 3LONA 4XBDA 1GI9B 1WTGH 2HNTC 1BMMH 2ZGHA 3T62A 5DP9A 5CHAC 3T25A 1WU1A 4NFFA 1IHTH 1XUKA 8LPRA 1PPGE 1D4PB 3GYLB 1GHVH 3A86A 1P10A 1NS3A 3F1SB 1A5GH 1KTTB 1DLKB 1OS8A 2NU0E 3Q77A 1BITA 1ZRKA 2FMJA 4DW2U 2O9QA 1HAZB 2XCNA 8GCHG 3ODDA 3VPKA 1C2JA 1O2LA 1MD8A 5DP6A 1TNGA 1DDJA 1SQTA 2HNTE 3IITA 5JB9S 4YM9A 2G5VA 4JK5A 3LDXH 2ZP0H 3U9AH 3SOSA 3NPSA 2A32A 2FX4A 1W7XH 1HRTH 3ATMA 2OC8A 4ISIH 9LPRA 1BB0B 3P70B 1BDAA 2VGCC 1EUFA 2TGAA 4MNVA 1TX8A 2XBYA 1GBKA 2ZPQA 1KXBA 1P01A 1MMJN 3F6UH 2ZKSA 1G3DA 1P3CA 1SGTA 1TBRH 1TRYA 2BX3A 5G4BA 1IQEA 1SLUB 4RKOB 2R3YA 3M3SA 2ZDAH 2O8TA 2WPHS 1HJ8A 1QRXA 1O3AA 2VIQA 4GHQA 4AX9H 1ZYOA 3RXPA 2QXJA 2GZ9A 1KXFA 1Z8JB 1P04A 1PYTD 1NT1A 2VIPA 1SGPE 4BTTB 1P2IA 1RIWB 2WV4A 3U1IB 2G81E 3D49H 4AB9A 1RS0A 1UJ1A 3BF6H 3RXHA 3MHWU 2SGDE 1EB2A 2QAAA 2FI5E 4UFEH 2FTLE 3SGQE 2I6SA 2BQ6B 4BAMB 3URCA 3Q3YA 3RU4D 3ZZAA 1TPOA 1SR5C 5DP7A 3UNSA 3VGCB 4YT7H 5CMXH 3RC4A 3M7TA 4WF8A 1MTVA 2PUQH 3RMLH 3SJ9A 4FUEA 2Y5HA 1CA0B 1C4Y2 5JYIA 4FUGA 4O3TA 1C1WH 2FOEA 4Q2KA 3A80A 2FOGA 3SQEE 1WV7H 2Q6FA 1O2NA 1SGYE 2V3HH 1DSTA 3HGPA 3LU9B 3TJVA 1GBBA 3E0PB 4OS7A 1IQKA 3MNSA 1OYTH 4YESB 1C9TA 1SGNE 2A7JA 2A2QH 2O8UA 3MU1A 4Y79A 5DKMA 1O5BB 1YPKH 4NIYA 2FDAA 2ZTZA 4OGXA 3UREA 1H9HE 3H7TA 3MH7A 3RM0H 3LGWA 5EXNA 3TGJE 4KTUA 3M37A 3O8BA 2BDCA 1GMCF 4U2WA 1AY6H 1T4UH 4IC6A 4JZIA 2RDLA 3SJOA 3RP2A 4BXSA 3RLYH 1Q2WA 1O30A 2GT7A 4A5TS 2OC7A 3GICB 5CHAB 1C5RA 1YPEH 1SGEE 1B0EA 4X8TH 1N8OC 4Y10E 5JB8S 1MTSA 3M5OA 1GGDC 4I8HA 1VCWA 3N7OA 1GDNA 1O32A 1ABJH 3FP8E 1EX3A 3LGTA 1QFKH 6GCHF 1V2QT 3EDXB 1AKSA 3FP7E 1SHHB 1MU6B 1NESE 1NRRH 1V2LT 1Q3XA 4IBLH 3RXOA 4B2AA 1H9IE 4KP0A 1AWFH 1DWDH 3A7ZA 1A3EH 1AD8H 1S84A 3T27A 3GDVA 1AGJA 1QR3E 3LGIA 3P95A 3K9XB 5JBBS 1C5WB 2XXLA 1UVOA 1ZR0A 1D3PB 1KXEA 1AUJA 2AYWA 2P93A 1KTSB 1C2IA 1NY22 1O37A 5IDKA 2FLRH 2C3SA 2P3UB 2PKSB 3ZVCA 3A7XA 3VXFH 4FUJA 4O97A 1PYTC 2AIQA 2ZO3H 4A92A 3K2UA 3P6ZB 1P0SH 1HBTH 1SHYA 1WBGB 1XUGA 4CRDA 4AORA 1TMBH 1GHAG 3SU3A 1QBOA 1UTLM 3VXEH 2TGTA 1BRUP 2ULLA 3TIUA 1F5KU 3EGKH 2GGVB 2BXTH 1C2GA 1HAIH 3U98H 1GMHF 3F9HA 1ZSLA 7KMEH 1O3IA 2Z9KA 1FPHH 1ZPCA 3Q3XA 3GY3A 4K69A 2FM2A 2ESTE 5F6MA 2Z9GA 5DGJA 1CE5A 1K22H 1O3GA 1K1IA 1FN6A 2ZA5A 4AN7A 1F0UA 1K1LA 2XYAA 1ANCA 3L3TA 4ZKNU 3UY9A 3NKKA 3LC3A 3QO6A 4XBBA 3ZZ7A 1Y3XA 1SC8U 5I25A 4WY3A 1YP9A 3E91A 4Y8YA 5GJ4B 1BZXE 5C1YA 1FMGA 1ESBA 2WPLS 3RU4E 3U8RH 1QRZA 3VB4A 2WPJS 4A1VA 2SNVA 4UDWH 1IQIA 2QF0A 2C8XB 4R8TB 3EA8A 1KLJH 1P2KA 3A8CA 1SGCA 3SU4A 1FY8E 3SORA 4NZLA 5L6NH 2VWMA 2J95A 2PGBB 1GCTC 2F9UA 3E3TA 1GMDF 3KQCA 4KTSA 1TGTA 1DXWA 2ZQ2A 1LHFH 5A09A 2A4OA 4ZAEA 1TNIA 4ISNA 2VWOA 1BTZA 4X6MA 2ZNKH 3MFJA 5BRRE 2GTBA 2ZHQH 1GGDB 1TNHA 2GDEH 2ZFRH 2WUBA 5DG6A 1GPZA 3KQEA 4MQAA 3RXGA 1UHBB 1O3JA 1NRNH 1O3DA 4IN2A 1DS2E 1PPCE 1RJXB 4D76A 1JMOH 1SGIB 3PTBA 4H42U 1S82A 1ZHPA 3SZNA 2C4FH 4FU9A 1UVPA 5LPRA 5BPEA 1N6XA 2IPHA 4ABHA 1L4ZA 2SNWA 4RSPA 1MQ5A 1BTHH 1W2KH 5EPYA 4B1TA 2AGGX 3BTQE 4X2XA 1C5UA 2ZDVH 3KL6A 2HRVA 5B6OA 2G4TA 4CRCA 1CVWH 1O3KA 1P3EA 5F03A 3ZVGA 1OYQA 2TIOA 4ESTE 3S9AA 2A45B 8KME2 2AMDA 1ANDA 2ANYA 2FI4E 1MD7A 1BRCE 4GAWA 1O5DH 3UR9A 5FPTA 1P9UA 3U8OH 5TCCA 1NROH 2FWWA 3B23B 4YZUA 4K60A 1IQHA 2PGQB 5C3NA 2PSYA 1WAYB 1BT7A 1LQDB 4INHA 1GDQA 2SGAA 1BHXF 3QTVH 1O2HA 2XNIA 2AEIH 2G55A 1C5TA 2PFEA 3P17H 2IOTA 1IQLA 1PPZA 1ZGIA 1YLCA 4D9RA 1TGSZ 3RU4T 1L4DA 1Z6EA 1TNJA 2CXVA 3BIVH 1AZ8A 1FI8A 1PPHE 1NFYA 2ZU5A 4GVUA 1EATA 1WCZA 2ZPSA 1GBMA 2A5KA 2AFQB 3RXTA 4TY6A 1KY9A 4CH2B 1OX1A 2TRMA 3MH4A 4BANB 4X8SH 1O2KA 2ZHWH 2ALPA 1EPTB 4AGJA 2TGDA 4UFDH 2BXUH 5DP3A 5FBIA 3RXAA 1H9LB 2EI7A 2J38A 3B8JA 1Q31A 1YPJH 1S6HA 2QXGA 4GPGA 4TWWA 3UNQA 4KGAA 1O2VA 1ZOMA 1DWBH 2A31A 5DP4A 1T8MA 2B5TB 2TGPZ 1P9SA 4AGKA 1NRSH 1ZRBA 2V0BA 4K1TA 1TWXB 2Y80A 2KAIB 4XFQA 1XUJA 2CF8H 5FAHA 2ZI2H 1NFWA 2UUYA 3GCTF 2ALVA 3UWIA 1P2OA 4AYYB 3NWUA 4TYDA 5EOKA 1QBNA 1ELAA 2B7DH 3QLPH 2CF9H 5AFYH 1G37A 3V3MA 1GVKB 1AIXH 3M5NA 1W11U 4F4OC 4X8VH 1YGCH 2VINA 2BD7A 3ZVFA 3TPIZ 1G3EA 1B5GH 4UFGH 1CHOG 1VITG 4ZKSU 1FY4A 5K0HA 3SGBE 3MO6A 1RXPA 3A7TA 3SNDA 4IMZA 4AFUA 1G36A 1MKXK 1TPAE 1V2NT 3SI3H 2Z7FE 3ENSB 4GHTA 4X6PA 2BDYA 2VIOA 1O5AB 1O3PB 4ZXYH 4I31A 5I46H 3MOCA 4ABEA 1V2UT 3HPTB 3GISB 2AIPA 5ESBA 1SG8B 1ELDE 5EQSA 1Y59T 2C93B 2IN2A 1PPEE 1OWIA 3UOPA 2STBE 1WSSH 3AW0A 1O3BA 1KLIH 1O2SA 2FODA 3DT0H 2LNCA 1E0FD 1OP0A 3K6YA 5AHGH 3SUDA 4AOQA 1ETRH 1VJAU 2ZHEH 1BIOA 1SB1H 1ARCA 1SLVB 1WTHD 2PHBA 2J4IA 4E7RG 3A7VA 4MNXA 1WYKA 2ILNA 4JZFH 4CBOA 4DJZB 1FN8A 5GDSH 1MUEB 3GDUA 2FYRA 2R3UA 2ZCKP 2P94A 1QB9A 2G4UA 1VGCB 1LO6A 2ANKH 2Q6DA 4JZ1A 1Y5BT 1EOJA 2GX4A 2JH0D 1TX7A 4XSKU 3BEFB 1K21H 1NU9A 3ZVAA 1RIWC 4Y6DA 1XUFA 2GCHG 1ZJKA 4U30A 3TNSA 1BJVA 1F92A 2PKAB 2PR3A 1UCYK 1YLDA 3LT3A 1HYLA 1AQ7A 1SFQB 1THRH 1ZHRA 5A8XA 1A2CH 1B7XB 2H5CA 1C4U2 2RA0A 4NWKA 3OY5U 3ZVEA 1T4VH 2P8OB 3ZZ9A 1BTXA 2GCTB 1GI0A 2YOLA 1AFQC 4K3JA 1UTMA 2F3CE 3BTDE 5T6DA 3P8FA 1CA0C 2FI3E 2J2UA 3LH1A 2OCVB 1O3CA 1VZQH 3TNTA 1BCUH 2Q1JA 3KIDU 4HI3A 2OXSA 2G5NA 1AMHA 1NRQH 1H4WA 3F9GA 1SGFG 1DSUA 3PM3A 4XOJA 1O2TA 2WUCA 1T31A 1HIAA 1Y5UT 3GCHC 1BUIA 1SOTA 5E0HA 4OS2A 3ZZ4A 4BAHB 3BSQA 1AHTH 5FX5A 4AFQA 1CGIE 2ZGXH 1O3HA 1OPHB 1A7SA 1EJAA 1C2LA 1P57B 4X2WA 1AI8H 2QC2A 1GHZA 2VH6A 3PWCA 1C2FA 3G01A 4MVNA 1Z8GA 3GY7A 3VB7A 1TFXA 1PJPA 3LKWA 1E37B 5FPSA 3M5LA 1UTNA 1ANBA 3MNBA 4CREA 1GBFA 2F83A 2BQ7B 4K8YA 3SUEA 4IS5A 4SGBE 3RXEA 2ZFFH 1LQEA 1IQMA 5LH8A 3ZZ3A 2PUXB 1FXYA 1W3CA 1FQ3A 1QBVH 1S0RA 1SVPA 2ZF0H 2ZIQH 5J4SA 2FP7B 5JBTA 5E2PA 1T32A 4GLYA 1V2PT 1GJCB 3A7YA 3SV2H 1C1TA 1DUEA 1TALA 1C1SA 3F68H 1V6DA 4WVPE 2AGIX 2BLOA 1NC6A 2BLQA 1ZTLA 2NU2E 1MKXH 3RMNH 3P8NA 3UWJH 3GY5A 5EPNA 2UWOA 2RCEA 2UUKB 3KN2A 1P12E 2PKSC 1FIWA 1EXFA 1P03A 2OLGA 2BD2A 1THSH 4ABJA 1O5FH 3BTFE 4BNRA 1QHRB 4O3UA 1HAVA 5SGAE 3BTWE 4B71A 1NPMA 2PTCE 2OD3B 1MCVA 5GXPA 3H5CB 1ETSH 1BBRE 3A8AA 5GCHG 1ZGVA 3UPEA 1W14U 3OSYA 5EODA 2DUCA 3HGNA 4DURA 1KDQB 1Z8IB 5FCKA 2ZU2A 1EZQA 1C9PA 4XBCA 2XC4A 1W10U 1DT2A 2XC0A 4NIXA 3H7OA 1PPFE 4A1XA 3FZDA 4AB8A 2PLXA 1VITF 1S85A 2BDBA 3LIWA 1GJ5H 3NZIA 2BD9A 1MTNB 1AFQB 2GT8A 5C5NA 1ZSJA 4B2CA 1BMLA 1SGRE 1F0RA 4K8BA 4OS6A 1LHEH 2ZECA 1HAGE 1Z71A 1F0TA 1K1JA 1DWCH 2V6NA 5T6FA 3P8GA 4BAOB 2FOAA 1UCYH 2ZDLA 2JH5D 1AZZA 1ABIH 1MAYA 3GCHB 3ZVDA 1UK2A 1AU8A 1TNKA 2G00A 1GI2A 2D8WA 1INCA 4HTCH 1OWKA 1GG6B 5AFZH 3RLWH 2Y7XA 1SBWA 1V2VT 1AVXA 4HZHA 5HGGA 3NCLA 7GCHF 4THNH 1UVUH 1A46H 1C5NH 4ABFA 4MPWA 1AB9C 3S0NA 1LTOA 2AS9A 3M7QA 5JDUB 2CJIA 5DPAA 4NIWA 2R0KA 1D3TB 2ZHFH 3GY2A
chains in the Genus database with same CATH superfamily
4WJG2 2JKHA 1H8DH 4BXWA 4U32A 1V2MT 2XWBI 4AYVB 2G8TA 1O3MA 3S69A 2ZCLP 2GD4B 4DIHH 1K28D 4F49A 1TPPA 2W3IA 1MU8B 3UUZA 4NA7A 3S7HB 2XCFA 1QNJA 3A89A 1PQAA 1NN6A 1PQ8A 3DA9B 1O36A 5E2OA 1E1RD 1O2RA 4FXGH 1O2PA 3SNEA 3RXCA 1BRBE 4GCHG 3TK9A 1K1NA 4X2YA 1MKWK 2HGTH 2P59A 1XM1A 1A5HA 2AGEX 4M7GA 3QN7A 4VGCB 4QT8C 3STJA 1EAXA 4X1RU 3OE7D 4CBNA 1MAXA 3MH6A 3F9FA 2B0FA 1Z7KA 4OS5A 4OGYA 1O0DH 5ESTE 4Q7XA 2GP9B 3OFND 3A88A 3M7UA 3DSOA 5EQQA 2FO9A 4A7IB 3KQBA 3V13A 5K7RA 3L6PA 1VJ9U 2BZ6H 2F4LA 2RFKC 2ZPRA 1A4WH 2FOMB 1AWHB 2A4GA 2SGFE 4CHAB 2C8YB 1ELVA 4AC9A 3P8OA 1QB1A 1GHWH 2W26A 1EAUA 1GI8B 1MH0A 1W13U 5A0BA 3ESTA 1P09A 2HLCA 2XWAA 4Y8XA 4X1NU 1IQNA 2WHXA 4B75A 2FOCA 4DOQA 1L1JA 4ABIA 4MPVA 2BY9X 2QA9E 1C2DA 1XMNB 3SGAE 3C27B 4HFPB 5DP5A 1CGJE 2SFAA 2UUFB 1E38B 1EPTC 1LVMA 3ZV9A 2Z3DA 4Q7YA 5L2ZH 3RC5A 1UTJA 1C2KA 3FAOA 1ZTJA 1VKYA 2WPMS 1NFUA 1TQ7B 4ZH8A 4DVAU 7ESTE 2BOHB 8ESTE 2P3FH 1YYY1 8GCHF 5C5OA 2NWNA 3T29A 1W0YH 5C94A 3RC6A 1GVLA 5GWZA 3SYJA 4ABAA 2STAE 1FZZA 1VITH 3KYFA 5F8ZA 1C5SA 2PWXA 1W0JD 2A1DB 1F7ZA 2VIDA 3M3TA 2OC0A 1SQAA 1SGQE 1C2HA 1MTWA 2R2WU 3Q3KA 2OP9A 1BMNH 4NSVA 1Y3UA 1UO6A 3AW1A 1BRAA 3VB5A 1AB9B 4LOYH 3SO3A 1GBTA 1Z1IA 4DG4A 1CU1A 1UVSH 3UQVA 3A83A 2FOHA 3V0XA 1EASA 4ACAA 6LPRA 4RKJB 2HLDD 4YOIA 1S6FA 2Z3EA 3UIRA 3N7DA 2ODPA 1C5ZB 2GZ7A 2Y7ZA 2CGAA 5GCHF 1OKXA 1N1LA 1DXPA 1W0KD 3MU8A 2ZFQH 3QWCH 1TGNA 1C2EA 4Z1MD 2J5UA 1GBAA 1TA2A 4IC5A 4CRGA 4AZ2B 3O8RA 3TGIE 4U01A 4DY7B 1P2JA 4AG2A 3FFGA 3ZYEA 2TBSA 1HUTH 2FX6A 1C5QA 3S9BA 3SUGA 4HG6A 4XDEA 3T28A 3MTYA 4WH6A 1PFXC 1KXAA 4GSOA 1FY1A 1AN1E 1Z1JA 3RXUA 1J8AA 1L1GA 2GDDA 3V7TA 1EZSC 1KIGH 1C1UH 4TY7A 4FUFA 1DOJA 2W7UA 2VNTA 4ZUHA 1GJ7B 3PLKA 2VH0A 1SGFA 3RMOH 4BTUB 2FIRH 1C5XB 2OC1A 4UFFH 3QDZB 2ZCHP 1G3CA 2V35A 1CT2E 1VGCC 1VR1H 3OY6U 3RXMA 3ZVBA 1GI1A 1NO9H 2CV3A 3BTEE 2R0LA 3D23A 1MZAA 1NTPA 2V3OH 1QL8A 2OBOA 3QGJA 4H6SB 1ZZZA 3A87A 2VVCA 3LJOA 1IQFA 3M36A 2AMQA 3W95A 4Z6AH 1MKWH 1GWAA 2O8WA 3MO9A 3RXVA 2BDHA 1ESAA 3UQOA 4ZKOU 1GJDB 1EJMA 2Z9JA 1AVGH 3MU4A 1GI5A 1FAKH 3RXBA 4WXIA 1HAYB 4DIIH 1TOMH 4X1PU 1BHXB 2P8OC 2GCTC 1NM6A 4P02A 1NZQH 1C5VA 5GIBA 1X7AC 2GV6A 3AAVA 1HAOH 2ZFPH 2WPIS 1N6YA 4TPYA 2QCYA 4X2VA 3SV6A 1WUNH 1WQSA 1QL9A 1MTUA 3D62A 1HJ9A 2EI6A 1D3DB 1RRKA 2QN5T 3F2GA 2A7HA 3TLOA 2OINA 2THFB 1LHCH 5A8ZA 2A4QA 3MMGA 4FU8A 1QIXB 3R0FA 4YLQH 4ISHH 3FVFB 1M9UA 2KCAA 4NWLA 1V2OT 2JETB 4O03A 1KMHB 1QY6A 3ZYDA 1P2MA 4BTIB 4WXVA 5A2MH 1KXDA 3K65B 5JBAS 1GDUA 1AFEH 1UHBA 5E0GA 5EG4A 2J92A 3OYPA 3TJOA 1D3QB 1OWHA 3I78A 3SU6A 3GOVB 1HAPH 1ZHMA 1HIAB 3NXPA 2W3KA 2A5AA 5EW1H 4KTCA 3TK5A 3BTME 4X1QU 3SHCH 2FLBH 3VEQB 1GHAF 2W6JD 2XOKD 2PTNA 2KM0A 1QB6A 1ELTA 2VWNA 2FESH 3UB0A 6ESTA 3AVZA 2W7SA 1HJAB 1UW7A 1NFXA 1TBQH 3LGUA 4MNWA 2F9BH 1OWEA 1PPBH 3BEIB 3LPRA 1FPCH 1A0LA 1A1RA 2D2DA 1Y3WA 2BD4A 2BLVA 1C5YB 5B6LA 1NBMD 1UVTH 3TH4H 1B0FA 3GCNA 2BVXH 1G3BA 3OEED 1PQ7A 2RA3A 1S5SA 1EP5A 1RTKA 3HK3B 3WY8A 4LK4A 2ZGJA 1IAUA 2V3MA 3PB1E 1PQ5A 3A85A 1XXFA 3NUMA 5HYOA 1J14A 2O8LA 1O5GH 2ZU4A 1SL3A 1T8NA 2QE7D 3ZZ8A 3LC5A 1C1QA 1EAWA 1C5PA 1TMTH 1ZPBA 3SNCA 2VJ1A 4E06H 5C0UA 1GMCG 1FDPA 1GI7B 5A0CA 4YOGA 2ZG0H 3TH2H 1D6RA 1L2EA 2CHAB 4GUXA 1BQYA 4X0WU 2Z9IA 2QV1A 2ZTYA 2HOBA 2ZDKA 2LELA 4R0IA 3PMJA 4TWYA 1GVZA 5FHTA 3CS7A 1DFPA 1AE5A 1EPTA 4LZ4B 5L30H 6GCHG 4ISOA 1QCPA 2H1UA 1HAVB 3AK5A 1UTQA 1DICA 1HB0B 1JBUH 4JCNA 1MTNC 3E16B 2A0QB 3RXQA 1YKTA 1IOEA 3ELAH 2WSSD 4MLFB 3VB3A 1KLTA 3SU1A 1WQVH 1P8VC 1MBQA 1P06A 2WYJA 4PROA 1S81A 2KAIA 3ODFA 1Z6JH 5DO4H 4B6EA 1O35A 2OBQA 2VIWA 2TPIZ 4BAKB 1K9OE 2BD8A 2BOKA 1P11E 1XXDA 4X6OA 5LPEA 1YCPK 1E35B 1LPZB 2J98A 3CENA 4YLUA 1VCQA 4ABGA 1GG6C 4ASHA 5TJXA 1HNEE 1C2MA 4HGCA 1TMUH 1Y8TA 2PW8H 4NGAH 1JIMA 2Z94A 1TLDA 3OTJE 2ANWA 2Y82A 3BG8A 4JMYA 3MU0A 2UWLA 3T2NA 3MWIU 1XUHA 3EQ0H 2ZTXA 3BEUA 1XKBC 2Z3CA 2BD5A 4B74A 2HPPH 2FEQH 3BIUH 3EAJA 1QZ8A 3RDZA 3SU0A 1GMHG 4JYUH 3I29A 4K1EA 2BLWA 1HGTH 3KNXA 2BY7X 1W7GH 1FUJA 5C17A 1JRSA 1O2ZA 5C0TA 3DD2H 3RXFA 3GCOA 2YMSD 1QURH 1K1OA 1TAWA 2J97A 1TPSA 1EQ9A 2C8ZB 4Q4LA 1FONA 1FY5A 4H4FA 1MABB 1P2QA 1L1NA 3EA7A 4Y0ZE 4YO9A 4ABBA 1YC0A 3A8DA 3PTNA 1ZJDA 1O31A 1ACBE 2BB4A 2EC9H 3M5MA 1GHXH 2BMGB 4VGCC 1ELFA 5H4IB 4ZMAH 7LPRA 1JXPA 1DLEA 2QY0B 1C1VH 2CMYA 3MNXA 1BJUA 4UD9H 1OXGA 5T3HA 2QGRA 3U69H 4OS4A 1UTOA 3QTOH 1EAIA 1GHYH 2Q6GA 1O2OA 1YBWA 4ZCNA 1AKSB 1MBMA 2GMTC 3BG4C 1T7CA 3UR6A 3BN9A 2J9NA 3VB6A 2GVFA 1TRMA 2Y5FA 4JK6A 2ZU1A 1VCPA 2PKAA 3KYGA 1GBHA 3MO3A 1EB1H 1NBME 1GMDG 3SQHE 1YF4A 5HKKD 1LPKB 5EW2H 1F2SE 1LMWB 3RXIA 1COWD 2G52A 3MI4A 2FXRA 2FS8A 4D7FA 2KFWA 1C4V2 1ARBA 4CHAC 2AHME 1SPJA 2CK3D 2BTCE 4MTBA 5EGMA 2ZEBA 3OAAD 4A6LA 1LDTT 1JIRA 3STIA 1LKAA 1DE7H 4D8NA 1E36B 2P3TB 4X8UH 1F5LA 1DPOA 3DFJA 4YT6H 1SLWB 4JZEH 3RXSA 1CHOF 2F9PA 3LGVA 1TE0A 1TABE 1QL7A 2FZZA 4CRAA 3A81A 3T26A 3U28C 3BTKE 3GY4A 1U6QA 3FKSD 1AO5A 5CE1A 3PO1C 4MPUA 1H8IH 1OP2A 2OQ5A 4ZXXH 1AVWA 1IQGA 1XX9A 3A8BA 1SQOA 1ORFA 4Y7AA 1V3XA 3UOUA 3DHKH 3R3GB 1A5IA 3C1KA 4KELA 1YPGH 1C1RA 4I8JA 4UEHH 4AFSA 1C1OA 1F0SA 1BTYA 5CDFE 1LHDH 3SJKA 2P95A 1AE8H 5EJ1A 1ZPZA 1SOZA 1S83A 1THPB 2F9OA 3FP6E 1UK4A 4Y8ZA 3DUXH 3TH3H 1GBEA 1FNIA 1ZMLA 3RMMH 2HNTF 1P2NA 2JJ1D 3FOAA 3PWBA 3PV5A 3KQDA 1TGBA 4RN6A 2EY4C 1T8OA 1J17T 1YCPM 3A84A 4I8GA 5A8YA 3SUFA 2EEKA 2LP6A 4B73A 2IPQX 1QA0A 4E05H 1UTKA 1C1NA 1LVBA 4CRFA 2OTVA 2KR7A 2M2AA 3BTHE 1EOLA 1A0JA 3SV8A 1XUIA 4KKDA 1UMAH 3FN8A 2H5DA 3P92A 2W5EA 2QXHA 1YCPH 2UWPA 4FVBA 2YMSC 3OU0A 2GCHF 1W12U 4E7NA 1LKBA 1BTPA 3W94A 3A7WA 4NFEA 1P05A 5LGOA 3WW7A 1BBRK 3F3BA 2K8IA 4DGJA 5TCAA 4AFZA 3RXDA 1S0QA 3A82A 4NA9H 1BTWA 4Y7BA 3HKJB 1A0HB 1CT0E 4YOJA 1C5MD 3SNBA 1QQUA 2C8WB 5FBEA 2HWLB 4FVDA 4YTAA 3JZ2B 1KSNA 1O2IA 4JZDH 3LOXA 1QJ6B 3OX7U 1FLEE 4FUCA 2GMTB 3BG4B 4WWYA 1TQ0B 4OM9A 3SU2A 1EJNA 1MQ6A 3GCTG 2F9NA 3LH3A 1NRPH 2BYAX 4ASUD 5L2YH 1HAXB 1SSXA 1RTLA 2VGCB 2NU3E 1KDQA 1QGFA 4UE7H 5A0AE 3KHVA 3KF2A 2ZFSA 4Y11E 2BHGA 4LXBH 1DY8A 4BAQB 4CR9A 1P02A 9ESTA 2WPKS 1XKAC 3SI4H 1JWTA 1O3NA 1V2RT 2FOFA 4NSYA 3SU5A 1Y5AT 2GKVE 1FY3A 1GBCA 3W1EA 3F9EA 2FTMA 1C1PA 1O2UA 1G2MA 3AAUA 3HKIB 3LGYA 1FV9A 1NU7B 4NG9H 4LZ1H 2SGPE 1HPGA 1W0ZU 1BMAA 5EQRA 3TK6A 1ANEA 1O34A 4ABDA 2WV5A 2OQUA 3ZZDA 1ELGA 1DM4B 3PO1B 3SNAA 5HM9A 1LPGB 1C1MA 5FPYA 5F8TA 4MDSA 2AMPA 4CH8B 3RM2H 2UUJB 5IYTA 1GCDA 1HV7A 4D7GA 3E0NB 3M61U 1YPLH 3LJJA 1O3FA 3SBKA 1TBZH 1ESTA 1O2MA 4NA8A 4IN1A 3RXLA 2OUAA 1XVMA 1TYNA 3AASA 4MNYA 2R9PA 1G9IE 4FUIA 5E8EH 5T1VA 2KCOA 3QK1A 1GI4A 4WMEA 1YPHC 1O5EH 1RFNA 3MYWA 4SGAE 1AUTC 2R2MB 3SJIA 4INKA 3U1JB 2XBWA 4ZROA 3TGKE 2KCYA 5C1XA 4FUHA 1SFIA 4I32A 3M35A 5AVDA 3ZV8A 2JETC 2ANMH 1OWDA 2BM2A 1FJSA 2FOBA 4X1SU 1G30B 1O2JA 2ZC9H 1O2WA 2H2ZA 1SLXB 5E0JA 2EI8A 3RUOA 5FX6A 1O2XA 1O3LA 3E6PH 2L6OA 2F9VA 4WH8A 2OK5A 1O2QA 1YPHE 1O38A 2QYIA 1FAXA 2NU1E 2WZQA 4K2YA 1UTPA 1V2KT 2BVRH 4ZHAA 1D6WA 2BY8X 2YMSB 1KYNA 4FUDA 4F55A 5FCRA 1DX5M 1GHBG 1SI5H 3F0PA 5JPMH 1DUAA 2Z9LA 1WOFA 1GL0E 5PTPA 1HJAC 2H9TH 2ZDMA 4Y76A 3SV9A 1N8OB 3UFAA 2XC5A 4IMQA 4Q80A 3S7KB 3ATWA 3DFLA 1OSSA 1D9IA 3BV9B 3GDSA 1CBWC 2VIVA 2ZGBH 1E34B 1HLTH 5HXFA 3PROA 3EE0B 1GJ4H 4BOHA 4J2YB 5C2ZA 1TGCA 1CA8B 1HDTH 3PMBB 3MQKC 3QGNB 1DY9A 1GI3A 2BD3A 3QZQA 4WMFA 2B9LA 2SGEE 3QZRA 1W8BH 2XRCA 2VWLA 1LHGH 5JBCS 1TRNA 2O8MA 1GBIA 3ZZ6A 4NZQA 4TSFD 4Y71A 2QF3A 1BBRH 1GBDA 2YNBA 5EXLA 2K0QA 4FUBA 3TU7H 2ZQ1A 3PLPA 3KQ5A 4JYTA 1DVAH 4K1SA 6CHAC 1TOCB 3NK8A 2CHAC 3PYHA 3GY6A 2A2XH 3SHAH 3FZZA 1T8LA 3OTPA 3E90B 5ETXA 2C90B 1LCYA 1TA6A 3PV4A 5DJ7A 1H1BA 4Q63A 1J15A 3ITIA 4INLA 2QIQA 3S9CA 5C20A 2F91A 2LPRA 1ETTH 1J9CH 1EP6A 3HATH 2JH6D 2Y5GA 2B8OH 4UONA 1ELEE 1ID5H 1F5RA 2D1JA 1JRTA 2DE8A 2G51A 4K5ZA 4ZKRU 3SN8A 1O3EA 3ZZ5A 1MZDA 2JDID 1ZMNA 1KXCA 4NCYA 4CRBA 2VVVA 1Z8RA 1SGDE 3ATLA 1Y3YA 1EKBB 4AG1A 4MG3A 4I8KA 2AERH 4DT7B 1K1PA 3KCGH 1V2JT 1O2YA 1QJ7B 3EA9A 1BA8B 3RXRA 3UTUH 1V2TT 2BY6X 2Z6BD 2K1QA 3JZ1B 1Y3VA 2PV9B 4X6NA 1XVOA 2BDGA 3GS9A 4GCHF 1ELBA 2H6MA 3I77A 2XW9A 1HXEH 3WWFA 3VG8A 1TX6A 2YNAA 2BDAA 2IJOB 1TNLA 2A7CA 1HFDA 1O3OA 1RD3B 4IW4E 1UCYE 2L74A 4H6TA 3V12A 2BY5X 1HAHH 1OWJA 2GV7A 3DSPA 1OP8A 2ODQA 4JYVH 1ELCA 3Q76A 2JIZD 1FIZA 4I7YH 1ZTKA 1EZUC 1A61H 3TJUA 1V2WT 1OOKB 1LVYA 1JOUB 1DITH 4ZHLU 5F8XA 2A5IA 1BOQA 2SGQE 5T6GA 3RXKA 3UAIC 3URDA 1ZSKA 1K2I1 1TIOA 2WPDD 1J16A 1GJAB 4MPXA 2AH4X 5FXLA 2HALA 1GCTB 5DN6D 3GY8A 5DSFA 1HCGA 2I6QA 4OS1A 2VVUA 4Q7ZA 3PMHB 3ZZBA 2CN0H 3UNRA 2HVXA 3BTGE 1C5OH 2H9EH 1V2ST 2ZDNA 1G2LA 5EU8A 1GBJA 2D26C 4Y0YE 1CBWB 1O33A 3MNCA 5ABWA 3QX5H 1CO7E 2NU4E 1IQJA 4ZHMU 5LPFA 3BTTE 3MU5A 3KGPA 2Y6TA 1IHSH 2ZGCA 2Y81A 3VFEA 4I8LA 2EA3A 3D65E 3U8TH 4TPIZ 3L33A 3CP7A 1SMFE 2ZWLH 2XBVA 2VU8E 2BDIA 3E1XB 3M3VA 2BZAA 7GCHG 1H8HD 3OEHD 3ATKA 3PMAB 2BVSH 1G32B 2WV9A 1GJ8B 1CT4E 1GJBB 3KEEA 1YPMH 2BX4A 3ZZCA 1HXFH 3ATIA 2DE9A 4CR5A 6CHAB 2ZFTA 1LVOA 3HK6B 3SZEA 5EJZA 5C67A 1GJ9B 1QRWA 3IWMA 2P16A 1QJ1B 2VB0A 5HM2A 3B9FH 4J1YA 2M5TA 1CSOE 2H9HA 1CQQA 1L0ZA 3DSGA 2A4RA 1A3BH 2WYGA 1O2GH 3TJNA 5J4QA 2ZU3A 1GI6A 2ZZUH 4XE4A 1K0HA 1FX0B 3TITA 4RT1A 2J94A 1DWEH 3FANA 3GYMA 4A1TA 1K1MA 3E8LA 5EXMA 3K6ZA 2XBXA 2RG3A 5FL7D 1ZLRA 4B2BA 2XTTB 2WINI 1EZXC 3SV7A 2QXIA 1C5LH 3EYDA 3VGCC 4D9QA 1GHBF 4I33A 1TONA 1MCTA 3PLBA 5C1UA 1GBLA 1RTFB 4ISLA 1GJ6A 4Z0KA 3SW2B 2GZ8A 2BQWB 2HPQH 3F2FA 4O9VA 4B76A 1UK3A 2ASUB 2J34A 5HMAA 3CS0A 2PSXA 5DK1A 4WMDA 1QQ4A 1QA7A 3MH5A 5DP8A 3RXJA 4DCDA 2ZHDA 1CGHA 3IG6B 2ODYB 1QTFA 1BTUA 1RGQA 1ZMJA 1GL1A 5GPIB 1DANH 4TT3D 3QUMP 1O5CB 3O8DA 2FS9A 1CHGA 1TB6H 3T5FH 3Q00A 2GJGA 3SJ8A 3TVJB 4NIVA 5AF9H 2FYQA 1YM0A 4IGDA 2FPZA 3O8CA 4FU7A 1O39A 3LONA 4XBDA 1GI9B 1WTGH 2HNTC 1BMMH 2ZGHA 3T62A 5DP9A 2VBCA 5CHAC 3T25A 1WU1A 4NFFA 1IHTH 1XUKA 8LPRA 5KECA 1PPGE 1D4PB 3GYLB 1GHVH 3A86A 1P10A 1NS3A 3F1SB 1A5GH 1KTTB 1DLKB 3CNRA 4YXWD 1OHHD 1OS8A 2NU0E 2RDEA 3Q77A 1BITA 1ZRKA 2FMJA 4DW2U 2O9QA 5IK2D 1HAZB 2XCNA 8GCHG 3ODDA 3VPKA 1C2JA 1O2LA 1MD8A 5DP6A 1TNGA 1DDJA 1SQTA 2HNTE 3IITA 5JB9S 4YM9A 2G5VA 4JK5A 3LDXH 2ZP0H 3U9AH 2HVYB 3SOSA 3NPSA 3H09A 2A32A 2FX4A 1W7XH 1HRTH 3ATMA 4F48B 2OC8A 3EE7A 4ISIH 1BB0B 9LPRA 3P70B 1BDAA 2VGCC 1EUFA 2TGAA 4MNVA 3FO8D 1TX8A 2XBYA 1GBKA 2ZPQA 1KXBA 1P01A 1MMJN 3F6UH 2KZ4A 2ZKSA 1G3DA 1P3CA 1SGTA 1TBRH 1TRYA 2BX3A 5G4BA 5EIYA 1IQEA 1SLUB 4RKOB 2R3YA 3M3SA 2ZDAH 2O8TA 2WPHS 1HJ8A 1QRXA 1O3AA 2VIQA 4GHQA 4AX9H 1ZYOA 3RXPA 2QXJA 2GZ9A 1KXFA 1Z8JB 1P04A 1PYTD 1NT1A 2VIPA 1SGPE 4BTTB 1P2IA 1RIWB 2WV4A 3U1IB 2G81E 3D49H 4AB9A 1RS0A 1UJ1A 3BF6H 3RXHA 3MHWU 2SGDE 1EB2A 2QAAA 5HIZA 2FI5E 4UFEH 2FTLE 3SGQE 2I6SA 2BQ6B 4I86A 4BAMB 3URCA 3Q3YA 3RU4D 3ZZAA 1TPOA 1SR5C 5DP7A 3UNSA 3VGCB 4YT7H 5CMXH 3RC4A 3M7TA 4WF8A 1MTVA 2PUQH 3RMLH 3SJ9A 4FUEA 2Y5HA 1CA0B 1C4Y2 5JYIA 1S6LA 4FUGA 4O3TA 1C1WH 2FOEA 4Q2KA 3A80A 2FOGA 3SQEE 1WV7H 2Q6FA 1O2NA 1SGYE 2V3HH 1DSTA 3HGPA 3LU9B 3TJVA 1GBBA 3E0PB 4OS7A 1IQKA 3MNSA 1OYTH 4YESB 1C9TA 1SGNE 1BMFD 2A7JA 2A2QH 2O8UA 3MU1A 4Y79A 5DKMA 1O5BB 1YPKH 4NIYA 2FDAA 2ZTZA 4OGXA 1SKYE 3UREA 1H9HE 3H7TA 3MH7A 3RM0H 3LGWA 5EXNA 3TGJE 4KTUA 3M37A 3O8BA 2BDCA 1GMCF 4U2WA 1AY6H 1T4UH 4IC6A 4JZIA 2RDLA 3SJOA 3RP2A 4BXSA 3RLYH 1Q2WA 1O30A 2GT7A 4A5TS 2OC7A 3GICB 5CHAB 1C5RA 1YPEH 1SGEE 1H8ED 1B0EA 4X8TH 1N8OC 4Y10E 5JB8S 1MTSA 3M5OA 1GGDC 4I8HA 1VCWA 3N7OA 4M9FA 1GDNA 2JJ2D 1O32A 1ABJH 3FP8E 1EX3A 3LGTA 1QFKH 6GCHF 1V2QT 3EDXB 1AKSA 3FP7E 1SHHB 1MU6B 1NESE 1NRRH 1V2LT 2QF4A 2V7QD 1Q3XA 4IBLH 3RXOA 4B2AA 1H9IE 1WDIA 4KP0A 4ACBA 1AWFH 1DWDH 3A7ZA 1A3EH 1AD8H 1S84A 3T27A 3GDVA 1AGJA 1QR3E 3LGIA 3P95A 3K9XB 5JBBS 1C5WB 2XXLA 1UVOA 1ZR0A 1D3PB 1KXEA 1AUJA 2AYWA 2P93A 1KTSB 1C2IA 1NY22 1O37A 2F43B 5IDKA 2FLRH 2C3SA 4XD7D 2P3UB 2PKSB 3ZVCA 4DT4A 3A7XA 3VXFH 4FUJA 4O97A 1PYTC 2AIQA 2ZO3H 4A92A 3K2UA 3P6ZB 1P0SH 1HBTH 1SHYA 1WBGB 1XUGA 4CRDA 4AORA 1TMBH 1GHAG 3SU3A 1QBOA 1UTLM 3VXEH 2TGTA 1BRUP 2ULLA 3TIUA 1F5KU 3EGKH 2GGVB 2BXTH 1C2GA 1HAIH 3U98H 1GMHF 3F9HA 1ZSLA 7KMEH 1O3IA 2Z9KA 1FPHH 1ZPCA 3Q3XA 3GY3A 4K69A 2FM2A 2ESTE 5F6MA 2Z9GA 5DGJA 1CE5A 1K22H 1O3GA 1K1IA 1FN6A 2ZA5A 4AN7A 1F0UA 1K1LA 2XYAA 1ANCA 3L3TA 4ZKNU 3UY9A 3NKKA 3LC3A 3QO6A 4XBBA 3ZZ7A 4FETA 1Y3XA 1SC8U 5I25A 4WY3A 1YP9A 3F2HA 3E91A 4Y8YA 5GJ4B 1BZXE 5C1YA 1FMGA 1ESBA 2WPLS 3RU4E 3U8RH 1QRZA 3ZIAD 4RI0A 3VB4A 2WPJS 4A1VA 2SNVA 3WWBA 4UDWH 2KCPA 1IQIA 2QF0A 2QF5A 2C8XB 4R8TB 3EA8A 1KLJH 3DCLA 1P2KA 3A8CA 1SGCA 3SU4A 1FY8E 3SORA 4NZLA 5L6NH 2VWMA 2J95A 2PGBB 1GCTC 2F9UA 3E3TA 1GMDF 3KQCA 4KTSA 1E79D 1TGTA 1DXWA 2ZQ2A 1LHFH 5A09A 2A4OA 4ZAEA 1TNIA 4ISNA 2VWOA 1BTZA 4X6MA 2ZNKH 3MFJA 5BRRE 2GTBA 2ZHQH 1GGDB 1TNHA 2GDEH 2ZFRH 2WUBA 5DG6A 1GPZA 3KQEA 4MQAA 3RXGA 1UHBB 1O3JA 1NRNH 1O3DA 4IN2A 1DS2E 1PPCE 1RJXB 4D76A 1JMOH 1SGIB 3PTBA 4H42U 1S82A 1ZHPA 3SZNA 2C4FH 4FU9A 1UVPA 5LPRA 5BPEA 1N6XA 2IPHA 4ABHA 1L4ZA 2SNWA 4RSPA 1MQ5A 1BTHH 1W2KH 5EPYA 4B1TA 2AGGX 3BTQE 4X2XA 1C5UA 2ZDVH 3KL6A 2HRVA 5B6OA 2G4TA 4CRCA 1CVWH 1O3KA 1P3EA 5F03A 3ZVGA 1OYQA 2TIOA 4ESTE 3S9AA 2A45B 8KME2 2AMDA 1ANDA 1YLNA 2ANYA 2FI4E 1MD7A 1BRCE 4GAWA 1O5DH 3UR9A 5FPTA 1P9UA 3U8OH 5TCCA 1NROH 2FWWA 3B23B 4YZUA 4K60A 1IQHA 2PGQB 5C3NA 2PSYA 1WAYB 1BT7A 1LQDB 4INHA 1GDQA 2SGAA 1BHXF 2W6ID 2XNDD 3QTVH 1O2HA 2XNIA 2AEIH 2G55A 1C5TA 2PFEA 3P17H 2IOTA 1IQLA 1PPZA 1ZGIA 1YLCA 4D9RA 1TGSZ 3RU4T 1L4DA 1Z6EA 1TNJA 2CXVA 3BIVH 1AZ8A 1FI8A 1PPHE 1NFYA 2ZU5A 4GVUA 1EATA 1WCZA 2ZPSA 1GBMA 2A5KA 2AFQB 3RXTA 4TY6A 1KY9A 4CH2B 1OX1A 2TRMA 3MH4A 4BANB 4X8SH 1O2KA 2ZHWH 2ALPA 1EPTB 4AGJA 2TGDA 4UFDH 2BXUH 5DP3A 5FBIA 3RXAA 1H9LB 2EI7A 2J38A 3B8JA 1Q31A 1YPJH 1S6HA 1WXRA 2QXGA 4GPGA 4TWWA 5KGOA 3UNQA 1YY3A 4KGAA 1O2VA 1ZOMA 1DWBH 2A31A 5DP4A 1T8MA 2B5TB 2TGPZ 1P9SA 4AGKA 1NRSH 1ZRBA 2V0BA 4K1TA 1TWXB 2Y80A 2KAIB 4XFQA 1XUJA 2CF8H 5FAHA 2ZI2H 2PP6A 1NFWA 2UUYA 3GCTF 2ALVA 3UWIA 1P2OA 4AYYB 3NWUA 4TYDA 5EOKA 1QBNA 1ELAA 2B7DH 3QLPH 2CF9H 4FOUC 1G37A 5AFYH 3V3MA 1GVKB 1AIXH 3M5NA 1W11U 4F4OC 4X8VH 1YGCH 1YWUA 2BD7A 2VINA 2J98B 3ZVFA 3TPIZ 5HIYA 1G3EA 1B5GH 4UFGH 1CHOG 1VITG 4ZKSU 1FY4A 5K0HA 3SGBE 3MO6A 1RXPA 3A7TA 2IJD1 3SNDA 4IMZA 4AFUA 1G36A 1MKXK 1TPAE 1V2NT 3SI3H 2Z7FE 3ENSB 4GHTA 4X6PA 2BDYA 2VIOA 1O5AB 1O3PB 4ZXYH 4I31A 5I46H 3MOCA 4ABEA 1V2UT 3HPTB 3GISB 2AIPA 5ESBA 1SG8B 1ELDE 5EQSA 1Y59T 2C93B 2IN2A 1PPEE 1OWIA 3UOPA 2STBE 1WSSH 3AW0A 1O3BA 1KLIH 1O2SA 3N7EA 3N99A 2FODA 3DT0H 2LNCA 1E0FD 1OP0A 3K6YA 5AHGH 3SUDA 4AOQA 1ETRH 1VJAU 2ZHEH 4P00A 1BIOA 1SB1H 1ARCA 1SLVB 1WTHD 2PHBA 2J4IA 4E7RG 3A7VA 4MNXA 1WYKA 2ILNA 4JZFH 4CBOA 4DJZB 1FN8A 5GDSH 1MUEB 3GDUA 2FYRA 2R3UA 2ZCKP 2P94A 1QB9A 2G4UA 1VGCB 1LO6A 2ANKH 2Q6DA 4JZ1A 1Y5BT 1EOJA 2GX4A 2JH0D 1TX7A 4XSKU 3BEFB 1K21H 1NU9A 3ZVAA 1RIWC 4Y6DA 1XUFA 2GCHG 1ZJKA 4U30A 3TNSA 1BJVA 1F92A 2PKAB 2PR3A 1UCYK 1YLDA 3LT3A 1HYLA 1AQ7A 1SFQB 1THRH 1ZHRA 5A8XA 1A2CH 1B7XB 2H5CA 1C4U2 2RA0A 4NWKA 1SQRA 3OY5U 3ZVEA 1T4VH 2P8OB 3ZZ9A 1BTXA 2GCTB 1GI0A 2YOLA 1AFQC 4K3JA 1UTMA 2F3CE 3BTDE 5T6DA 3P8FA 1CA0C 2FI3E 2J2UA 3LH1A 2OCVB 1O3CA 1VZQH 3TNTA 1BCUH 2Q1JA 3KIDU 4HI3A 2OXSA 2G5NA 1AMHA 1NRQH 1H4WA 3F9GA 1SGFG 1DSUA 3PM3A 4XOJA 1O2TA 2WUCA 1T31A 1HIAA 1Y5UT 4RT0A 3GCHC 1BUIA 1SOTA 5E0HA 4OS2A 3ZZ4A 4BAHB 3BSQA 1AHTH 5FX5A 4AFQA 1CGIE 2ZGXH 1O3HA 1OPHB 1A7SA 1EJAA 1C2LA 1P57B 4X2WA 1AI8H 2QC2A 1GHZA 2VH6A 5CHBA 1EFRD 3PWCA 1C2FA 3G01A 4MVNA 1Z8GA 3GY7A 3VB7A 1TFXA 1PJPA 3LKWA 1E37B 5FPSA 3M5LA 1UTNA 1ANBA 3MNBA 4CREA 5GNDA 1GBFA 2F83A 2BQ7B 4K8YA 3SUEA 4IS5A 4SGBE 3RXEA 2ZFFH 1LQEA 1IQMA 5LH8A 3ZZ3A 2PUXB 1FXYA 1W3CA 3PRDA 1FQ3A 1QBVH 1S0RA 1SVPA 2ZF0H 2ZIQH 5J4SA 2FP7B 5JBTA 5EJLA 4XRNA 5E2PA 1T32A 4GLYA 1V2PT 1GJCB 2EQNA 3A7YA 3SV2H 1C1TA 1DUEA 1TALA 1C1SA 4B6FA 3F68H 1V6DA 4WVPE 2AGIX 2BLOA 1NC6A 2BLQA 1ZTLA 2NU2E 1MKXH 3RMNH 3P8NA 3UWJH 3GY5A 5EPNA 2UWOA 2RCEA 2UUKB 3KN2A 1P12E 2PKSC 1FIWA 3PV2A 1EXFA 1P03A 2OLGA 5F53A 2BD2A 1THSH 4ABJA 1O5FH 3BTFE 4BNRA 1QHRB 4O3UA 1HAVA 5SGAE 3BTWE 4B71A 1NPMA 2PTCE 2OD3B 5KEDA 1MCVA 5GXPA 3H5CB 1ETSH 1BBRE 3A8AA 5GCHG 1ZGVA 3UPEA 1W14U 3OSYA 5EODA 2DUCA 3HGNA 4DURA 1KDQB 1Z8IB 5FCKA 2ZU2A 1EZQA 1C9PA 4XBCA 2XC4A 1W10U 1DT2A 2XC0A 4NIXA 3H7OA 1PPFE 4A1XA 3FZDA 4AB8A 2PLXA 1VITF 1S85A 2BDBA 3LIWA 1GJ5H 3NZIA 2BD9A 3NRLA 1MTNB 1AFQB 2GT8A 3F0OA 5C5NA 1ZSJA 4B2CA 1BMLA 1SGRE 1F0RA 4K8BA 4OS6A 1LHEH 2ZECA 1HAGE 1Z71A 1F0TA 1K1JA 1DWCH 2V6NA 5T6FA 3P8GA 4BAOB 2FOAA 1UCYH 2ZDLA 2JH5D 1AZZA 1ABIH 1MAYA 3GCHB 3ZVDA 1UK2A 1AU8A 1TNKA 2G00A 1GI2A 2D8WA 1INCA 4HTCH 1OWKA 1GG6B 5AFZH 3RLWH 2Y7XA 1SBWA 1V2VT 1AVXA 4HZHA 5HGGA 3NCLA 7GCHF 4THNH 1UVUH 1A46H 1E1QD 1C5NH 4ABFA 4MPWA 1AB9C 2KX4A 3S0NA 1LTOA 2AS9A 3M7QA 5JDUB 2CJIA 5DPAA 4NIWA 2R0KA 3PRBA 1D3TB 2ZHFH 3GY2A
chains in the Genus database with same CATH topology
4WJG2 2JKHA 1H8DH 4BXWA 4U32A 1V2MT 2XWBI 4AYVB 2G8TA 1O3MA 3S69A 2ZCLP 2GD4B 4DIHH 1K28D 4F49A 1TPPA 2W3IA 1MU8B 3UUZA 4NA7A 3S7HB 2XCFA 1QNJA 3A89A 1PQAA 1NN6A 1PQ8A 3DA9B 1O36A 5E2OA 1O2RA 4FXGH 1O2PA 3SNEA 3RXCA 1BRBE 4GCHG 3TK9A 1K1NA 4X2YA 1MKWK 2HGTH 2P59A 1XM1A 1A5HA 2AGEX 4M7GA 3QN7A 4VGCB 4QT8C 3STJA 1EAXA 4X1RU 4CBNA 1MAXA 3MH6A 3F9FA 2B0FA 1Z7KA 4OS5A 4OGYA 1O0DH 5ESTE 4Q7XA 2GP9B 3A88A 3M7UA 5EQQA 2FO9A 4A7IB 3KQBA 3V13A 5K7RA 3L6PA 1VJ9U 2BZ6H 2ZPRA 1A4WH 2FOMB 1AWHB 2A4GA 2SGFE 4CHAB 2C8YB 1ELVA 3P8OA 1QB1A 1GHWH 2W26A 1EAUA 1GI8B 1MH0A 1W13U 5A0BA 3ESTA 1P09A 2HLCA 2XWAA 4Y8XA 4X1NU 1IQNA 4B75A 2FOCA 4DOQA 1L1JA 4ABIA 4MPVA 2BY9X 2QA9E 1C2DA 1XMNB 3SGAE 3C27B 4HFPB 5DP5A 1CGJE 2SFAA 2UUFB 1E38B 1EPTC 1LVMA 3ZV9A 2Z3DA 4Q7YA 5L2ZH 3RC5A 1UTJA 1C2KA 3FAOA 1ZTJA 2WPMS 1NFUA 1TQ7B 4ZH8A 4DVAU 7ESTE 2BOHB 8ESTE 2P3FH 1YYY1 8GCHF 5C5OA 2NWNA 3T29A 1W0YH 3RC6A 1GVLA 5GWZA 4ABAA 2STAE 1FZZA 1VITH 5F8ZA 1C5SA 2PWXA 2A1DB 1F7ZA 2VIDA 3M3TA 2OC0A 1SQAA 1SGQE 1C2HA 1MTWA 2R2WU 3Q3KA 2OP9A 1BMNH 4NSVA 1Y3UA 1UO6A 3AW1A 1BRAA 3VB5A 1AB9B 4LOYH 3SO3A 1GBTA 1Z1IA 4DG4A 1CU1A 1UVSH 3UQVA 3A83A 2FOHA 3V0XA 1EASA 6LPRA 4RKJB 4YOIA 1S6FA 2Z3EA 3UIRA 2ODPA 1C5ZB 2GZ7A 2Y7ZA 2CGAA 5GCHF 1OKXA 1N1LA 1DXPA 3MU8A 2ZFQH 3QWCH 1TGNA 1C2EA 1GBAA 1TA2A 4IC5A 4CRGA 4AZ2B 3O8RA 3TGIE 4U01A 4DY7B 1P2JA 4AG2A 3FFGA 3ZYEA 2TBSA 1HUTH 2FX6A 1C5QA 3S9BA 3SUGA 4XDEA 3T28A 3MTYA 4WH6A 1PFXC 1KXAA 4GSOA 1FY1A 1AN1E 1Z1JA 3RXUA 1J8AA 1L1GA 2GDDA 3V7TA 1EZSC 1KIGH 1C1UH 4TY7A 4FUFA 1DOJA 2W7UA 2VNTA 4ZUHA 1GJ7B 3PLKA 2VH0A 1SGFA 3RMOH 4BTUB 2FIRH 1C5XB 2OC1A 4UFFH 3QDZB 2ZCHP 1G3CA 2V35A 1CT2E 1VGCC 1VR1H 3OY6U 3RXMA 3ZVBA 1GI1A 1NO9H 2CV3A 3BTEE 2R0LA 3D23A 1MZAA 1NTPA 2V3OH 1QL8A 2OBOA 3QGJA 4H6SB 1ZZZA 3A87A 2VVCA 3LJOA 1IQFA 3M36A 2AMQA 3W95A 4Z6AH 1MKWH 1GWAA 2O8WA 3MO9A 3RXVA 2BDHA 1ESAA 3UQOA 4ZKOU 1GJDB 1EJMA 2Z9JA 1AVGH 3MU4A 1GI5A 1FAKH 3RXBA 4WXIA 1HAYB 4DIIH 1TOMH 4X1PU 1BHXB 2P8OC 2GCTC 1NM6A 1NZQH 1C5VA 5GIBA 1X7AC 2GV6A 3AAVA 1HAOH 2ZFPH 2WPIS 1N6YA 4TPYA 2QCYA 4X2VA 3SV6A 1WUNH 1WQSA 1QL9A 1MTUA 3D62A 1HJ9A 2EI6A 1D3DB 1RRKA 2QN5T 2A7HA 3TLOA 2OINA 2THFB 1LHCH 5A8ZA 2A4QA 3MMGA 4FU8A 1QIXB 3R0FA 4YLQH 4ISHH 3FVFB 1M9UA 4NWLA 1V2OT 2JETB 4O03A 1QY6A 3ZYDA 1P2MA 4BTIB 4WXVA 5A2MH 1KXDA 3K65B 5JBAS 1GDUA 1AFEH 1UHBA 5E0GA 5EG4A 2J92A 3OYPA 3TJOA 1D3QB 1OWHA 3I78A 3SU6A 3GOVB 1HAPH 1ZHMA 1HIAB 3NXPA 2W3KA 2A5AA 5EW1H 4KTCA 3TK5A 3BTME 4X1QU 3SHCH 2FLBH 3VEQB 1GHAF 2PTNA 1QB6A 1ELTA 2VWNA 2FESH 6ESTA 3AVZA 2W7SA 1HJAB 1NFXA 1TBQH 3LGUA 4MNWA 2F9BH 1OWEA 1PPBH 3BEIB 3LPRA 1FPCH 1A0LA 1A1RA 2D2DA 1Y3WA 2BD4A 2BLVA 1C5YB 1UVTH 3TH4H 1B0FA 3GCNA 2BVXH 1G3BA 1PQ7A 2RA3A 1S5SA 1EP5A 1RTKA 3HK3B 3WY8A 4LK4A 2ZGJA 1IAUA 3PB1E 1PQ5A 3A85A 1XXFA 3NUMA 5HYOA 2O8LA 1J14A 1O5GH 2ZU4A 1SL3A 1T8NA 3ZZ8A 3LC5A 1C1QA 1EAWA 1C5PA 1TMTH 1ZPBA 3SNCA 2VJ1A 4E06H 1GMCG 1FDPA 1GI7B 5A0CA 4YOGA 2ZG0H 3TH2H 1D6RA 1L2EA 2CHAB 4GUXA 1BQYA 4X0WU 2Z9IA 2QV1A 2ZTYA 2HOBA 2ZDKA 4R0IA 3PMJA 4TWYA 1GVZA 5FHTA 3CS7A 1DFPA 1AE5A 1EPTA 4LZ4B 5L30H 6GCHG 4ISOA 1QCPA 2H1UA 1HAVB 1UTQA 1DICA 1HB0B 1JBUH 4JCNA 1MTNC 3E16B 2A0QB 3RXQA 1YKTA 1IOEA 3ELAH 4MLFB 3VB3A 1KLTA 3SU1A 1WQVH 1P8VC 1MBQA 1P06A 2WYJA 4PROA 1S81A 2KAIA 3ODFA 1Z6JH 5DO4H 1O35A 2OBQA 2VIWA 2TPIZ 4BAKB 1K9OE 2BD8A 2BOKA 1P11E 1XXDA 4X6OA 5LPEA 1YCPK 1E35B 1LPZB 3CENA 4YLUA 1VCQA 4ABGA 1GG6C 4ASHA 5TJXA 1HNEE 1C2MA 4HGCA 1TMUH 1Y8TA 2PW8H 4NGAH 1JIMA 2Z94A 1TLDA 3OTJE 2ANWA 2Y82A 3BG8A 4JMYA 3MU0A 2UWLA 3T2NA 3MWIU 1XUHA 3EQ0H 2ZTXA 3BEUA 1XKBC 2Z3CA 2BD5A 4B74A 2HPPH 2FEQH 3BIUH 3EAJA 3RDZA 3SU0A 1GMHG 4JYUH 3I29A 4K1EA 2BLWA 1HGTH 3KNXA 2BY7X 1W7GH 1FUJA 1JRSA 1O2ZA 3DD2H 3RXFA 3GCOA 1QURH 1K1OA 1TAWA 1TPSA 1EQ9A 2C8ZB 1FONA 1FY5A 4H4FA 1P2QA 1L1NA 3EA7A 4Y0ZE 4YO9A 4ABBA 1YC0A 3A8DA 3PTNA 1ZJDA 1O31A 1ACBE 2BB4A 2EC9H 3M5MA 1GHXH 2BMGB 4VGCC 1ELFA 5H4IB 4ZMAH 7LPRA 1JXPA 1DLEA 2QY0B 1C1VH 2CMYA 3MNXA 1BJUA 4UD9H 1OXGA 5T3HA 2QGRA 3U69H 4OS4A 1UTOA 3QTOH 1EAIA 1GHYH 2Q6GA 1O2OA 1YBWA 1AKSB 1MBMA 2GMTC 3BG4C 1T7CA 3UR6A 3BN9A 2J9NA 3VB6A 2GVFA 1TRMA 2Y5FA 4JK6A 2ZU1A 1VCPA 2PKAA 1GBHA 3MO3A 1EB1H 1GMDG 3SQHE 1YF4A 1LPKB 5EW2H 1F2SE 1LMWB 3RXIA 2G52A 3MI4A 2FXRA 2FS8A 4D7FA 1C4V2 1ARBA 4CHAC 1SPJA 2BTCE 4MTBA 5EGMA 2ZEBA 4A6LA 1LDTT 1JIRA 3STIA 1LKAA 1DE7H 4D8NA 1E36B 2P3TB 4X8UH 1F5LA 1DPOA 3DFJA 4YT6H 1SLWB 4JZEH 3RXSA 1CHOF 2F9PA 3LGVA 1TE0A 1TABE 1QL7A 2FZZA 4CRAA 3A81A 3T26A 3BTKE 3GY4A 1U6QA 1AO5A 5CE1A 3PO1C 4MPUA 1H8IH 1OP2A 2OQ5A 4ZXXH 1AVWA 1IQGA 1XX9A 3A8BA 1SQOA 1ORFA 4Y7AA 1V3XA 3UOUA 3DHKH 3R3GB 1A5IA 3C1KA 4KELA 1YPGH 1C1RA 4I8JA 4UEHH 4AFSA 1C1OA 1F0SA 1BTYA 1LHDH 3SJKA 2P95A 1AE8H 1ZPZA 1SOZA 1S83A 1THPB 2F9OA 3FP6E 1UK4A 4Y8ZA 3DUXH 3TH3H 1GBEA 1FNIA 1ZMLA 3RMMH 2HNTF 1P2NA 3PWBA 3KQDA 1TGBA 4RN6A 1T8OA 1J17T 1YCPM 3A84A 4I8GA 5A8YA 3SUFA 2EEKA 4B73A 1QA0A 4E05H 1UTKA 1C1NA 1LVBA 4CRFA 2OTVA 3BTHE 1EOLA 1A0JA 3SV8A 1XUIA 4KKDA 1UMAH 2H5DA 3P92A 2W5EA 2QXHA 1YCPH 2UWPA 4FVBA 3OU0A 2GCHF 1W12U 4E7NA 1LKBA 1BTPA 3W94A 3A7WA 4NFEA 1P05A 5LGOA 1BBRK 4DGJA 5TCAA 4AFZA 3RXDA 1S0QA 3A82A 4NA9H 1BTWA 4Y7BA 3HKJB 1A0HB 1CT0E 4YOJA 1C5MD 3SNBA 1QQUA 2C8WB 5FBEA 2HWLB 4FVDA 4YTAA 3JZ2B 1KSNA 1O2IA 4JZDH 3LOXA 1QJ6B 3OX7U 1FLEE 4FUCA 2GMTB 3BG4B 4WWYA 1TQ0B 3SU2A 1EJNA 1MQ6A 3GCTG 2F9NA 3LH3A 1NRPH 2BYAX 5L2YH 1HAXB 1SSXA 1RTLA 2VGCB 2NU3E 1KDQA 1QGFA 4UE7H 5A0AE 3KHVA 3KF2A 2ZFSA 4Y11E 2BHGA 4LXBH 1DY8A 4BAQB 4CR9A 1P02A 9ESTA 2WPKS 1XKAC 3SI4H 1JWTA 1O3NA 1V2RT 2FOFA 4NSYA 3SU5A 1Y5AT 2GKVE 1FY3A 1GBCA 3F9EA 2FTMA 1C1PA 1O2UA 1G2MA 3AAUA 3HKIB 3LGYA 1FV9A 1NU7B 4NG9H 4LZ1H 2SGPE 1HPGA 1W0ZU 1BMAA 5EQRA 3TK6A 1ANEA 1O34A 4ABDA 2WV5A 2OQUA 3ZZDA 1ELGA 1DM4B 3PO1B 3SNAA 5HM9A 1LPGB 1C1MA 5FPYA 5F8TA 4MDSA 2AMPA 4CH8B 3RM2H 2UUJB 5IYTA 1GCDA 1HV7A 4D7GA 3E0NB 3M61U 1YPLH 3LJJA 1O3FA 3SBKA 1TBZH 1ESTA 1O2MA 4NA8A 4IN1A 3RXLA 2OUAA 1XVMA 1TYNA 3AASA 4MNYA 2R9PA 1G9IE 4FUIA 5E8EH 3QK1A 4WMEA 1GI4A 1YPHC 1O5EH 1RFNA 3MYWA 4SGAE 1AUTC 2R2MB 3SJIA 4INKA 3U1JB 2XBWA 4ZROA 3TGKE 5C1XA 4FUHA 1SFIA 4I32A 3M35A 5AVDA 3ZV8A 2JETC 2ANMH 1OWDA 2BM2A 1FJSA 2FOBA 4X1SU 1G30B 1O2JA 2ZC9H 1O2WA 2H2ZA 1SLXB 5E0JA 2EI8A 3RUOA 5FX6A 1O2XA 1O3LA 3E6PH 2F9VA 4WH8A 1O2QA 1YPHE 1O38A 2QYIA 1FAXA 2NU1E 4K2YA 1UTPA 1V2KT 2BVRH 4ZHAA 1D6WA 2BY8X 1KYNA 4FUDA 5FCRA 1DX5M 1GHBG 1SI5H 5JPMH 1DUAA 2Z9LA 1WOFA 1GL0E 5PTPA 1HJAC 2H9TH 2ZDMA 4Y76A 3SV9A 1N8OB 3UFAA 2XC5A 4IMQA 4Q80A 3S7KB 3ATWA 3DFLA 1OSSA 1D9IA 3BV9B 3GDSA 1CBWC 2VIVA 2ZGBH 1E34B 1HLTH 5HXFA 3PROA 3EE0B 1GJ4H 4BOHA 4J2YB 5C2ZA 1TGCA 1CA8B 1HDTH 3PMBB 3QGNB 1DY9A 1GI3A 2BD3A 3QZQA 4WMFA 2B9LA 2SGEE 3QZRA 1W8BH 2XRCA 2VWLA 1LHGH 5JBCS 1TRNA 2O8MA 1GBIA 3ZZ6A 4NZQA 4Y71A 2QF3A 1BBRH 1GBDA 2YNBA 5EXLA 4FUBA 3TU7H 2ZQ1A 3PLPA 4JYTA 1DVAH 4K1SA 6CHAC 1TOCB 3NK8A 2CHAC 3PYHA 3GY6A 2A2XH 3SHAH 3FZZA 1T8LA 3E90B 5ETXA 2C90B 1LCYA 1TA6A 3PV4A 5DJ7A 1H1BA 1J15A 3ITIA 4INLA 2QIQA 3S9CA 5C20A 2F91A 2LPRA 1ETTH 1J9CH 1EP6A 3HATH 2JH6D 2Y5GA 2B8OH 4UONA 1ELEE 1ID5H 1F5RA 2D1JA 1JRTA 2DE8A 2G51A 4K5ZA 4ZKRU 3SN8A 1O3EA 3ZZ5A 1MZDA 1ZMNA 1KXCA 4NCYA 4CRBA 2VVVA 1Z8RA 1SGDE 3ATLA 1Y3YA 1EKBB 4AG1A 4MG3A 4I8KA 2AERH 4DT7B 1K1PA 3KCGH 1V2JT 1O2YA 1QJ7B 3EA9A 1BA8B 3RXRA 3UTUH 1V2TT 2BY6X 2Z6BD 2K1QA 3JZ1B 1Y3VA 2PV9B 4X6NA 1XVOA 2BDGA 4GCHF 1ELBA 2H6MA 3I77A 2XW9A 1HXEH 1TX6A 2YNAA 2BDAA 2IJOB 1TNLA 2A7CA 1HFDA 1O3OA 1RD3B 4IW4E 1UCYE 4H6TA 3V12A 2BY5X 1HAHH 1OWJA 2GV7A 1OP8A 2ODQA 4JYVH 1ELCA 3Q76A 1FIZA 4I7YH 1ZTKA 1EZUC 1A61H 3TJUA 1V2WT 1OOKB 1LVYA 1JOUB 1DITH 4ZHLU 5F8XA 2A5IA 1BOQA 2SGQE 5T6GA 3RXKA 3URDA 1ZSKA 1K2I1 1TIOA 1J16A 1GJAB 4MPXA 2AH4X 5FXLA 2HALA 1GCTB 3GY8A 1HCGA 2I6QA 4OS1A 2VVUA 4Q7ZA 3PMHB 3ZZBA 2CN0H 3UNRA 2HVXA 3BTGE 1C5OH 2H9EH 1V2ST 2ZDNA 1G2LA 5EU8A 1GBJA 2D26C 4Y0YE 1CBWB 1O33A 3MNCA 5ABWA 3QX5H 1CO7E 2NU4E 1IQJA 4ZHMU 5LPFA